4P5MA

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
180
structure length
180
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 180
sequence length 180
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5mA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5mA01
5GHWH 1H15A 3JV4A 4W6XB 5LG1A 1A6UH 1LWRA 2V7HB 1WLHA 3VXUD 1ES0B 3OKLA 5DFVD 3T2NL 4PJDE 2V17H 1DN0B 4E41B 5B39G 3VMPA 2CH8A 5INCA 2R23B 3OAUH 5E00A 1RMFH 3UTSE 4D9LH 4PIRF 1MHEB 2F53E 5I66A 3TCXA 2X4SB 2ZCLH 1HQ4B 1D9KB 4F33A 1OSPL 1Z2KA 2O5YH 4HWEL 5GS2D 1B0GA 4MX7B 3V4VL 1I85C 3B2UC 1WCBA 3RVWC 4M6NH 4XP4H 4NO3A 4RISH 3EOBA 5LWYL 2MQ3A 2AEIT 1IM9D 5DTFA 1NEUA 2W60B 4RAUA 1EEZB 4QXUH 1EGJH 3AU1A 2QADB 2AXJA 3V0WL 1MHPL 2FYYB 2YD6A 2PO6A 4JFYB 4LLMB 4XNMA 3RNQB 4H1LA 5TDNB 2C4FU 3MRRB 4YZFF 1WFOA 5T3ZH 5ACLA 3QNZA 3MV7E 3T3ME 5H94B 5LXGH 3ZT5A 4FHBD 1T04B 1OQOA 1J0JA 1ACZA 3QUMB 1FSKC 4UU9A 4WNQB 4RMVA 4FXKB 1A1NB 3QAZB 1G9MH 3QBTB 4UOJA 2JJVA 4MJIB 4GLRI 4L4TB 1MJ8L 4OLXL 1S9XA 4C83B 5C86A 3EDFA 4LARL 4CVZB 5CIPB 2HLFD 5C09D 4OBSA 3HZMB 1O7VA 3NABH 3RUGA 2ERJB 1YMMD 5TQ2L 1FL5B 1MFAH 4ODWA 4WCYL 2YPVL 2XA8H 3MOBH 1ZSDB 2E9IA 5CP7A 2P8MA 3VI3F 1EVUA 4R0LA 5DEGA 4ALAL 2X42A 2NX5B 3GMOA 4GBXD 4QY8A 3WIFA 1RJZB 3TIDB 3X17A 1ZK9A 5D7IA 2DLFL 2J4WH 2A1WH 3SE9L 4LEXL 3WCYA 4QHKJ 3RL1A 4FQ2L 3ULVD 2AEQL 3RZCA 4HGKC 4H1LG 1SVCP 3A6CH 4TTDD 5FB8B 2A9ML 3WEXA 1M7IB 3QUXD 4KK9C 5FKAA 4RMRA 1Z5LB 1MRFL 1EHAA 1V05A 2FATH 3WLBB 3QXUA 4Y1AA 1IGCL 3IF1B 5T1DH 2D0FA 1I9JL 2ZG1A 5FDYA 2KL6A 4Z78B 1UZ6E 1IQDB 4LQFL 2FDBP 3VXMD 5I73C 4TRPH 5DJ6A 4JLRB 4CADB 2P5ED 4PD4K 4XZUB 3VXOB 1KCUL 2OSLB 1MH5B 1R5IB 4MB5A 5AYUL 4Y4KA 3GO1L 4S1RH 5HHPA 2X4RB 2X4NB 3PJSA 1F4AA 3GKWL 4M6AA 4PV8A 3BDYL 4NT6B 4FABL 1FZKB 2V9QA 4PJXF 1JMZA 4HIIA 5EU7E 5FYJL 4DAGL 5ECJE 1A7BA 1OTSD 5CSZA 3SDAC 4YFEA 1ZT4A 3GEWB 4JO4H 5TFSL 1BPVA 3L3JA 5DFTA 2Y6SC 4KV5F 1KEML 4NZRL 3QCUL 3DV4A 3PWNB 4IOSD 1T1WB 3CZJA 1FPTH 1RULH 4CMHB 3GMMA 5EN2A 3RWJB 3TIEB 1NGXB 4MD5A 4WFEE 1BD2D 1RURL 4Y2DC 3NIDE 1NCDL 3V0AC 1XCTA 3W39B 3STZA 1U93B 1KELL 3QIBB 2W38A 1NCTA 5SWZB 1EZVY 2D7TL 3TN0D 1YEFH 4LLYA 2YUWA 4JM2B 1MFEH 3FO2A 2ICES 5E2UL 2XN9E 1JI1A 3IRZA 2D4DA 4Y88A 2OS7A 1UA6H 3MLWH 2X7LB 4YDIL 1S7TB 2QR0B 4HUXA 5EC1B 5BQ7B 5E9DD 2DQUH 3E0GA 3HTLX 2RFXA 4HUKB 3LQZA 4AG4L 3MV9B 5FGBA 1GC1C 2EDYA 4KKLC 5DMIL 2HFFB 1YQ2A 4TNWF 3N1FC 3G5VA 4M6OH 3OPZH 4WHDA 4HWBH 2IALB 4FTVE 4J3WA 3S6CA 2B4CC 3H9SA 4PGBA 1GGUA 1QA9A 2LTQC 3G04A 2YPLA 1W0VB 1I8IA 2WIIB 4NHCH 4NQVB 1UM5L 2VAAA 3GJFH 1SJXA 4QHMB 4WI4A 1LP9B 1PG7H 3VXSB 3GSRA 1J8KA 3MJ9L 3KLHD 5BV7L 2X9XA 3UTTA 4MA1C 2ZOLA 4GMSH 4MD4A 1JJUA 4NDMB 4YBLC 1ZLUH 3C2AL 1S7VB 5LAXB 4LMQI 4ZS7L 3S4SB 2FX8L 4N9OB 3CFCH 3P9LB 2DMBA 1MAJA 2XZCH 2J5LC 2V5TA 2XRAL 3VFGH 5FYJU 3RHWF 4PGJA 2BHUA 3O6KH 1FNHA 4P59L 1MJUH 3ARBC 3DI3B 4R90H 1S8DB 4XBPA 3IDYC 4Y8DC 1BOGB 5GIRA 1CK0L 4I3RH 4J3UA 1ZHNB 3HUJB 4D0DB 5GGQL 3WJLC 4OM0L 1IFHH 4XBEH 4X5LA 3EYUL 2EDWA 4NZTL 5JLZA 5SX4I 2EDHA 4NPYA 1XGQA 5T1MB 2NY4D 1Q9WB 4XWGL 4ZOEA 5DK0B 4PRDA 1KLUB 4LPUA 4HC1A 3MOAH 2DWEA 3MRPA 3DUHA 1BBDH 3SE8H 4I0CC 4ZUTA 1HILA 2YD9A 3H3BC 4P2QD 4DTGL 3U7YL 1MFBL 2PW2A 3KWWA 2WW8A 5IB4B 1UT9A 3DURB 1CG9B 3UJIL 3V9FA 4H8WH 5I1JH 3ULVE 2FX7H 2F8XC 1BLNB 1WQVT 4BKLA 1NFIA 5IJVB 2WUCH 3QDGB 4Y4KC 3S37X 2G9HB 2LABA 4W4NA 3O4LD 1CGSH 1A7OH 1Q9LB 5E6IB 4P0DA 1KJ2A 1ND0A 5GHWL 2EXWD 3NTCH 1PJ9A 1UZ8A 4CMMA 3RGVB 1PY4A 2V17L 3VGAB 1A8JH 2XWTB 3CFDB 3KS0H 5I30H 5KAQG 3HG1A 3OAUL 1RMFL 2XYCA 5EZLB 5JPNA 2BXZA 3DBXA 2ZCLL 1IKFH 4FQXA 1XF2A 5J3HD 4R97C 2O5YL 3WNPA 3WJJC 1ZWIA 5D96C 4ZD3H 2BCKA 3BVNB 2DQFB 3T8XB 3PHOA 4CN6A 4U1GC 4WEBL 4M6NL 4XP4L 2D0HA 4WIQA 1KB9K 2VISB 2HT3C 5DUBB 1P2CB 2XT1B 5J56B 4TNVF 5FFLA 4PJHE 5CZXD 5FOBB 3DSFL 3UBXI 4QXUL 4P3WA 1A7QH 1S7XB 1EGJL 4OZGE 2UY7A 1JZ5A 4QRRD 4CDGC 2VTFA 2I5YH 5E56A 4I0PD 3MLVH 5CD5D 1REIA 3GMPB 1BD2E 4V1DA 5T3ZL 3DHMA 4NZDA 4PJ7E 5LXGL 3QEUA 1D5XB 3QO1A 4R7NB 2CO6B 3D6GA 5FCUH 2GCYA 4N1CA 3NZ8A 3ZT6A 1G9ML 2G2RA 3TNNB 1IAOA 1CLZH 5IVOA 5IVZB 5MERA 3WLWC 5MEQA 2VLJB 5ENWB 3V4PH 3VXNB 3ZHLA 1W8OA 3MV8E 3NABL 2FHCA 3S5LA 4WU5A 2BVYA 3TNMA 1OTTC 1QPPA 3GSNB 1MFAL 5I1CH 2XA8L 3MA7A 3MX0A 3MOBL 4PJAB 5FGSA 2GJ6A 3CDGA 5I17A 5DLMH 2VXSH 1KULA 2R1WA 3BKCH 2Z0BA 3GFUA 4O2CA 1J8HB 1JIBA 1TVDA 1A6AB 3S9DB 4ZUSA 3VXRB 3GMLB 5K93A 2J4WL 3HCVA 2A1WL 4RGOH 3OAZH 3OB0H 2HMIC 1Q9KB 3O2DH 1VB9A 1U8HA 5AEAA 3A6CL 4ZNEE 5KSAC 1UCBH 3HFMH 1T4KA 1ED3B 4NQDB 2KPNA 5C2BH 1U6AH 3B3IA 4JR9H 2ITCA 4MHHG 3LSOA 5DXWA 5T1DL 3RWDA 1K4DA 2FJGA 1E27A 4JHZA 3I2CH 4ZPTA 1AD0B 1MY7A 1U58A 4CVXB 4OFDA 3FB6A 2JCCB 4P3CH 1KB5H 1CWVA 3QPQD 3S5LG 3O6FA 4X6BB 4PJCE 3GJFK 4Y8AA 3FOMB 4S1RL 3BP6A 3MZTA 1SYSB 1PFCA 1YJDC 2E6JA 3GUTB 2NLJA 1XF4A 3KPSE 3B5GA 5LGJB 4Z7UB 2W0LA 4QRQA 2BMKA 5I73B 1S7RA 4GAJH 1DQDH 1X9QA 4OD2B 2DAVA 1ZLUK 1XH3A 1GPOH 1QSFE 2Z31B 4F57L 4UDTA 4MZ2A 4JO4L 4RZCB 5GPRA 1IRAY 2BSED 2PNDA 1FG2B 4WFGE 1H8OA 4I0KA 4QRPA 3SN6N 4P2QE 5DMGD 5FA4A 4UBDC 1FPTL 4G8EB 1ORSB 4R8WL 4BSWA 4UNVA 5DSCB 3MZGB 3ARVA 1M7DB 5JOFA 3RKDD 4IJ3C 4LDLB 5F89A 3SDAB 1CXEA 2ICEB 4HS8H 4BFBD 3PL6A 1RK0A 2VE6B 3O4LE 4LCIH 1FCCA 5C07B 5IW1A 4UNUA 4WHTA 1YEFL 4WU7B 5MENE 3QNYB 4PJFE 3VRIA 1MI5B 3QUZD 4KMQA 4Y2DB 3JXAA 4AYFA 5IESH 4RMTA 4LVOC 3MLWL 4Y19D 3HC0B 3LKRA 3U2SB 2X41A 1KIQB 2DQUL 5DHYA 5C0BE 4UTBH 2W9EL 3V8CA 4NKIH 3MRCA 3EYSH 4MD0B 2APVA 4CNIA 2WLYA 2J8UA 3SE3A 1WCBB 5ID0B 1OT2A 4M6OL 3OPZL 4AZ8A 4JRYA 4P3DA 5FGCE 4HWBL 1G9NC 5CHNB 3LHPH 3ZKQD 2NY2C 1IAMA 4M8QA 3HN3A 4J8RB 2VLMD 1BX2A 3EUUA 3U0TB 1PG7L 5J4MA 5E94A 1NMCC 2CLZB 3H3KA 5T5FH 3OGOE 3ARQA 3QNZB 3SQOH 4ZO8A 5DEFA 5LGKA 4GMSL 4I18A 1W0YT 4UIKH 5CZKA 5D1ZD 3SKUD 3TJHC 1PAMA 4HH8A 5C2UB 3D5OF 3CFCL 3O3AB 3KDMA 2XZCL 3O6KL 2Y9RT 4MA1B 5GSRB 1QR1A 4HEME 4YBLB 2VH5H 1KPRA 3QDJD 1JL8A 5FIEA 4ODWB 3DECA 1KGCE 3RWFA 4I3RL 2XXCB 4P4RA 5CP7B 4KXZH 1IFHL 4XBEL 2J5LB 1MREH 4KJWD 4OFYA 4JZOA 4LLDA 2YN3A 4JKLA 3EYOB 4G43A 5KVMC 4QY8B 2ADIB 2A83B 1WBZA 2DS4A 3MOAL 5E24E 3ARBB 5ELIA 1BBDL 3SE8L 2DYPD 3BE1H 3IDYB 2HN7A 2AV1A 3KYNB 4AEFA 4H8WL 1XR8A 5I1JL 2FX7L 1E4KC 2HTLC 2WUCL 3O6FC 1RZFH 4FQJH 3IETA 4Y5XA 4HBQA 3KYOA 2EZ0D 3KPNB 2VMFA 1KNOB 1CGSL 1A7OL 2EIZA 2P8PA 4KPHH 2BOCB 7CGTA 2LAGB 4JGJA 3BP7A 3I6GA 3NTCL 2VLLA 2DTSA 2XG5A 2CRYA 4HKXB 3PXHA 4HX1B 4TTDC 3DARA 3C8KA 1CBVH 1YNTA 4Y4KB 3QUXC 5I30L 1TJGL 3RWHA 4XI5C 3Q3GA 3MSPA 1IKFL 1QD0A 5T1KD 4X4XA 4UINH 4JREB 4NFCA 4ZD3L 2AABL 3FFCD 1IEAA 2BSRB 4PRHD 4KK6D 1YEJH 2V2WB 4LHUA 4Y4HD 3L1OH 1BIIA 3PL6C 3K80A 4P46A 3RIAF 1FO0L 3KJ4B 3L3JB 4XC3L 5SWSD 4O2EA 3T65A 1QEWA 5L9DH 4ZFOL 4PJBE 3WN5A 1NFDE 3D2UB 5D8JH 4MAYD 1I8MA 4R97B 4G9FA 2VABB 4X5WB 3B6SB 1UENA 1A7QL 3MGTB 1A4KB 3IJSB 3MRFA 5HHNA 2AP2A 3ES6B 3ARED 5ACMA 4Z7QF 5K9QI 5LQBH 2I5YL 3SDDB 4U1GB 4NC2B 2ZUQC 1T2JA 3FO0H 3R06A 4YIQB 4DKFH 2P7TB 1TETH 4JRXB 3DLQR 1RZGB 4RBPH 1CFQB 3SE3C 1Y6NR 5FCUL 3ZYIA 1S7QA 3CCHA 4L29B 4PG2A 1CLZL 2CUMA 4ODHH 2AJ3A 4M1GH 1OGAA 3OGCA 5CJ8A 3V4PL 3TYFB 1TVBB 3D85A 2DQTH 4OV5A 4NRXB 3LQZB 4U6HA 4O2FB 2UWEE 4X4ME 5GISH 3TBVB 2LU7A 4LHUG 5I1CL 1OQXA 4DN3L 5KW9L 1NC2B 4L3EE 2NNAA 5DLML 4Y5YA 4I18C 2VXSL 3FOLB 3MLPA 1OY3B 3BKCL 4IOFC 1QA9B 2FIKA 3MV7B 3QG7H 5GS0L 2YPLB 4GRLA 2WBWB 3MRDB 1ZT1A 4HJGA 3LV3B 4NC0B 3AMKA 5C0AA 3CFBB 3MRIB 4YHLH 3UTTB 2C4XA 3EJJX 4LSTH 4U1NA 1I1FB 1UCBL 3HFML 1JPGA 4JJ5A 2ADFH 3FJTA 2NY3D 3WFHB 4JR9L 1YN6A 5DVKA 3QA3B 5BOPA 3VI4E 3SKNB 2CRZA 2XKNB 3I2CL 3VG9C 1MEXH 1Q9OA 5KSAB 1FRGH 4I4WA 4OI9A 3EO1A 1CXIA 3K4ZA 5GGSY 3KLHC 4FQCH 5JIIA 4P3CL 1KB5L 2OXHA 1H5BA 3T77B 1XR9A 1HDMA 1IAIM 4OCWH 4HWNA 5ID1B 4MQXD 2CIKB 4PREA 1G0XA 3MC0A 5JOPD 5F8QC 4OLYH 4GAJL 4ELMA 3L5IA 4M93C 3WO4C 3OKNA 1NAMA 3EYFA 5C9KA 1HNFA 2VQ1A 3QEQA 1ZXQA 4XNUH 1GPOL 5E1HB 4OCSH 1G9EA 1LILA 2AI0H 3FKUS 5KOVC 1U3HD 3EFFB 1T20B 4JGUA 3NVQA 4U3CA 2ZWLT 1NFIB 3CSBA 2Y07H 1NH6A 3IU3B 4G6MH 4O58H 3HE6D 3LN5A 5CMAA 2NTFA 4WV1A 5JZ7D 4PRBA 1NCUA 4HS8L 4HJ0D 1KJ2B 4EOWH 5DD3H 3UCRA 1UZ8B 1A3LH 4X0KA 4QHNA 4LCIL 1URLA 2X40A 4XBGB 4Y89A 2AJXH 2R1XB 3H8NA 4ZAKA 2EDLA 4P46C 4IJ3B 3UEZA 5IESL 5K9KA 2C3HA 4AENB 1JNLH 1R5WA 4OSUH 1TJIH 3QQ9C 1I7ZB 5EORH 3TC9A 3WN5C 5C3LD 4PRID 3IDGA 4NKIL 3EYSL 1I4FB 3AAZA 1QFHA 2EXWC 3PHOB 1TQBC 2XKSA 2D7OA 2VDOL 3T1FA 3FFCE 1AKJA 3LHPL 4W68A 3ROOA 1A02N 2F5BH 1RZJC 4ZSOB 5D9SA 4HWZB 5SWSE 5EPMB 5DHVH 3B43A 3LPWA 1QFUH 4U1KB 5J3HC 5GJSH 3MNVB 1P7KA 4A6YA 3L7EA 2HA1A 5T5FL 3VXUB 4X6CE 2CUHA 3GIVA 2OM5A 3O3BA 2LAAA 5HI4D 3SQOL 4N1HB 5F9WC 4OLVH 2NY2B 3WYRA 1GVIA 5EOTA 1XF1A 4UIKL 4QXTA 2VITB 5GGSA 1CL7H 5HGDB 5JR1L 2CKBH 5C6PB 3AS2A 4UQ2B 4WEUD 4KU1A 2XKUA 5KVFH 1FYHB 1NMCB 2GT9B 4WJ5A 2EE2A 4Y5YC 3IDIB 4WI8A 3DMMA 1D3CA 5HGAB 3ZTJH 3PDGA 1B4JH 4F7MB 4UT9L 3JV5A 4LU5H 4I0PC 5CD5C 2VH5L 1BJ8A 3QXVA 3U30B 3V5KA 1ZGLP 1GGCH 1CFNA 4EXKA 1F42A 4YDVA 1B90A 1H8SA 4RFOH 1IM9B 3QRGL 3CDGB 3BPNC 1JHTA 5IHUH 4GFTB 3BJ91 4P2CG 1WFUA 3TA3D 2WINB 4J4PC 2V5MA 3V95A 1U8HB 2DN7A 4MJ6A 4I5BA 2ID5A 4X4YA 5I71C 2CSPA 1Q0YH 1X5GA 5EUOE 3SGEH 4CJ1A 1FORH 2P24A 3I3EA 1H0DA 3GM8A 1RZFL 3NACH 1VFAB 4FQJL 3QDAA 2APWA 1K4DB 4KPHL 5C09B 2PUQT 4NQSB 4G7YH 3C6LD 4D3CH 1P4IH 1PD6A 5J1TC 3SE4A 1YMMB 1JCKA 3G5XA 1CBVL 1T89A 3LN4B 4K7PH 5AYQA 1CLYH 1GZQB 4XPGH 3RBGA 2L7UA 2YSSA 3U79A 4G6FD 4J2XA 4XXCA 1P4BH 3QP3A 2BMKB 4JPIB 1JNHA 4P49A 1WUNT 4IS6B 4UV7H 3QQ3A 4F37K 4UINL 1NUNB 1X5YA 4DGIH 3ULUD 1WBXA 5CGMA 3IGAA 4WV1C 4HUVA 3ZKNC 2CO7B 3QUXB 3DRTB 3L1OL 3ZE2E 4U6XB 4DVRH 2RCSH 5F1SA 3QPQC 4HWBA 1N8ZB 3RUGE 5L9DL 3VMNA 5D8JL 4ZTPH 1JWMA 5FDWA 2VLKB 4J3XA 2H2PD 5HYJD 3ULUF 4L8CB 1WGOA 3VXMB 4HIEA 5LQBL 4KUZH 2P5EB 2FLRT 4ZXBC 4R96A 4PJXB 2BSTA 4OM1H 3R8BB 1UQSB 1DL7L 4DKFL 5D7IE 1I1AD 1TETL 1K4CB 3CXHJ 5IW1B 3QEGH 2DI8A 1S7WB 3UTPD 3BRGC 5T3XL 4GXUN 3TJEH 4ODHL 3I02A 5LCVH 4M1GL 3LKRB 2J12B 5KN5A 1VEPA 2ZUQB 3RKDC 4NQCA 4Y1AE 4N0YH 2DQTL 5DJ2A 4HIHB 3MBEC 4NC1C 3LMJH 1MCWM 3PWPD 4PS4H 1IC7H 5GISL 2AQ1A 2PKDA 1B2WL 1WIOA 4PRIE 3OKYA 5ITFA 3QEHA 4P3DB 4DK6A 1NL0L 1BQSA 4F9PA 3WDHA 5HI5C 3GMRA 4MJ2A 5DD6A 5L0QC 3LQAH 3QG7L 1AI1H 4X99A 3SGDH 4PD4J 4WY7H 3RI5K 3AY4C 5E99H 2Y4SA 1FDLH 1J05B 1RUAH 1QFWH 1QRNA 5ANMA 2BY3A 1C08A 3MFFB 1AXTH 1NLBH 3RIFF 2HG5A 4TYUA 3A0OA 4YHLL 3IYLW 3D3VA 5I8CB 4LSTL 5MI0C 3DUUA 2X09A 2OYPA 2ADFL 3O9WC 5DA0B 3EO9H 3ZDXF 3UO1H 2FJFB 5E9DB 1Q8MA 1H8NA 4MCYB 3TH3T 4XP5L 4YHPA 5C71A 4LSPH 1MEXL 2VWEC 1FRGL 3SO3C 5L2KB 1F3JA 1LO0H 3H9HA 1W72L 4FQCL 1T80A 2EIDA 1CXKA 1E4JA 4OCWL 4PFEA 1KFAL 4M62L 1KIRA 2ZCKH 1JRHL 4X7TB 4YDKH 3SDXF 2JB5H 2VDLH 3O45A 2FH6A 1EEUA 5J6HA 3LRSB 4PV9B 4CW1B 4JZOB 4LLDB 3FQNB 3LD8B 3VXPA 1YPZA 1XCQB 4JQXA 1DN2A 3WNNA 4C56D 5HYFA 5IB3B 1D6EB 4WI2A 1RUML 1R3JB 2ZUSA 4OCSL 1CU4H 1MVUB 5ETUA 2C1OA 2AI0L 1INEH 3U46B 5KJRL 3MRGA 4LPCA 1MJ7H 4L3CB 3W11D 2DIAA 4K71C 4M93B 1T89C 2Y07L 1J5OH 3WO4B 4G6ML 1K85A 4KJWC 4JFDA 3H9SE 4QWWD 3QUYA 4TVPD 4D0BA 4EOWL 3I6GB 5DD3L 2DLIA 1JRHI 2NCMA 2VLLB 4G6JH 4EN3C 3BEVB 1HHIA 3C8KB 3ZL4H 3W0WA 2AJXL 2H1PH 3E8UH 3REWA 4R2GD 5DVLA 3RWHB 2NY4B 1JNLL 5IBLD 3IDJA 4OSUL 1TJIL 5KOMC 3ZTNH 5EORL 5C08A 5ICXB 1CLOH 1PKQA 4IBLT 4X4XB 5L8KB 5FCSH 4F7CA 4NJAH 2JE8A 4RGNE 4P2QB 4GXVH 4X9IA 5JW4R 5FYKH 4NKOB 4NQXA 1AGFA 1V8HA 3P73B 4U33A 1MHCB 3HHRB 1BIIB 5IMKA 2DL9A 4QEGA 4P46B 2QQLH 4ORGB 4POZC 1QEWB 4TTGA 3FL7A 4WGVB 5F7FA 2F5BL 5BJTA 5BMFH 5I1DB 4TOYH 3EAKA 1ZHLB 4PJ5A 4I2XB 2OBGA 4AT6A 5GJSL 5AUMB 2UUDK 3DIFA 3O2DA 4MXVE 1TQBB 2R56L 1F4XH 4Q97A 3I3DA 4KK6C 4OLVL 4WI5A 5C9JA 4PRPA 3SQBA 3AM8C 2CKBL 2GFBA 1NSNL 3AC0A 2H8PB 4F9PC 1A6ZB 5HGHB 2JJSC 3FQWA 5KVFL 4HXBH 3HI5H 5GRJH 1AP2B 1BBJB 5F9WB 3UTPE 3AREC 4LU5L 1KYOK 2V7NA 4CGTA 1JWSB 1GGCL 2YD5A 2EEAA 2XNAA 1QFPA 1LMKA 2VQUA 5M95B 2WK2A 4Z7WA 2Y06H 4WO4C 1X5HA 3NFNB 4Y5YB 5J13C 3GJEA 3PWPE 1S78C 3QDHA 4F7PB 5HYQB 5IHUL 1WZMA 2QSQA 4QRRB 3OWEA 5IEKB 4I0PB 4I48B 3EDEA 5IF0B 1DDHA 2Z8SA 4J7RA 3RDTC 1LE5A 2D31A 1HWGB 3MRKA 3BPNB 1UG9A 3NPZB 4HULB 4KRMB 5SV4A 3TT1H 4R7DA 3FB7B 1IC1A 1P9MC 3NACL 3RPIB 1D6VH 2YD3A 4LLUA 3VWKA 5IIEA 4FA8A 4JGMA 1EO8H 2JIXD 4LP4A 5GQBA 4OFVA 5DDHB 5T1LA 1I9IH 4Z7VF 5KBNC 4K3GA 4D3CL 4XPHL 1P4IL 3HZKA 5F96H 3QFJD 5I71B 1AE6H 4BELD 4WI7A 4I4WB 1BZ7B 5D2LF 4HS6B 5EO0B 4PP1D 5IG7A 1FJ1A 1AR1D 5EIVA 5TGBA 1P84J 3SJVA 1FBIH 1FIGL 3GSQB 4V1DE 1JPFB 5HHOD 1CLYL 2APTA 3GMQA 1LK2B 2B2XH 3HMWH 4PJIF 2MWCA 1P4BL 5DJZA 2GQHA 3B8SA 1NAMB 4DGIL 1WFNA 5EO9B 4QRSB 1PEZA 4OKVB 1F5WA 1RUQH 1SMAA 2ADJB 2C4FT 4FQIL 1L7IL 2QKIA 4C56E 4Y4FA 4DVRL 2RCSL 3Q6FA 1NCBH 1ZMYA 5F72S 5KSUA 5CS7A 2NY5C 4ZTPL 4YBHA 1MFCH 1AHWA 3FN0H 1UWXK 2C1PB 2GJ6E 4WV1B 4OCXL 4KUZL 3S3SA 1K5NA 3CFKA 5FYJD 4NBYB 4OM1L 4OF3A 3LEYL 1AFVH 4N0UA 3TCLA 4QHUB 3QEGL 4TVPE 1PG7X 3RY6A 3VFOB 4AY0A 1U3HC 2X4OB 4LLQA 4G6AD 5FK9B 1JHKH 1WITA 3W9EA 1L6XA 4LLVB 4ZXBB 1XT5A 3HE6C 3VFVB 3GSXB 2IPKA 4ZS6C 1JMXA 5JZ7C 4N0YL 3PQYA 1NUFA 5BRZD 1N5AB 3LMJL 4NN7C 4PS4L 5J6GA 3OXRA 5CJXC 1N0LA 1D5ZA 3T1FB 1XIWA 1N2RA 4DUVA 4K8RH 4PRNA 3LQAL 2OX5A 1AI1L 4WY7L 2Z4QA 5B38A 1KN2H 2NQCA 3MBEB 2R2EA 5E99L 1FDLL 1RUAL 3IFNH 1QFWL 1AXTL 1NLBL 1T21A 3GIVB 5TH2A 4LHUD 2H32A 2X4TB 1KXVC 1KXTB 3TGXA 5JO5B 5L0QB 3OKEA 2DM7A 5EBGA 4LSVH 4UILH 5DD1H 3BIKA 3EO9L 4Y19B 1P6FA 4LVEA 4PY7B 4IRSA 4ZO9A 4HUUB 4MGXA 5F3BA 3UTQA 4L8SA 3SO5A 4QRPE 5F6HI 5GRYA 1YQVH 5HHMB 1I1CA 5MI0B 1BQLH 3RWIB 3S7GA 2FRGP 5DRZA 3L3GB 3V5KB 3O9WB 3SGDI 5DJDA 4OCYH 3PGCA 3R0MA 2VNCA 1DQQA 2EICA 1QFWI 2ZCKL 4WW2A 4YDKL 3QH3A 3CVIH 2VDLL 1L0YA 4BFEA 1IAKA 3AB0C 5DRWB 3P9WB 3I6LD 1UJ3A 5F9DC 3SO3B 43C9B 5B38G 4Z76A 1TTUA 4U1IA 3VWKC 2YUXA 3D85D 3ZHKA 3PABB 4Q58C 1CU4L 5C0IB 2R2BA 5F1IB 3HS0B 5EU6A 1INEL 3PWLA 1BQUA 4G6KH 1H0DB 1MJ7L 2J8UE 3OX8B 4I13B 2HKHH 3VA6A 1J5OL 4RDQG 1BQHB 5DQ9B 4DZBB 3JV6B 1DVFD 1MRDH 4LEOB 5J8OA 1J0HA 3EYQD 1ZOXA 4BH8A 3QDJB 4G6JL 3P0GB 1ITCA 1UVQA 4JFQB 5I1IH 1YY9D 2JB6A 2P48B 1F6AA 2WMPA 4M7JH 2H1PL 3E8UL 3L5WB 3QG6B 4Y5VB 5FA3A 2HWZL 3H9ZA 3U6RA 3QIUC 3KS0J 3ZTNL 4QRUA 1CLOL 5HHOE 3IKCB 4EN3B 4U0QB 2VUOA 3C6LC 3DVGA 1YDPA 4L8DA 5FYKL 4MLIA 4X8XA 3X3FL 5IMMA 3EFDH 1OLZA 2QQLL 1C7SA 3GB7B 2FH8A 2P43B 4OUUA 3CU1A 5BMFL 1JWMB 3RY6C 3GSOA 1BVKB 1A47A 1S9YA 5DJCB 2OTWB 2H2SD 3ZYZA 5T5NF 4U6VH 2FHBA 5FEBA 4QYOB 4JPWH 4XVTH 1FL6B 2Z35A 3LZFH 4BH7A 2HJKA 1AR2A 1NC4A 4Z0BH 3ULUC 2AJZB 4KJYA 4NSKB 4PGCA 3E3QC 2W91A 3FQTB 2ZUXA 3D1MC 4UAOC 4XCEA 4C4KO 2YD7A 5FYJE 5D5MF 5SV3A 1MELA 3MXVH 4JFED 5C8JA 1XIWC 3T0BA 3LCYA 4MA3A 2XOTA 4HXBL 3HI5L 5GRJL 3I02B 2AXFA 4JN1H 1SY6L 2H2PC 1QSZA 3STLB 1J10A 3MCKA 3NCBB 4NQCB 4PRHB 5I18H 1JPSH 1ZHBB 5T3ZD 1HHGA 2A38A 5HBBA 3ILPB 4WWKA 1YY8A 2QHRH 2HJFB 1ZT7B 5ITFB 4DW2H 3QEHB 2EIEA 2R4RH 5FM5M 3WHXA 1I1AC 5BRZE 1I7UA 5SWQA 1FZMB 4NIKB 1Y6MR 3LKPA 3AREB 4QRTA 1OB1B 3MV11 4IRSC 3PHQA 3IDNA 3BYYA 4MCZA 3FB5A 4AM0B 3MLZH 1CDCA 3GBNH 3KNBA 1LEGB 2EYTB 4WO4B 4MA7L 5J13B 4ZQKA 3DUUB 4LMQE 2ARJA 3TT1L 1ITBB 1RZ8A 1EXUB 5GGRY 4M6MH 3C2SA 5E08H 1P53A 5DZOA 1EO8L 5DWUH 1E28A 1IC5H 2FL5B 1OWRM 3QZWB 1I9IL 4UOW0 3RDTB 5F96L 4G9FE 3VFMA 1EBAA 1Z9OA 2F54B 4U7SA 3UP1A 5D72H 3D0VA 1FBIL 3QXWA 4P48A 1BMGA 1X5IA 2B2XL 3O45B 3NZHH 1I75A 3HMWL 4M9PA 3TBWB 1FZJA 1X5FA 1MFNA 4V2BA 2J3SA 1DUZB 5AAWA 3OKOA 4K7PY 3KPQB 1OGAE 1RUQL 5ETUB 4F3FB 5GSVB 4NO5A 2IG2H 2GSGA 4PY8J 3I84A 4LIQH 2AQ2A 3NCYS 5DS8A 5H37G 5GGVH 4N5ED 4GRWF 1MFCL 2OK0H 4WUUA 1PVHA 4MDJA 3FN0L 1K2DB 3K2UH 3JWDC 5DHVA 4Z95H 3MGAA 4NBXB 4PJ9D 4R3SB 1JV5B 3H42H 3TPUA 4U3XA 1RZKC 1HSAA 1YYLL 4UMGA 5FO7A 5JHDD 3V79C 1NCWL 2X4QA 4NP4H 3TO4C 2BVQB 4YNYB 3TBTA 1HSBB 2OXGA 1AFVL 2PTUA 5C0AE 3DNKA 1YEDB 2J2ZA 2GK0A 4JANA 2VDPH 2CKBA 2YD2A 3WFCH 1JZ4A 3W11C 4K23L 4I8DA 4TUOA 5A2IH 1ZA6A 2HLAB 4PP2A 1IVLA 2BNQD 3JBG7 2J7LA 3CDFA 3KLDA 4QWWC 2FECL 1I8KB 1AGFB 1U3HB 2C3WA 3OAYH 5DUPH 4KK5D 1MIEH 4KKBD 4AIZA 5HDOA 4NKDB 1QHOA 3F7RA 3PWVB 5CEXB 3QT2A 4ODVH 3SBWA 4LBEB 4XXDB 1WZ1L 2CDFB 3NIGE 3HE6B 1P7HL 1QSEA 4YLQT 1J18A 4NN7B 3IFNL 4R4BB 1N6QL 1WISA 5CWSA 4ELME 4OB5L 1B0RB 4YAQA 2CLRA 4JFXB 3UPCA 2MHAB 3QEQE 4WWID 3OJDA 1UYWH 4LSVL 4UILL 4WWKC 5CP3A 5DD1L 5CJOH 1E6JH 3FT3A 2FECI 4LKCA 3EOAB 5FUOH 2R0WH 3X11B 1HZHH 1IL1B 3WFZA 3BUYB 4NZUH 1QUNA 2FD6H 4WHYG 1FN4A 3ZTJG 4UIMA 3A6BH 2B1HH 1BQLL 5GS3A 1JGEB 3MRBB 1WAAA 1N3NA 2ITDA 1MCPH 3BZFA 4OCYL 5D6CB 1A2YA 3X14B 2R69H 1CGYA 5B3JE 3MODH 5T3ZE 3HPJA 5AZ2H 5D1QA 5C0CA 3CVIL 4HUWB 1T7WA 3MRHA 4RNRB 1P4LB 2ZG3A 3HRPA 2EDJA 3D0LA 3S34H 1TDQA 2YOCA 5GZOC 1U8QB 5ADOL 4JM4H 2E6PA 4ZMAT 2B39A 3KGRA 5CSBA 5B4MD 5A2KH 4GG6F 32C2B 4NKQB 3BMVA 4U7MA 1VACB 1JFQH 4PGEA 4O4YH 1IGJB 1I3RA 1A1OA 1Y0LB 4G6KL 3AB0B 4MNQA 5EZJB 2HKHL 1TMCB 1L4IA 5C0EA 3QWRA 2XWBA 5D2NC 1AIFA 4OFIA 1U3YA 4LSSH 1AGEB 2BNRA 4P57A 3VFRB 3QQNA 5I1IL 4YHYC 1QLRA 5FUCC 3SJVB 4M7JL 3ZYJA 4XTRC 3NMEA 1BZ9A 1FAIL 5I2IB 2E7LA 3TH2T 5IQ9A 2ESVA 3T0WA 3MROA 2M1KA 4OZHF 1R6VA 3AMLA 3QIWA 5I75C 3C5ZA 1IE5A 1WT5A 5IB2A 1GGIH 4OQ1A 1OLLA 3MJ7A 1U8LB 3EFDL 3P4MA 5KSVA 1VERA 3FAXA 1AR1C 1UFUA 3QIUB 2DQCH 1G7LB 1DUYB 3O3EA 3P40A 3C6LB 1LEKA 2P42B 2WNGA 2DRUA 4JPWL 3F6LA 4XVTL 4Z0BL 4TNVK 2W0PA 1NANH 2VOTA 2OJEA 1QR4A 2V5RA 5JHDE 1FH5H 2K9UA 3B9EA 2W9DH 3Q0HA 5IJKC 4G6FB 3ARYA 3OF6D 2WLZA 3LDBC 4F7TA 5IHBA 3MNZA 1PZ5A 1U0QA 1DBAH 5INDA 5K9JH 3RU8H 2JKXA 4JN1L 5I18L 1FHGA 5EIIA 5IHZA 1JPSL 2NYYD 3KLAB 2OCFD 2UYLA 3VE0A 3C5JA 5CEYB 9CGTA 1QG3A 2QHRL 1TVHB 4DW2L 5HI3D 2R4RL 3B5TA 1FNEA 1XIWB 3EKCA 1LD9B 2SEBA 3VG0H 2ORBL 5D5MA 4K2UH 4G6AC 3CX5K 1AJ7H 5HYJB 5JPMA 4PYHA 1OW0A 2R2EB 3MYJB 1T6WA 1F90L 4MJ5A 3SGKA 4G8GD 3FB8B 3GSNH 2X70B 4O51B 3BGFC 3GBNL 1I1AB 5HHXH 2V6HA 3D18A 5JA9A 1FLRH 2ZKHH 1BFOA 4ZDHA 7FABH 2FSEA 3P4NB 3Q6GH 1FNGA 4GW1B 5JHLH 3QUKA 1CICD 1DFBH 1EEYA 3EO0A 4IRSB 4M6ML 4PR5B 1MWAA 2KH2B 2Q3AA 3SCMA 5GS0D 3UPRA 5E08L 3GNMH 5DWUL 1IC5L 5D1QC 3GBMH 2DM2A 3P4OB 1OAZH 3PWPB 2DICA 5DRXB 5D72L 2P8LA 3IU4H 4AEEA 4EVNA 4YEEA 3ZSSA 5DJDB 4JCLA 4URTB 1R0AH 2PXYD 5B3NA 2L4OA 5DJAA 3GMNA 3MRNA 3NZHL 5BZDB 5FKPA 1M6OB 4I9WE 1IAKB 3BIBX 1V7ML 3O41B 1I3VA 4MVBD 1O7SA 4DVBB 3UJTH 2IH3A 2IG2L 2AXGB 4LRNH 4O5LH 5IOPA 5EU6B 4TPRH 1VKXB 3S36H 2XY2A 1UKSA 3QI9C 5GGVL 5E8PB 1HHJB 1A6PA 3SDXB 4OCMC 2OK0L 4W6YB 3K2UL 4Z95L 1UM6H 5JDSB 3C6SA 1QPXA 3H42L 5HHVH 4L4VD 4RMSA 4HJJH 4P4KA 3H6JA 5I16B 4NP4L 5A2LH 1EFXB 1KJMA 1FV1B 5DK3A 2VDMH 2HVJA 4LLWA 1KBGH 5ANME 2IAND 2D0GA 2X1WL 1LE9B 4FQ1H 2IPUK 2VDPL 1RY7B 4PJGE 2J8HA 1NCCH 4MYWB 3L3HA 3WFCL 2BNUA 4C56B 4OCRH 5T1LD 3VGHA 3TO4B 2CIIB 3TBSA 5L7XH 2E7CA 4EUPB 1FVCA 5E8EB 3MRQB 1DBKH 1DVFC 25C8L 4QOKA 4WI9A 4L8DB 4GKNB 5B8CA 3EYQC 3LS5H 3T0VA 5DUPL 4HBCH 5KTEH 4HK0B 1MIEL 1Q38A 1YY9C 1SEBA 4ODVL 4MLSA 5GRVL 3L7FA 1RQ5A 1MCHA 3BSZL 2GAZB 3DYMA 4P23A 3UC0H 1MJJA 4WW1B 4MQ7A 4O02H 1LNUB 1U2CA 3TZVA 1XGRA 2I26N 4KTYA 2YEZB 2IADA 4U7KA 3RTQD 1NC4B 1YPZE 4TUKH 1TCMA 4APQC 1OAYL 4Y4FD 3HE7A 4PJ8A 3Q1SL 4GAYA 5L2JA 4R2GB 1UYWL 5CJOL 1E6JL 5CILH 3PGFH 4JQVA 4ZPVA 2DJSA 1JGLH 1FFNB 1YEIH 2R0WL 3C60D 5F44A 4H1LH 1HZHL 4JFFD 2Y7QA 4NZUL 2FD6L 3OR7B 2H2SC 1SJHB 1M05A 2B4CH 3A6BL 4YXHH 2B1HL 1WWCA 2AJUL 2PTVA 3LKOA 4D8PA 4NRYB 2AJSH 1MCPL 1LO3H 3QRFM 2R69L 3CH1A 3FQUB 1QFWM 3WNOA 3MODL 1CI5A 5AZ2L 3KPLB 2JJTC 4NGHH 4LKXB 4P2OD 3S96A 3X3GH 4EI6A 1BREA 4LNRB 3W0WE 3QJHA 4YHNA 4HZLA 3S34L 5DJYA 1YNLH 1IGML 3SCMC 4C4KT 3PHQB 4JM4L 1L6ZA 1KIPA 5D7LD 2VQTA 2O5XH 1M71A 3NFPB 1JFQL 1PKQE 3BN9D 4GAFB 1R3KB 4O4YL 4ZQKB 4FMFA 3DX8B 2EE3A 4OTXH 1RZ8B 5IM7A 4XP9H 1KCVH 1RJYB 2Z8VC 3CSYA 2CRMA 3VDCA 2OL3A 3FT2A 3OR6B 3SKMA 2C9AA 2ZUWA 4HUMB 1AC0A 1UB5B 3RWEB 4GG6A 3KR3H 1MCDA 4K94C 3MLSH 1OAQH 4PJ5E 5D7SH 1MUJB 3KXFD 3IFOA 4JO3L 5AD0A 5JQHC 3ARPA 3CC5A 1JF1B 3LVEA 5D2NB 1HINH 2VLRA 5L8JB 4U0RC 2Q8BH 5HDBE 3DX9A 1T1XA 3VH8B 3RL2A 3RJQB 1ZA3A 1ZANH 4PRPE 3WMSA 1TQCC 4Z7VB 3SOBL 1BWMA 4RAVB 1GGIL 4AH2A 2VXQH 4YHYB 5BVJA 1X5KA 2CDGB 3BWAA 5D2LB 4NO5B 1AGCA 1HHHA 1O0VA 1AGDA 1EAPA 1LP9F 2DQCL 5IFHH 1L0QA 4IHOB 2IF7A 2JIXB 5I75B 4WUUB 3V6OA 2Z93B 3WFBH 4PJIB 4Z7WE 1C12B 1WIUA 3F12A 5IEHB 5ABDE 3QFJB 5H2BB 4EQ2A 2EDOA 5H8DA 5HDLA 1HSAB 1XGTA 3NPSC 3LPFA 4X5XB 3S3PA 1INDH 1FGVH 1RIUL 4L4VE 4NM4H 1FH5L 4E0RA 1D5IH 3I85A 1I3UA 4PJEF 3EYVA 3KG5A 2OTUB 3CK0H 4NNYB 1DBAL 3JSSA 4TUOB 5K9JL 1ZA6B 3RU8L 4S1SH 4AQOA 1L7TH 2IC2A 1PBYA 2C3XA 4LCWA 5F7WC 1YUHB 4KDTA 5IB1A 3KHQA 3KJ6H 1BGXH 3TZVC 3KPRA 1BF8A 5J0BA 3BP4B 3LDBB 5TF0A 3LKSB 4HPOH 3SPVA 4LNVA 4S11A 1DQLH 4XVUD 4UOW1 1DEDA 4K2UL 5T3XD 1J7VR 5F6HJ 1AJ7L 2NW3B 1KCLA 4JHAH 2G75B 3ARTA 4EIGB 4JQVC 3VFPA 3ZSTA 5GGRB 4IIQC 3FONB 1X7QA 4X6DE 5HHXL 1HK6A 5E5RB 4LASH 1FLRL 4FQQB 5TQ0L 3NIFF 7FABL 1PQZA 1EJOH 2ZSWA 3AUVA 3Q6GL 3OJDB 1SEQL 5JHLL 2C26A 4K9EL 1DLHA 4NHUA 3FT3B 1YN7B 2APXA 2PW1A 3MGOA 1S9WA 5IVXA 3QULA 5BS0A 1NBYA 3GNML 3GBML 4DCQA 3BGFB 5BRZB 5HPMA 3ZE0E 3HZYA 4RIRA 1OAZL 4S2SA 5IR1A 1CDUA 4UT7H 3BPCB 5F88A 5I1KL 4JFFE 3W2DH 2GYSA 1N3NB 3IU4L 4MS8C 2YBRA 4QXGH 1MCLA 1A2YB 1BFTA 3QNXA 2R0ZH 1R0AL 4N0CD 3ZYOA 4MNHA 4HW6A 3LH2H 4JY5H 1TIUA 4OGAD 1W0WA 4FXLA 4N0UE 1F2XK 4I3SH 5EFIA 3MRHB 4OUOA 1OAXH 3K3QA 5CBAB 2V7HA 4XNYL 3PGDB 4HCRL 3BPOC 1ES0A 3VXQB 4AJ0A 1QBAA 1Z6JT 1DN0A 1PLGH 2R23A 3T2QA 2OTPA 2NY1D 3UJTL 3QHZL 4LRNL 4O5LL 1MHEA 3GRWH 5D7LE 4TPRL 2X4SA 2PTTB 3S36L 1HQ4A 2EE6A 1HXMB 3VD4A 1P7QD 1T1YB 1KSRA 4MX7A 1ZTXH 5AG9A 1WTGT 3BDXA 1UM6L 2ED9A 5HHVL 5EDXA 2V9TA 4HJJL 4P5MB 1YJDH 2Y23A 2BNRB 4P57B 5B4MC 3DROB 1OAKH 2VDML 3T0EA 4Q9CA 1KBGL 2W60A 1EEZA 3ALXA 3QI9B 2BHZA 2AK4D 4FQ1L 5I8OH 8FABB 5J12C 1NCCL 5EU3B 1KJ2H 4HS3A 4JFYA 4ZFFA 3RNQA 5TDNA 5DC9B 4OCRL 5L7XL 5H94A 1PKOA 4JN2B 1DBKL 1T04A 1BFSA 3G6JF 1EHNA 2GHWB 3QUMA 4WNQA 2IMNA 4FXKA 4HBCL 1A1NA 5KTEL 2CKNA 2A6KA 3P4MB 4MJIA 4L4TA 4RMUA 1S5IH 4C83A 4CVZA 4H8WC 4POYA 1H3XA 5CIPA 5HJ3B 5I19L 5TPWH 1DVFB 1J1OH 1KT2B 1LEKB 2EDTA 5DVMA 4O02L 2EKSB 3NOIA 4P5TD 3RI5F 1NGWB 1FL5A 2CRIA 2RHEA 1LK3H 4TUKL 1ZSDA 3E6FB 5F6IC 1ZGLM 2NX5A 3O11B 4U2ZA 5JUEH 1RK1B 1DQML 1RJZA 2ZOKB 5CILL 3PGFL 3TIDA 3FO9B 4F7TB 1I3GH 4Z8FH 1JGLL 3UAJC 1YEIL 2UV3A 4ZUVB 1G9NH 3U7WL 1OAUH 5FB8A 2B4CL 5EIIB 3UBXB 1M7IA 2LU3A 4YXHL 4APQB 3OZ9H 1OP5K 1E4XH 4WFFD 4L8BB 2AJSL 2AJVH 4G8IB 4O00A 3WLBA 1LO3L 3DJ9A 1GL4B 1FNEB 2VN7A 4LVNB 3OXSA 2DB8A 4HK3J 4OAWB 5DC4B 4NGHL 5D5MB 3X3GL 4Z78A 1VGEH 1IQDA 2DTMH 1N59B 4XZUA 4C58B 3VXOA 1YNLL 4S1DD 4B0MM 1QZ1A 3QPXL 1MH5A 2A9NH 1J9CT 4OLUH 5I1LB 3W82A 2NYYC 2O5XL 3CDYA 3D18B 4MXWH 1UM4L 2X4RA 2PYED 1ZVYA 4LGRB 4TSBH 3JZ7A 4NN6C 4XMKH 3MBXH 5F7YC 3VWJA 4JFEB 4NZJA 4NT6A 1FZKA 4XP9L 3SCMB 1KCVL 1A6WH 1KIUA 1U36A 1JZ6A 4DGYH 5E7FA 1FZOB 1BM3H 3L6FB 3L5XH 4FFWD 4KRPD 3KR3L 1WBYB 1C5DB 1OAQL 3PWNA 4XCCL 1QO3A 4QHLB 5D7SL 1BVZA 1T1WA 3TIEA 1NGXA 3MRNB 4W4OA 5F7LB 1HINL 1H9VA 1FGNH 3CZFB 2Q8BL 3T2PA 4YDLC 5GS0C 1U93A 1ZANL 1A3RH 3BZDA 1TTGA 5SWZA 4JO1H 1LO4H 4J3VA 2VXQL 3T4YB 3PV6B 1SHMA 2LVEA 4I3GA 2DIJA 2HAZA 3DX6B 2VR5A 5F93C 1RVFH 3FN9A 4XAWH 2D7PA 5EC1A 1S7TA 2QR0A 5BQ7A 4U0RB 5D1XD 3T0EC 3MUHL 2H9GB 2PXYC 5C0CD 5IFHL 4ZOAA 1JGUL 3VRJA 4F9LA 1TQCB 1Y18B 3G6AA 2QADC 3GSUB 3MV9A 1G6RL 4YX2H 2FEDD 3BHBB 2HFFA 2L0DA 3VD9A 2MCG1 4NQED 1BP3B 1HOCA 2IALA 1KCSL 3F7VB 1FGVL 2ED8A 2HVJB 1D5IL 3OMZA 4XPTH 1W0VA 1A7PH 2DI9A 2WIIA 4NQVA 4QHMA 1LP9A 2XFXB 3IB4A 3VXSA 3D39B 3CK0L 4GRWB 3VFNB 2GW5A 3NPSB 4S1SL 3REVB 1L7TL 1U8OB 2ARWA 2DM4A 2WUBH 1TTFA 2YA2A 4NDMA 4YBQD 4U3HA 2D4FA 1TFHA 1S7VA 1BGXL 3KJ6L 4GW5B 1NGPH 1PY9A 4M61B 2XQBL 3P9LA 4RGMC 1DQLL 1JZ2A 1X4ZA 3IRPX 1ADQH 4JHAL 2PR4H 5JHDB 4MQ7B 4NO0D 5GRWA 1WEJL 1HI6A 1S8DA 3Q5TA 5FO8A 4AIXA 1BOGA 2EH8H 3HUJA 4YO0B 4LASL 3ZHDA 4D0DA 3ILQD 5F9JB 1EJOL 4Q9BA 5T1MA 1Q9WA 5FUCE 1T3FB 5J1AB 4KKAD 2EYRB 5DK0A 1IAIH 2NPLX 3RIFK 1KLUA 4ZPVB 4IIQB 4RFEB 2BNQB 1AO7D 2Z92B 5IFAH 1VFOA 2Y7QB 3GSWA 4OZIF 4WDIB 5IB4A 3DURA 4UT7L 1CG9A 4JDZB 3G08B 1BLNA 3W2DL 1U8PB 4QXGL 4NUGH 5IJVA 2R0ZL 3CFEA 2G9HA 3LH2L 4JY5L 3NN8B 3G6DH 1Q9LA 5E6IA 3PXJA 3BZEB 1SM3H 1IGYB 3VWJC 1OAXL 3U9UA 3FN3A 3C60C 5CD3B 1Z9MA 1XF5A 3C5SB 5EBMB 3PP3H 3RGVA 2F53D 4HHAB 1P5UA 4U1SA 2XWTA 4KKCC 1CDIA 5JXEA 3CFDA 1VGKB 1M71B 1PLGL 4UV4H 5EZLA 5SX5K 4JY6A 1F6LL 2LQRA 3DRQA 2D3VA 4XHQA 4PJDF 1Q1JH 5E8DH 1IQWH 5E8NB 1WCQA 4LRIC 2D7MA 3GJFB 5IM7B 2G60H 1ZTXL 2LE9A 4K3DL 4P2OC 2E8ZA 2XTJC 3M8OH 3BVNA 5I1EL 3SKMB 5MEPB 1QSVA 2DQFA 5DUMH 3OBAA 2NW2B 1YJDL 5CLTA 4YEFA 4GG6B 3MR9B 2VISA 5CGTA 5DUBA 3BP5A 1OAKL 1P2CA 5J11C 3MJ8B 2WZPD 5FOBA 1WZLA 4P99A 3BN9C 1HYRC 1S7XA 5DT1H 5I8OL 5JDJA 1VFBB 1I85A 2VLRB 2FX9H 1KJ2L 4XB8A 5ACZB 4DKEH 3GMPA 3RL2B 2UVEA 4EDWH 5EBLB 4DFHA 4KVNL 3OKDA 1KG0B 1D5XA 2OR9H 3F5WB 3WHE1 4RQQB 4R7NA 3GGWB 5BVJB 1TZHB 1A6TB 1EBPA 2FHFA 4HPYH 3TNNA 5J12B 3IDMA 3N0PB 3T3MF 1AGCB 4MNGE 4EKXA 1S5IL 1IGTB 5IVZA 1AGDB 1EAPB 2D03H 1CGWA 1WAAE 2VLJA 5ENWA 3VXNA 3J7HA 2EE9A 1DQTA 4JPVH 5TPWL 3UYOD 4NQUA 4M03A 1J1OL 3LS4H 4OZHB 3JWOH 5C0CE 3GSNA 1AQKH 5FYKD 5IB5B 4PJAA 1LK3L 4ENED 5I15H 1HEZB 3TT3H 3I75B 4HGWB 1J8HA 1SJEB 1A6AA 1U8KB 2ZUYA 2HH0L 3VXRA 3GMLA 1UWGH 1I3GL 4Z8FL 3RZWA 3DYPA 1Q9KA 3CUPB 1U91B 4M3JA 1F13A 2ICWA 4Q9QH 1WICA 1G9NL 4MNQE 5F6IB 2WSKA 3MYZA 4PTUA 4LCWB 3CVHB 2F58L 1ED3A 1RZJH 4HSQA 3NFSH 1K8DB 4JFPA 4NQDA 4PBVC 4OI7A 2AJVL 3DXAD 2FZ3B 1CXLA 4J12A 4QXWA 4MXQC 4OGXL 5CZVH 4MSWB 4QTIH 1CCZA 4N8VB 4P2RD 4BK4A 1AD0A 4OV6F 2DTML 4ONHA 3MNWB 4X6EB 4CVXA 1RAMA 1G7PB 2A74A 3KPPA 2JCCA 3I6KB 1Z3GH 4PPTA 2DBJA 3V4UH 2A9NL 1UZ6F 2NZ9D 1OCWH 3FOMA 3AS0A 1FO0B 4MXWL 2O93L 5E6YA 4NJ9H 3A6OA 3HB3C 4TSBL 3OTTA 4EI5A 4XMKL 5ISZB 4K3EH 1BJ1J 5IHLB 1JNJA 4OD2A 5D71H 2ZCHH 4XVUC 1A6WL 2X9WA 1FLTX 3FHQA 4DGYL 1OGTB 2UZIL 4MHHI 3VA2C 1JZ7A 4DCQB 4F8TA 4UT6H 1DLFH 2Z31A 1BM3L 4RZCA 4X8JA 3L5XL 3BRDA 1FG2A 5IR1B 1AO7E 5CJ5A 4NN6B 5F88B 4NQTA 4AK1A 1R3LB 2YBRB 5AWNH 1ORSA 3OKMB 3OV6A 1R3IL 3OJVC 5DSCA 3B9AA 4MNHB 1M7DA 2I9TA 3O8XC 3SDAA 4M4PA 2IQAB 5EFIB 2EDKA 1LGVA 4F7EB 5LJYH 2VE6A 3ZZ1A 3SDCD 4G8GB 1A3RL 2X44D 3NIDF 2XN9D 4JO1L 2BRQA 1LO4L 5C07A 4WU7A 3QNYA 2IGFL 1MI5A 4Y2DA 2Y25A 5FYLE 3U7AA 2A6JB 1RVFL 2I9LB 3FT4B 4XAWL 3HC0A 4KTDL 1CICB 4YDLB 3U2SA 1ORQB 1KIQA 1I7TB 5HVHC 4N0FB 1KLFA 1INQB 4OGAC 1OM3H 1NAMH 3HKFA 1NCNA 4FTVD 4MD0A 3LEXB 4GQ9H 4XVSL 5KS9E 4YX2L 3X12B 4NWUH 5ID0A 2CLVA 4WTXA 2GUOA 4LK4A 3QHFH 5CHNA 3B9DA 3T0EB 2PXYB 3CX5J 4J8RA 2AQ3A 5E4IA 1A7PL 3DTXA 1FFQA 3U0TA 1VPOH 1XZ0B 5GS1C 5TDOB 2CLZA 2QQNL 4HS3B 4ZFFB 4M8VA 3OHXB 1RIVH 1GSMA 2ATPB 2WUBL 2BRRH 1KB5B 3O6LH 4U1MB 3RNKB 4QLRA 3WFEH 1NGPL 2A6KB 1KLGB 3O3AA 4RFNC 2G5BB 4B41A 1QBBA 1ZLWK 1U42A 3QDMD 1CD1B 3JTSB 5GSRA 1MCBA 1NBVL 2PR4L 1ZHKB 4RX4A 4M3KB 4Z77B 1J0KA 3RWCB 1WK0A 1UXWB 3EOYG 1VFUA 3C87A 5A16B 2X5PA 3TEUA 2EH8L 4RGMB 2IANB 3IDXH 1JVKA 4KJPD 1D5MB 3CXHK 1ROWA 5FYKE 4IRJD 3EYOA 2ADIA 1IAIL 4BYHA 2A83A 4PRAA 3S35X 2DQGH 2O5ZL 3TO2B 3ARBA 1YEKH 5KANG 4A6YH 1BHGA 3ESUF 1CFSB 5IFAL 3KYNA 4D9QD 3AVEA 5DR5H 2BOBB 4UQ3B 3WJLA 3X13B 5CUSH 4EEEA 4NUGL 4JO2L 4R6UA 1DBJH 1TNMA 4H0IA 3OXSB 3UMTA 3KPNA 1KNOA 3G6DL 2BOCA 3ULVF 4EI5C 5I1AB 4NFBA 3DXAE 2PCPB 3UTZA 4UDUB 4XHJC 3SEPA 2NTSP 4Y16A 4HKXA 4FQLH 4P2RE 3RTQB 4HX1A 1HCFX 1IAII 1RUKH 5EG6C 2Z31C 4CL7A 3CIQA 1MAMH 1FNLA 3HLAB 5DQJA 1Q1JL 5E8DL 1IQWL 4JDVB 1X3DA 3VWJB 1L9MA 2FWOB 1A1MB 4JKWA 1LDPH 3C60B 2G60L 4NRZB 2BSRA 3M8OL 2V2WA 5D93C 5DUML 4Q2ZB 4X7FC 2YUVA 1QLEH 4G80B 2AAVA 3ZDYE 1BWWA 1QO3B 3TM6A 3D2UA 5D7JA 2VABA 4X5WA 2D7NA 3B6SA 3WJJA 4OCLC 4P2OB 3P9MB 3MGTA 1A4KA 5DT1L 3IJSA 2XTJB 3ES6A 1BIHA 3CMOL 2FX9L 4PB9L 1OP3H 4C59B 1MF2H 4PJHF 3SDDA 5DJ0B 1WC7B 3CDCA 4OZGF 4EDWL 3N06B 4YIQA 2P7TA 4UTAH 5J11B 4JRXA 2OR9L 1RZGA 4HDIA 1V3MA 4BA8A 5DVNA 1CFQA 1A3QA 5DYOB 1KTLA 1II4E 4HPYL 3ZLQC 4L29A 3MV8D 1G7QB 4PJ7F 5DD0H 2X4PB 3P11H 3IKKA 2Q7NA 3QXTA 1CLCA 1UJTA 2A0LD 2D03L 3TYFA 1TVBA 2P45B 3VRJB 2IAMD 3OKKB 4X6FB 3MCG1 4QNPE 4NRXA 3G6AB 3LS4L 5A2JH 5K33A 4O2FA 1NAKH 3JWOL 3S3JA 3TBVA 3NCYP 1AQKL 1Q72H 4E41D 1HOCB 1NC2A 5I15L 3TT3L 3VD7A 4FFZH 3KXFB 2EDFA 3FOLA 3MV7A 3TVMD 4NO2B 5DHXB 4P5KB 3MRDA 1D9KD 4RRPA 1UWGL 5D1XC 3LV3A 1HXYB 4HWUA 1IZKA 1JTOA 3CFBA 4QT5B 3MRIA 1MSPA 4Q9QL 4J3TA 3IVKB 4GQPH 3U1SH 3G9AB 2VR4A 1I1FA 3EGSA 1RZJL 1QBLL 3MJGX 3NFSL 1JN6B 3WFHA 3H0TB 3QA3A 3ECBB 3HPLB 5CINH 5CZVL 3SKNA 2XKNA 1EA9C 4QTIL 4PJEB 4N5UA 3PUCA 1FFPB 5F7MC 1F6FB 5KSAA 3SDYH 3BQUC 2VC2H 1LO2H 5C0GB 3WXWH 4KWUA 5BCAA 2BSSB 1Z3GL 3T77A 3UTOA 3V4UL 3KPSD 2P5WD 3QDME 1HI6B 3NCMA 5FO8B 1OCWL 1NDMB 3ROLB 5ID1A 4YBQC 2QSCH 4HKZB 4NJ9L 3C8HA 2V5YA 1YNKH 3N85L 3F58L 4MJID 3GRWA 1MCRA 2CIKA 4MMZC 2AERT 1MLCB 1IGFH 1QSFD 4K3EL 4PJCF 1IJ9A 1DCLA 5HYSA 3MLTB 4RRPG 5D71L 2ZCHL 4I77H 4WFGD 3S37H 5DK2B 3HI1B 1DLFL 3MPCA 4GRMB 2YHGA 3GSWB 3HI6H 3S36X 5C7XL 3V6OE 3EFFA 1T20A 3ARDD 1HQRB 4Y16C 1JUFA 1JHLH 5GZND 5AWNL 2NX5D 4D9QE 1N7MH 3CFEB 4JKMA 3IU3A 3ESVF 5IQ7L 3MLYH 3MXWH 4KKAC 2DKSA 5MEND 4KJQC 2HTKD 3U9UB 2XTLA 2F8VA 1A6UL 5I8EB 1XF5B 2R9HD 4JREC 4OZFA 2DI7A 5DVOA 4U1SB 2DKUA 1N64H 4XBGA 4PUBH 2R1XA 4ONOA 5C0BD 4D9LL 3KJ4C 4JY6B 3O8XB 3DRQB 4AENA 2GTZB 4OCNC 1D7FA 1I7ZA 3BXNB 4PJFF 5D7JC 4MDIB 1OM3L 1NAML 1TXKA 3KPRE 3JUYA 4GQ9L 3JV0A 1I4FA 4NWUL 5IW3A 4DWHA 3BX7C 3SDDC 3SKOB 4RISL 3PDOA 3QHFL 3BP5B 5HVHB 3L9RB 4ZSOA 2C7UB 3CFJB 4ODBD 1P84K 4L1DA 1T22B 4HWZA 4DOHB 5EPMA 2CD0A 1JGDB 1P5VA 4U1KA 3MNVA 3FQRB 4RA0C 3VXUA 2XPGB 1F4YH 1RIVL 6CGTA 3VGFA 2VJXA 1QVOB 2DQIH 1W72B 2BRRL 3OKDB 4HMDA 2NY5H 4UNTA 5IVXE 4OZFG 2NY1B 3BIAX 5BS0E 5ITBH 2VITA 4MB3A 3WFEL 4LVHC 5HGDA 3IDMB 1FFRA 4UQ2A 5GS1B 3IAPA 2GT9A 3QJFB 1P7QB 3IDIA 1DR9A 1NEZB 1BZQK 2E8YA 5FECB 5HGAA 5DZNA 4F7MA 2NY0D 3FRPA 1KGCD 3B9KD 3QIBD 5DO2C 3HAEA 3CD4A 3FQXB 4JM2D 1GOHA 1IT9H 3G6JB 1IM9A 5HHQB 4RFNB 3IDXL 2AK4B 4NYLB 1U8JB 4BQ8A 2BVOB 4ZTOH 1H3PH 4E41E 3BFOA 2WINA 3V5HB 2DQGL 2AV7B 4XNXH 1YEKL 3MTRA 1OSZB 4A6YL 4LF3B 3MV9D 2ICWB 4MAUH 4Y7MA 3DX7B 5DR5L 3K46A 4PTUB 3IFPB 5CUSL 1OARH 1CT8A 4JFPB 2FATL 2VXTH 1NUDA 1F4WH 2IFFH 1QACA 1VFAA 2DLTA 3NCEB 4TN9A 2NY6D 4ZYKB 3JWNC 1X44A 3BISA 3T04D 3NCCB 1SVZA 4UUJA 5C09A 4MQTB 2APBA 1T7XA 1G7JB 4NQSA 3DYOA 2H41A 1NJ9B 4TRPL 4ONHB 4P5TB 2A74B 1YMMA 5F1OB 4HF5H 3KPPB 4XRCB 3ZKMD 2HVKB 4FQLL 4XCFH 2VN4A 1E4KA 5F7DB 4W6WB 4KRLB 3LN4A 1IEBB 1MAML 1AD9B 1GZQA 4OI8A 5CKAA 2YZ8A 4EI5B 2P5WE 4FZ8H 4JPIA 2VL5B 4IS6A 5ICYA 2CK0H 4MJIE 4L4TE 2EDBA 4NNXB 1C8PA 3QUXA 3RVUD 2EO9A 1DBBH 1ZAGA 3DRTA 4LCCC 2MPAH 5I9QC 4U6XA 4X8JB 1QLEL 1N8ZA 2JJUA 3OG4B 4X83A 4J1UB 4HD9A 3ULSB 2NZ9C 1TPXC 4WTZA 2W0FB 1RULL 3QFDB 3WUWB 2ILLA 2VLKA 4JVPA 2I9TB 4L8CA 5EU7C 3ARFD 3VXMA 4TUJB 1U8NB 2K1MA 1RSFA 2E7BA 1MCNA 5D93B 5B22A 2P5EA 4PJBF 1MF2L 1NFDF 2NX5E 4PJXA 5HYEA 4ERSH 1UQSA 3W5MA 2QSVA 4HQQH 1S7UB 4UTAL 1K4CA 1FYTB 3WIHA 5JQ6H 1MFEL 2I60H 2PYEB 1BJMA 1S7WA 1IC4H 4U1JB 4WI3A 1S9VB 3QDGD 3C9NB 3K81A 3V6BR 5DD0L 1UA6L 1S5HB 3P11L 2XQYG 3V0VB 4KI5E 2R0LH 1G7HA 4LOUD 5HGBB 5HY9B 5BXFA 1ADQA 3ARGD 3I3BA 4HIHA 4L3ED 1NAKL 3RGVD 2CLVB 3SDCC 5JORB 2Z91B 5KSBF 1Q72L 5DFVC 2F15A 2GUOB 1NBQA 5EU5B 4FFZL 1AXSB 2UWEF 2YXMA 5EBWB 5DJ8B 4WTZG 2AEPH 3DTXB 4NHCL 5F7UA 5L88H 1A6VH 1J05A 3BPLC 2WBJD 1F00I 1EO7A 3MFFA 5DZLA 2DWDB 5H35B 3WD5H 4LIQE 4KY1H 1Q94B 3TN0A 5I8CA 4MNGB 3U48A 4DN4H 3U1SL 1VFMA 5HDQH 4NCC2 2VO5A 2XZQH 3CH8A 3MMEB 3U30C 2OMBA 4GS7C 3NGBB 1P1ZB 5D1XB 2FO4B 2FJFA 2HKFH 5E9DA 1LEIA 5CINL 4MCYA 2HJLB 3GIZH 4MMXC 5CLWA 4QKXB 3VFGL 3EJYD 4NWTH 4J6RH 3KPOB 2IBZX 2DDQH 3FAWA 4D2NA 1SYVB 3SDYL 5L2KA 2VC2L 1LO2L 5I0DA 3VI4F 1MJUL 4NQEB 5J06A 5E1AB 1DE4B 4R90L 4JFZH 3NAAH 5CFHA 4M7LH 2QSCL 3W81A 5SWZE 4X7TA 1YNKL 5A2FA 3ZDZE 3IFLH 3LRSA 4PV9A 4CW1A 3FQNA 1IGFL 1XCQA 1VENA 4RMWA 3BQUB 4PRAB 4ETYA 5IB3A 1RPQA 1D6EA 2Q7YB 1NLDH 1R3JA 4AIOA 2HLFC 4CDHA 1MVUA 2H32H 3FO1B 2AK1H 15C8H 2DQEH 2FB4H 1UB6B 3FTGB 3U46A 5IMOB 3MV9E 4YHOH 1LQSR 1JHLL 4L3CA 2VZ3A 3N9GH 1TJHH 3BI9X 4NUJB 2E6QA 1J8HD 2E3VA 2M26A 4KJPC 1CFTB 3B2VH 3MLYL 1JK8B 1XF3B 4GBXC 3UTZB 1EZVX 1ZE3C 5ERWB 3DVNB 4Y16B 2J6EH 3BEVA 4U49A 3ULVC 3VXSE 3BZ4B 4OZIB 2V2TB 1N64L 4Q7DA 3RX7A 2AKRB 2B5IC 3OAZK 3OB0K 4GMTH 5DQJB 3TBYB 4L4JA 3VGDA 5AAMA 5IV2B 5C70A 1OTUD 5ICXA 4OD1H 3IXTB 4JPKH 1AO7B 3G5ZA 4P2QA 4NKOA 3TYGH 2Q86B 3P73A 3RX8A 5KVGH 1LVEA 1MHCA 2IFGA 4ORGA 3MA9H 1BFVH 1CIUA 1CXHA 4OZ4A 1RZIA 2BVPB 4CJ0A 4IMKC 5JW4Q 5D7JB 2WQ8A 5I1DA 3O4LA 2VZSA 4PJDB 1EO5A 1ZHLA 5ICZB 3HUJE 4I2XA 5E8OB 4L9LC 5AUMA 2QTEA 3MLVL 3UTSB 1F4YL 3EHBD 4NOBA 2F53B 3DHJA 5E2VH 1JBJA 2DQIL 4RAHA 1OTSC 4JAMB 2NY5L 3MACH 4HDIB 4KHTH 4KMTH 5FM4A 5ITBL 2Z8WC 2P4AB 2DJ4A 4X6CF 1KTLB 3JWDH 3U36B 1XGPB 1R5VA 4EBQH 3RJDA 5KS9B 4EZMA 5FV2A 3KYMB 2H8PA 1A6ZA 5HGHA 1RZKH 4XX1G 1AP2A 4U6YB 3DGCR 5IFJB 4XGZB 5KSBE 4EUPH 1HKLH 3QDGE 1BBJA 4X9BA 4S0SD 4RMQA 5IBTH 1ONQB 1V7NH 3MUGA 3QQ4B 2IBBA 3UJJH 1JWSA 1TNNA 2GSIB 4LVHB 5HXMA 5M7QA 2X4UB 1IT9L 3TN0C 1ZLVH 2H45A 1R24A 4GOSA 1IBGH 2NR6D 3NFNA 4F7PA 5HYQA 4AMKH 4QRRA 4ZTOL 1H3PL 5IEKA 5E03A 1YEHH 4I0PA 4I48A 4RGOL 4H0GA 2D9QB 4XNXL 5DF0A 5TDPB 3O2DL 1QQDB 2UVFA 2IAMC 5IBUB 5IF0A 4TULH 2DJUA 4MAUL 2WV3A 5DQDH 2HFGH 3EGSB 3LAFA 4GKSB 1OARL 1RIHH 1MCSA 2VXTL 4LDOB 2IFFL 1U6AL 2YMXH 3FB7A 4TVSa 5C2BL 3RPIA 4DKAA 5EUOF 2F5AH 4J4PA 3HC3H 1XGUB 3TVMC 5DDHA 4MB4A 3HA0A 3I50H 4KKLD 2FJHA 2PO6D 3DGGB 3LD8C 5C6TH 5HYIA 4KQ3H 3T2NH 1MQ8A 4HF5L 1BZ7A 1I1YB 4HS6A 5EO0A 1FVEB 4E42B 4XCFL 1WF5A 1JI2A 3GSQA 2DQJH 1JPFA 3OJMB 1X5JA 1LK2A 4FZ8L 4F80A 1DQDL 5HYSB 2CK0L 1OD9A 5EO9A 4QRSA 4OKVA 2ZG2A 4A2MA 3QCTH 2ADJA 1HWHB 1MAKA 5LWYH 1YC7A 2MPAL 1EH9A 1QLFB 5H37H 1JUFB 3DXAB 2FBJH 5K9OB 4X98B 2YRPA 3ZE2F 3V0WH 5KZCD 1MHPH 4P2RB 1BAFH 5DI8A 1BVLB 4PJAE 1F02I 5IWLC 2C1PA 5F8RC 3RUGF 2NY4C 3DV6B 4LCCB 3T1WA 5I9QB 1J8HE 3RZCD 3OJ2C 4ERSL 4HQQL 5IGXH 4OZFB 1TPXB 2L7JA 4QHUA 3P3YA 2YD4A 3L3DB 3VFOA 2I60L 2X4OA 4LPVA 5FK9A 1MJ8H 1T0NB 1TCRB 2F9BT 4Y1AD 3L95B 4PY8I 1FC1A 2V2XB 5D7IF 4LLVA 4ZXBA 1GZPB 4NQDE 4ORZC 3VFVA 3GSXA 4UTBL 1NFDA 1N5AA 4PLKD 5MP6H 2YPVH 2EH7H 2KKQA 4DZ8B 1JZ3A 2R9HC 1G1YA 1ZVSB 4Y4KD 4Z18A 3PDOB 4QTHB 2HT2D 2GKIA 5LBSH 2JCCE 4QF1B 3BD3A 2CPCA 2NMSA 2N7AA 2YK1H 4PB0H 3MBEA 1WSST 5J9PA 1A6VL 1FP5A 2WBKA 2O61B 2R2HB 3SDCB 2XZAH 3WD5L 2XN9B 4Z7UE 4KY1L 1EHLH 1JYXA 2ATKB 3VRLE 2R29H 1YECH 1M4KA 4NOFA 2X4TA 3D87B 5GRXG 3QUZA 5JO5A 2ENSA 5HDQL 1G7MB 2XZQL 4KVCH 3PNWB 1MCQA 2X9YA 4Y19A 3AY4A 4PY7A 1T5WB 3RRQA 3BPLB 2HKFL 4HUUA 5CZXC 2IMMA 4XNQB 3QWOB 3GIZL 2O26U 4WHYH 2W0KA 4XH2B 4NWTL 4J6RL 4FTVB 1KCUH 1HH6B 3RWIA 3WL9B 2FIRT 3L3GA 3HAEB 3O9WA 1T1ZB 1LO5B 3K8LA 4GS7B 1CR9H 3NAAL 4MA8H 4M7LL 4JFOB 1MREL 3IFLL 5C07E 3FRUB 43CAA 1AGBB 5DRWA 1MI5E 2WWKO 3JTTB 43C9A 1CE6B 3QXAB 3MO1A 1U9KA 5JIPA 4RBPK 3PABA 1NLDL 2FEEL 4JE4B 2AJYH 3BE1L 5TFSH 2DLHA 2QEJA 3P4LA 5C0IA 5E7BA 3B9KC 1T5XB 5F1IA 2AK1L 2IWGA 3U83A 3O0RH 4UZGA 3HS0A 2FB4L 2DQEL 3BJLA 5D1ZA 1JTPA 1NC2D 4MZ3A 5I76B 2BVUA 1CT8B 3H9SD 5CP3H 2W07A 3OX8A 3N9GL 1TJHL 5I8KH 2YPLD 1BQHA 4HG4J 3B2VL 1AQDB 5DQ9A 2I25N 3NCJH 3JV6A 4DZBA 4UUJB 2DLGA 2R1YB 4LEOA 3L3IB 1ZGLB 1OTTD 1KELH 2Q76B 4U1HB 1IILE 3IS1X 3QDJA 4KXZI 3UTTD 3BGMB 2J6EL 2B20A 3L5HA 3P77B 4JFQA 1J1XH 5IK3A 3STBA 4Z5RB 3L5WA 3QG6A 4Y5VA 3QXDB 4GMTL 1FQ9C 4RGND 2FEEI 2X05A 4GBXB 4FS0A 5EC2B 2HMID 1KXQE 1JYWA 2NY6C 1E6OH 4OD1L 3IKCA 4JPKL 4EN3A 5ICYB 2DYPA 4AG4H 5KSAD 3EIFA 5F7EH 4JG1H 1YEJL 3TYGL 3T3PE 5KVGL 1TZIB 4NCDA 1KPUB 2B5IB 2Z8RA 1JPTH 3GB7A 2YRLA 1GGBH 3ZT7A 4FRWA 1BVKA 4K7FB 4FFYH 5DJCA 2OTWA 4BM7A 1BQHG 4XC1H 2MFNA 3N1QC 2Y5TB 4QYOA 2E5EA 1FL6A 3AGVA 2AJZA 5KAQF 4NSKA 4JQIH 3KPMB 3FO0L 3FQTA 1DEEB 3IXAB 4LLAA 3MACL 4KMTL 3N1MC 1YYMH 4MXVF 1GJIA 3JWDL 3VFUB 5GRUH 4EBQL 4KC3B 3W5NA 5DMGC 5T1KA 1RZKL 2E9JA 4L9LB 1MPAH 3DO7B 1F3DH 5IKCA 1G7HB 4P59H 3T2OA 1HKLL 4DGVH 3STLA 3ARFC 5BXFB 3ZO0A 4PRHA 1ZHBA 5IP4A 4PJHB 1V7NL 3UJJL 2XI9A 1MCWW 3CSGA 3ILPA 4OZGB 2HJFA 5SWSA 2YPKB 1ZT7A 3AM8A 3V5DB 4OM0H 3VGGA 3HG1D 1B9ZA 2JJSA 4MAYA 4AL8H 1IBGL 3QUZC 4X6CA 1BD2B 4GKOA 1FZMA 4AMKL 3DOSA 3V6ZB 3AREA 4FQXD 1OHQA 4PJ7B 3WSQH 3U82B 1YEHL 3DUSB 1OB1A 2QQKH 4G5ZH 3KPTA 4AM0A 4DTGH 1DJSA 4TULL 1F3RB 3TN0B 1LEGA 1VCAA 2EYTA 4WO4A 5DQDL 3VCLB 2HFGL 3UZVB 1U41A 1PGRB 2LFGA 4HFWA 1LHZA 1RIHL 2WANA 3MV8B 4X9FA 5JNYB 2GITB 3HZVB 2YMXL 5FV1L 1EXUA 1X5XA 3BRFA 5KG9A 1LEIB 2F5AL 4P9MH 3HC3L 1A7NH 2FL5A 3QZWA 2IAMB 3C8DA 3I50L 1GAFH 3MJ6A 2DIBA 5FYLH 3RDTA 5C6TL 1U8MB 4Z0XA 4V1DD 4KQ3L 2F54A 2WBJC 4ZFGH 5IT2H 5BW7A 2NY2D 4CN4A 3MUJA 3VGEA 1P9MA 4Z7NE 1J0IA 2DQJL 4F58H 1GCFA 4FN0A 2A6IA 4D0CB 3TVMB 5D1ZC 4JFHE 4HAFA 4JRXE 5FO9B 2GY7B 2DD8H 3TBWA 3DO3A 2GIYA 3O81A 2XV6B 4OLYL 5EUOA 4W81A 5FF6B 5I1HH 1DUZA 1ERNA 3EJYC 4XNUL 4GSDH 1MQKH 1A64A 3LKNB 3KPQA 4WEBH 1PW3A 3QCTL 5ESVB 3TJHD 4F3FA 5GSVA 1AC6A 4HKBB 2GJ6D 5ESAB 3DSFH 2FBJL 3GBLA 2J88H 1MWAH 2E7MA 1K2DA 2QLVB 3BEWB 1BAFL 4O58L 1KUMA 4Y5VC 3RVXD 4JZJA 4R3SA 1JV5A 4PJCB 3QZWG 2YPLE 4OQTA 2BVQA 2LVCA 1A3LL 4YNYA 3KPSB 2P5WB 1HSBA 5IGXL 3FFDB 5DD5H 4Z7OE 1EDQA 4BSJA 5DRNB 3UX9B 1YEDA 5E2JA 4QCIA 3MREB 3UTTE 1T0MB 2IBGA 4ACPA 1QSFB 4TQEH 1W8NA 2HLAA 1F4HA 2EZ0C 4K94H 1XMWA 2ZSVB 4K9EC 1RHHB 3PF2A 3V6FB 3F7YB 3G5ZB 3P0YH 4JEGB 1GGYA 3BH8B 2MQ0A 1I8KA 1U3HA 4EJ1C 1VDGA 5MP6L 2EH7L 1L9NA 3ARDB 2HTLD 3O6FD 2HRPH 4B53A 3MLRH 4NKDA 5TE4H 2ZZUT 4OZ4B 3PWVA 5LBSL 1RZIB 3GSVA 5CEXA 2UZYB 4LBEA 4XXDA 2CDFA 3HE6A 2YK1L 1EAJA 5LGHH 4AQ1B 3O4LB 2K7QA 4PB0L 4MWFB 3GI9H 5MENB 1OTUC 4PJFB 1QFUL 4HEPG 3BW9B 4R4BA 3Q48A 2XZAL 4LSQH 5CJXA 4HFUH 4KHXH 1EHLL 3O6MH 3WV0A 2QHLA 2R29L 3H3PH 1YECL 4XMPH 2VDQH 2JJWA 5KVEH 1B0RA 4JFXA 4Y4HC 1Y6KR 4XI5D 2MHAA 5C0BB 3LY6A 3JUZA 1CL7L 4KVCL 4QRPD 2K3TA 2YC1B 1R5VB 4U6TA 5CBEB 4H5SB 2VLKD 3EOAA 2F74B 4GRWH 3X11A 4MAYC 2CMRH 4PRIA 2F19H 1IL1A 3CAFA 3BUYA 5FGCB 1B4JL 1N4XH 2IBZY 2Y36H 3PL6D 3QB7C 3MUGB 1JGEA 4FFVD 3EHBC 3MRJB 3MRBA 3UYPA 1O5DT 4Q74A 5D6CA 1CR9L 3X14A 1N26A 4MA8L 1PG7W 5EO1A 3WE6B 4RFOL 4HKJB 1R24B 5F1NB 3HMXH 2VIRB 4HUWA 4ZUUB 4RNRA 1P4LA 2LV4A 3HG1E 1U8QA 1CL7I 5HD8D 4F57H 32C2A 2AJYL 3LOWA 1J0YA 1VACA 1Q0YL 3PWJA 4JRYD 2H3NA 3O0RL 1IGJA 3WNMA 4JZNB 1Y0LA 1FORL 4XPBH 5BW7C 4R8WH 5EZJA 1CE1H 5I8KL 4LP5A 2NR6C 4GG8B 1U8IB 4U31A 5DMKB 1ETZB 4K3HA 4ETQB 3CLEH 3NCJL 4YGVB 4KQ4H 2NY0B 3NBNA 4G7YL 4U4BA 2B0SH 1G84A 2J8UF 2FJHB 1FL3B 3B9KB 3PWUB 2F8OA 1KJVA 4I1NB 4ZSOE 1S7SB 4KK8D 1AGEA 3VFRA 5T33H 2R39A 1J1XL 4IOFD 3VXUE 1QFOA 4K7PL 3ET9F 4XPGL 4G42A 4CVUA 5I2IA 3T09A 4N0RA 2NY3C 3TA3A 3VFWB 3EZJB 2CXKA 2W9EH 4XCYB 1E6OL 4CVWA 5C0FB 1WWWX 4UV7L 1EUTA 1ZEAH 4UB0H 3SGEI 5L2KD 5F7EL 2PO6C 4JZJC 2H6PB 3NCFB 4ODXA 4JG1L 1KPVA 1U8LA 3MRLB 1JPTL 1DQJB 4JHWH 3QIUA 4X9GA 5CKGA 4LCYB 4YZFE 3HNVH 1G7LA 5L6YH 1GGBL 1DUYA 2NY6B 2NXZD 4OFYD 5FHAH 4MQXC 3WXVH 4GH7B 4FFYL 4N9GB 1HH9B 5DI8B 3C6LA 2OL3H 4XC1L 1TLKA 4JY4B 5IW6B 1VHPA 4JQIL 4NCC1 3A67H 5FGRA 1XAUA 4PTTA 2HT4D 3T4AB 1YYML 5GRUL 1DANU 4R0LC 3IT8D 3TJEL 1MPAL 3M45A 5LCVL 2JK5B 4HIXH 3PDDA 3VI3E 4DGVL 4L5FH 2FGWH 3KLAA 4PJBB 1NFDB 3L3OB 4HJ0C 3ME0A 4LGPB 1IC7L 5CEYA 5C09E 3RZCC 1TVHA 4CAGA 3THMH 4P9HC 1LD9A 1YMME 1PYWB 4AL8L 4PLJD 1JE6A 3E6HB 4N68A 5HYJA 3ARFB 1X4YA 3WSQL 4YFLI 3MYJA 5J9PB 3VXTB 2QQKL 3TESA 3FB8A 4G5ZL 4M7KH 2X70A 4O51A 4YR6A 1I1AA 4OF7A 3WS6A 4PLKC 4WVRA 4P46D 4YXLH 3QUZB 3EDKA 1CDJA 1VEOA 5KSBB 2R15A 3P4NA 5TJWK 4GKZB 4GW1A 3QQ9D 5AG8A 2HT2C 4G9FD 2UWEB 4PR5A 4FG6D 3UO1L 4MQSB 4D9RD 4IMLB 5F1KC 4YE4H 4P9ML 4Y2OA 5F7HA 1A7NL 3ARGB 4G7VH 1GAFL 4LSPL 3O2WH 5ILTH 3P4OA 5FYLL 4HH9B 4L3EB 1QTYT 2MJWA 3U0PB 4WEMB 3PWPA 2YS4A 4OLWH 2VLKE 3CVHH 1LO0L 4ZFGL 5DRXA 5IT2L 2J6EA 3VXME 5HI4C 2P5EE 3P30H 4PJXE 1TJGH 3GI8H 4F58L 1U92B 1I7RB 3CJJA 4C55A 4G8FA 2JB5L 5BZDA 1B3JA 1M6OA 2DD8L 43CAB 1OGAD 4KV5E 2WBJB 3MO1B 2AABH 5I1HL 4OGYH 1F11B 3O41A 1RJLA 4GSDL 3WKNA 1MQKL 3V7AG 1FO0H 4BZ2H 4XC3H 4DVBA 2ADGA 2AXGA 5D1ZB 1VKXA 3BH9B 4KROD 4BSVB 1B6UA 4B7IA 5E8PA 1HHJA 5FOJA 2J88L 4GRLD 1MWAL 4H0HB 4JRYE 4PG9B 3SDXA 5JDSA 5KVDH 5DURD 4QGYA 5C0AD 3TA3C 2PN5A 3G5YB 4GUPB 5I16A 1Z0NA 3ZKXC 1EFXA 1FV1A 3HR5B 5FGBC 5DD5L 1TITA 1F58H 3ZL4L 2WWKT 1MHHB 1LE9A 5IK3B 4KZDH 1L0XA 4TQEL 4OIAA 4M5ZH 1NBZB 4J4PD 1CD0A 1NGYB 1HN1A 5E2WH 4C56A 3TO4A 2CIIA 4K94L 4ZFZB 3WDJA 4EUPA 5E8EA 2DYPB 3MRQA 4NJAL 5E9DE 3P0YL 4GXVL 1FSKB 4GKNA 4JVUA 1G0DA 2GK2A 4DN3H 2HRPL 4HK0A 5KW9H 1M1SA 3MLRL 5TE4L 5L2KE 4EIZC 5GS0H 1A9BB 2CGRH 3M17B 2C3VB 5LGHL 4TOYL 1DZBA 2GAZA 4RGNC 2BDNH 4NKMA 1P69B 3K7UA 3GI9L 4H25B 1FNSH 4WW1A 1LNUA 5J89A 2JF1A 4LSQL 1KN4H 3QEQD 4G9DB 2YEZA 4HFUL 3NIGF 4KHXL 3O6ML 1F4XL 3H3PL 4XMPL 2CDEB 2VDQL 5TE7H 5KVEL 3K4AA 4KAQH 1OF2B 4TSAH 3PIQB 1VADB 3CGTA 4LCUB 4ELMF 1HHKB 1FFNA