4P5MB

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
199
Chain Sequence
b'QAYDGKDYIALKGPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 199
sequence length 212
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5mB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5mB01
4OGZA 3FONA 4CN1A 3HTLX 4KI1A 5FGBA 1P6FA 1ADQL 5TFSH 1J0KA 1QACA 4WY7L 4UOW1 4PG2C 1RZKL 4UT7H 1ED3B 1DEEB 3RTQD 3JV6A 3KHQA 4PLKD 3IFPB 3P3YA 3QIWA 1AP2B 2I27N 3MRBB 1HXMA 4R4BA 3B3IA 4P2QE 1VFAB 4M1GH 3CLFH 2AEPL 1AJ7L 1G7LB 4BELD 4JAMA 2XZAH 4LNVA 5TDOA 1QPPA 1RURH 1GGCH 3QFJD 3OB0K 4JR9H 4F2MA 5M7QA 4Y5VC 2VABA 1I8LA 3O4OC 4FQLH 4CN6A 4JGJA 4J12A 4EQ3A 4DUXA 5KJRH 1YPZE 4OZFA 1BZ9B 2YUZA 1GGIH 2R0KH 4OFKA 1NDMB 3LQZA 3HNTH 1YECH 3DETC 4LCCC 2NY1B 3SKMB 4JFHD 3IJYA 1O0VA 3MA7B 1V5JA 1FO0A 5BZWA 2GAZB 1C08A 1QSFA 1BVKA 5SWSA 1S7XB 4ORGB 4M62H 2HA1A 4P0DA 3MLPA 1BJ1J 15C8H 1OLZA 1YEIL 4CDGC 5ABDE 4E9LA 1T1ZB 4XNMB 3JWOH 2GK0A 4OLWL 1KENH 2Y5EA 4J7RA 3TIDA 5IBLD 3V4VL 3IU4H 4IHOA 3V6OA 3T3ME 3NA4A 3BPLC 4JVWA 1ORQA 5FYJE 2XPGA 4PJDA 5D9SA 4HUWB 4Z0XA 4M5YH 1OWRM 1P5VA 3MRKA 3N85L 4NQEB 1BD2B 3TZVC 2YD2A 3GHEH 3ALWA 1OAQH 5D2LF 5IMLB 5MENA 2C1PA 3SDDB 1MHPH 4PJBA 2W65B 2HN7B 2FIKA 6CGTA 3FN0L 4X6DB 4E41A 5IIEB 3LKOA 1BQUA 1VGKA 3BPOC 1QBBA 5IQ7L 3MACL 3S37X 1NDGB 1R5WA 3NFNB 3V7AG 5KZCB 2ED7A 4PJCE 5AZEH 4IRZL 2BY3A 2FHCA 1FPTH 2AJZA 3GJFB 4UNVA 4UAOC 4BQ8A 4QRPD 4NRYA 1TTUA 4PJHA 3KLSA 3QHZH 2OJEA 3MREB 3PWLB 2QQQA 4X7FC 3WIFA 3ZT5A 3CCHB 5CUSL 3WV0A 2FDBP 3O9WB 4EBQL 3BVNA 3P30H 1MCIA 1QFUH 4LPUA 5FKPB 3MRPB 1W0VA 3CFEA 2GJ6B 4GAGL 5JZ7D 5B3JE 4KK9C 4NC1E 3GIZL 4UDUB 1MCJA 1H5BA 4F8TA 3QDGE 1WZMA 2EH8H 1EHLH 4JFQA 4DFIA 1CZ8L 4WEBL 4PJIA 3VE0A 1N64L 2XTJD 3GM8A 2AJVL 4DQOH 1IGTA 4K94C 1WBZB 4C56E 4NDMA 2Y4SA 4FQHB 4Z7WA 2FL5B 3PWNB 3QUYA 4NN5C 2BSTA 2QL1A 2N7AA 1WJ3A 2VR5A 1OGTB 1JPSL 2B1HL 3DXAB 2VZOA 4X9BA 3WIHA 3QDJA 3BEWA 1VEOA 4X6EB 3BXNA 3GSXA 2LFGA 2VSDA 5IEKA 5J1AA 2EO1A 3OR6B 5EU5A 3O4LD 4XAWH 5E7BA 1CR9H 3MV7A 3INUH 1KEGL 2H3NA 1N0LA 4ZAKA 5I71C 3MBEC 1KJ2L 3BZ4B 5SWSD 2KDGA 4NYLA 1GZPB 2I5YL 2ZPKL 5CSZA 3QNZB 1ZSDB 4HBCH 3CU1A 1CGUA 1U41A 4JKLA 1JGUL 2BRQA 3ES6B 2WIMA 1EEYB 4OJFH 4RNRB 3ZL4H 3GUTA 3HZKB 5E2VH 5GGUA 3PWPE 5FOJA 1BIHA 4DZBA 2XIDA 3UTQB 4QRUB 2OMNA 4UBDC 4QRQB 3RWCB 1S3KL 2HVKB 2P4AB 4ZPVA 3QZWA 2IQAA 3RUGA 3SDCC 5A2KH 5EU6B 4ZFOA 4GG6A 4NZUH 3EJZC 1KNOA 1U42A 1UQSB 5FV1L 4ZFGH 4F7EA 3O2WL 5IK3B 2VQUA 5DSCA 1FYHB 1YDPB 3QRGL 1KJVA 5FCUH 5H37H 2Q1EA 1NUFA 2BX5A 3MROB 5DTFB 5F3BB 1Y0LA 2GSIA 3BHBA 3WIIL 3D9AH 4GW5A 4IIQC 1LDSA 1A6TB 1RIHL 2R23B 3GK8H 2A73B 1MNUH 4TNWK 1DLFH 4JO3L 1YJDL 4XH2B 4K9EH 5FO7B 4HMEA 3D2UB 1X9QA 5E5MA 5I2IA 3GMQB 3MJGX 4UDTA 1YUHA 1JWUA 1CL7H 4WFFE 3IDIA 5FO8A 2R8SH 4HH9B 3EYVB 3G04B 3GSVB 4HCRA 4R7DB 2EH7H 3VH8G 1K4DA 4AENB 4C83B 3DRTB 4U31A 1ZLWH 4CADB 1KCUH 3ALXA 3RVTC 2VDMH 1JHKH 3T65B 1MRCL 3KDMA 4NN6C 2NY1D 1IBGL 2EE6A 4HJ0C 4PJ5E 3QHFL 4NQTA 3TT3H 4FXKA 3BUTA 2EDTA 1KIQA 3O41A 3ZZ1A 1FFNB 1MCRA 5DD1H 4MQXD 1S7TB 1CDGA 4KMTH 2BSSA 3TT1H 2VXVL 2GJZA 2K1MA 4WDIB 2I60H 5IBTH 3R8BB 4UQ2B 3STZA 1Z5LA 3OKOB 2CIIB 4GH7B 5SX5H 1KLUB 4LPTA 5AD0B 1L9NA 4KTDH 1HSAB 3WKML 2VJXA 3QDJD 1U6AL 2Z91A 1L9MA 2VDLH 2OI9B 3SDXB 1CXIA 2VERN 4GAYA 1C7TA 2YPVL 3RTQC 1KBGL 1BD2D 3VI4F 4PLKC 3I3EA 3MV01 1AO7A 4MA3A 4TOYL 5I76B 2BP3A 2DQEH 2CLZB 1AIFB 1NCUA 5E0QA 4LCYB 1K8IA 1ZS8B 3H9ZA 3DRQA 3FQTA 5EU7C 3EYSL 1V7NL 5I0ZA 4EI5D 1QHPA 2E7LA 1B6UA 5KSAA 5J3HC 4WV1B 4WO4D 4EN3B 5IB4B 4YXKL 3AC0A 2Y6SD 2VDQH 3TA3B 4LCWB 3MOQA 1QR1A 3FQUB 2MFNA 3GI9H 1QP1A 3S97C 43C9B 3DX6B 3RY6A 3NTCL 4JLRB 4WTXA 4EI6A 1CDJA 4NPYA 5DJYB 2CLRA 3N0PB 5H94A 2LU3A 2BRRH 3QJFA 4Z95L 5GGQL 1Z3GL 2F53A 1PKQA 2JIXA 5TPWH 5IBLC 5D7IA 3PHOA 1AGEB 4ZUTB 2VH5H 5T3ZH 1CE6B 3UO1L 4JPWL 1U92A 4WHCA 4HKZB 4EDWH 4YR6A 3BEVA 2FR4B 5EZLA 4TPRH 2Y25A 1JL8A 4ZSOA 4BSVB 1PZUB 1D5ZA 1HIMH 5GISH 4PV8B 4U1NA 5IHUH 2XWJB 1SY6A 5C0AD 5EC1A 4PRNA 2EIEA 4NHUB 4RA3A 4J3WA 2EXWD 2DDQH 5I74C 1AD0A 4XGZA 4ELKA 1T21A 5DUPH 3DXAD 1Q1JH 3B5HA 5HHPB 5I9QC 1LP9B 1RVFH 2VLJB 3MR9A 4LHUG 4JKPL 1FNHA 4KDTC 2J8UE 1D5IH 3MO1B 4P3DB 4Y5XB 2HTLD 3B5GA 2W9EL 3SY0A 3SKNB 3UTSA 1OGAA 2UZIL 3L5XH 4NQUA 2DQTL 3W2DH 2HLAB 1MCWM 5E6ZA 2F74A 5L88H 5DUBB 5FOBB 1F4WL 3V6FA 1HINH 5ILTL 3FFCB 1U8PA 2NY4B 3TIEA 1GXEA 1M7DB 5D6CA 1CFVH 3MRQA 3RJQB 3ZDXE 2YS4A 5DC0A 4UOJA 5FGBC 3IGAB 5JZ7C 2HMID 2XY1A 4PTTB 5TQ2H 1G84A 1ZAGA 4XPTL 1AGFA 4JDVA 1BFOB 1DE4B 5BXFB 4OFPA 3VWKA 1QSEB 4KV5F 3LDBB 5A2IH 2W9LA 5J56B 3UTZA 2B5IB 1UH4A 5KS9F 1SYSB 4GKZB 1CGTA 5C9JA 2JJWA 1JGLL 4ERSH 1AO7D 1VKXB 4YE4H 1P4BL 3OZ9L 5HI3D 2R2BB 2XTJC 3MXVH 1XGRA 3WFEH 5ID0B 1OL0A 1YNTA 5E6IB 5KVEL 1AXIB 4LSQH 2C7UB 4O9HL 5DJ6B 3S35H 1JGVL 1QNZH 1RUKH 1AFVL 1RJZB 1C1EL 3OJDB 1RJCA 1DR9A 3D87B 1PJ9A 5CGMA 2YK1H 3NFPA 2P5EB 5C9KA 2X09A 4HD9A 1VB9A 1AXTH 1IAIM 3EOAB 2XRAL 1FE8H 4Z76B 2VXUL 3G6JA 4DVRH 5I1AA 4YFLF 2IANB 4JM4L 1UB5B 3VMNA 3O81A 5E6YA 4ZYKA 3H6JA 1CGXA 4Y19E 4IOFD 1X5HA 1NCBH 3SGJA 5J4MA 1UGNA 3CU7A 3QISA 4NOBA 5I66A 2UYLA 1UXSB 5HDOA 1EDQA 3TO4D 5I8EB 5HHOA 5JHDA 5C0RH 3A6CL 2XWTB 4JFYB 4XCEA 4QWWD 4CVUA 4G6FB 1QVOA 2DLFH 4L8BB 3H3KA 1TZHB 5DD6A 3LSOA 1NGXB 3CC5A 4G7VH 4X4MA 4PJAA 3DO3A 3HRPA 3OGCA 2VAAA 4OF8A 3VXUB 4YDKH 4MNHB 3H8NA 1Q9KB 3MYJA 3D25A 3S96B 3WFBH 1TZGL 1XR9A 1VCAA 4MGXA 1SHMA 3IKKA 2LTQB 4TTDD 1Z9OA 4X4XB 4IRSA 1JHLL 2WUCH 2VDNH 5TQ0H 3MV9B 3C2AL 4KKCD 4PS4L 3IS1X 1HH9B 5IESH 1XGPB 1A1OB 3VD5A 3BRDA 1X7QA 5FYJH 1HKFA 1BIIA 2FD6H 3GMRA 3WL9B 2VDOH 5IW1A 4F57H 4QF1A 1UXWA 3MRMA 2F8OA 1UM6L 2ZG1A 2RBLA 1KN2H 3LHPH 4J3OC 2AEQL 2N4IA 3DV6B 1F42A 2ICWI 1IC4H 2XZCL 4DGYH 5EZJA 5FA3B 3MLYH 3O45B 2AK1H 3PDOA 1J5OH 3DPBA 5HHXH 1IAIL 2MOVA 4LSSH 2HT4D 4D8PA 1W72H 2VL5B 5GS1A 2B0SH 2W0FA 1BFVL 1JWMA 1N5AA 3KHOA 2FZ3B 1PZ5A 3VDBA 2UY7A 4ACPA 4LLQB 2ZG2A 3FO1B 1EUUA 3MYZA 4DTGL 4XXCC 4O58H 4CNIB 1BVLB 1MQ8A 1N6UA 3E6FB 5D2LB 3IDXH 4I48B 3F6IA 1UA6H 5EU4B 5CEYB 4OBSA 5AAMA 4MQXC 4GMTL 2VDRL 2KZWA 3BZEA 3P0GB 4EOWL 2HAZA 4NZRL 3OWEA 4NBYB 1BQLH 4JHAL 3AGVA 5BS0B 2YPLA 4G8FB 2IFGA 4A2LA 5I18L 3MLUH 1H0DB 2DQFB 3GSUB 3MRGA 4MZ2A 5MI0C 3L5JA 1YC7A 3W5MA 4L8SC 2ADIA 4HWUA 1FC1A 1G6RB 4P5TA 5DZNA 2H2PD 4P2QB 4OZ4B 2GTWB 2E9IA 3JV4B 4G8GE 2JCCE 5EB9A 1MI5E 3ZT6A 1K4CA 3NOIA 1ETZB 5JR1H 2EYSA 5B8CA 2AP2A 4Q9QL 3TNNB 5E4EB 1E0OB 4JFED 2P5WA 4G6AD 4JY5L 3VXPB 1YPZB 3LMJL 4EI5C 4HXAL 5JOFB 3P40A 4LKXA 2VLJD 3VG9B 4WO4C 4UNTA 3B43A 1QKZH 1G7HB 1FLRH 4LEOB 4LHUB 3MRLB 2Y6SC 3H3BC 1U8JB 1IAOA 2EIDA 3AMLA 3MXWH 3OV6A 3PGFH 4I1NB 4BFGA 3HZYB 5F9OH 1KXVC 5E08L 1RK1A 4X9GA 2WINB 4TN9A 4XVSH 2XZQH 5DGQA 4GJTB 1R6VA 3GKWH 4I4WA 2GUOB 1A7NH 4M03A 4ODBD 5MEOA 1X44A 3LPGA 1G9NH 5JPNB 2BVQB 5K9JL 3LN4B 4FA8A 1I3VA 3MODH 1JGDA 2B4CH 4WI6A 2Q6WB 1FL6B 2WWMD 4XVJL 3VGAC 4BUHA 3ULSA 4O2EA 3AROA 3DHJA 1GOFA 1OAUH 2EEBA 4OCRL 2XT1B 5KTEH 2OK0H 1BBDL 3V4UL 4DKAA 4HIXL 2NZIA 1SJEB 1XF3B 5J1SC 4D9LL 1EJOL 1I3GH 3DUUA 5E6ID 1CGYA 3EO0A 1EGJH 4RCAA 3SQOH 4GAGH 4ZD3L 1JHTB 1FGNL 3B6SA 2EXWC 4M61B 1C16B 4NKQB 2ERJC 2KQMA 3TBVA 1OSPL 3W9DB 3CK0L 5E8PB 1P2CA 1KEML 5LGHL 1W8NA 3QAZB 1HZHL 1AGDA 1Z6JT 2HTLC 3BN3B 1KPRA 2NY2C 1P7QD 3CSYB 4HUKB 3D18A 1WFUA 1G7PB 5IKCB 2V17H 4R90H 1UZ6E 3JWOC 2YWZA 5E2WL 1DBAH 3T1FB 4PREB 5JO5A 1FVCA 4P2OA 4U6VH 2R0ZH 1X4YA 4G42B 5A3ID 5KN5A 5E8EB 3TBWA 1HH6B 2PR4L 5T3ZD 1N26A 4FZ8L 2ZCHH 1NMCC 3T2PA 5J9PA 1IJ9A 3QDGB 4G6FD 4I13B 2XQYK 2HMIC 2VZ1A 4PG9B 2VN7A 3X12A 2YRLA 1VEPA 3VFUB 5LG1A 1HEZB 1XGTB 2C26A 3VXUD 3PV6B 1X5GA 4CMHC 3G6AB 4NKDB 1GPOH 2VLME 1FNEA 1B4RA 4P9ML 1DBJL 1IEAB 3PDDA 4U49A 5HI3C 1HNFA 4MA7L 1IKFL 1T03H 2A6KB 4CMMB 3AU1A 2VKXA 1CD1B 2OLDA 3VWJA 3N1GC 5F7DA 2PUQT 2W91A 3BUYA 1S5HB 4YXLL 2BERA 5BVPL 3O0RH 2E7LC 3C5ZA 4NO0D 4HJJH 2VWEE 3GBML 4Q6YA 1WAAF 2XNAB 1ADQA 4XP6H 1CVRA 3FQWB 5I6XC 4JQXA 3QI9A 3QA3B 5MEPB 2ZUYA 1QRNB 5TH2B 3RL2B 3WFHA 3L3GB 1S5IL 2DLIA 1IFHH 4BKLB 3G5ZB 3M8OL 4MB3A 4IOFC 3MFFA 3MGOB 2YRPA 4WU5B 3C8KA 1NUNB 3TO4C 1AHWB 2NXZB 3NIDE 1A7BA 1X6LA 5TE6L 4MSWA 5B39A 2X40A 4JRYA 1B0WA 4QWWC 5D7JD 2BOCA 3ZYOA 5CEZE 5EOQL 4F33A 1DBBL 5I30L 3VJ6A 5A40E 4X99A 1DQTA 4OCLC 2P43B 4XC3L 2D31B 3WUZA 1X5KA 2AI0L 1J1OH 1IM3A 3W0WA 3T09A 3ZYJA 2AKRB 5EUOF 1T7ZA 4TTDC 5A16A 1OARH 1OTUD 5I16B 4P5MA 2GCYA 5C0GA 5E8NA 4GQPH 4KKCC 2F54E 4X5WA 5ELIA 1HHHB 3KYAA 5IG7A 5D72H 1ZT1B 4K3DL 4LLVB 5DS8B 2ESVD 2E7HA 4K2UL 4PD4K 5KSVB 1CBVL 4A6YH 1RZ8A 5HYSG 1T2JA 4MD5B 1JK8A 4K3EH 3JTSB 5EU3B 3O2VL 4X6CA 3MV8A 2JB5L 4TSCL 3UEZA 4Y4HD 3QUKA 4XRCA 2I24N 4I5BA 1DQQA 2ENYA 4NFCA 4P2OD 1F4XL 4QNPF 1P4LA 4O4YH 4WI4A 3QUZD 5I8CA 4JFFA 2HT4C 4R7NB 4OT1H 4YAQA 1KBGH 1XR8A 5IMOB 5IHZB 2LVEA 4PJ5B 2HFEB 2PYFA 2AXGA 5I1LA 4LVNC 4XPBL 1JN6B 1X5JA 4FQIH 3D69A 3U4BH 4C55A 5EORL 3P77A 3GIVB 3LPWA 2J4WH 3EYQD 5FUZL 2FX7L 3CFJA 4N9GB 4PJFF 4JKKA 1BWMA 2EDOA 1T6VN 4YC2C 5BRZD 1A4KB 5ESQB 2LABA 4I0CC 5DMKB 32C2B 2X4SB 3EGSB 4HKBA 3H0TA 4IJ3C 4ZQKB 2ZKHL 3AB0B 5FYJD 1P5UA 4WW1A 1ZHKA 5GRJL 3BKMH 3QUXD 4WTZG 4GXVH 3NCJH 4HJGB 1NCWH 5DK0B 4D0BA 5JUEH 1L7IH 1RZJH 1OQXA 1EFQA 3KPMB 3QXDB 5GRXG 2J2ZA 4ODXA 2QHLA 4K9EC 3MV11 4N90E 1I3RA 5DT1L 4P9HL 2HWZH 5BQ7B 2GT9A 1V3JA 2DWEA 4ODSL 2H2PC 3QEUB 3CDGA 5FYJU 5IV2A 2OTWB 1A6WL 1MRFL 1X4XA 4CVXA 5I75C 3B9KB 1AD9A 2G2RB 4BFIA 1TZIB 1R3LB 3SGJC 5C0FB 5FUCE 4G6AC 5DYOA 2C4FT 5IP4A 1A7PH 2BSRB 2CPCA 5EH1A 2AEWA 5FGCB 4ZTPH 5GGVH 5D2NA 1FIGL 3H7LA 1GOGA 3VGFA 4OD2A 4XWGL 1N5YL 1XIWA 2PNDA 2Z35B 1HDMB 4F58L 3E6HA 3N50A 4HUXA 3QEQA 1G7IA 4HXBH 3W0WD 2QQKL 4JFOA 3KYOA 5F1IB 3C9NB 3FZUC 2GSGB 3WYRA 1YEHH 3DYMA 1VPOH 3L5IA 3F7YA 1C5DA 4JQIH 3V0WH 4ONFL 1KJ2A 4YBLB 5E1HB 4K23L 1NMBL 2XV6B 2VXSL 2WWMC 3BH9B 4I18B 4HPYH 1VERA 1DL7H 1F3JA 1MFAL 3PNWB 1JPTL 5SWZB 1N2RA 1SVZA 4EDXB 4J4PD 3ABZA 4C56D 1P84K 2ZUQB 2E8ZA 2CH8A 3WS6C 2R1YA 5DRWB 3BH8A 5FHBL 4YQXL 4B7LA 1JPST 2BC4A 4Y16A 2FJHA 4CU8A 3VFMA 4KK8D 4Y7MA 2YKLH 2J8UB 1NQBA 1S7SA 2BFVH 1XGQA 3GNML 5KW9H 1AKJA 4G3YL 1J86A 4NSKA 4DOHE 4U1MA 3UYRL 2O5XH 1G6RL 4DKEL 2VISB 2IGFL 4I8DA 4WTWA 1U0QA 3QRFM 1MCBA 2CIKB 4GAJH 1FZOA 5DA0B 2P8MA 2BVOB 4KJWD 2E5EA 4RMSA 1C12B 2EDQA 3ECBB 4OKVA 5JXAH 5B22A 3ARDD 4UINL 5A3IC 5C8JA 3PWPD 4N1EA 1YA5A 3VXSE 4MLIA 2SEBB 1LEGA 5AZ2L 2ZWLT 2HFGH 3O8XD 3KPPB 4HLJA 4UQ3B 4HK0A 2V2XA 1WBXB 3QULA 5B4MD 4YHLL 4NFBA 3O3DB 2BDNH 4P5TC 3K0WA 3QWOB 3V52H 1B2WH 2JK5A 3TCLA 2ICWJ 4OFYD 4R96A 3H9HB 4PY8J 4PJ9A 3S35X 1F11B 1R3JB 1M6OA 4L9LA 3PIQB 3IDJB 3LN5B 1D5MA 5FA4B 4LEXH 4GBXA 5DHVH 4GKOA 1Q0YL 3DURA 1T89A 1BQHG 1MQKH 1QA9B 1BGXH 3TNMB 3S98A 5D1QD 5CEXB 4C59B 2KZ1B 4JJ5A 1XH3A 3WKNA 3K3QA 5EWIH 1NCCL 5HYSB 2XN9B 3I6KB 4WFFD 2Q20A 5IFAL 2FJFA 3B2UD 3MNZB 1DQJA 4PBWD 1NKOA 4HQQL 3GRWL 1YN6B 2OQJB 3DYOA 5C0CE 4NBXB 3P9MA 3MMEA 2P7TB 1E4KC 1UFUA 5DWUH 2YD7A 5KSBA 1XCTA 3FN9A 3NH7L 4K7PL 4U6XA 5F7YC 5HI5D 3BYYA 3UBXI 4XBPB 3SQBA 5IR1A 1F58H 4YNYB 1F3RB 5D7JC 2MSPA 3MCKA 3H9SB 1N59A 4PJEB 3FT3A 5ALCH 2X10A 5D1ZB 5CWSB 4F3FA 5SV3A 1CT8B 1REIA 3QQ4B 5J57B 4UTBL 3L3DA 4YDVA 5I1JL 5C71A 2KQNA 1S9WB 1DUYA 1IT9L 3VXTA 3FQNB 4N0FA 4UU9B 3UPAA 4XCNB 4BZYA 4WWKB 1JV5A 3OXRB 3IAQA 2DYPA 5KG9A 2VXQH 1OTUC 3WHXB 5K9QG 5ISZE 4RRPG 2PXYB 1JPFB 4JY6B 3MUHL 1NL0L 3PL6D 5T1LA 3UTTE 4D0DA 4DAGH 3FCTA 4FN0A 1AKJD 4X8JB 4PJDF 1T1YB 3B83A 4L3EA 4NM8L 1NBVL 4MCZB 1DUZB 3RZCD 5H35A 2OS7A 5HY9B 4IRJB 2P8LA 5HVHB 4MJIE 1S9VA 3L3KB 5E56A 5HSFA 1H8OA 1CICB 4XZUA 3VI3F 3VFRA 1U8HB 3TYGH 3DO7A 3MRFA 4MJ6A 4Y4HC 1CK0L 1RIVL 5CJXC 4P2OC 3U0PB 1YNLH 1ZLUK 4NIKB 1F6AA 3D3VA 2O5YL 1TQCB 1YYML 3QUZC 3EJYD 1V05A 4JCMA 3MLRH 1G6VK 4U6YB 3U48A 3NA9L 5C0BE 4WCYL 3WN5B 1MF2H 2YD3A 4U0QB 1WICA 3BPNC 2XWBB 4PJHF 3KPNB 3VGDA 1ED3A 3AS0A 1DEEA 4R4ND 4LRNL 1A14L 2WANA 4N0YL 1JMZA 3GSNB 5HGDB 1HNGA 2P48B 4GSDL 1RFDH 1MCWW 2EDBA 3MRBA 1OW0A 1VFAA 2DQJH 1IQDB 4WRLA 3QUXC 5HDQH 2K7PA 1G7LA 1FFPB 2DJSA 4JVPA 4NUJB 4YGVB 1MCPH 5C0ND 4HUVB 4G8GB 1CE1H 2JCCB 4M00A 2G5BB 2WSKA 2CRZA 4H25B 2X9XA 3CDFA 1MJ8H 4Z78B 1UYWH 3TJEL 1YEJH 3LEXB 1OP9A 1YMME 1I7RB 5D1XD 1Q72H 3GMLA 4QYOB 4FABH 3SKMA 5LBSL 5IT2H 4Z7NE 1ZA3B 4Z7WF 2GAZA 3C5SB 2LQRA 4Z7QE 1G9EA 3FRPA 1S7XA 4ORGA 3WXWH 1DANT 4NOFA 1I8MB 4PRID 1T1ZA 5IVXE 4XNMA 4DEPB 4DW2H 1EZVX 2QBWA 4N0UE 5F9AC 5GGRB 1RUQH 3KG5A 3AY4A 3RDTB 5J6GA 4MS8D 5JXED 4JRXE 1XT5A 5FB8B 3SJVE 5CJ8A 5KVMC 4K07A 4M1CD 3WFDH 3VFPA 4FFYL 3D39E 4WFEE 1K9TA 1FVEB 1FCCA 5JMOC 4QRSA 3QEGH 5IMLA 1CWVA 3SDDA 4M5ZH 4Z18A 1PW3A 2W65A 2HN7A 3S5LB 1YN7B 4X80L 4WUUE 4X6DA 4K71B 4YO0B 3T8XB 5T1LD 4BYHA 3MLXH 5CEZH 2ADGB 4L3ED 2UVFA 1NDGA 4NWTL 3TYFA 4UNUA 5CZVH 3ZDYE 4J4PC 3P0YL 1B4JL 2CRMA 3GJFA 4IOSD 2DB8A 4RX4D 5DHVA 2H32B 1CXHA 5EG6C 3CJJA 5HGHA 4JKMA 3MREA 1H3UA 3PWLA 4NC2B 4EXPX 2AABL 1QFHA 3CCHA 4KHXL 5LKNA 1PD6A 1HXYB 3O9WA 3PP4H 3BGFB 1YY9C 2HKHL 2CKBH 5FKPA 3MRPA 2H45A 4NGHL 2GJ6A 1WFOA 4UIMB 3FN3A 4AYFA 3OR7A 5F7KC 2R29H 4IDJL 3ULUF 1ZGLB 4Y19D 1U3HB 1H3WM 1MFBH 2IAMD 4UDUA 1G9NC 4OD3H 2XA8L 1YYLH 2WBKA 2WIIB 4OGYL 4CGTA 3S4SG 3U30C 1ND0B 3HG1E 1CD8A 4KJWC 4PRDB 5FUOL 2B4CC 1LE5B 4P2RB 4GS7C 2Y36H 4PRBB 3ARDC 1WBZA 4XPAH 2APXA 4FQHA 4Y8AA 2FL5A 5H2BB 4AM0B 3PWNA 1ES0B 1ZWIB 3E0GA 1G1CA 3O8XC 4JO4H 1NAKL 5T1DH 4QOKA 4R8WL 5I1HH 1OGTA 4Z7VA 3HNVH 2IH3B 3RKDD 4K3JL 3I9GH 4W70A 4PRPE 5B4MC 4QRTB 4X6EA 4MAYD 4X9HA 5JOPE 5HYJB 1YEEH 5C2BL 3QDAA 1FVDB 2XQBH 1RJYB 5J06A 3ARVA 3SCMA 2HYMA 5L7XL 4YWGH 5ALBH 3RY4A 3BZ4A 4PV9B 1RULL 3GBNH 3QUMH 4X98B 4O5LL 1GZPA 2W9DL 1XZ0B 4GFTB 1EPFA 4XC3H 4Q0XH 3QNZA 2FGWH 2WQRA 1ZSDA 1OAKL 4JJHA 5D1QC 1J0ZA 2O5ZL 4BH8A 4Y5YB 4RNRA 4O2FB 3HZKA 4NJAL 4ELMF 1XIWC 3UTQA 4R4FL 5F96L 4QRUA 5L2KD 1L6XA 2Q8AL 1LNUB 3DUSA 1JUFA 2BK8A 4ODHH 4QRQA 1RHFA 1FRGH 3B2UC 3RWCA 2HVKA 4U2YA 5F7NC 1DSFL 2J6EL 1MEXL 5EU6A 2EDYA 4NT6B 1UQSA 5IK3A 1MJJA 2EYTB 5HI5C 2V5MA 4RMVA 2X4QB 3BRFA 1YDPA 1I3UA 4MYWB 1UM5H 2R4SL 3O6LH 5HVFB 3L6FB 3MROA 4H88L 1RY7B 5F3BA 2LV4A 4ZXBD 2WP3T 4GQ9H 5T1KD 1A6TA 2R23A 4XCFL 4JANB 1GHFL 4BUGA 4HZLB 4ZS6C 1BZ7A 2F54B 2EDWA 3M1BB 4UT6H 3PQYE 4Y16C 2NY7H 3K4DA 3GMQA 4YFDB 3FKUS 5AYUH 5HXMA 5DD0H 2NZ9D 1UWEL 4ZUUA 4NM4L 3SKOB 3DECA 3PL6C 1DLHB 5KVDL 4ZUWB 1PLGL 1MI5D 4HH9A 3EYVA 1A3LH 3H42H 3G04A 1E4WL 3GSVA 2J88H 4JCLA 2BY2A 4R7DA 3VW3H 3KJ4B 3RZCC 4KRMB 4M9PA 4AENA 4C83A 3DRTA 1HQRB 1H9VA 4CADA 1Q94B 1Z9SA 3T65A 2V2WB 4QO1A 3GJFK 3OKDB 1TFHA 3KPRB 2E27H 4MHHG 4XP4H 5EOCH 3X3GL 1RMFH 4YHKH 1FFNA 4POZD 4EJ1C 1S7TA 3LS4H 4DUWA 2VZTA 3VXNA 4GKSB 5IJKA 4UIKH 3M17B 3EJYC 4WDIA 5F1OB 5KANG 5F7UA 2NXYD 4YK4B 3WO4B 2XZZA 3OKOA 3RU8H 2PTTA 4U7KA 1KLUA 5AD0A 1HSAA 1TVDA 1BOYA 5F9JA 3TFKC 3Q5TA 2EC8A 4XNYL 4FFZH 3QUMB 1G7QB 1MREL 2DL9A 5I76A 4R0LB 2CLZA 1PY4A 3JZ7A 3I75B 5J12B 4LCYA 1TNNA 2HVJB 2YEZB 1I85A 1ZS8A 4QRRB 2VLKE 5ADOH 5HDBF 3SGDI 5C0NC 4WV1A 2DMKA 3ORJA 5IB4A 1VFBA 4XCYA 3TA3A 4LCWA 4H5SB 5CZKA 3E2HB 4OCSH 5D1XC 1FLTX 1A7QL 43C9A 4JLRA 3L5WA 1OQOA 4QKXB 5CJOH 4Q9RH 4M6OL 1MY5A 4LLAA 2NTFA 2CDEA 3CXDL 4L4TB 5DJYA 4W4OC 3ARBD 2VLRB 4XTRD 4WIQA 3WFCL 3PXHA 1WITA 4TSAL 3HMXL 4CKVX 3NBNA 3BISA 3TN0B 4YFLI 4EVNB 4O2CB 1AGEA 4XP9H 1MJUL 4ZUTA 3VXMD 5KVGL 3G6JF 3CVHB 5IGXL 4EZMA 4MNQE 4MS8C 4S2SB 5EBWB 4OZIE 4HKZA 1X5FA 3MJ8B 3WDHA 1AY1L 1G9MH 3S4SB 4PV8A 5ADPH 3QPXH 2XWJA 1RZJC 3ZE1E 5GJSL 5T33H 4NHUA 4C54A 1KFAL 5EOCJ 3EHBD 1QTYT 1FDLH 4QTIH 1EXUB 5JW4Q 5HHPA 2VLMD 1LP9A 1TETH 1ZTXL 3LY6A 4P3DA 3MO1A 1EHXA 4MB5A 4Y5XA 2PYEB 4AEIH 4S0TD 4MAUH 1TQBB 3ULVF 5JOEA 3SKNA 3GMMA 3GSNL 4LSPL 2CK0L 4Z0BH 3O6KH 3D5OF 5I15L 1B0GB 1QBML 1CDCA 3GI8L 5DUBA 1WZKA 5FOBA 5ENWB 1E6JL 1IGJB 3MCG1 3FFCA 2UZYB 4AT6B 2FHFA 2YUVA 1CD9B 2W07A 1DBKH 4DGVH 4YXHH 4XVTL 5DR5H 3CLEH 4WEUD 3IGAA 4PJGE 1OT1A 3HAEB 1A6PA 1BFOA 1CN4A 1DE4A 1DQLH 1VFUA 1ZEAL 2OP4H 2ZG3A 4HF5L 5BXFA 2IAMC 1QSEA 1MSPA 5CINL 4AEHL 3ARGB 2EDJA 2IC2A 4RFOL 1JZ5A 4N8CH 3VXSB 4JM2F 1GVIA 4ESKA 1ZGLM 1VKXA 2EECA 1O7SA 3IJHB 4TRPH 2ATKB 2R2BA 2W60B 5CEZD 3ZYIA 4Z77B 3TVMA 5DQ9A 5E9DE 3BZDA 5DJ6A 3F58L 4CVZB 1MIML 3RWDB 1RJZA 1IQWH 1QR4A 3VFVA 3OJDA 3RKDC 3L1OL 4OCWL 3FT4A 2ID5A 1GIGH 4ORZC 3DYPA 5I1CH 1A3RL 2P5EA 4QXTB 4LAJH 1CLYH 3EOAA 4MAYC 4V2BA 4Z76A 3RX7A 5D93C 2IANA 4NWUH 3U7AA 1GJIA 1EBAA 1NH6A 1A4JB 3AREB 4LQFL 2XOTA 4KTYA 4KUCF 2NX5A 4OF6A 3FL7A 2JELH 5CMAB 1ZOXA 3HB3D 1MH5A 3ESUF 4X7EC 4WHYH 1SEQH 1UXSA 2X89A 3QIBD 3ARXA 2B1AH 5I8EA 2YN5A 4J3SA 5I1JH 2DM7A 4MXQD 2XWTA 4MDJB 2J3SA 1KIUA 3V0AC 4L8BA 4LVOC 5D71L 5FYLH 1QSZA 1X3DA 2RCSL 2FWOB 4CRPA 2R69H 3LKQA 3NMEA 4HS8H 4RAVB 1U8LB 5E2TH 3D85D 4MNHA 2DQHL 4YPGB 5T5FL 4ZS7H 3S96A 4B0MM 1AQDB 4FMFA 4WGVB 2NY6D 6FABL 4U1IB 5BZDB 3MV9A 4JPKH 4OLUH 4XPFL 2OYPA 4HPOH 5DURD 1HH9A 4JQVA 3OKKA 2NY0D 1XGPA 3KYMB 1A1OA 2IF7A 4ZO6A 2MCPH 4M6NL 2DQCL 2YSSB 2OL3H 4ZXBC 3WL9A 3MRRA 3VRLE 2Z31B 1KC5H 3UTTB 3NN8B 5DJDB 4R2GB 4OV5B 2IPTH 4JG0L 5C07B 4XX1E 3B9EA 5FM4A 4N90D 3N1MC 1OTTC 1U8OB 3BKCH 1SQ2N 2NZ9C 5ERWB 2BHUA 1VENA 3U9PL 4I3SL 2CO6B 2VL5A 4MJIB 1LO2L 1NC2A 2PW1B 2FZ3A 3K8LA 3PF2A 4PP1D 1OLLA 1JCKA 4LLQA 2DKSA 3FO1A 3G6DH 4BJLA 3I2CL 3EUUA 4LLWB 4CNIA 1BVLA 3F62A 4NKMB 4YDIH 3E6FA 5D2LA 3KPSB 2I9TB 4HWNA 4I48A 4UILL 4YIQB 5EU4A 5KVFL 4KK5C 1MY7A 3RAJH 5CEYA 4EUPG 5DZLA 1FL3B 3UYPA 4YHOL 5J13B 4G80B 1NMAL 1EX0A 2DM2A 5DHYB 2AXJA 3TVMD 2NXYC 1Q9OB 5EBLA 4LSTH 3QXUA 2Y1VA 1A6AA 5BS0A 3X3FL 1DQDL 5I1KL 3O6FA 1ZVHA 2F5BH 3Q6FB 4G8FA 8FABB 4U33A 1H0DA 2DQFA 2NY3B 3GSUA 4V1DE 4NO2B 4H0HB 1E4XI 4WU7B 3DBXB 1NGWA 1M71B 1ZA6B 1DP0A 2AJUH 4L8DA 2GTWA 2Y72A 3HUJB 3JV4A 4XPHH 5EIIB 3DV4B 3MOBL 1ETZA 2X4PB 4CU6A 4L4VB 1LO0H 1FFRA 4TSBH 3SCMC 4OZGE 3ARFB 4KKAC 2C3WA 3TNNA 4AMKL 2NX5D 5ANMB 3V79C 3VXPA 4AJ0A 4XNQA 1MCSA 1YPZA 3KR3L 3WNLA 3ZKMD 5EUOE 3ARTA 1EEUA 4JO1L 4JFPB 1G7HA 4LHUA 4QHLB 2R39A 3MRLA 1D3CA 3IETB 3BW9B 4PJ7F 3HZYA 4TQEL 1D5BB 2W92A 2X4UB 3WLBB 1WEJH 5IVXB 4JGMA 5F44A 2GUOA 3HE7B 1F6AB 4PJXE 2UY6A 4KWUA 4N0UB 4RAUB 4LBEB 4KXZI 3ARBC 3N06B 5JPNA 2BVQA 3HE6A 4FQXB 3K7UA 4NRXA 4JRXB 3ZE0E 5JHLH 5ITBH 4DN3L 2DQDL 2Q6WA 3SJVB 3LRHA 4YHZL 4OF0A 3D39B 1IARB 5CJ5A 3BGAA 1CI5A 4FNLH 1B88A 4URTB 1SJEA 1XF3A 1JRHL 5FYKL 4OZHF 3DX9B 2D0GA 1I1AB 4HDIA 4HIHB 4AIZA 1JP5A 1DDHB 1I8KB 1JHTA 3QR2A 2A9MH 2DQIL 3JWDL 3GRWA 5GZND 4M61A 1MWAB 1C16A 1YEKH 3EHBC 3MUJA 3QCVH 3VCLA 4GOSA 3W9DA 3ZE2E 5CCKH 5EC2A 5E8PA 1NC2D 2ZJSH 3H9YA 3U46B 1G7MA 1VACB 4P3WA 3LH2L 4X4YB 4XWOD 3CSYA 4P4RB 4Q6IB 2JF1A 3EDEA 3NPSB 2A9NH 4LSVH 1G7PA 5MERB 4J6RH 2XQYG 1AC0A 3ARED 4KAQL 4OCXL 4R8WH 1G7JB 2VWEC 4PREA 5LWYL 2MHAB 4F9LA 2VDPH 3SGDH 4G42A 5E8EA 4IMKA 4WI9A 1KB5B 5I1DB 5CIPB 1EAPB 4LKCA 3E1F1 4MA8L 5F89B 4QTHB 2M26A 1OM3L 3QEHB 3KJ6L 4OLYH 4IS6B 5IVZB 4PG9A 4XP1H 4UMGA 4M43H 5C0CD 1D9KA 5MP6L 1HEZA 1LO3L 1DEDA 1P53A 1RULH 1XGTA 2FBJH 2WW8A 4FOMA 5IFHL 3P9LB 4CJ1A 3G6AA 4KHTH 2CR6A 4NKDA 2ZOKB 3FQRB 1IEAA 2W1NA 4I77H 1NGZB 4ZTOL 2A6KA 1IRAY 1ZT4B 4RZCB 1CD1A 3BJ91 1I85C 2NQCA 1NAMH 5C09E 3ZTNL 4JO2H 3T0EB 1HKLL 1T2XA 5EU7E 3THMH 1S5HA 1NJ9B 4W6XB 3U7WL 4JHWL 1ORSB 4M4RA 3C6SB 5DHXB 3CVHL 1U9KA 5D7LD 4HWEH 2VC2H 2F5AL 5C0EB 2XNAA 4DWHA 2CDGB 5I1IH 3FQWA 3L7EA 5F3HB 1GC1H 1L0QA 1IGFH 5MEPA 5FEBA 1QRNA 5TH2A 5ISZD 3QXTA 3QWRD 4PGDB 3MRDB 4TULL 3L3GA 3UTTD 3CUPB 5KBNC 2IMMA 4JFHE 2MPAH 1MHHB 4M7ZC 5DD3H 5IB5B 5BJTB 4TVPH 1L7TL 1KTKE 1RV6X 5IOPB 1WCBB 4LLMB 3MGOA 4JPVL 4B53A 1UJ3C 3MLTB 3L7FB 2L0DA 3QIBC 3S7GA 1AHWA 3VFTA 1TITA 5GJTL 2Z93B 1O7VA 4AIOA 1SMAA 5C3TA 2DOCA 1NCDH 1SEBA 3IFOB 3PWUB 2V6HA 3WUWG 5EZOL 1KB9J 2D31A 3GO1L 1MCNA 3X13A 2AVGA 2CXKA 1SM3L 1VESA 4JEGB 2WBJD 1NGPL 3QDMB 2YBRB 2AKRA 5C0BD 1X5AA 3PWVB 3VXRE 5C0JB 2NY6C 5I16A 4EUPB 4KZEL 1D6VL 3A67H 1OAXH 3VD4A 5IHLB 5JQ6H 4HIIB 1HHHA 3QQ9D 2QJDA 2Y23A 2FCBA 2NY0C 2B7DT 1IC1A 5KSVA 1VSCA 4QGTA 4JN2B 1SJXA 3PQYB 4HUUB 4IDLA 4DN4L 1N4XL 5ESAA 2BJMH 4JN1L 1CGSL 2NW3A 1K6QH 5ICYB 1C5CL 5E00B 2AJSH 1T7XA 1I1YB 2IPUK 3QWQB 1MUJA 2HTKD 4PB0H 3QG6B 3PG2A 1IM9D 5IB1B 5A2LH 5FYLD 1YMMD 1PG7L 1UC6A 1UM4H 4NKIH 4LSRL 1I9IH 3GMPB 4NQDE 4LVEA 4R7NA 2A1WL 1HWGB 4U3HA 4F7TB 5IMOA 5IHZA 4PJ5A 2HFEA 3UC0H 3WDJA 1MFEL 1JMXA 1I75A 4OM1L 3GIVA 2R0LL 2AGJL 4N9GA 4XC1H 5HJ3B 4HS3B 1UZ8B 5ITFB 1A4KA 2BY1A 1R5VB 5ESQA 1IEBB 1NCAH 2VB5A 3LKRB 2AJXH 5DMKA 3OX8A 32C2A 2X4SA 4ZQKA 2QQLH 1A6UH 3E3QE 4U1JA 4HWBH 4I0PB 4M93C 3TVMC 2ZCKL 4RMTA 5CJQL 4HJGA 3SJVD 4YX2L 4L1DA 3KPMA 4KQ3L 3DTXB 3RWGB 3QEUA 4GW1B 4WUUD 1EHNA 1ITCA 2NW2B 3O4LE 1S7QB 2OTWA 1FZJB 2EICA 3UROR 3ZDZF 2H41A 1ZANH 5L8KB 4IBLT 1HOCB 3B9KA 2G2RA 4HT1L 3QG7L 1TZIA 3ZHLA 5B21A 5CP3A 5C0FA 5TF1L 4WHDA 5SWSE 3RWHB 5IBUG 1A47A 4HX1B 3V6BR 5L9DH 3ZKMC 3MJ7B 1T2QL 3PWJA 3T0AA 2PO6D 5LCVH 4M7JL 5DQJA 1TJIL 4XMLH 3V6OE 2PF6A 2Z35A 1HDMA 5DJ2B 5KS9A 4JM2B 2D7TL 4R9HA 2X1XR 3NZHL 4JZJB 3QO1B 4X4ZA 2Q8BH 3AAZB 4UT9H 4APQA 2D4DA 4RMUA 3ZMRA 4Y2DB 3RWIB 5F1IA 1JFQL 3C9NA 2GSGA 5MENE 2Q7YB 2O61B 4PJBE 2AXFB 3GB7B 4MNQB 2VE6B 4LU5H 4E41E 1KJ3L 4QLRA 3HG1D 1TIUA 2IFFL 4JQVC 4MLSA 4I18A 2H6PB 3PNWA 5E70A 3MLVH 5SWZA 1TXKA 3CVIH 1MJ7L 4EDXA 1QLRB 3UDWC 5DRWA 3SBWA 3DROB 5D70H 3NACH 1TPXB 3RIFK 4PRPD 2J8UA 4FHBD 2J6EA 7FABH 1XAUA 1RZ7L 5GZNC 4NCC1 1P69B 5HHQB 2JJUA 1E4XH 1U3YA 2HH0L 2R0WH 1PEZA 4OAWB 4BFEA 1ZLVH 3WJJA 4OQ1A 4GRWE 2VISA 3LZFH 3BKJH 3VFNB 4ZPTB 4XWOC 3ARQA 2NTSP 35C8H 1B90A 2CIKA 5FO9A 4U0RC 4OLVH 5FDWB 4Y4FA 3OAZH 5DK2B 1D6EB 2BVOA 1A5FL 2IQ9H 1T1WB 1A1NB 3UMTA 1C12A 1FNFA 1YQVL 4PJIE 2ADFL 4RGNC 2JTDA 5F7FA 4PJGB 1KULA 3QJHA 5GGVY 4B50A 3ULUL 2SEBA 1NFIB 1JI1A 4X5XA 1KCVH 5ETUB 2FB4H 3KPPA 3QDHA 5F1NB 4UQ3A 4OIIH 4H20L 3O6FC 1G9MC 4L5FH 2IG2L 1WBXA 5M94B 3WNMA 2Y5TA 5J7CC 3EDDA 3O3DA 3QDJE 3QWOA 2FIRT 4KXZH 1G0XA 5E9DB 3P11H 4TUOB 3F7VB 4R97C 1H3TA 3U1SH 4PRAB 4NNPH 2CGRH 3MV7E 1F11A 2DQGL 5T3XH 2WUBL 3FO0L 3J8F7 3R1GL 3PIQA 3IDJA 4NP4L 1RK0B 4OCYL 4Y5VB 4RMQA 3O4OB 2RR3A 4WW2C 1P4IH 3WNKA 5E95B 2DBLL 1QA9A 2M2DA 4WUKL 5CEXA 4LCCB 1OP5K 3PQYD 5DQDL 2XACC 2DF3A 1SMOA 3GJEB 5HYSA 2XN9A 1BECA 4PUBL 1W0WB 2K3TA 3I6KA 4ALAH 3WJLA 2OSLB 4G9DB 4I3RH 4APQD 5IQ9B 5KANI 1YN6A 1UKSA 2HRPH 2AS5M 2OQJA 1MWAL 3RUGE 3I50H 3BPLB 2P7TA 4GG6E 3FAXA 3HE6C 4LK4A 4S1QL 5BVJB 3NCYP 4HGWB 2V9RA 4XBPA 4HIEB 3EDKA 3KLAB 4YNYA 4MXVF 2BNRA 3CFBB 2XKUA 1KN4L 4FZEH 1ERNA 4ZNEA 3H9SA 3RA7L 3BD5A 4PJEA 4XNXH 3NABH 3TZVB 5SWQB 4K8RL 5D1ZA 3TH2T 4ZMAT 1U8MA 1CT8A 1FBIH 3QQ4A 5TDNB 1LK2A 1MELA 5SX4I 4KQ4H 1EO7A 4UU9A 2WBJC 3U7YH 3WE6B 4CBPA 4WWKA 3BPOB 1ZVSB 3QCUL 5D96C 5C0AE 3REVB 1EBPA 4JZOB 1KB5L 5CLWA 3WHXA 2DBJA 1H8NA 1N0XH 2PXYA 2QHRH 5HHMB 4IMLA 4MJ2A 3T3PF 3OAUH 4RGOL 4LDOB 4WTZA 5BOZG 3QQ9C 4X8JA 4ODVH 4Q2ZB 5CILH 3REWB 4UAOB 4XCCH 4DK6A 4PB9L 4PJ7B 4MCZA 3JVGC 1DUZA 3F7RA 2W0PA 2R56H 3RVVD 3DWTA 5GS2H 4TVPD 1F8TH 1IGMH 1N3NB 5HY9A 1WWWX 4IRJA 2D03H 1UCBH 2VLKD 4U1HB 3RWFB 4Y4FD 1CICA 1U8QB 2EIZB 4ONGL 4PRHA 2FHBA 1EA9C 1TCRB 1U8HA 4X7SL 1BM3L 3LIZL 4OI8A 1DZBA 2HTKC 3U0PA 4OTXL 5DVMA 3UXFA 4FMKA 1HHGB 3RNQB 4IMKC 4U6YA 3FOLB 1UEMA 3WN5A 4ZFZB 3BDYH 2D4FA 3HHRB 4FS0A 2XWBA 3VFWB 3ILQD 1XGYH 4KI5F 3MNWA 3KPNA 1FNSL 1D9KC 3TEUA 4LSUL 3KR3H 4NN5B 3GSNA 3LKSA 4X6FA 1AO7E 5IMMA 1KYOJ 1NFKA 3LB6C 4V1DB 1R0AL 4H1LH 2YD6A 1NBZA 4FQJL 2H1PH 2XICA 1FFPA 3LEYH 3U9UB 3CFCH 1MFDL 4NUJA 4YGVA 4G8GA 2JCCA 2G5BA 3OB0H 3RRQA 2MNUA 1A21A 3HPJB 4DZ8B 3QH3B 1XEDA 3LEXA 5DEFB 5I71B 1I7RA 3MBEB 2ARJB 1G1YA 1JF1B 1YEDB 5IFJB 2VUYA 4QYOA 3DX8B 1ZA3A 2NY5H 4X0KB 2EDRA 3FJTA 3C5SA 5L8LB 1U8IB 1I8MA 4L1HA 1CXLA 2BNUB 2A0LC 1ZLSH 4BQBA 5GGRA 2M8XA 2PO6C 1PKQE 4JG1H 5L6YH 2BNRD 3C60D 1U58B 3RDTA 5D7IE 3O3BB 5KSUB 1N7MH 3EOYG 3HZVB 3O2DL 1NC4B 2P24A 3SDCB 3ZHKA 4S1SH 4ZG1A 4XVUD 5FB8A 2VXTL 1I7TA 5IM7B 3RP1A 1FVEA 4G9FB 3KYNB 3W82A 4ODTH 2FRGP 1J18A 2CJUH 3AFLA 1U36A 1H8SA 1YN7A 1JNHB 1UENA 4FP8H 5I17B 5AWNL 2BSED 3NGBC 1XFPA 4IIQB 1WAAA 1F4YL 3SHSA 3MRHB 1EO5A 1KELL 1VFMA 3EFDL 3RWJA 3PHQB 1F5WA 4X7TB 2JJTA 2X9YA 1IC7H 4M6ML 5CD3A 3DUHA 1FSKC 4QXGL 3UTSE 1OGAE 2VDKH 3BZFA 2OMBA 3UJTL 2Q7NA 3MSPA 5F8QC 1LEIA 3IXAB 1GAFH 1KCSH 3RI5K 1HXYA 1H3XA 3F65A 5C7XH 4FQQB 5MP6H 1EHAA 3MLWH 4KVNH 1BQHA 5E2UH 1P9MA 3DETD 4NN6B 3ULVL 5DGRA 4UIMA 5F7EH 1ZGLA 4YUEL 1U3HA 4RWYL 3TESA 4ZTOH 4P46D 1TDQA 3BN9D 1LK3L 2WIIA 3I6GB 5HYEA 1ND0A 2V7NB 2AEIT 4LIQL 1LE5A 3X14B 1NEZG 4P2RA 3VXQA 3C08H 4OD1L 4JDZB 4PRBA 1CLZL 1I7UB 3V5KB 1WBYB 5GRUL 3O3AB 5H2BA 3HMWH 4K7FB 4AM0A 1QLEL 2VZVA 1WTLA 1ZWIA 1NLBH 2ADJB 2IH3A 3RTQB 1DQML 2ZUSA 5I19H 3W5NA 3TZVD 3HZMB 4PGCB 4QRTA 4OCNC 3CFKB 4HFWB 2DLEA 1IKNC 1KPUA 4G7YL 5HYJA 1BEYL 2Z4QB 1FVDA 3LEVH 2J8OA 2DD8L 3DX7B 5C70A 2YA2A 3QFJB 4X98A 2UV3A 2FATH 1UACH 5J0BA 2RHEA 1J05A 1XZ0A 3IJSB 3P4OA 3B2VH 3QHTC 4FQ1H 4LCIL 5HHOE 3SDXF 5JHDE 3U0WH 4Y5YA 3WD5H 4O2FA 4U1SB 3ARPA 3UZQA 1AI1L 1NSNL 4OZFH 3IDGB 3BE1L 4PJAE 1LNUA 3MCLL 2KPNA 4XNUL 1J1PH 1VGEH 2BVPB 4L29B 4YHIB 3TBSA 4APQC 4NQSA 3OB8A 3NIFF 3ARYA 4NRZB 2RB8A 4I0KA 4KUZL 2H26B 5CHNB 5A1AA 1B0RB 1S7WB 2X4QA 1UWGL 3HC3H 4NKOB 4QHKI 3L6FA 3VXRB 4NJ9H 1BLNB 4OLZH 2B2XH 4Y2OA 3MOAH 1KJMB 4JANA 3HPLB 4GKNB 4HZLA 3F8UB 5I74B 2Z0BA 2F54A 2LU7A 1BOGA 3M1BA 3P0VL 4NHCH 2X70B 5I9QB 2FSEA 1OVZA 3OAYK 1X6NA 2Q86B 4XPGL 4WVRA 1GC1C 3SKOA 1DLHA 1JIBA 5LXGH 2CK2A 3WDIA 4ONOA 4QRPB 3HI1A 3V4PL 3UJIL 4ZDHB 3SE9L 3FTGB 3RVVC 4YHNB 1HQRA 1A7OL 4PGJA 3IXTB 5TE4H 3OKDA 4Y4FC 3K81A 1TJGH 2VIRA 1MCOH 3KPRA 1TTGA 3H3PL 5F93C 5ID1A 1BFTA 1MIEH 4WNQB 2ZOLB 1MFCL 1SBSH 1LP9F 3QIUD 4GKSA 4BZ2H 3IS0X 5T3ZE 3M17A 4Z7UE 1A6ZB 4RMRA 5I8KL 3HC0A 4GRWH 2YPLE 3BP7A 3PGCB 1E6OL 2VR4A 3ILQC 4E42B 3V5DA 2XTJB 1IC5L 2C9AA 3BQUD 3EJZD 1T83A 4R4BB 2Z92A 5T1MB 3MA9L 3DMMA 4UV4H 1LGVA 2K7QA 1NLDH 4G8IA 5FHAH 1J87A 3BSZH 1NUDA 2HVJA 2YEZA 1AXSB 4QRRA 5GS2D 2JB6B 4F2MB 3JTTB 3MNVA 2PKDA 4NQCD 1FH5H 3L3OB 3EO9L 1IEHA 1KV3A 3BOVA 1WT5C 5EBMB 3HKFA 1INDH 3O4LB 3MLSL 5SX4H 3WIHH 1FO0B 5BZWB 3TWCH 4P3CH 4ODUA 5MHSE 1C08B 1MAML 4JDTL 5SWSB 2BZDA 5I1EL 5F6HI 4M48L 3MJ9L 2P42B 4L4TA 2VLRA 1YQ2A 4KY1L 3TBTB 5ACMA 3KXFD 1WCQA 3T2OA 2UWEE 3LKPB 4Y1AA 5D9SB 4MCYB 2BMKB 1DFBH 1RUML 2DQUH 4O2CA 4Z0XB 4EVNA 1A2YA 3MRKB 4F37K 2P44B 3C60C 4AL8H 4RIRB 3CVHA 2ZP0T 5GXBB 5DFVC 4S2SA 5MENB 5EBWA 4P23D 1RZ7H 4XVUC 4OFDA 3MJ8A 1K85A 3S4SA 1MLCA 1J8HA 4E41B 1OPGL 4RFEA 1NEZB 3A6BL 5EN2B 1AQKL 2BNQD 1NGYB 1EMTL 3F5WA 4OUOA 2FYYB 4P57B 2ESVE 2HRLA 3S36H 4MXWH 2PYEA 3BT2L 2OJEB 5F7LB 4K94L 3WIFB 5C09D 3OTTA 5I1GL 3S37L 5FIEA 4M9OA 2NNAB 4NZTL 5J3HD 3I3DA 1B0GA 2X4OB 1BX2A 2F58H 4EQ2A 3CFEB 4LPXA 1M05B 1IGJA 3HFMH 1QFOA 1WZ1H 1Z0MA 4JFZH 1YEFH 5GS0H 5L0QC 3VFGH 3WSQH 5BCAA 4HCRH 4RBPK 2RJMA 3VDCA 3DGCR 5DRXB 4PJIB 5CSGA 1PDKA 4P46C 3BN9C 4PJ8D 1J9CT 1U95A 2H8PB 2N1KA 4YHYC 3UTPD 3ARGA 2E6PA 2APWA 4MQTB 3HI6L 3NIGF 3MRCB 2FO4B 5BRZE 3SO3C 4PLJD 3IJHA 4GRLD 4M02A 4D9QE 2ATKA 2F19H 2W60A 3MRNA 1A1MB 1XF1A 1VFOA 5MI0B 5AUMA 4L8SB 4CVZA 5HHVH 3O6MH 5JNYA 1IAKA 3QDJB 3RWDA 1F00I 3UPRA 5DI8B 1DBMH 4NUGH 1I7ZB 5IEKB 4YHMH 4QXUL 2CUIA 3VXRD 4QXTA 3GSQB 3MV7B 2YD1A 3C09C 3WEXB 3S3JA 3RGVD 2RFXB 4JREC 4UTAL 1CLOH 1BF2A 2RIKA 4DJMA 5GRVL 5F9DC 4EI5B 4KVCL 1A4JA 5K59E 3OKYA 3VRIB 3PJSB 4WO4B 5LQBL 1JNJA 3RIAK 3VG0L 2OCFD 2IBGA 1PSKL 2H9GA 4HBQA 2YMXL 1T20A 2R1XA 1I9JH 3V7MA 4Y1AD 2YA0A 4LARH 1BBJB 4MDJA 5E8DH 2AK4D 1RUAH 4HFUL 3SDAA 3SE4A 2P47B 5H37G 4KTEH 1FAIH 3UJJL 3RUGB 3KYKL 2IWGA 4LVHC 4NQDD 3W0WE 4GXUN 1YPZF 1AQDA 3U4AA 5E94B 3VGAB 1KJVB 4OF3A 1QUNA 4GW4B 2PW2B 3EYUH 1AGCB 4U1IA 3GEWB 4XAKE 1FCGA 5BZDA 5JPMB 5FCSH 5HPMB 4ZO7A 1Y0LB 1KCRL 2IH1B 5IWLC 1IGCH 3KYMA 1H3GA 1OAZL 4P59L 2DTMH 3QIWD 1Q9LA 4BFBD 4BZ1H 2DI9A 2YSSA 4RFNC 5ESVA 5JW4N 3GDBA 5C0AB 3GMNB 1OTSC 2JJTC 1GGBL 3SKJH 2Z31A 4PY7B 4UDTB 3T3MF 1YUHB 3Q1SL 5DJDA 2ERJB 1X5IA 4X6CE 4OV5A 1SY6H 5C07A 2W0KA 5ERWA 4KC3B 3NCEB 2NY2B 5IB2B 1IMHC 3NZ8A 4MJIA 1QYGH 4JFFE 2D9CA 3HR5A 3EFFB 4NNYB 4K7PY 1JE6A 1QSFD 1KIQB 1RU9L 5DUMH 4NKMA 3LD8C 2Y07H 3KPSA 2I9TA 1JTOA 1Q38A 5EO0B 1LDPL 4PJCF 4H8WH 1NMCB 3QCTH 4XMKL 4D3CL 1TJHL 1WWBX 2QSCL 1FL3A 3QIUC 4G80A 1J1XL 4K3GA 1S9YA 4S1RL 1Q9OA 1J88A 2AQ3A 2A6IB 5J1TC 2A6JB 4Q97A 3Q6FA 1CFSB 8FABA 1JNLL 4CMHB 4NO2A 3CMOL 3CXHK 1UH2A 1HHJA 4WU7A 3SE8L 1AO7B 2Z8SA 5MEND 1EJ6A 3GHBH 1M71A 1QFWH 3BQUC 3HUJA 2FNBA 5DMGD 5EIIA 3DV4A 5T5NF 3OJMB 5B3JF 4E41D 3W39A 4L4VA 4OM0H 3LS5L 2G60L 3BDXA 4JFDA 5FGSA 3ARFA 3BAEH 1QOKA 4GO6B 5ANMA 5I6XB 1N6QH 4WJ5B 4OIBA 1NPUA 2EC9T 1RIUL 3I85A 2EE9A 3RZWA 3S34L 3NAAL 1YEGL 5D2NE 5ACLA 3IETA 3BW9A 3OF6A 4NQVA 2OJZL 1F02I 1D5BA 5H94B 4R26H 4LASL 3WLBA 3QEQE 3HE7A 2HKFH 3LQAH 2CDFB 3VFOB 3MLZH 3TO4B 4N0UA 1V7MH 4LBEA 1YNKH 2JIXB 2YXMA 4FQXA 3PHOB 3TH4T 5BV7H 4JRXA 2COQA 5D7SL 3C6LA 5BO1L 1EO8H 3HNSL 4YR6B 5EZLB 3D39A 1D5ZB 3MZGB 4U1NB 1KT2B 3FO2B 5E99L 1I1FB 3MRIB 5DF0A 2DIBA 3IF1A 4P23C 4TNVK 4CW1B 3DOSA 3QUYD 3IFLH 2ZNXA 3DX9A 5CBEB 2UUDH 1I1AA 4HIHA 4ELKB 1T21B 1INEL 1DDHA 1I8KA 3IB4A 2WQ8A 1RUPH 1A7RL 5DJAB 2A83B 1CQKA 3IFNH 5C08A 1MWAA 1MFNA 3SY0B 2ZCLL 4S1DC 2QQNL 5H8DA 4ELMA 2X4NB 1VACA 2NY5C 3MV7D 3QNYB 3K2UL 4OB5H 3V6ZB 4X4YA 4ZAKD 3UZVB 1QBLL 4P4RA 1I9RL 4Q6IA 3RIFF 3SGKA 2A77H 3V6FB 1MPAH 5DC4B 1RJLB 1U8PB 3DVIA 1G7JA 3P9WB 4OQTL 2VZSA 2MHAA 5F7WC 1Z0NA 4ETYA 1HCFX 4LVNB 1IE5A 1CU4L 1PGRB 5DLML 2XG5A 2PCPA 3FMGH 4G6JL 1JYXA 1KB5A 5I1DA 5CIPA 1EAPA 5F89A 1TVHB 5TE7L 3UTZB 1H3PH 5IVZA 4IS6A 2A6DB 4YC2B 2NMSA 4PJ8C 2EDXA 4IJ3B 1XGRB 1T83C 1A02N 2ZOKA 3FQRA 1U93A 4ETQB 4PLJC 4G5ZH 3DMMC 1ONQB 4GRLC 5LAXB 3OKEB 1NGZA 1MRDL 4JFDD 2BOBB 1ZT4A 4RZCA 5TF0A 1RZFH 3Q6GH 5A2FA 3T0EA 4LFHG 1NJ9A 5C6TH 3HC4H 5JA9A 1ORSA 2IBZX 3MRJB 4AG4H 5I1AB 5C0EA 1ACYH 4Z8FH 2CDGA 3F7QA 5F3HA 1CG9B 3K1DA 5I75B 3E2HC 2MCG1 4JFEB 3OPZH 3RGVC 3VXOB 1S8DB 3MRDA 4KUZH 1RQ5A 3RKPA 1JZ2A 3CUPA 4DGIH 1LO4H 5DO2D 5GS0D 4Y4KA 5K93A 3OQ3B 5IW6B 2HLFD 3NPZB 5JTWA 3GSRB 4LLMA 3SDYH 2Y9RT 3HRZB 1INQB 2NY2D 3L7FA 4PRIE 4XP5L 4JZNB 3CC5B 5KSBE 1HHKA 2Z93A 4O02H 1M1SA 1JNNH 4TUKH 5FAAA 3DSFH 2ZSWB 3PWUA 5BMFH 3D25B 1QLFB 4DKFL 2D7MA 4KPHH 1LHZA 5GZOD 2YR3A 4XI5D 2H2SD 3L5HA 3QDMA 1IGIL 5DMIL 4CN4A 2QSTA 1K3IA 2FX9H 5C0JA 1AE6L 3NFSL 4EUPA 2UVEA 3U83A 4M7LH 1X7QB 5C08D 1NBYB 4KZDL 4ODWB 4RISL 3GMRB 25C8H 2CXGA 2IPUG 1UXWB 3MZTA 1KPVA 4FTVA 4L3EE 1C5BL 5JW5B 4JN2A 3WXVH 4MZ3A 5D5MB 1Q0XL 3QIWC 1IL1B 4HUUA 3S88H 3E3QC 5FM5M 5GHWL 2AJYH 5EZJB 4NCDA 4LAQL 1T22A 4LHQB 1A6VH 5EA0L 4OGXH 5FF6B 1G0YR 5ICYA 5DD5L 5E00A 5F6HJ 4JB9H 1I1YA 4F15C 1ZT7A 2ATPA 5KSAD 1RPQA 2YC1B 5F6IC 2W0FB 3BP5B 4GMSH 5GQBA 5JW3H 1I8LC 2Z8VC 2FX8L 3E8UH 1E28B 3HS0B 1U2CA 4XBEL 1P7QB 1K2DB 3ESVF 1FGVL 2J5LC 4OSUH 2I07A 4F7TA 1L0YA 4PFEA 3MBXH 1FFOB 2ORBH 2Y06L 2FJGA 5T5NG 4KKLD 4L3CB 3T2NH 1H15B 4MA1C 2OR9L 2CUMA 4FXGB 4QT5B 4ZOBA 2J8UF 5HJ3A 4HS3A 1UZ8A 4Z7UB 5HHNA 1T0NA 4MNGE 1R5VA 4OLXL 1QO3B 5ITFA 2F53D 1IEBA 5GGTL 1NGQL 2JIXD 4WENB 2OZ4H 2YPLB 4M7KL 1EH9A 3MLSH 2HFFB 3V6OC 3T0DA 3DVFA 4UB0H 2X2YA 3BKYH 2CMRH 3MRGB 4ZOEA 4J3TA 2VQ1B 2D9QB 1S9XB 2Z8WC 3DVNA 4P5TB 3N9GH 4G6MH 4HWZB 4LDLB 3TV3H 3DTXA 4HC1H 5CP7A 5F88B 4X5LA 12E8H 3RWGA 1CDYA 5TFSL 3ZDXF 1E27B 2FEEL 1BAFH 4GW1A 1EFXA 3V2AR 1FYTA 4UT7L 5DMGC 1T4KB 2J12B 5IEHB 2NW2A 4G6KH 1S7QA 3K46A 4BK4A 3IRZA 2RAMA 4NO0B 1F90H 1HOCA 4JY4B 4U1LB 1NCTA 1F6FB 4XMPH 3I6LD 1JBJA 4HX1A 3KNBB 3Q0HA 1R3IH 1CF8H 2R4RH 4M1GL 3CLFL 3UTSD 5LGJB 1RK1B 1OGAD 3GMOB 3MJ7A 2XZAL 2ZUTA 1HHIA 2C3VA 4F8QA 1RURL 1GGCL 4JR9L 4I4WB 1ADQH 1FG9C 3SDAC 4FQLL 5DJ2A 2FECL 4JM2A 4PD4J 5KJRL 4JZJA 4WY7H 3QO1A 5L2KE 1RZKH 5CAYB 4MQSB 3DVGB 1GGIL 2R0KL 3AAZA 5I8OL 3HNTL 1YECL 4Y2DA 2EEAA 2UWEB 3RWIA 3OJ2C 2EDEA 4HKJB 3NCCB 5D7JB 3P4MB 5GSRB 2O61A 4O2EB 4M62L 3GB7A 3VWKD 15C8L 1H5BC 1KGCE 2IPKB 4X6DE 5ICZB 5KAQF 4OLEA 4P4KA 3JWOL 2AEPH 1AJ7H 1KENL 4OBRA 3IU4L 2I9LA 3G5XB 3DROA 3QUYC 4M5YL 1R5IB 2ZNWA 5J6HB 3GHEL 2ESVB 1OAQL 1P2CB 1MHPL 1AGDB 3VFSB 5HHQA 1CLCA 4PJEF 4OFIA 1YEIH 4OAWA 3MPCA 5DEZA 2FH8A 2ZUVA 4OLWH 4YZFE 4ZPTA 4Y4HB 5AZEL 3V4VH 5JO5B 4ZAKC 2EDKA 4JPIB 4P2OB 5KOMC 5FDWA 5DK2A 3RI5F 1D6EA 1T1WA 3QUZB 1A1NA 3QHZL 4QCIB 5HHOD 5JHDD 1Z9LA 3N85H 5J9PB 1FV1B 3BPNB 2R15A 4AH2A 2O26U 4PG2A 1NFIA 3P30L 5CZXD 1QFUL 5F1NA 3FN0H 4QOKE 4Z7VE 3H7BB 5BRZB 5IQ7H 3FZUD 2AJ3B 3MACH 3WUWA 3ARWA 4IRSD 4IRZH 3AU1B 1FYTD 1PSKH 5E9DA 3F7VA 3QUXB 1T5XB 2LAAA 4J1UB 3S8WA 2V2TA 2EH8L 1EHLL 5F7DB 4PRAA 5E1AB 5HGGS 4U6TA 4WWID 1I1CA 4EXKA 1RK0A 3EBAA 4Y5VA 4LP4A 3RY5A 4DQOL 5CUSH 1A8JH 3QXAA 4EBQH 3CH1B 5FK9A 4XHJD 4LCCA 2D7OA 5DK3A 2MKLC 2ARWA 1W72B 2MQCA 2A2QT 3FHAA 4KRPD 3GJEA 5D8JL 1W0WA 1CIUA 4PJCB 3Q48A 2YZ1A 2OSLA 3GIZH 4G9DA 5DO2C 3RPIB 5GS0C 2L7UA 1P84J 4XAWL 1CR9L 2HLFC 1CZ8H 3INUL 4WEBH 4MSWB 2JCCF 4M7LT 8CGTA 5EU6E 2BOCB 4AIXA 1N64H 4MDIB 2MJWA 2AJVH 4R3SB 5BVJA 4HGWA 3C6LC 4UV7L 4HIEA 4Y0GA 3HA0A 3CFBA 3W0WB 4HBCL 4L8CA 1JPSH 3VXME 2B1HH 4OJFL 1IAII 3V0VB 5SWQA 1OAYL 2OZ4A 3PE9A 3ZL4L 5E2VL 5TDNA 5GZOC 4XI5C 3WFZA 3EYOA 2H2SC 3WE6A 1NCNA 4G43A 5C0GB 4HGMA 2VO5A 4KUCD 4J2XA 1UWXK 2WMPA 2YPLD 3VRJB 3MJ9A 4HC1A 1ZVSA 4U3CA 2QR0B 5JMRA 5K33A 1KEGH 2QKIB 3ISWA 4NZUL 1KJ2H 4P5TD 4ZFGL 4P2CG 3LRGA 4C56B 4GT7A 3REWA 4J8RB 1OSZB 4PJ7A 2I5YH 2ZPKH 5FCUL 3T04D 5EO1B 2YD8A 4X6CB 5HPOA 4LCUA 1N3NA 1JGUH 4DVBB 1WK0A 2I26N 1MLBB 3Q3GB 3QUKB 3RHWF 4RQQB 4U1HA 1DQQB 3ZTJG 2P5WD 3D9AL 1U8QA 2EIZA 3GK8L 1TCRA 1MNUL 1DLFL 5KSAC 4JFFB 3QFDB 4K9EL 1ZLUH 1WC7B 1S3KH 5F9WC 1XR8B 2PYFB 5I1LB 1HHGA 4NN7C 4AQOA 3RNQA 3TBYB 5MHSD 1CL7L 4YDJB 3FOLA 3RY6C 1SBBA 1XF4A 3O2WH 3CFJB 4ZFZA 2R8SL 2EEDA 3U30B 4ZOCA 3VFWA 3QRGH 4BSJA 2EH7L 4KKLC 1K8DB 2R2HB 4GS7B 4OZHA 4HSQA 3ARDB 1KCUL 1DN2A 1JHKL 2VDML 2ICEB 4AQ1B 3PWPB 1L0XA 3WIIH 4WW1B 2ITCB 1R3HB 3O8XB 1RIHH 3TT3L 4JO3H 1YJDH 3PP3K 2X4RA 2VUOA 2NLJB 2EYRB 3ZSTA 5DD1L 1UZ6F 3TT1L 4KMTL 2EDHA 3U9UA 1UVQA 2WWKO 1X5XA 2I60L 5IBTL 1LWRA 1DVFA 4DZ8A 3QH3A 4XNZC 5IV2B 2HP4A 4RGMC 3V7AE 4QHMB 1NUGA 4LCWE 3MBEA 4KTDL 4PP2B 2ARJA 5IFJA 5GGSY 3V5HA 2VDLL 4BFIB 3DI3B 5DDHB 2DLHA 43CAA 3DX8A 1MRCH 4X0KA 1IBGH 4Y4KC 2P46B 3QHFH 2DQEL 3CFDB 2QSQA 5D1QB 2X4TB 1U8IA 5KAQG 5F72S 1BFSA 2W38A 5GRWA 2BNUA 4PR5B 1XIWB 2DICA 2VXVH 4GLRI 4X9FA 4C4KT 4H8WC 5FXCH 5KSUA 1KG0B 1INEH 1OF2A 3HZVA 2VDQL 1NC4A 3SDCA 4HMCA 3WKMH 3JWNC 3GI9L 1U6AH 5IM7A 1Q9WB 2YPVH 4G9FA 3KYNA 4TOYH 3UAJD 4F37F 2RQ8A 1JNHA 3VWKC 2BRRL 2IEPA 3EYSH 1V7NH 4IOIB 3WNPA 1UKTA 5TPWL 4D9QD 3EDJA 3PHQA 5HYQB 4E0RB 2BC4B 4Y16B 2VH5L 3NIDF 4YXKH 5T3ZL 2WLZA 2A38A 2AQ2A 3GGWB 1S7SB 4EDWL 3VWJD 4TPRL 3PL6B 1HIML 3NTCH 3C5ZD 5GISL 1AKJB 4LLDB 4U1MB 4LPWA 1LE9A 1CFTA 3IXAA 3RZCB 3QI9D 3JXAA 4FQQA 3HR6A 3FFCE 1JYNA 3CZFB 3WHE1 2DDQL 4ZNCD 4M1DL 5DUPL 3EOTL 4Z95H 1Q1JL 5GGQH 4JFXB 1Z3GH 4LP5A 2N56A 1RVFL 3LQAC 3QO0A 3AXLB 1D5IL 3WS3B 4PGEB 1NFDE 1QSEE 5JQHC 3C2SA 3UO1H 3I6GA 4JPWH 5BV7C 3WNOA 2V7NA 4C4KO 3W2DL 5C0DB 3X14A 3V95A 4D0CB 3VGEA 4JDZA 4JRYD 1I7UA 5C92A 5L88L 2E7BA 2XTLA 2C3XA 1WBYA 5B38B 3O3AA 4XB8A 4K7FA 1HQ4B 1HINL 5CZXC 2ADJA 1O5DT 1CFVL 2HJLA 4Z5RA 3IT8D 3HZMA 5TQ2L 1DVFD 1B9ZA 4JKPH 1DN0B 2P5EE 1J12A 1PYWA 4IRSC 4XAKD 2D7NA 1OB1B 2W9EH 4UUJB 4A6YB 2Z4QA 1D5MB 2OTUB 2UZIH 2DQTH 2BHYA 4ERSL 1UKQA 1QD0A 5CBAB 4YE4L 4L3AA 3QFJA 3MXVL 3WFEL 2NX5E 1L6ZA 9CGTA 4LSQL 1KIRB 4JJ5B 2YUWA 3IJSA 1F4WH 4OI9A 5D1XB 3S35L 2VAJA 5ILTH 1QNZL 1RUKL 4XHJC 1Y6MR 4QY8B 3MV8D 4U1SA 5CFHA 2BVTA 1WGOA 2YK1L 3CD4A 5KOVC 4KRPC 4XPTH 4EIGB 3IDGA 3RIAF 1AXTL 1YY9D 3MMEB 4PRIB 1FE8L 2BVPA 4L29A 1A9BB 4DVRL 4JFFD 4RISH 2V9QA 5GS1C 5JLZA 2ED9A 5IR1B 1JGLH 1P4BH 3OZ9H 1NCBL 1CS6A 2H26A 5KVEH 5CHNA 7CGTA 3FT3B 3S3SA 1P7KA 4O9HH 1S7WA 4F3FB 1JGVH 4NKOA 2Q76B 2HG5B 4P4KC 1AFVH 1ZXQA 5C0RL 1T0MA 5L2JB 1RI8A 1C1EH 1I1RA 2DLFL 1JV5B 1JWSB 3S5LG 1BLNA 4WHTB 2DYPB 5KG9B 4G7VL 2D7QA 1KJMA 3HPLA 4GKNA 3V9FA 5E5RB 1BMGA 4YDKL 2XRAH 2VXUH 5T1LB 3GSOA 2X70A 4JM4H 3WFBL 4L3EB 5BOPA 4KDTA 2Q86A 5GRVK 2C4FU 4ZUSB 2QADD 2WUCL 2VDNL 3K80A 4X6BA 5TQ0L 1XGUA 4EKXA 2IBZY 1JGEB 4QRPA 3AS2A 4ZDHA 5IESL 3BD4A 4XZUB 3FTGA 4YHNA 5B8CC 3A6CH 1MVUB 5FYJL 2X41A 3DO7B 2FD6L 3IXTA 3QT2A 3GJFH 5DJ8B 2DS4A 3ETBF 2VDOL 4F57L 2ICWB 4UZGA 1KN2L 3LHPL 4U4BA 5D2LE 1K5NB 1IC4L 5C86A 3IDUA 2FLRT 4DGYL 4WNQA 2ZOLA 4M8VA 1C8PA 3T77B 3MLYL 4RGNE 3G5YB 1TZGH 2AK1L 4Y19B 1J5OL 5HHXL 1XIWD 1JHLH 2IAMB 3S6CA 2HT2D 1A6ZA 4LSSL 3C2AH 3QEQD 3N1FC 4J3UA 1W72L 1XF5B 4PS4H 5BS0E 3PGCA 2A74B 1D5XB 3NCBB 2B0SL 4MNGB 4HG4K 4E42A 4P99A 4KJYB 3PHSA 2VZUA 3BP6B 4O58L 5T1MA 1LEKB 3IDXL 5DVNA 1UM6H 2AEQH 1UA6L 5J11C 2XZCH 3FRUA 2EO9A 4OQTA 4FQCL 4J3VA 1AXSA 2JB6A 3JTTA 3L3OA 1IAIH 4MAYB 5EBMA 1BQLL 1EEQA 3GMLB 4G8EB 3P4LA 4ZS6D 3ZKQD 5D7LE 3O4LA 5D93B 5I8OH 4Q74A 2VITB 3DARA 3MLUL 3FB6B 4Y16D 1BFVH 4HLZG 2E6JA 1U8KB 4DTGH 3UYOD 2C3GA 5DMJB 5JR1L 2X1WL 5DJZB 3BIKA 3G5VB 3TBTA 1FG2B 4LVOB 3QQ3A 3C5JA 5J6GB 4GMTH 2VDRH 3TPUB 3LKPA 1GRWA 5L2KB 4MCYA 2BMKA 4EOWH 3R0MA 4NZRH 1KTLA 4JHAH 4RIRA 5I18H 1QKZL 3VFPB 1FLRL 1WQVT 3PGFL 1R24B 3MXWL 4QRSB 5F9OL 3HCVA 4XVSL 4ZO8A 1WIUA 2XZQL 1FFQA 4ISVB 3DIFB 1ZHNB 4KJQC 3GKWL 3MFGB 1NEZA 1A7NL 4N0RA 3VGHA 3UAJC 5EN2A 4E5XB 2DIJA 1G9NL 1NGYA 3TYFB 3TFKD 4Q9QH 1CTNA 4MQ7B 4ZXBB 3MODL 4JY5H 2VYRE 2FYYA 5T1KB 4TNVF 4P57A 5DHVB 2B4CL 3LMJH 1LQSR 4HXAH 3IFPA 1AP2A 5HGHB 4PYGA 1KSRA 4PJ9D 1OAUL 2FH6A 3TO2B 5KTEL 2YOCA 4HK3J 3RVWD 2OK0L 3ZKSD 1T1XB 4GBXD 3VWJC 5E08H 2NNAA 1CGVA 3T2QA 2X4OA 1ZHLB 1MI5B 3C5ZC 3SO5A 4WW2F 2C4XA 5HBBA 5EULV 1I3GL 1EGJL 1M05A 3SQOL 3OR7B 3OKMB 5FYLE 4JQXC 3QI9C 3OHXB 1BZ9A 1R3KB 5K9JH 4XXCA 1NDMA 1RZKC 2GQHA 2LVCA 2BY0A 3MA7A 5IMKB 1ZGLP 5DRXA 3ARSA 4XVJH 3U82B 3IDYC 2H8PA 3W9EB 4OCRH 1BBDH 3V4UH 4KROD 3MRCA 4HIXH 2FO4A 2NXYB 1CXFA 1XCQB 2V17L 4R90L 1DBAL 4QOKB 4Q9CA 5JW4R 1A1MA 4Z7VB 4D9LH 4GLRH 1FL5B 4U6VL 1EJOH 2R0ZL 4L8SA 4ZD3H 4HUWA 4YDLC 1FGNH 5D8JH 5E5UB 2ZCHL 5DI8A 1I7ZA 4NQEA 1BD2A 1OSPH 1CGWA 3CK0H 1DVFC 3K4ZA 1KEMH 5LGHH 3GSQA 3WEXA 3SCMB 1HZHH 2DYPD 2RFXA 1QRNE 5IIEA 4EI5A 2WLYA 1GPOL 3TCXA 4UV7H 5ECJE 3KPLB 3VRIA 3PJSA 4WO4A 3NFNA 4LRIA 5E2WH 5GGTA 3CFIC 1T03L 4BH8B 1OAYH 5FM8A 2C1OB 4O00A 4N8VG 2PR4H 3IDNB 4NO3B 4FZ8H 3O11B 3O0RL 3HUJF 2C3HA 1BBJA 3DUSB 4HJJL 1JUFB 2DM4A 1OP3K 4XP6L 4RDQF 1GGUA 3ARBB 3VI4E 2GY7B 3D3VD 3L3HB 2E3VA 1MJJB 1IFHL 5E94A 4N8PA 1KXQE 4P9MH 1DBJH 4GW4A 2PW2A 1AGCA 4MA7H 3ARUA 3VXMB 1IKFH 5JPMA 4Z7NF 5HPMA 5TJWK 4F7PB 2IH1A 3MUY1 4RAHA 4Z7QF 3K1KC 2V5SA 4YXLH 1UADC 5BVPH 5BW7A 2AV1B 5IVXF 1BZ7B 2HJFB 3GBMH 5C0AA 5C6WH 4KU1A 3GMNA 4FQPA 1NEUA 3B8SA 2VN4A 4PY7A 1J1OL 4ZUUB 2CQVA 3N1QC 4HHAB 3KLHD 1S5IH 3DXAA 1FNGB 1QRKA 1DANU 3CX5J 2MWCA 3H2WA 2JLLA 2E7CA 1OARL 2PTVA 3M8OH 2DAVA 5IB2A 2QADC 3I3BA 3OR6A 1LILA 2KL6A 3UTOA 1SYVB 5D72L 2XFXB 1PVHA 2IMNA 5TE6H 3EFFA 4NNYA 1AR2A 4GG8B 5EOQH 4A6YL 1DBBH 5I30H 4U1GC 4K3EL 4J3XA 5EO0A 3VXNB 3ZDYF 1II4E 1KLFA 2AI0H 2R9HD 3L95B 5EUKB 3DGGB 5DJCB 3ES6A 3HAEG 1EEYA 2YA1A 5D2NC 3BMWA 2PTTB 4LOUD 3UBXG 1VA9A 5E8OB 2HT2C 4O4YL 5F9JB 2A6IA 2A6JA 5HVWA 3ILPB 1CFSA 4OT1L 4C57C 3DI2B 3RL1B 4NQED 4K3DH 4FQIL 3MGTB 4K2UH 3SDDD 1MAJA 3U4BL 1CBVH 3U79A 4U6HB 2J4WL 4U1KB 4I3GA 4QHNB 1KGCD 3W81A 3L3JB 1KTRL 4CU7A 3CSPA 1JTTA 3O2VH 2JB5H 4TSCH 5DTFA 2GITB 4UOW0 3JV5A 4X9IA 5KZCD 1EK3A 1VFBB 4XCYB 4NO5B 1F4XH 4WJ5A 3BKML 2XXCB 4GXVL 3NCJL 2A73A 1NCWL 4TYUA 4XH2A 5FGCE 5JUEL 1L7IL 1RZJL 3GFUA 4WGWB 5FO7A 3T0VA 4KI5D 5K9KB 3F12B 1QQDB 3D2UA 2CKBB 3L5WB 5EIVA 1S9KC 4M7ZB 2ZUXA 3SPVB 4KV5E 1FN4B 4F80A 5JDSB 2NTFB 2CDEB 4XPBH 1Z9MA 2NPLX 1OTTD 2HWZL 1UJ3B 5KS9E 2XA3A 3O9WD 5EORH 5FUZH 4I2XE 2FX7H 4AEEA 3QIBB 3VFOA 2CDFA 5D4QA 3TO4A 3IYLW 5IUSA 3FT2B 3T0XA 2GJ6D 5FM5O 3ET9F 2YD9A 3LN9A 2BVUA 5C0IB 1PFCA 2ZKHH 2MTPA 3X17A 5GRJH 1BZQK 1A7PL 3D85B 5CD5D 4ZTPL 4KK5D 5GGVL 3ROLB 1MCEA 4KJPD 1KT2A 1YJDC 3FO2A 5SWZE 1I1FA 3MRIA 2NY6B 5DT1H 4P9HH 5DRNB 4CW1A 3RX5A 3OG6B 4ODSH 5CBEA 2GTZB 4HXBL 3CPLB 5DURB 4QOKD 4M1DH 3EOTH 4UQ2A 2CIIA 2NY0B 1A6WH 1MRFH 1U91B 2HJKB 3V8CA 3KPOB 2A83A 1YEHL 1VHPA 1VPOL 4JQIL 3SDXA 3V0WL 2ILLA 3GMMB 4FFWD 2X4NA 1AIFA 3QNYA 4HPYL 3SCMD 3V6ZA 1DL7L 4KKAD 4PJ9C 4TVPE 1FIGH 3RVWC 4L9LC 4XWGH 4MJ5B 1N5YH 1SJHB 4GBXC 4F58H 1T89C 1RJLA 3ZT7A 2DKMA 4EN3A 2QQKH 3QQNA 3R0NA 4OUUB 2YKLL 3ZKXC 2BFVL 1NFDB 3FQUA 4WEMB 3DSNA 3DX6A 5KW9L 1TVHA 4ONFH 3P4NB 4N8VB 5E7FA 2A6DA 2O5XL 4K23H 1NMBH 2VXSH 5FGRA 1MFAH 3KPQB 1JPTH 1S7VB 5EU6D 4GAJL 4M93B 4KROC 3TVMB 5DQ9B 4ETQA 3G9AB 1ONQA 1RHHB 5LAXA 3OKEA 5FHBH 2BOBA 4YQXH 3VFVB 3D6GA 5JXAL 1CE6A 3FT4B 2YPKB 2FR4A 4F7CB 1CFQB 2HFGL 2DKUA 3MRJA 4BSVA 3GNMH 4FXLA 4WHYG 4CL7A 3EOBB 4GUPB 4RDQG 4G3YH 5M95B 3UYRH 1CG9A 3D2UD 3PABB 5MEQB 1G6RH 4DKEH 2IGFH 4JFEA 2NX5B 4MMZC 3VXOA 1S8DA 2XN9E 2BDNL 1MH5B 5CSBA