4P5MB

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
199
Chain Sequence
QAYDGKDYIALKGPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 43
structure length 199
sequence length 212
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5mB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5mB01
4BSWB 5CEXB 4JLRA 5KSAC 2B1HL 5T1LD 5E6YA 5BXFB 5EB9A 1WCBA 5HHMD 1TZIB 4BK5A 5EIIB 4GW4B 3TZVA 3LV3B 2GHWB 3TO4A 4JM4H 1F58L 4LSPL 3UC0H 5CP3H 4PTTA 4E9LA 4L9DA 2YA0A 3VFTB 4PJ8C 1OTTC 1CLCA 4MJIE 4PTTB 3N06B 2APXA 2NXZB 3ARTA 4OCSL 2NTSP 3OXSA 1OOAA 5TE4H 4PGBA 3TESA 1R5VA 1OTSC 3KNBB 1BIIA 4P4KC 3RBGA 1JZ3A 4RMSA 1LK3H 4ONGH 4PJAE 2HVJA 4ODHL 4WEMB 5EU7C 4M7LT 4H1LB 1FZJB 1AQKH 3EYFA 3QEUA 2R0WH 5JORB 1FNAA 1V05A 5BVJB 5FAAA 3I02B 2AK4A 2CDEA 4MJIB 5I1DB 5D71L 1QACA 5K93A 5I6XC 4UBDD 3SDCA 4YPGB 2YN5A 4G6KH 5MEQB 3GI9L 5H35B 3P0VH 4JGJA 3GMNB 4HJ0D 2PYEE 3I50H 2CXGA 3A6OA 3G6JA 1J8HA 4MS8C 5E2UL 4AIOA 2XFXA 1Q38A 1WQVT 4NHCL 4PRDB 3BW9B 1JGLL 4G43B 4Y5XA 5IVXE 3QH3B 4X6DE 3OJ2C 4HUVA 1DJSA 4LCCA 3CXDL 2BNRD 4NO2B 5L6YL 2RGSA 3MLYH 1EPFA 5TQ2L 4UIMB 5E08L 3ECBB 4ODUB 2H26B 3KPQA 5TGBB 3QIBD 5CIPB 3C5ZB 4O58H 1CXLA 3P9LA 3SE4A 1V3MA 5DC4B 1HH6B 3OR6B 4LLUA 2F5AH 4PB0H 2F58L 4MAYC 2AI0L 1WT5A 3BPOB 3DGGB 4PJHE 3NN8A 1JZ4A 1I3GL 4FOMA 1LE9A 3LSOA 2BVOA 1FYTD 3DHMA 3TIEA 4U1KA 3QNXB 1CFNA 3VG0L 3HR5B 4JM2B 1C12A 3MR9B 2XWBA 4AQ1B 5F7MC 4GW1B 3ZTJG 3OKEB 1RZFH 1JF1A 1YZZA 1LEKB 1M71A 1FC2D 5DSCA 4URTB 5E4EC 1CFQA 1SJHA 2BVEA 5BO1H 5I1KH 1DCLA 1U91A 1EFQA 4WDIB 1N2RB 2X4UB 4TSBL 3VXOB 4NUJB 5D1ZC 3DPBA 4GRMB 1NCNA 4YEEA 4ORGA 3MXWL 4P23B 3TT3H 4D9RD 4GKSA 5K33A 1DFBL 1G9NL 4MNQA 1VGEL 4ELMA 4YEFA 5JXEA 3IDMB 3T0EC 1A7OH 3FB8A 1SM3H 1KN4L 5BJTA 1CE6A 4AENA 5ADOL 2HKFH 4JO2H 4QHNA 2FHFA 4S2SB 4DKEL 2VWEE 3HRPA 4JFDA 2NQCA 4TTDD 3S36L 1IEHA 4U1NB 4NNPL 4JO2L 4HS3B 1ZLSL 3WYRA 3HAEG 5DMJB 1C5DA 3F7VA 1BQHB 3EYOA 4XNMB 5GJTL 1B88A 1JWMA 3RNQB 1OP5H 5FKAB 4Q9QH 5EBMA 4TVPL 5EZOL 3L7EB 3MLWH 4HMEA 3SO3C 3LRSA 2Z91A 2HT3D 1D6EB 3HTLX 4QTHB 1UH2A 4U33A 1NSNH 5BZDA 1QSEB 3VG9B 1MJUL 5E8EA 1L7TL 5EZOH 4DGYH 1RZKC 5HGDB 4LGRB 1L6ZA 4HS8L 5FXCH 2HTLC 1T4KA 5BZDB 1UC6A 1L7TH 1AGFA 4NN6B 1QBMH 3B8SA 3PGDB 2CK0L 2SEBA 5HGAA 5IEHB 4GS7B 4AEIH 5E94A 3IGAA 4ISVB 5GZNC 5D5MF 4FRWA 2UZIL 1U8MB 3QEGH 1AD9A 2EIZB 4I1NB 3ULUH 2XACC 1IQWL 1J1PH 1VGEH 4Z6AT 5HPMB 2E5EA 4QEGA 1NAKL 3GK8H 2P5WE 3WL9B 2FEEI 3R06B 3QJHA 3ARGA 5LVEA 4P23A 4BKLA 1LMKA 4NJ9H 3P30L 4IEFB 3OAUL 4H5SA 4OM0L 1BPVA 4DKAA 1HSBB 3OTTA 3T77A 3VXRA 5JIKA 4XMLL 4AK1A 4QCIA 4X7EC 1GZQB 4R7NB 5I30L 1OHQA 2J5LB 5HGAB 1OWRM 2GSGA 4ZUWB 3RZWA 4L3EB 1G1CA 1G0YR 3FO9A 4YQXH 1U8IA 25C8L 3I6LD 4LQFH 2G2RB 3WFBH 5HHOD 3D0LA 5B8CA 2ZCLL 3BGMB 5SWSA 1N5AB 4RRPG 4Z7OF 4Z7WE 2AJUH 1K9TA 2Z4QB 1A0QH 2G5RA 1WWAX 25C8H 3QHFL 5I1AB 1KJMB 2BVOB 5EBWA 2CK0H 3EOAA 4I77H 1KLUB 4U6VL 1SY6A 4QTHA 1UQSB 4OD1L 3DGGA 3G5XB 4M7JH 5BW7C 5GPRA 2DLTA 1G9MC 5C86A 4O5LH 5F89B 1N59B 1QUNA 3ARED 1NH6A 1LO5B 3RP1A 5HPOA 2R2HB 3MRGA 3O9WA 3WUWB 5CSGA 3VXTB 5CGTA 4EVNB 4LQ1A 2CUHA 5KN5B 1T89C 5CEYB 3QUXB 1KTDB 1A4KB 4WVRA 1B9ZA 1FFPA 2BCKB 5GRJL 4CW1B 2EZ0D 4OZIB 4NYLA 2EH8H 3IDMA 3OAZH 3RI5F 2NY6C 4JFHE 3IFOB 5I76A 4ZFGH 1C7TA 5JXAH 4JFDE 4OCRL 3B9KD 1KN2H 3H9SE 4JEGB 3FO2A 1BVLB 1WICA 1F6AB 3VRIB 3PIQB 4K55A 2OP4L 2RAMA 1XCTB 5DVNA 1FNLA 3V6OE 4ORGB 3IFOA 4HKXB 3STLB 5DK2A 1HXMA 4U2ZA 4TSCL 1H5BC 2IQ9H 4OGAD 3CCHB 3L3HB 1VFBA 4AZ8A 1D5ZB 1TTGA 3W0WA 5FK9B 2NYYD 2QV2A 4PJ5E 4MQ7A 4ETQB 2GJ6D 1I7RB 2UWEB 3PWUB 1ZTXL 4K9EC 2OTWB 3F6LA 2P8LA 3CAFA 4GFTB 3JTTA 4GW1A 4PJIA 3ZDZF 3KNBA 4NPYA 1IBGH 4JFYA 5IV2A 2XA3A 3L3JB 4JGUA 2VLJB 4H8WL 5IB1A 1UKQA 4OUUB 3ULVE 1FPTL 3MGOB 1FCCA 4JPIA 4JREB 4L3AA 1HSAB 1CD0A 1DSFL 2VLKE 3OHXA 2VUOA 4HUWB 5JHLH 1EX0A 1I8IA 5EZIL 3KPNA 4G5ZH 3RL2A 2PTVA 1PKQB 2Y6SC 3BEWB 3QIUB 3MV9D 5HI4C 1J8HE 3T0ED 1A64A 3MMEA 3WDIA 4D2NA 5SX5H 5B38G 1CG9A 3DSNA 4D8PB 4XGZA 1AJ7H 2EH8L 4XNQA 7FABH 5CD3A 3ARGC 4JJ5A 2BXYA 4YR6B 6FABL 5HYSG 1BQSA 5BS0B 1S9XB 4KGJA 5KS9E 2FGWL 1BOGA 4BKLB 5FO7B 3UBXG 1MCWM 2XFXB 4U6HB 3ARGB 3QDMA 2YOCA 3QIWD 3SQOL 1MWAL 1U41A 3CGTA 4NKOB 1BWWA 4YZFE 1FFNA 3BAEL 3OSKA 2X4QA 3WFEL 1BFOA 1RULH 5C2BL 5K9OB 4NQDA 4CN1A 3IRZA 5DVLA 4I0PB 4GW5A 4YDIL 1P4IL 5IW6A 3MLSH 3EHBC 3LRGA 4Y4FA 2XXCB 3EYFB 3QEUB 3PQYE 4F7TA 3INUL 2J4WH 4DEPC 5D4QA 3EYQC 3O2DH 4LOUD 2P4AB 4ZDHB 2SEBB 2VAAB 3LH2L 5KSBA 5GGTL 4DVBB 5EO1B 5ILTH 1KG0B 3ARFC 3QIBC 3F7PC 3SCMA 1DSFH 5EO9B 4MWFB 5A3ID 1J86A 3Q3GB 4N0RA 3U7YL 2YD2A 2XY1A 5JW5B 2VLMD 5L8JB 2W1NA 4DZBA 2CGRL 3CVIL 4S0SD 3MOBH 5HHME 3DURB 2QQLL 3LB6D 3MLVH 5IB1B 4WW2C 1EFXA 5FUOH 5D1QB 4QRQA 4JDZB 3A6BL 5JLZA 3IVKA 3RWHA 1T7YA 2QQLH 4WW2B 1YNTA 1EUTA 2G5BA 3GMQA 1HHHA 5IT2H 3QAZC 1RSFA 3WHXB 4IHOB 3ZKNC 3CLEL 4PRID 1F4YL 1UGNA 4HPYL 4K3JH 3UTTD 1T0PB 4M8VA 3NACH 4OIAA 4D9LH 4I18C 4I48A 1Z6JT 4UDTA 4XPGH 3QJHB 4XPAH 5KSBF 3DROA 2M26A 3WSQH 3V8OA 1A4JA 1WUNT 1P4IH 2QADB 2V17H 3ZDXE 1OTSD 4TNVF 3T4AA 4J4PA 4P2QA 2EDFA 1S7VB 4LRIA 2HRPL 2FIKB 2H3NA 4WU5A 3QCTH 5DHYA 3BN3B 4P3CH 3FMGL 4PS4L 2X09A 3BP4B 3OJDA 3S37L 2APTA 3D3VD 1NFDF 1A3QA 4XP1H 3DXAD 1JF1B 4Z7NF 1FL5A 3EZ8A 3OKEA 5CWSA 3QBTB 1YNLL 5F89A 4FQJL 5D6CB 3TBVA 5JOFB 2CD0A 2XTJB 3CVIH 2VXQL 2EEBA 1N26A 4HWNA 1U8NA 1N64L 4IJ3B 2YD1A 4CU6A 3LSOB 2ID5A 1KC5L 1A1OA 4JZNB 3RFZC 2D31B 3FB6A 1T22B 4E41D 3FQNA 2O5YH 4F7EB 2WAHA 5J06A 3MA7A 4LLUB 2HFFA 5IT2L 3D2UB 3DV6B 3VXQA 4XT1C 3S3SA 3MRFA 1U3HC 3GJFB 1KLGA 1Q9WA 4OLWL 1J88A 4LCCC 2EIEA 2CIKA 1PSKL 4IOIB 3O3BB 5MP6L 1RPQA 1ZA6B 2WBJD 5IGXH 5FOBA 3VH8G 5GS3A 1A8JH 4R2GB 4XP4L 2EDOA 4GMSH 4AENB 2I27N 2JTDA 4JZJA 1INEL 2PR4H 4WUKL 2B2XH 1MCWW 2FX7L 3H3PL 2ZSWA 3VFRA 1E4KC 1DQLL 1VEOA 1K8DB 2NLJB 4X6EA 4HBQA 4R0LA 1RU9L 2R39A 3DXAE 3P11L 3VGDA 2Q7YB 5CEZH 4GRMA 3MUGB 2VERN 2YPLB 1NLBL 1JWSA 4QGTA 3NPSC 4ZXBD 2C3GA 3TNNB 3L7FA 4GLRI 2ZUXA 4NJAH 4M00A 5KAQF 3UCRA 1K85A 2AK4D 5DMGC 1NLBH 4C57C 4PJHF 3KLHD 2HG5B 5JORA 2YZ8A 4NJAL 4H1LA 1T1ZA 4ZS6D 2K7QA 3LZFH 3O6LL 5BRZA 1KLGB 3EJZD 3VMNA 1UCBH 2PN5A 3MRFB 2Y72A 1B4RA 3DXAB 5JO5A 1R5VB 5D7LB 4ODVL 4WEBH 1KCKA 4R8WH 1LE9B 1AE6L 1F4XL 1IJ9A 3BT2L 4OLUH 1AO7E 3IDNA 4JPWL 1SQ2N 3TO4C 1CFTA 3PHOA 4G8GE 1VERA 1U8NB 4U7KA 2E7LA 1JNLL 5DVMA 3QUXD 2NNAA 2IH1B 5EO9A 1I8MA 3SKUD 1RV6X 3ZMRA 5GGQL 4GRWH 4YHNB 5ERWB 1LP9B 3O6FC 1NBZA 4NKDB 4PV9B 3U0WH 4F80A 4J3SA 1INQA 4WUKH 1D9KC 1EVTC 1WISA 3SOBL 3GUTB 3BRDA 4LGSB 3VXME 4NZRH 2NX5D 2BMKB 4K2UL 4RX4A 4P46C 2OXGA 4MJ5B 3MV8E 4AYFA 1XGRA 3MUY1 2AI0H 3UX9B 4JFDB 1HH9A 2P5EA 3MRDB 3P0YL 3P11H 4LRIC 1KIRB 3HMWL 3KAAA 3VFNB 1NAMB 2QSTA 1A4JB 3SGJC 1I1CA 1HKLH 1NCDL 4U1HB 2YZ1A 4NQDE 5A2LH 4J7RA 1MEXL 5EUOE 3HRZA 5FO7A 4GQ9L 2A83A 3UTSA 2EO1A 3MV8B 5D2LE 1MRCH 3MODH 3DX6B 3HNVL 5IEKB 4G6MH 1UACL 5D2LB 1WZLA 4G6FB 5KS9A 4Y2DB 1OP3H 5FYJE 3RL1A 1W0YT 4G6ML 3SEPA 2FH8A 3OXSB 5D1QA 2FD6L 5F7EH 2NZ9D 3C60B 5DGQA 2J12B 3LS5H 3BQUC 5CBAA 2D7MA 3GM8A 2GK2A 4LARH 1OWWA 2VDLL 3VFTA 4Z7WA 1HSAA 1LDPL 4PJ5A 3PWJB 1C1EL 4JFFE 4X99A 4HAFA 4LARL 3FFCA 5C08A 2DLIA 4R4ND 1ZT4A 3WDJA 4UIKL 3I3EA 1DBJL 4OT1L 3RWCA 4YGAB 3MGTB 2YPVL 2KQNA 4QXTB 3ZYZA 2R4RL 4CMHB 1GHFH 3S35L 3EFDL 3ECBA 5CJOL 3ULVD 4Z95L 2EYSB 4M6NL 4NC0B 1EO8L 3RDTD 1CGSH 2ORBH 4MQ7B 2EIBA 1LILA 1G7LA 4XH2B 3QXDA 4ZS7L 1Q9LB 5B4MC 1F6FB 4HG4J 4LCWA 5SWZA 1HCVA 1F8TL 3ZSTA 3MA9H 3IJYA 5IF0B 3CFJB 3D48R 4XVJH 1MSPA 3KYNA 1F2XK 5E5MA 4UNUA 1CDHA 1NC4D 4L8DA 4H25A 1OAQH 3ALXA 1HZHL 4HIJB 4KVCL 4AEFA 4LVEA 4FZ8L 3MO1A 4HHAA 1UENA 2OL3B 4PV8A 4DGVH 1OAQL 3T8XB 3VFSB 4DVRH 4EUPH 3GGWA 1QNZL 2XN9E 5HHQA 1ES0A 2JIXA 3UXFA 1CK0H 3ILPB 1BBDL 4S1QH 3N1GC 4F33A 3PL6D 4UTAH 5HVWA 5L7XH 1PKQA 3CC5B 5FECB 5ESVB 1EMTL 3FOMB 1BIIB 1QSEE 1D6VH 1YMME 1F11B 1FRGH 2ZJSL 3GSWB 4N68A 5JW4N 1EMTH 3V9FA 4P9HC 4PJXF 1A1NA 4WI3A 2ZOLB 2A6KA 4ZTPL 4JN2A 2BSRA 3RIAF 4ODBD 4X4MA 3IDJB 1P7QA 2C5DC 3KVQA 3ZE0F 1CLYL 4M6OH 2H8PA 2I9LA 5KVEL 2O26U 2GFBA 3WFBL 4Z18A 3TZVC 2OR8A 4P2RB 5E00A 1H15B 1NLDH 3SHSA 3CCHA 3L3HA 1X4YA 4KTYA 1WWCA 5E0QA 1Z0NA 3DSFL 4OCNC 2ITCB 5H8DA 4CNIA 4Y4FD 5KANG 5ICZB 5J13C 3HAEA 1CXEA 3FO2B 5FYLE 4LLMB 2YUWA 5D9SA 1Y6KR 3RPKA 5IJKA 4IIQC 1V7NH 2YBRB 3LOWA 4U1JA 1B90A 3VFUA 1BLNB 4JQXC 2V9RA 2HJKB 4IIQB 1RZKH 1WBZB 3B43A 2WINA 4YFEA 5DUBB 1NCAH 5C0EB 3VD9A 1FP5A 4FQCH 3G04B 3T2NH 3EAKA 5E94B 1LEGB 1VKXA 3B83A 1OTUD 1EFXD 1B2WH 1FIEA 2IAMD 4KKCD 4X6DB 1H3WM 3E6HB 4L8BA 1L9NA 4NNXB 4FHBD 3CVHL 1XGPA 4QXGH 4PRHD 2IQAB 1N0LA 2VLKA 5F7KC 4MD0A 4J2XA 1F5WA 1T5WA 4NO0A 2BX5A 3QEQB 4LCUB 1E4WH 1A9EB 3IFLL 1U3JA 1Z0MA 1F3DH 1WIUA 2RBLA 2A6JA 3BKYL 5CSZB 2ICWA 4RNRA 2YWYA 5DQJB 3FN0H 1EGJH 1DP0A 4OV5A 3MBEA 1T03L 4Z8FH 3OF6D 1BQHA 1XGUB 1YYLH 1IGTA 3W9EA 4PJ8D 2WINB 4M93B 3TYFA 1T03H 5E4IA 1FBIL 1U6AH 4U1IA 4Z7VA 1CBVH 3L3IB 1S5IL 4P2OA 1CLZH 3VI4F 1DVFB 1A3LH 3RWDA 4HIIA 2FLBT 3CMOL 4D0CB 5J4MA 4LBEB 5E8DL 4ONFL 3MV7B 2HTLD 1T1YA 3U9PH 4L29A 4XCFH 5BV7H 3KR3L 2ZCHL 1IGYA 3EYVA 2AXFB 5E8DH 4M5ZL 4J3TA 4B7IA 1T20A 3MBXH 5D96B 4LSQL 3BE1L 3GJFK 2J2ZA 1W72B 1R3KA 2A6DB 2BJMH 2APBA 5MEPA 1TQCB 4KQ3H 2BY2A 3PNWB 4XHQA 5FGBA 2JLLA 1FFOA 3I85A 3PGDA 3P40A 5C0AD 4X4YB 2AJVL 5IBTH 2LTQC 4HKZA 1SBBA 4ZSOE 1WIPA 3B3IB 2P5WB 3AVEA 4JN2B 5HDQL 4HKJA 4MX7A 2GITB 4UOW1 5FA4B 4KKNA 3GO1H 1RJLA 4IRSD 3GMRA 1YEJL 3CH8A 4TRPL 5D7SL 1DLFH 1RMFH 4JFXB 4P46D 2OJZH 5GS0L 4FZEH 4HQQL 4WCYL 3MRRA 2YKLL 2GJZA 2J4WL 5GGRA 5C0CB 1AFVL 5GS0H 3NCJH 4HJJH 1ZVSB 5SWQB 5FYKL 3KJ4C 4I9WE 1A3LL 3WIIL 2YMXL 4Y7MA 1I4FA 4FQIL 3IAGC 1OT1A 2EKJA 3H3KA 4G8GA 2ZCKL 1JE6A 2B5IB 3EYUH 4ZG1A 1KXVC 3L9RA 4TNVK 3JV0A 1CVSC 5E5MB 1OAKL 4PRNB 1UKSA 1S9WB 3CXHJ 5IQ7H 2R2BB 4JHZA 1MCQA 2VZ3A 3IXTB 3G6JB 4FTVD 2DKMA 3UPRA 1KIQB 3MNVA 4KRMB 2P8PA 4Y5VA 5EOQH 3MJ9H 1G6RH 4MB5A 4HIEB 3T1FA 3TWCH 3VXOA 4Q6YA 1JHLL 1CXKA 1LO3L 3DMMC 5CILH 1YECH 2VUYA 5C0FA 3TA3D 1F4YH 3LKPB 3T1FB 4HIEA 3UTTA 3PDOA 4K3JL 3FT2B 4FFZL 5JW3H 3NACL 3DMMB 5KW9H 1A5FH 1T04A 1Q0XL 1AQKL 3HKFA 3L3KB 1C12B 3MR9A 2AEPL 5I8OL 4PGJA 4OZ4A 4I0KA 4N0YH 4JFZL 5HD8D 5T3XH 1W8NA 1FZKB 3UJJH 4F7PB 4QHMB 4OKVA 4QLRA 2FGZA 3M1BB 5HBBA 5FYKU 4TSAL 2FO4B 3LKOA 3OL2A 4RAUA 3QDJD 4M9PA 3SY0A 3ZE2E 5JR1L 5DUML 2HFEB 1WCBB 3QIWA 5AG9A 5I19H 4NIKB 5JR1H 2YD8A 3OMZA 1JYVA 3HUJE 5C0AE 3X3GL 3TN0D 3TPKA 3MRLB 4F15C 3BSZH 1IMHC 2VXVH 1WSST 4G43A 4P4KD 4XCYA 4Y5XB 3RWIB 3SE3A 1U93B 3LN4B 2D03L 5JHDD 3GI8L 1ZGLA 1LO3H 3OKDA 5EZLA 3O0RL 1AGDB 3R1GL 4ODHH 2Q6WA 1I3GH 5EC1B 2KBGA 1IC7H 1OGAA 4MZ2A 5DFWH 1EH9A 3UPAA 4HDIB 1P53A 2OTPA 1SBSH 2D7QA 3W0WE 2ZUVA 1JIBA 2ATKA 3TBWB 1AHWC 3HE7C 3VWJD 2BERA 1S7UA 3V4UH 4G7VH 1YPZB 3IJSB 1TNMA 3O9WD 5I1KL 4KJWD 3GNML 5GGUA 4M4RA 4X9GA 1QLFB 3QR2A 2XZCL 3D2UD 5JIHA 3E3QE 1XF3B 2HH0H 5DJ6B 2HFGL 2XQYG 1LNUA 4J6RH 4W4OA 4QOKE 3UROR 2JJTA 3BH9A 4Y1AB 5CZXD 4F7CB 1YEEH 4E42A 4WFGD 3VU2A 3D18B 2B1HH 1XMWA 1Y18B 4UV4L 1AIFA 1BGXL 4QRRA 4HFWB 3QWQB 3RWFA 5DJDA 4PJFA 3V0AC 4O58L 1OM3H 5ADOH 3BN9C 4BFGA 5F6IB 2C9AA 2KPNA 2DRUA 4PJEF 3RZCB 1AGEA 1B0RA 1WV7T 5HJ3A 1EBPA 2W60B 4W6WB 4OI8A 4KHTL 4KKLC 4JPWH 1KF9B 2VISA 5IVZA 4ORZC 5IVXA 1J18A 4X6EB 1ZHLB 3LDBC 5IHUH 2V5SA 4KJQC 1K8DA 2NLJA 4OD2B 4N1EA 2J8UA 4V1DA 1UB5B 4FQXD 5F8RC 2YPKB 2X4SB 1A7RH 2X4TB 3VXPB 3WXVL 5T3ZL 1MCBA 3F12B 5MI0C 1AGCA 1WFOA 3MZTA 3RNKA 1MI5B 5C1MB 2V2XA 2E9WA 5I9QC 5IBLC 2FR4B 2HN7A 4Y19D 4EUPB 3RTQC 4YHZH 1Q0YH 2VC2H 5CJQH 4WO4B 1MIMH 2MJWA 3D2UA 1EAJA 5I9QB 2DLGA 5EULV 5L2JB 3MRMB 3JTSB 4OI9A 2ZPKL 3GIVB 3QRFM 2AJYL 4GLRH 3MACH 4HK3N 2X9WA 1AD0B 3NABH 3MXWH 1HIML 1MCLA 5IVZB 4PJBB 3ARFA 1H15A 5C0RH 1MRCL 3MODL 1OSZB 5D2NA 3FO0L 1V7MH 5C0BD 1YJDL 1ZA3A 5DJ0B 4KK6C 2A1WH 1AGEB 1FYHB 1JPTL 4CGTA 5FB8A 1M6OA 5IM7A 5T1DL 3FT3B 5TJWK 3VFWB 3I6KB 4HFWA 5HYEA 3HMXL 2BRRL 3GHBH 3O3DA 2XWTB 1JVKA 4RMQA 3ZYIA 1ZT1B 5TE7H 5F6HJ 2CKBA 1YMMB 4HULB 4XCCH 1E6JL 5AUMB 1T66C 4XXDB 4OZFH 2UZYB 3FONA 2R2CA 1CYGA 5BV7C 1JNNH 4Z7UB 5D6DC 4WO4A 1J1OL 1G7JA 4V1DD 4PLKC 4DJMA 2DQEH 2DQFA 4MNQD 3I2CH 1DBKL 2KH2B 3V7MA 1NQBA 1MI5A 1QA9B 4XC3H 3GGWB 1MUJB 3T3PF 4ZO9A 2VC2L 3QFJB 1RUML 3MCKB 1WFUA 2EECA 4OM1H 3VD5A 2C7UA 4P57A 3UTZB 4HZLA 2BDNH 1TJIH 4AEIL 2WANA 3QEGL 3C9NB 1KGCD 2OR9H 2VXUL 4TOYH 1UADC 3KGRA 3U46A 4S0TD 3ZDZE 4R4BB 5B38A 1J0ZA 1T7XA 2X44D 4QNPF 3T3PE 5L0QB 3A0OA 4Q97A 1TVHA 5JW5A 4PJXA 4M7KL 4PJ8A 4JRXE 4LEOA 3RI5K 5KJRL 1KN2L 4HIXH 5GRUH 1MWAA 4Z9KB 5FUZL 3UBXA 1EJOL 5H37H 2R8SL 3C6SA 3OZ9L 4O02H 2YR3A 4JKWA 2LV4A 3P30H 4G9FA 5FDWB 5D2NE 2VJXA 5JDSB 5D7LD 1JGVL 3VFVB 1WBYA 5LKNA 3DYOA 4NO5A 3FFCB 2GJ6B 5C08B 4J3WA 5MHSE 5DMKB 2O5XL 3EBAA 4EEEA 1MAML 1T0NA 4KJYB 1QFWI 2R15A 2VLRA 5D2NC 5ANMA 3GFUA 4YX2H 3ULVF 4U3CA 1C5CL 4NQSA 1ORSB 3C5SA 5IB3A 4K23H 4O5LL 3V52L 4JY5H 4NQXB 4WFHD 5LJYH 1CCZA 1TPXC 2DI8A 5GGUB 2Q20A 3B5GA 2QSCL 1QR1A 4R9HA 2VAJA 2WZPD 1OB1A 1X4ZA 1TZHB 1QFOA 3QWRD 2AEQH 1TJIL 4S10A 3EO9H 3IKCB 5ENWB 2NPLX 1H0DB 4QY8B 1ZSDA 3U79A 4P2RE 3BZEB 4M7LH 3WFCL 1U8QB 4LSRL 43C9B 1QRNE 3CFBA 3LN5A 1WAAE 4XCNA 5KVFL 2FX8H 3RL2B 4CBPA 2Q87A 1QQDB 1JGDB 2X41A 1NBQA 4XNZB 5EO0B 5E5UB 5IW1A 2IANB 3GSOA 4RFOH 3HNTH 2HYMA 1ZVYA 3RDTB 3K46A 2EKSB 3D69A 1JGVH 4NSKB 3VFVA 1NJ9B 4HS6A 4U49A 3I6KA 2XTJD 2D7OA 3UBXB 5J6GB 4TTDC 5FV1L 2W91A 1DE4B 1C5CH 1OL0A 3MRRB 4XNYL 3VD4A 2HMID 2DQIL 3DX7A 4RFEB 4M8QA 2P7TA 5E99L 5HGGS 4OZGE 1RJLB 5EZIH 3MRNB 2AW2A 2IBZX 2VQUA 1KCLA 2DI9A 1N3NA 5E99H 1ZV5A 1IGML 4AL8L 4Y4KC 4X4YA 1FORH 2X4PB 2A6IA 1E27B 4M7LL 3QUXA 3UJIL 3O4OB 3PNWA 5IB2A 1VFUA 3S34L 5MEPB 2F19L 2X1PA 1QBAA 1P4BL 2O5ZL 5F7NC 1LO5A 3Q5YA 5EOTA 4PJGA 4Y4KA 2Q86A 2X7LA 3VRLE 5I1EH 1RIUH 4OFYA 1G9EA 1S9WA 1XFPA 4K94L 3HNSL 5C0IA 3MV11 2ZCHH 3VXUE 4JKLA 4X4XB 5L8LB 2F8OA 1K5NA 4WHDA 3BH8A 1P7HL 1D9KD 2W60A 4OQTA 1FYTE 4W4NA 3ZE1F 4U1IB 4O9HH 4IMLB 5KVDH 1WWWX 3O6FD 4IRJD 1ZOXA 4U4BA 3U36A 1I3RA 4BQBA 1A6WH 1W72H 4Y4HD 3ILQD 3KJ4B 3MBEB 2DQIH 2WW8A 1MCCA 2FRGP 2WSKA 1RIHL 1P1ZA 5E9DE 3VXRB 3NAAL 1HSBA 4HCRH 4R96B 4UT7L 4NP4H 3OV6A 3U7YH 3PWPE 2HLFC 3MBEC 4NUGH 1T22A 5FHAL 1SY6L 5B21A 4Z5RB 3R4DA 4G6JH 3MRPB 3MLZH 5GS1A 3KXFE 3MRBB 4UT6L 5DD5H 2VSCA 4XP9H 4F9LA 2P5WA 5ADPH 3T4YB 1RURH 2A2QT 2ZKHL 3QEHB 4XP9L 4PLJD 3RIFK 1KC5H 1JV5A 4HWBL 4K3HA 3WHE0 4A6YH 5C0EA 1O5DT 1MAJA 4OF6A 1EJ6A 1BD2A 5IEHA 3WS3A 3BKJH 2D2OA 5EIVA 4I2XA 4KK5D 3VWJB 3PG2A 4HUXB 4BJLA 3QI9C 4NNYB 2V17L 2XNAA 2Y5TA 2LAGB 3UTQA 1FVDB 3UC0L 4EQ2A 3CFIC 5FCUL 5GIRB 5EU4B 5C8JB 3BZDA 3TYFB 4ZO6A 5I17A 3UO1L 2D0GA 3WHXA 2VDML 5F9JA 2FYYB 5FCUH 5A2JH 1HEZA 1X5YA 4K7PL 3RNQA 1NFDB 2X1QA 5FHAH 1OCWL 5H2BB 4QRQB 1ZEAH 3RWJA 2FYYA 3U36B 3MXVH 1IL1B 2H9GA 1C16A 5FKPA 4GRLC 3U2SB 1T83C 4R26L 1JPSH 4WUUB 2AGJH 3SCMC 4LK4A 3QHTC 4HWZB 3KJ6H 5C3LD 1X5HA 2P46B 5FUOL 1NUGA 2EDTA 3B2UC 1S7RA 3SCMB 3B9KA 3NA9H 2NY1B 5HHVL 4W4OC 1EZVX 4I2XB 4UUJA 4JRYD 4P2QE 3B9DA 2WWKO 5ITBH 3L3KA 1PSKH 3AM8C 5ESVA 2E7CA 2DQTL 5AD0A 4LAQH 5GGSB 5C6TH 1JZ7A 3ZTNL 2FL5B 1Q94B 1TETH 1I7UA 4DOHB 2G60H 3CVHA 3QG7L 1KPUA 4XPGL 2NY2C 5IFAH 2Z93A 1XCQB 3QA3A 5C6PB 3VRJB 4OGXH 1N4XH 5FIEA 5F21B 4XHJC 5EORH 4H0GA 4HPOL 3G6JF 1DQML 2NY2B 1PYWA 3TIDA 1KYOK 1RU9H 3O2WL 4JKMA 5KZCD 4QRPE 3S4SB 3PXHA 4OCSH 5JNYA 1MI5E 2J6EH 4GKNA 1X5KA 5TE4L 2ICCA 4NKIH 3FQXA 4WNQB 1CD8A 3NIFF 2AEWA 3NIGF 4ZUSA 5A2IH 4LAJH 1GIGL 2IANE 3FQRB 4RISH 3MRLA 3KHQA 2DM2A 3FMGH 3DX7B 4HH8A 4NQTA 4PS4H 5LWYL 4P2RA 5E00B 3RVTD 4LASL 5FFLA 5GS2H 3OJMB 5E8NB 4KAQH 4YBLB 2VO5A 2DM7A 3QIWB 5SWQA 2GQHA 4ODUA 4XAWL 1MVFA 1IC1A 4KU1A 5DTFA 4MD4A 5E8NA 5BS0D 2PW1A 3MROB 1FN4A 5EZJA 1MCPL 1C5BL 3RX7A 3TT1L 3QIWC 4HS6B 1XGYH 3V7AE 2K3TA 4WY7H 3K2UH 3N1PC 1FFRA 2EO9A 3JZ7A 1UZ8A 4HLZH 4KDVA 2NX5E 4RZCA 2FSEB 3BO8B 3GSQA 4P9HL 1QD0A 2H32B 3Q2CA 1UA6H 2FECI 2VR4A 4XAKE 3SOBH 2VDLH 3G5ZB 3NBNA 1HI6A 2X1OA 1CF8H 3UZVB 5J1SC 3QUZA 2YK1L 1ETZA 1ZVHA 5A16B 5GGQH 4PPTA 4QY8A 1INDL 1CF8L 1FVEA 2OL3A 4PV8B 5DZOA 5ANME 5C0BB 2B0SH 2VXTH 5I1HL 1ZHNA 1CGWA 1N6VA 3HE6A 3LS4H 3VFGH 3RTQB 3HB3D 4HCRA 3KYNB 5FO8A 4U6YA 5F7HA 2MSPA 3L6FA 1GIGH 1BVLA 1MVUB 2R1YA 4KH2A 4Z95H 5DMIL 4YPJA 4S11A 4YNYA 4RMRA 3X13A 4Y2OA 3HMWH 2DTMH 4D0CA 1UZ8B 5EFIB 1YC7A 4LIQL 5DK0B 4M6AA 1CXFA 5TPWL 3V6FB 3IFPB 2VDRL 5HI4D 1LP9F 4LSTL 1F45A 2RJMA 3Q5TA 3TT1H 2NYYC 5IFHL 4A2LA 1EHXA 3NCFB 1WBYB 3MRJA 4PJCE 2FBJL 3RWJB 4IMKA 1LO0L 5DR5L 5CEXA 3LVEA 3MV9B 3BWUC 2XG4A 3HNVH 2GTWB 4KKBD 3G08B 2V2WA 3FKUS 3QXAB 5F7DA 5SV3A 3TBYA 3VXUD 1LO0H 1YYML 3X14A 5E1AA 4WNQA 2NNAB 3EOAB 1JMXA 1T3FB 4MCZA 5EOCL 4GAYA 1TJGL 2WLYA 1NAMH 4K7PY 3H9SD 2X1WL 4NNXA 2VL5B 5DDHA 4HK0A 3QNZA 3PUCA 4PJEB 2OI9B 4U6XA 4NNPH 2W65A 4K2UH 4IDJL 1M7IB 4OZFG 4QRSA 1KPUB 4D3CH 3UP1A 4ODWB 3SGDI 3FO1B 4XC1H 4NQCE 4OB5H 4IDJH 1QLEH 5BVPH 1F00I 3V8CA 5AD0B 5DLML 2ESVA 1NMAL 4LVOC 1NUNB 1ACYL 5HHOB 1FDLL 5B3JF 5JA8B 3MA9L 4C58B 4BYHA 2EZ0C 4LIQH 2DMKA 1A7PL 2Q7YA 1FNGB 1N6UA 2ORBL 2CSPA 4P59H 3P77B 2DMBA 1UACH 2V9TA 4KZDL 4LL9A 1X4XA 4BZ2H 3OG4B 5DMKA 1KB5L 4F37K 1QNZH 2CKBB 4YDVB 1UJ3C 5CEZD 1ZT1A 3TNMB 1BBDH 2XRAH 4Q58C 4NZTH 4U6VH 2PXYC 3JV4B 4EI5D 4FP8H 1UJ3B 4ZFZB 3UBXI 4JQIL 4M3JA 5GGTA 1FE8H 1NFDE 3SE8L 4CVXB 5MENE 2I25N 5KTEL 5F8QC 5I17B 2LABA 5EUKB 5J12C 1AGFB 1E0OB 3HG1A 3VW3H 1QSFD 4PJBF 1MCOL 4BQ9A 4DFHA 3VWKC 4HH9B 2PXYD 3FQNB 3KS0J 3HLAA 5TDOA 4RMVA 3E6HA 2YD6A 5CLTA 1F11A 5EWIL 2HKHL 5FKAA 1YQVL 1CL7L 4ZYKB 4O02L 5I15H 5HHXL 1NFKA 5I1LA 4HUUB 3UZQA 1LEGA 1VKXB 4OLVH 4LLVB 5FM5M 2BSTB 1ACYH 1JRHI 3R0MA 1WAAA 3DWTA 1NLDL 4JRXA 5EUOB 3HZKA 3IFLH 4N8VG 2XA8L 3DETC 5D5MA 3QDGA 4APQC 4ZNEA 4L1DA 2I60H 5FUCC 2D9CA 5ESQB 4C4KO 4PRPE 1NBYA 1IZJA 2WWMD 3CH1A 3DUSB 3RKDC 1J0KA 3JWOL 3JWDC 1WVZA 2W0FB 1HCFX 4XNZC 3TPUA 5FUCE 1DQQB 3NCMA 1GGCH 2AXHA 4IRSB 1DQJB 5EDXA 1CFSB 4N8VB 4HK3J 3RGVC 3V4VL 4ELME 1OQOA 5E2WL 4XMPH 1NCAL 2HP4A 1UWXK 5EU6E 5HJ3B 2EC8A 5I8EB 2X9YA 1G7PA 1V3LA 3QUYC 4QOKA 2VE6B 5IM7B 2MMXA 2OZ4L 1XIWC 4WO4D 2E27L 3DVNB 4N8CH 2ZJSH 1NGXA 2DQJL 4TQEL 4X6CB 1CFNB 3ZHDA 1WF5A 5EWIH 4RGOL 3BWAA 2YA1A 1AJ7L 2NXYD 2PXYA 4DZBB 2X40A 4OZIF 1MRDL 4WHTA 1I8KB 4XPHL 4PGDA 2EE6A 1LNUB 5JOFA 1AHWA 1IKNA 5FDYA 2Q86B 2FWOB 3GMMA 1KEGL 1MHCB 2NY0C 1XH3A 4CDGC 1FLRH 4LLDB 3RUGE 4G8EA 3DUUA 3ARBC 4NO2A 5IB2B 5ENWA 1U58A 1G0DA 1GC1L 1S5IH 1YEIL 2R0KH 1A2YB 4F9PA 2YKLH 4H8WH 4IOFC 2YD5A 4GW5B 4NCC1 1JYWA 4Z0XA 4PP1D 2B39A 1IGFH 3LEYL 4WU7B 3ROLB 1PY4A 4R90L 5IF0A 1TZGL 3QEQD 1QBLL 4WFED 3O4LE 4M5ZH 2X4OB 1CQYA 4XP6H 5L2KA 4LPXA 1CGUA 2V6HA 1QFHA 2EDLA 4JDVA 4XMKH 3FQUB 3V6ZA 3SKJH 4WEUD 4P4KA 1PQZB 2GJ6A 3IKKA 4MMZC 3EGSB 1X5FA 4Q2ZA 5EC2B 1VACA 5DA0B 1T80A 4MA8L 4XGZB 2JF1A 2DICA 2FJFB 2MCG1 3BGFC 1B3JA 2DJ4A 1MFDH 5CINH 3RBSA 1EXUA 2Z92B 2ZNWA 5DYOA 1FC1A 1UH3A 5ICYA 4M1GL 3ZKQD 3T0EE 2D7TH 4PJIF 1ED3A 3BD5A 1MFDL 2FIRT 5F1NA 5CJBA 2P42B 4EDWL 4MVBC 1NDGB 1MF2L 4NWTH 3RIFF 1MQ8A 3JV6B 5IW3A 5JQ6L 1QQDA 5IBTL 3CX2A 4LEXL 4DTGL 2MQ0A 2OQJA 4Y0GA 1HNFA 1YN7A 4JFZH 4KROB 3BJ91 43C9A 1CIUA 3CJJA 4JG0L 5D7KD 5FHBH 2MPAH 4EI6A 3WJLC 4D0BA 1GAFL 3AB0C 3BUTA 4F58L 4GKOA 5C0BA 5GSVB 1EBAA 1CDGA 5F3HA 3QFJA 4P4KB 4OJFL 5GGRY 5GGTH 4WV1B 1NMCB 2AKRB 1WFTA 1RI8A 3BDBA 3SDDB 4P5TA 5D1XA 5IIEA 1N6QL 2RIKA 1OARH 1WCQA 1CFVL 1VFBB 5L2KB 3MUJA 1A6UH 4MSWA 3PV6A 1CGYA 1NMCC 2NY6B 3EDFA 1ONQB 3BMVA 1KIQA 3X3GH 3MLRH 4FFWD 1NPUA 3PIQA 1FL6A 3F58H 3BSZL 1HKFA 2WIIB 3CFKA 2P5EB 4JN1H 2F53E 4C56B 1KEMH 5H94B 5D8JL 4NC1E 5AEAA 5AYQA 3WS6C 2JJVA 3PJSA 1P7KA 1G6RL 1MCDA 4HT1L 4JANB 5D8JH 2A74A 3DBXA 2ADIB 1IC7L 1S9YA 1BAFH 1PJ9A 2AJZB 3MRHB 5JQ6H 5T3XL 3KPNB 1CICD 3O9WC 3GM0A 4HEME 2NY7H 4JCLA 5HVHB 5T3ZE 3KYOA 4K8RL 3W9DA 4PGDB 1I8KA 4MJ6A 2PKDA 5IGXL 43CAB 3IDNB 2VDQH 2D31A 3C5ZC 4OLEA 1DUYA 3QZWG 4FZEL 4OUUA 4S1DD 4OCXL 1A1OB 4R4BA 2F53A 3QCVL 4GSDH 4P3DB 3DJ9A 3MRMA 1GYAA 5FGBC 2VDMH 5T33H 1JZ8A 3V0VA 5IK3B 3QCVH 2ADFL 2ARJB 4GSDL 2MFNA 3N1FC 1YJDC 4EUPA 4MAUL 1FFOB 3GBML 4LLWA 1I7TB 4N0UA 1K6QH 3KPLB 2GCYA 5E8OA 1IGIL 1CFVH 5JHDE 2CK2A 3WO3B 1JHKH 2J3SA 3PXJA 1YNLH 4KI1A 5CCKL 1U8OB 2CMRL 1OAKH 3HS0B 4R7DB 5I19L 5F7YC 4XNXL 1HXMB 3J8F7 1EA9C 1BZQK 2VH5L 5CCKH 1MRFH 1G7MA 4YWGL 1F58H 4LSPH 2LQRA 5AUMA 3AM8A 2YD3A 5LGHL 1VFAA 3EOYG 4P23C 4HSQA 1WBXA 1QYGL 3DGCR 5C92A 4R3SA 2FZ3A 1D5IH 3I75A 1IZKA 4JRXD 3MRIA 3QG7H 4JVPA 4FA8A 3W9EB 1RJZA 2CIKB 2E7BA 2P5WD 4OFYD 3QPXH 4JB9L 4I4WB 3DV4A 5F6HI 1VESA 5J11B 3QPQD 4P5KB 4ZYKA 1A7RL 5HI5C 5JXED 1HK6A 5IBUG 4UV7H 3BD4A 3WLBB 2F8VA 1S8DB 5I1IL 4ELKB 4ENED 1HDMB 3ARYA 4XRCB 5EBWB 3V5HA 4BSVB 5CEZL 4AJ0A 5C9JB 3QNYA 1IFHH 3UAJC 4HKZB 3PWPD 3BQUA 4JHAL 3C8HA 4MNGB 2EDXA 1YEDA 1JHKL 3RVWD 5IOPB 4ACPA 3QXWA 4IBLT 5DEGA 2ATKB 3TBWA 1C08A 4NN6C 3ULUE 4L8CA 3JV4A 1IEAB 4Y5YB 1URLA 3WUWG 1Q1JL 1EVUA 1BGXH 4H0HB 1AO7B 5JUEL 1RUKL 4Y5YC 5KZCB 1ZLSH 4FQQA 5T1DH 5I1GH 5LGHH 3VXRD 3EDKA 1R6VA 4DAGH 1ZT7B 1ZGLB 3OKLB 3HI6H 1PG7W 5SWSE 1F4WL 1KIUA 1KB9K 4KROD 3ZO0A 4UOW0 3AMLA 3N85L 2R0WL 1MJUH 2WNGA 1ZANH 4JFFB 5KS9F 5KSAB 1DANT 1CS6A 5SX4I 2C3HA 4YHOL 3V4UL 3W39A 4AH2A 3BPNC 3QUKB 2NY1D 4ZPVB 2R1WB 1FL3B 5DSCB 4O4YH 3VXSB 3GSRB 2VL5A 1EFXB 3KYKH 5DDHB 1AP2B 3OB0H 2JCCF 2WQ8A 3LQAH 4N1CA 4F2MA 2I5YL 4XPFH 1X5JA 1TVDA 2P45B 2VNCA 2NXYC 1QLFA 4LKXB 3GSNA 4JJHA 5ETUB 3U0TB 2IALA 2DQCL 4G8IB 3VXRE 1R3JB 4ZQKA 5IHLB 1SM3L 4A6YB 1T21A 3WIFB 3VXNB 3SE4C 5HGHB 2DOCA 4OM0H 3HZYB 4M6ML 4B50A 1FNSL 2N1KA 5E2TH 3T65B 1BFOB 4DGVL 2X4QB 5HYJE 3SE3C 2LVCA 3QH3A 4PRDA 4HF5L 4OCWH 1A6VL 2WMPA 3IXTA 3NZ8A 2OLDA 3L95B 5FYJL 3CFJA 1PLGL 4BFEA 2ITCA 5CKAA 3VD7A 2EDWA 2AJ3B 5ID0A 3MLPA 3QXDB 1VADA 1PLGH 5BCAA 3PQYB 4LF3B 5BQ7B 1N2RA 2X4UA 2HT4C 5F97E 1JL8A 3DETD 2AK4B 1JI2A 1H5BB 4Z76A 3M17B 3SPVB 1M71B 5HYJB 1GGYA 1BM3L 1CXIA 3TT3L 4E0RA 5DJXA 3C09C 1JNJA 3MACL 2EXWD 1A7PH 3U30B 2IAMC 4XCEA 3HPLA 3G5XA 2DWEB 4L9LC 4U1KB 4HC1L 4MJ4A 4P59L 4P0DA 3JWDH 5GRXG 5LG1A 1BFVH 1BZ9B 2V5TA 4L3CA 4M1DL 5DRZB 4JO4L 2DWEA 4KQ4H 4PJFE 1JI1A 5E2VL 1QTYT 5GJTH 4L4TB 2AJSL 4DVRL 5JXAL 1T2XA 3FQWA 3IS0X 3O6FB 2WBJB 3K81A 1KJVB 5JW4M 4UILL 4ELMF 3LAFA 1NDMB 2EE9A 5DJZB 5I1JH 5D1ZB 5TE7L 1XF2B 1DANU 3C5JB 4I5BB 4WHYH 1JF5A 2VL4A 4KVNL 1S7SB 4HG4K 3PQYA 4LF3A 4ZOBA 4HUVB 2BVQA 4KK8D 4PRPA 3F65A 4AMKL 4HKXA 2Y07L 3MV8A 1TENA 3FOLB 1QSZA 2DKUA 1AY1L 2VLLB 4JFEA 2H1PH 1KT2A 1SMAA 2AV7B 2EXWC 2I07B 3E3QC 1ORSA 1RZ8B 4PJDB 2A9NL 2R0LH 1D5BB 5HYIA 4BM7A 5HDBF 4GQPH 1YMMD 3QQ3A 4OF7A 4YLQT 4NQCA 2VIRA 5FGRA 3IDUA 1T6VN 5C0DB 1QSFB 3AGVA 4I0PC 5GGSA 2PYEA 3NCBB 3UJTL 2OTUA 3EO9L 3U9UB 3TLRA 4FNLL 1B4JH 1IEBA 3GSXB 5FYJU 1IAMA 4YHNA 5JDJA 3L5IA 4NFBA 4OZIE 1I8LC 2D0HA 3E2HC 1BREA 4OZGF 4ZFOL 3EDDA 2FX8L 1FZMA 4Q7DA 3SDAC 2YRPA 2VKXA 3NH7L 4H20H 4K71C 4KGLA 2GK0A 4ZUUB 3VE0A 2GSGB 4JLRB 2BVPA 1NGYA 2OZ4H 4KZEL 4M3KB 1CGVA 2W59A 1TFHA 1TTFA 2DBLH 2VDOH 3QYCA 3QHFH 2AAVA 4MAYD 4BH7A 3QWRA 1AY1H 4J1UB 3AS3A 2CR6A 1ZTXH 1K2DA 3MBXL 4I13B 2AXFA 3HHRB 4OLYH 2A83B 1UM6H 5B3JE 3O2DL 2AV1A 5HDOA 2AJXL 4XWGH 1JZ6A 1CZ8H 3MV7A 3RQ3A 4NP4L 1BOYA 1Y6NR 3H7BB 4V2CB 1YDPB 1OAXH 1X5AA 3AMKA 5GRZA 2X10A 3EUUA 5F3BA 3BHBA 4YIQB 5DD6B 3MRKB 1J87A 5I0ZA 2EEDA 1OD7A 4CUCA 1TNNA 4ODXA 5IMKB 5IB4A 1MLCA 1U3HA 3ESVF 5FGSA 3VGHA 1JGUL 4QWWC 1NEZG 5EN2A 4OLZH 4X4ME 5HVFB 3IJHB 1LEKA 3UAJD 2P24A 4P23D 2N7AA 3I3BA 3QEQA 4LCUA 3IFNL 2JB6B 1T4KB 7FABL 1PKQE 1OGTB 3MA7B 2XYCA 1R5WB 5I75C 3IDYC 2IQAA 2VLKB 3O41B 6FABH 2F53B 3G9AB 1LEIA 4RMTA 1XGPB 1CGXA 1H3UA 1UZ6E 4RWHA 4RAVB 2NXZC 1MHPH 2X4NA 3QPQC 2MKLC 3IRPX 3HNSH 1G0XA 5C7XL 3W9DB 5K9QG 4LSSL 4WWKB 3LQZB 4IS6B 3KPQB 1G6VK 5EPMA 1X5ZA 4OLYL 3U0PB 1DEEB 4JANA 4LSSH 3H2WA 3RVWC 5HHQB 5ID1B 1ND0B 2AJXH 3QDHA 3MJ9L 4XWGL 1GJIA 2Y1VA 4EN3A 2APFA 4LCCB 1EEYB 3ZKMD 4UQ2A 1IAIH 3BN9D 2YBRA 1KPVA 3BEVA 5FM4A 4CU7A 2ZG1A 2AV7A 1UB5A 3HE6D 5C9KA 1A7QH 5LGJA 1XF1A 4HXAL 3ISWA 3RA7H 1QPXA 4X7TA 1D5XB 3EYSH 2VR5A 3A6CH 4WJ5A 4HWBH 1JGUH 1S7QA 5T1KA 3UJJL 4MB3A 4P3WA 4ETYA 5AZ2H 4P9ML 2ZKHH 4QYOB 3RIAK 1MFAH 1XGQB 5GSVA 4GMTL 2X4PA 5I71B 3FQWB 3O6FA 1A6UL 3LQZA 5T1LA 2AEIT 1NGYB 3RX5A 5IK3A 5SWZD 2BSRB 5BW7A 3E0GA 4V1DE 3O8XC 1ORQB 3HAEH 4CU8A 1DUYB 4YHYC 1FZMB 3I3DA 1GPOL 2EIDA 3BH9B 4PJ5B 4YDIH 4Z7WB 3MLSL 5J3HD 4H26A 4WFFE 4Z7VF 3GJEA 1XF3A 4POYA 1G7HA 2JJTC 4XZUB 4XHJD 1DQLH 1H8OA 1OP5K 4HT1H 3UTSE 1KJ2H 3NIFE 5E4EB 3PJSB 1T2QH 1XGTB 5LWYH 5JW3L 4YHKL 3O0RH 1BD2E 1JPSL 2DLFH 1S7VA 4Z78B 4KRLB 3TN0C 2WWKT 1A6TA 5IW6B 4NQCB 1R3LA 2E9IA 5TQ0H 4L8DB 1N8ZA 2Z31A 4LMQE 4XAWH 1WEJH 1DVFC 1U8JA 4L4VE 3NZ8B 1HQRB 1UJTA 4LP4A 2B1AL 3FRUA 5SWZB 4BFBD 4GKZB 1N64H 4UT9H 1U8JB 1VGKA 4KK5C 5C6TL 2E3VA 3CZFB 3RU8L 4PJHA 3VFOB 1IAKB 3N9GL 3LD8B 4NCC2 4G42B 5HHVH 3ARBA 5BVJA 5LBSL 2BNRA 2EDQA 5KBNC 5EOCJ 4YFLI 1U58B 2CMRH 2WBWB 4JFPA 4OLWH 1TZHA 3H0TB 2R1XA 3TM6A 3IVKB 4U3XA 4PJ9A 5DHVB 4PGBB 3P4NB 3WSQL 4JPVL 3OPZH 1YN7B 4N0UE 2OQJB 2J6EL 3OKOA 2FWOA 3SY0B 5F1OB 5F96H 1JNHB 3GI8H 1MCSA 3JV6A 4YO0A 5D1QC 1BZ9A 4L3CB 3FAXA 4PUBL 4M1CD 3V0WH 1ORQA 1QYGH 1OCWH 3BVNA 3E6FA 5JDSA 5HD8C 4YC2C 4ZDHA 1H9VA 3TBTB 5E1HB 1CDYA 4W68A 5JA9A 5HGBB 3L3OA 4P2OD 4U7MA 4G7VL 2A0LD 4YC2B 4JCMA 4XBPB 3RGVA 4Z7WF 2YUXA 5M94B 4ETQA 3V6ZB 5C09E 1T7VA 2EXYD 4LU5H 1S9KC 2J7LA 4ZFOA 2IBZY 2QADC 3AFLA 2XQBH 4GKZA 4NKOA 4NHCH 5DK2B 1KT2B 2Y7QB 3D3VA 5I2IA 5I6XB 3IU3B 1BZ7A 1W0WA 5ACZA 2R2BA 4QGYA 4YHZL 4RMUA 1A9BB 1U8PA 3KYMA 2DQDH 3F7YA 5F1SA 5KVMC 2GUOB 2JJUA 3RY5A 2CIIB 1TQBB 4HIHB 1P9MA 4EVNA 2QKIA 2XWJB 1XF2A 1JYXA 2XTJC 1IT9H 1YUHB 4PV9A 1O7VA 3LMJL 2OSLB 5KVGH 2VABA 3ALWA 3QIUA 4LCWE 2WBKA 2Z8RA 1ZE3C 3S35H 4FQ2L 3QJFB 2ATPB 3OB0K 3PF2A 4F8QA 3EZJB 4RWYH 3VGAC 5EU6D 4F7EA 1RUQH 4XRCA 4BSVA 4GXUN 4RAVA 2DJUA 1MPAL 3NIDE 1PZ5A 3GMRB 3QO0B 2HVKB 4Q9QL 1FGNL 1DN0B 2BK8A 2NXYB 4KAQL 5F9AC 3FB7A 3QULB 3U4AA 4NZDA 1OGTA 3HPLB 1UYWL 1XIWD 2RCSH 3WHE1 2ADGB 5EU5A 1E6JH 1I1YA 4M61B 5T3XD 3E1F1 1KTKE 5L2KD 1NGQL 3L3GB 3FT3A 3ARPA 4ZSOB 4LPYA 1FV1B 2WM0A 3BP5A 4L3EA 2IPUG 4G3YH 1DLHA 5TPWH 2FCBA 2OMNA 2WK2A 4JZOB 4R0LC 5INCA 5CJQL 3TNMA 4YXLH 1CDCA 2AJ3A 1F13A 5ID0B 1UA6L 4Y5XC 4AIZA 4R0LB 3SE8H 1QR4A 3IDXL 4PY8I 3OXRA 1CLOH 3GIVA 3G6DL 3H7BA 4O2FA 4WHYG 5C0RL 2PYED 4Q0XH 1JTOA 2OR9L 4TOYL 3BYTA 5DUPH 3TJHD 1FAKT 3VA2C 1NAML 3TVMB 2B0SL 2VXTL 3QDGB 4Z0BH 5I1HH 2ZG3A 5DLMH 4IHOA 3OGCB 4RBPK 3RWGB 1D3CA 1EO5A 1NMAH 3VXNA 3IF1B 1U8MA 4IDLA 4A2MA 4LLVA 4ODWA 5HHXH 4JFED 3OQ3B 4L5FH 3BESR 5DQJA 4L4VD 2OR7A 2IAMB 1IGCL 1UH4A 4D0DB 1TJHL 1QLEL 4GAFB 3SDXF 4LHUD 4RA3A 3TFKC 2L7UA 3TJEL 3FB6B 5D6DA 1FDLH 43CAA 1QBML 2W92A 4HJGA 1PVHA 5DRNB 4NGHL 1F8TH 4APQD 1GZPA 3PDDA 1DEDA 4MQXD 1BX2A 1GOFA 4MQSB 5IROA 2E8ZA 3MCG1 3NOIA 4FQPA 5ALBL 1NCCL 4J4PC 5IHZA 4KV5E 4P46B 4OAWB 2IWGA 4QCIB 2PYEB 1VPOL 4UQ3A 5DI8A 1C5DB 1L0YA 3T0BA 3T4AB 3QWOA 1VPOH 5HXMA 3CFKB 2W9DL 4ONOA 3PL6A 4U1GB 5JHDA 5E9DB 1ERNA 4N8CL 1MELA 5D1XC 5ISZD 1A1MB 3RY4A 1P7QD 4PGZA 4NRXB 5IKCA 5GRJH 2CPCA 3CNKA 2CUIA 4DN3L 3CMGA 4Z7QE 4E5XB 1CTNA 1LHZA 1ZHNB 4RAHA 3QUZC 5C07E 5I30H 5TDPA 1MHEA 6CGTA 2NR6C 1EUUA 8FABB 3VI3F 4Y5YA 5DQ9B 2XZQL 3EOBB 1W8OA 2GCYB 3QUZB 3P9MA 4HX1B 2H8PB 1MAMH 4DQOH 1FV1A 4X7CC 5CKGA 3B6SB 2WBJA 4XP5H 4RGMB 15C8L 4KZDH 2OX5A 4F7MB 1GC1H 4UINH 4UI2A 4FABH 4WW1B 5AG8A 4XP5L 2A9MH 5A1AA 3FB7B 5CMAB 1MCIA 1HDMA 3V5HB 4M7JL 4NQEA 1EEQA 3B2VH 5SX5K 3SDXA 1KPRA 4DUWA 1I9IH 3STZB 5ALCH 3FCTB 3P0GB 5EBMB 1CK0L 1J0HA 4XCEB 4W70A 4MCYB 1KXTB 3MV9A 3H42L 1IGJA 5DTFB 2IBGA 3KR3H 1FNEB 2GY5A 5C0DA 3BKCL 4FNLH 3M17A 3ULUD 4G5ZL 1RZKL 5EUOF 1P7KB 3H42H 3BDYH 1FORL 3VFSA 4FQCL 1D5BA 4RCAA 2NMSA 5FK9A 1RZ8A 1WBXB 4JDVB 4PJDA 4NC2B 5SWZE 4YBQD 4C56A 4NDMA 3S34H 4HXBL 1SVZA 4MHHI 5IHBA 3MX0A 4H25B 2VR9A 1P4BH 1AXTL 3L95A 2AJVH 4JR9H 3NFNA 4QRRD 2XZQH 4K94H 1WTGT 2PF6A 3SKMA 4NOFA 2KQMA 3V5KB 3TVMD 5I18L 1FVEB 1HWGB 1BQUA 3BJLA 1R3IL 3X12A 1KEGH 4BZ1L 1J1XL 2XIDA 3B8YA 1CFQB 4L8SC 1N0XL 4WTZA 3JWOH 4N0UB 2R23A 4F57H 4HEPG 4L4TA 1CZ8L 3ARXA 1CQKA 1QBBA 3T2QA 1EAPA 4M48L 3SDAA 1VFMA 2A77L 5C09A 3EJYD 2BSED 3GZKA 2DDQL 2XKNB 1ADQL 4JFYB 3C5ZA 4JREC 1S9YB 4XMKL 3HCVA 3GMPA 3TZVB 5B39B 5E6IB 4HX1A 4OFKA 2OL3H 4OLZL 1HXYA 3P4MA 1GZQA 3L1OH 2YD7A 4JFPB 2IJ0C 3UYRL 1BJ1J 1NUFA 4LPUA 3V5KA 4NWTL 2FGWH 4N8PA 5J6HA 4ZXBB 1PKOA 2GSIB 2VDKH 3OAYH 5DFVC 3HRZB 1J10A 1NMBH 3RGHA 1VGKB 4PG9B 4CVUA 1K3ZA 4HPYH 5C7XH 3MRCB 4JAMB 2QQNH 2ZUQB 1DUZA 3PP4H 3ZKXB 2CXKA 1GAFH 4D9LL 1P4LB 1A4KA 1IM9A 1L0XA 3NPSB 3NFPA 2EC9T 3VJ6A 3NCCB 4JRXB 3S36X 4TSAH 3LEXA 1FZJA 1T20B 4ISVA 4PY7A 4HUUA 4GH7B 3ARRA 4L8CB 4G8EB 5TE6H 1OLZA 2IALB 2HRLA 3D85D 4F9LC 3GSNB 3U0TA 1QOKA 2CLRA 1YEDB 2EDJA 1CICA 4MNGA 1TCRA 1AHWB 4AEEA 1RHHA 3D39E 4FFYH 5SX4H 3EJJX 3V5DA 4MAYA 4P2OB 3L3IA 4Y8DC 1A6AA 4NQVB 4OZHB 3JBG7 5AZ2L 2XKSA 1Q8MA 3D0LB 3VDAA 3RVXD 4DKFL 3GHEH 1UJ3A 5D93B 3ARDA 4Z7UE 1NFDA 3D85B 1PAMA 1IVLA 1U8KB 3F7VB 5BRZB 1O7SA 1JHLH 3DHJA 3EGSA 5TFSL 2CLZB 3ULUF 1IARB 4HJ0C 4WI8A 2VSDA 4MNGE 4YDKL 1QG3A 2VZUA 3WN5C 5T1KB 4R2GD 4X7DC 4OBRA 4CADA 1VFAB 4KJPD 1A7NL 1RFDH 1VENA 4C59B 1CFSA 3MUGA 3HC4L 1V3KA 4LKCA 2J1KA 4X6DA 2HLFD 1INEH 2PR4L 3MBED 4MDJA 4UV7L 3B9EA 4MAUH 5JHDB 4LGPB 4N5UA 4O2EA 5D7LE 4TPRH 5FYKH 4PD4J 3KXFD 1J9CT 1X3DA 4Y4KB 1TQCC 1U42A 2YMXH 1AO7A 5DRWA 2UY6A 3G04A 1A2YA 1ZEAL 4E41B 2NY5L 4NKIL 1UWEL 2CO7B 4POZD 1OTTD 3B4NA 1YEEL 2LTQB 1C08B 5E8OB 5TQ0L 1OY3B 2DQGL 4LLDA 4U6XB 5DEGB 5A40E 2BSTA 4PRBA 2NTFB 3FT4B 2PETA 3QI9D 3BQUB 4WWKA 3O45B 1ZKAA 5D9SB 1JTTA 4BELD 1HINL 3QDJB 2VXVL 1DQTA 3LKNB 1KNOA 4XVUD 5D7IB 5E8EB 1MFBL 3RVXC 3FFDA 3KPRA 3SDYL 5LBSH 2ATPA 4X6DF 4EJ1C 3ZLQC 3T0AA 1JWMB 3EFFB 2AJZA 4YXKH 5DJAA 1YUHA 5JTWA 5D7JD 1S78D 3I75B 1U3HB 4HPOH 1ZHKA 2BHUA 2YEZB 4ZOEA 4JB9H 2HLAB 2QJDA 3ROOA 4CMMB 4MHHG 4P2QB 2Y06L 5F3BB 5T33L 3SKOA 1DQJA 4MXQD 1PG7H 2I26N 3GI9H 4C55A 2ZZUT 5ACZB 1JGDA 3QO1A 1W0WB 5DUMH 3ABZA 1KCSH 2B4CH 3BIBX 3ULSB 1NC2D 2CLVB 4EOWL 4J6RL 3RTQA 2JE8A 4OQTH 5EOTB 4UZGA 1KTLB 4Y4HC 2VQ1A 3SDCB 3B2UD 1ES0B 3ZDYF 1MFCH 4GXUM 4Z7VE 3KXFB 4Y4KD 2I9TB 2UVEA 3L3OB 4GQ9H 4UV4H 1RD6A 1I1AC 4D0BB 5DFVD 4M61A 4PGCA 1WC7A 2UYLB 1MLBB 3HI6L 5EU5B 4Y16A 1F4WH 3E6FB 2BNUA 4ZUUA 3IJYB 2IADA 1J05A 4K7FB 4RIRB 1I1AB 3S98A 3WJLA 3QO0A 2K9UA 3LPWA 4MA3B 2F58H 4RSVA 5IBUB 1F4HA 4X80H 4XWOD 4L9LA 4JM2C 2PW1B 2X70A 4KKCC 3OKOB 1B0WA 2NY3C 5EO1A 2GEEA 4GW4A 5D71H 2HT2C 4JO1L 3LKSB 4C83A 1CTOA 4O4YL 4F15B 1H8SA 4PRHE 2Y06H 3C8KB 5GGVH 3F6IA 2HH0L 2VDPL 2CDGB 3LKSA 4BA8A 5H94A 4XC3L 4YDVA 1PQZA 3F7YB 3IFPA 4G42A 2YPVH 4TSBH 4MD5A 3I9GH 4X83A 1JBJA 3HZVB 1BM3H 5JPMB 4YHLH 4J12A 4Y19A 1K3IA 1QSVA 2DQCH 1G7IA 2F5BH 4EIGB 1VCAA 3C60A 4LP5A 2IADB 3T0EB 2WV3A 3H9HB 3QA3B 3HE7A 4M4PA 1U8QA 5I8KH 1ZSDB 4Q74A 2FBJH 4EIZC 4YHML 3OKNA 2WUCH 1RUKH 5KS9B 3V6OA 3D25B 1I7UB 5BS0E 1Q94A 3C6LC 2F5AL 5I8KL 1AXIB 3FO1A 1QRKA 4YHMH 2FD6H 4YBQC 3ARQA 5F7EL 2JIXD 3OKNB 2VKWA 5FEBA 4KVCH 4F9PC 3C6LB 4PJEA 5CP3A 5AAMA 1HI6B 4MXVE 1N5YL 1T0MA 3D3VE 4PJFF 3WD5L 4FP8L 1OAZL 2EYRA 5C2UB 2GJJA 3CFEB 1YY8B 4TVPH 3CFDB 1OW0A 1I8LA 4JO1H 3H3BC 3MGOA 5IVXF 3MV01 4XX1E 1ZHBA 1DBJH 4OT1H 3MJ8A 5GGVL 2ZP0T 1FO0B 3WKML 4ZUVB 1GHFL 2CRMA 2GYSA 1ZHKB 3TZVD 3T1WA 2FJFA 5DJXB 2ARJQ 1PBYA 4P4RA 1MIML 1YQVH 3PWNA 1L4IA 3HC0B 1TJHH 5BZWB 2IH1A 5DJYB 4S1SL 2OXHA 1LD9B 2PTTB 4M43L 3C2AL 4PJBA 2BNQD 4XVJL 5E2VH 4S1SH 1V7ML 3IXAA 1B4JL 3AREA 5L2JA 3C60D 3G9VA 3BP6A 3FQTA 1A3RH 5ALBH 1YNKH 4KMQA 4OCYL 4WTZG 4I0PD 2I9TA 4S1QL 3T65A 1V7NL 5EUOA 1IM3A 2R2HA 3KPOB 1DEEA 4R4FH 4DZ8A 4N0FA 3GB7A 5TDNB 4G9FD 3MLUH 1WZ1H 4JFQB 1U92B 4RMWA 4KVNH 4RGMC 4BSJA 4CN4A 3GJEB 4Z7UA 4JG1H 3T2NL 2ERJB 1RVFL 2DYPA 3BO8A 2FSEA 2DJSA 4MMXC 4QXWA 1LK2A 2FJHB 1JHTB 2VN7A 2RFXA 1KJMA 1WWBX 3MCLL 1A6ZB 3VXMA 4CMMA 2UZIH 3DI3B 2OM5A 3GBLA 4KHXL 4QHKJ 1QHOA 4WUUA 1LDSA 5B8CB 5D7KE 1PX4A 2OK0H 5I16B 3RZCA 3GSRA 1WGOA 4EXPX 1FAIH 4AL8H 1R0AH 5H2BA 4XVSL 1ITBB 3WNNA 4FMKA 3BPLB 3FN3A 4FABL 1JP5A 2D4FA 3MLTB 4M7KH 2B5IC 1U95A 1W2KT 2BC4A 4JO3L 4KTDH 1A3RL 3BKMH 5HYQA 4B41A 4KUCD 4HUKB 3V4VH 3T3ME 1G9ML 1UM4H 3KPRD 1YEHH 1N7ML 4AY0A 5I8CB 4HW6A 2Q8BH 1A7BA 4H88H 3UTOA 3VRJA 5CD5C 1XCQA 1SJVA 4AMKH 2EDYA 1FG2A 3L5WA 2KZWA 4ZD3L 1WZ1L 1SYSA 4XCFL 4YK4B 4L8SB 4MDIB 2VDNL 5I73B 5L8KB 3FAWA 3WV0A 4IS6A 5IB5B 2AERT 4NM4H 4YE4H 2QQKH 4KXZI 3GSUB 3G6AB 4NKQB 1IKNC 2PW2A 1BVZA 3P4OB 3RTQD 4CRPA 2FDBP 1EHAA 5MEOB 3FL7A 4JFHD 3RWIA 3MRBA 5AWNH 4EDWH 1QSEA 4UT6H 3U6RA 5K59E 4R96A 1BJMA 3IJHA 4FQ1L 3D85A 1U2HA 4X8JA 4F57L 4KKAD 5ISZA 3UEZA 4TRPH 1HXYB 4ZS6C 4XPBL 2DI7A 4U05A 4YIQA 5DD6A 5J12B 3DURA 2H2SD 1G9MH 1UM4L 1QZ1A 3B5TA 4RFOL 4YAQB 1YEHL 4ZXBC 1GGIH 3DRTA 1CWVA 3D39B 4YXHH 4WFEE 1DL7H 4XP6L 5EU3B 2DLHA 5C09D 3WUZA 4OKVB 1QO3B 3MFGB 1ADQH 1CXHA 1YEKH 4ZOAA 4KZEH 1MY7A 3PWPA 4FTVA 4MXQC 3LQAC 5HHOA 2ESVB 3BAEH 4PJGB 1JK8A 4OIBA 1QVOB 3NCYS 4J1UA 1B6DA 4PRPB 4WGVB 4DK6A 1MNUH 3GMLB 4XNUH 1IRAY 3P2TA 2YC1A 2X6MA 3WFDH 4M5YL 2BVPB 1X5IA 2QEJA 3INUH 4QF1A 1NDMA 1I7TA 1FJ1B 4HK0B 2FHBA 5DJ2B 2HJLA 1NMBL 2QL1A 1OAXL 4K9EH 3QIBB 1SHMA 5JHLL 4Z77A 3LN4A 4UT7H 3HR5A 3O6KH 3QNXA 3JWNC 1SY6H 1G7QA 5D7JA 3DO3A 3X3FH 3GSNH 2ICEA 1ZLWK 4UOJA 4J3OC 4PJGE 4WCYH 4FN0A 2P7TB 4LDOB 4NQEE 5J6HB 4EI5A 4TUJA 4LHUG 3TBYB 3P73B 1PEZA 2F19H 3G08A 1JPGA 2WP3T 4QTIL 1P1ZB 5D93C 5GS1C 1FN4B 4U7SA 3U9UA 4IRZL 4KUZH 4IM8A 3A6CL 3AS2A 3QCUL 5D5ME 1U3YA 1FNEA 3N9GH 2VZSA 1MREH 2A74B 2E7MA 3DBXB 4HWEL 3CU1A 1DL7L 4KMTL 4HFUH 3AXLB 2XN9B 5GZOC 1I1FB 4LLYB 1K6QL 2Q3ZA 4JY4B 1MCNA 3VFPA 1M4KA 3F58L 3SDDD 3BXNB 3LKRB 3T04D 1BD2D 3KG5A 4U0QB 2BOCB 3KPPB 2VLJA 3S9DB 1MVUA 4GG6B 3HZMA 5IP4A 4Y16B 4LHJB 4PGCB 3QIBA 5FYLL 3MLXL 2OTWA 2ED8A 5C0ND 3V0WL 3BZEA 5FCSH 2RB8A 1T1XA 2X4RB 1MHEB 2V9QA 5JW4Q 2H6PA 2K7PA 2EEAA 3W0WB 4AEHL 1S7XA 3QCTL 4YHKH 4DCQB 1T21B 4N9GB 4PGEB 1FG9C 2B1AH 4JFEE 2APWA 3HUJB 5C0AB 4ESKA 2X05A 1LGVA 4RQQB 5DHXB 5F9OH 4YDLB 3RU8H 3O3AB 3U4EA 4CW1A 3K2UL 2BSSB 5LAXA 4RFEA 3P0VL 5ANMB 2VLRB 4Z7VB 4PJXE 3TA3C 1KGCE 4WWID 3LPFA 1UWEH 2CDFA 4OBSA 1DE4A 3TV3H 5T5FH 4E0RB 5DJAB 4NM8L 4J3UA 3ZKND 5HYJA 4XVTH 4XB8A 3NCYP 4EDXA 4U1SA 3TV3L 5ABDE 4OFDA 1RZIA 1PY9A 4JFOB 4PY8J 3HE7D 2AP2A 1AR1D 1T2JA 5KSAA 1KPRB 4QHKI 4CJ1A 5LQBH 4LCYB 5DS8B 2Y9RT 5DRNA 5GIRA 3C5ZD 3OPZL 1I85A 2Q8AH 5HHNA 4JQVA 2GITA 4HKJB 4PJ8B 4MD0B 2B2XL 1CVRA 2HJFB 1NGPL 1WK0A 3TIDB 3ZKSD 4MJ2A 3KPSB 2NTFA 3U46B 3CSGA 3EDJA 2W9EL 3P9MB 5DURB 1AGCB 3MXVL 3G6JE 1BD2B 2H45A 2YC1B 2D9QB 1HYSC 4GRLD 4HZLB 4GXVH 5HGHA 3O2DA 2P48B 5TDPB 2VXQH 4LIQE 1QVOA 3GNMH 4NFCA 1FG2B 3EYVB 1R3JA 1ZLUK 3PHQA 2V2TB 3D9AL 1WLHA 3ARDD 3L3DA 1SEBA 4NQXA 4WI6A 5J9PA 5ESAA 3ZKMC 2X89A 1KCRL 3BZ4B 4LLMA 5E9DA 2DQDL 3HAEB 4R8WL 3OXRB 2OS7A 4HWZA 1J0JA 2JJSA 4CN6A 3MRPA 4YAQA 1QRND 1MFCL 3DIFA 1YMMA 1G1YA 3NMEA 2OZ4A 5DZNA 4Q9BA 1TJGH 2NY3B 3OKYA 4JHWL 4JFOA 5INCB 3LMJH 1Z5LB 3VFMB 1YEFL 4LOUC 1W0VB 4I8DA 3PWLB 3EHBD 4FQ2H 5I1GL 1IAII 1DBBL 4QRTB 4RGNB 3DTXA 5DD0L 1NBVH 4RDQF 5DJ0A 1EEUA 4CVZB 5HGDA 3Q6GL 4QXUH 5E03A 2X5PA 4X80L 1K5NB 2Z8WC 2V5MA 3HMXH 5E2TL 4WHCA 1JZ5A 4ALAL 1OTUC 1NGQH 1YPZA 3IJSA 3QB7C 4G8FB 3C9NA 5B39G 4N9OB 4XX1G 2FH6A 5FECA 5CZVH 5SWSD 2VABB 1S7XB 3OKKA 4MDIA 4HS3A 1JNNL 3KPOA 3V95A 2FHCA 2YS4A 2NY4C 2VB5A 1HILB 2DL9A 4ODVH 5J1AB 2PYFA 1KCUH 2CIIA 3IDXH 3PGCB 2Y6SD 1OT2A 2AJYH 1VDGA 5IVNA 4AM0A 4QOKD 1JWUA 3ZYJA 4FXGB 5D7IF 2XPGA 3M8OL 5KTEH 3QIUD 4KRPC 4L4TD 5FA3A 4P3DA 3ULVL 1HNGA 1MFEL 3KPMA 4PP1C 4WRLA 3KS0H 1T1WB 4IOFD 2DM4A 4P99A 4UAOB 3ULVH 1C1EH 1IT9L 3N1MC 1YPZF 4LLAA 4W6YB 5ITFB 3RGVB 1SJHB 4JO4H 4KQ4L 5DD0H 1FNSH 3HC0A 4I4WA 3PWNB 5CP7B 1MHHA 2M8XA 1RUPL 3L3GA 2UUDK 2CDFB 3QUYB 2R4RH 4JM2A 2MCPL 1EJOH 1Z5LA 1L6XA 3QQ9C 5GHWL 3T2OA 3VFMA 3QUZD 4HF5H 4OCWL 5T3XE 4JE4B 2A6KB 5CJOH 1FGNH 2F53D 3BZFA 4XMLH 4ALAH 5FV2A 5GGVY 3VG9C 2MCPH 4QHMA 5GXBB 1F3DJ 4Y1AA 1EAPB 5L9DL 1H3XA 2J88L 3FFCD 5C08D 4PJEE 1FL6B 2DQEL 3QJFA 5IFHH 4XI5D 1XR9A 2VWEC 1P84K 2ARWA 5EU6B 2YA2A 1NCCH 2AJUL 4P5TC 3ZDXF 3EKCA 4N9GA 4NN7C 5JW4R 3RUGF 5J9PB 1T0MB 1PFCA 2OSLA 4PD4K 4KI5E 4AQOA 5GISH 5C0JA 1GGCL 4CVWA 3H0TA 3O4OC 4PJDE 4NN7B 4TUKL 3LQMA 3SJVA 1SMOA 4G80B 4FZ8H 4PBXA 2QSCH 5F3HB 1X5XA 3QUMA 4K3DH 2W9DH 2ZUTA 3T2PA 3AREC 2EC9U 4TUKH 1SJEB 2BNQA 2B20A 2P8PB 2BHZA 4UDUA 3SGJA 3FHAA 3MFFA 1LE5A 1DN2A 2AABL 5L7XL 3VD3A 5CJXA 1R5IA 2EDBA 3LCYA 4OV6F 3L9RB 5JOEA 1YNKL 1MOEA 3CX5J 4ZFOB 1P2CA 1M7DA 4M03A 4O2CB 5KVFH 1P5VA 1NEUA 2Z31B 5C0GA 1LD9A 2W9LA 3J7HA 4BK4A 4XCYB 2R8SH 2P44B 5L0QC 3MRHA 5DA4A 2HKHH 5HHPA 5B8CC 1GSMA 4JR9L 1ROWA 3K1KC 1I85C 3DX8B 2HVJB 5I15L 1CT8A 1CL7I 3NH7H 4PJFB 4DN3H 3G5VB 3C8KA 1AQDB 2IQ9L 1WFNA 1NC2B 4PRAB 4E42B 4BZ1H 2XA8H 2V7NA 4S1RL 2I60L 4RAUB 3KDMB 3LRHA 5L88H 5INDA 3TO2B 1HZHH 1Q72L 2Y23A 4UTBH 5ALCL 1TVHB 4MA3A 1LP9E 1IBGL 4DGIH 4O51B 1KENH 4P5TD 2BFVL 2C3WA 4XCNB 1QKZH 5EIIA 2VZOA 5BXFA 3C6LA 3HUJA 5C0AA 3V79C 3IT8D 1MLBA 1T04B 1V3JA 1EZVY 2BNQB 1WTLA 3LKQB 2DDQH 2L0DA 4L8SA 1MCOH 2BOBA 4G6FD 5DVKA 2NY3D 3DX6A 4L4JA 4MGXA 4DUVA 4FQLH 4HXBH 1JN6B 3QUXC 3N1QC 4PR5B 4K3EL 4YFLF 3MV8D 1MCRA 4P48A 1FVCB 3RUGB 4MA8H 1A02N 4HD9A 1KTLA 3QISA 4WV1C 3CPLB 3FRUB 2CR3A 1QO3A 3QI9B 3HMXA 2CRZA 3FONB 4Y19B 1U93A 2D7TL 1NDGA 3HG1D 5INDB 3WN5A 1N8ZB 4BH8B 4WI5A 2BP3A 5C70A 3LKRA 3MLTA 5BOZG 1J1XH 4KRPD 4LRNH 5DJ8A 3WNKA 2HLAA 3ROOB 4NRZB 1NC2A 4PRAA 1FH5L 3KYAA 3CX5K 3QUYA 5DMGD 2JK5A 3WIHA 5FOBB 3JWOC 5ISZB 1TDQA 2ICWB 4K3GA 1RZGA 3H9SB 1FH5H 5FYJD 2VE6A 4POUB 3FN0L 3VWKB 4NCDA 4HGMA 1NCBL 5ITFA 3U30C 2NY4D 4DGIL 4NO0B 4WGWB 4HJGB 4PRHA 4PLKD 4KDTC 5I74C 1IGFL 4F7PA 3D0VB 1J05B 5FA4A 4OZGA 4M48H 3WKNA 3MFFB 3RHWK 2EYTB 3HPJB 5KSVB 3BKCH 1BBJB 3O8XA 3U48A 4AM0B 4JFQA 2VMFA 4N0CC 5D7JC 3GB7B 3N0PB 4FQLL 5TDNA 5ADPL 2DQHH 3QUMB 1CIDA 2Z93B 2NW3B 3VDCA 1E4XL 3EYSL 2UWEF 1GGTA 2DIAA 3TVMA 3L7FB 1HOCB 3A6BH 3OKKB 2DAVA 1MJ7H 2Z0BA 3QRGL 3ULVC 1J0IA 3CSBA 2JJWA 4U2YA 3NZHL 4D9QE 1IGYB 2NW2A 5HTSA 3PHSA 1I1RA 3CDGB 2E6QA 3KHOA 1BVKA 3HR6A 1LO4H 3BKJL 3SKOB 3VH8A 3EJZC 3H9ZA 4HH9A 1A7NH 1RFDL 2PTTA 3HA0A 4LEXH 4DTGH 5C0NC 3KWWA 3ZL4H 4XNUL 5EUKA 4PBVC 1DLFL 1RMFL 1X7QA 1IL1A 2FB4H 5LXGL 5B3NA 5IMMA 4DEPB 4P4RB 3D6GA 2VLRE 5DJDB 3VXQB 3DV6A 4RNRB 4JDZA 3RX8A 3QFJD 1ZS8B 3UTPD 3MJ8B 3GMOA 1T2QL 1A1NB 1A9EA 3S37H 4MQTB 4IRSA 2DLFL 2CGRH 4PRIB 4RRPA 1HHKB 3O41A 3BFOA 4OZHF 4JDTH 1FVDA 3CFDA 3B3IA 3I6GA 3CH1B 2BJML 1MRFL 1FNGA 4JDTL 3NTCH 4IRZH 4YWGH 1E4XH 5DO2D 5KAQG 3QDMD 4TNWF 1QFUH 3K80A 4A6YL 3OJDB 3BPCA 4J3VA 1GCFA 2PYFB 3SGKA 1HILA 4P2QD 1OAUH 2DN7A 4EN3D 4X7FC 3SBWA 5C07D 1HHJA 2IF7A 3BP6B 3OB8A 5EC1A 1JGEA 4L29B 1BZ7B 5D7SH 1DUZB 3MJ7B 2OJZL 2ZWLT 1Q0XH 2CRIA 4K8RH 5MERA 4OGXL 1U3ZA 5IWLC 4LSUL 1CDUA 4HIIB 2VDQL 1T3FA 2GAZB 5ICZA 4G6AC 4CVZA 4OCXH 3TA3B 4KRNA 1KJ2L 3VXUB 1E4JA 4GOSA 1ZXQA 1AGBA 2EDDA 2VYRE 3ARDC 5E70A 1O0VA 3PWLA 2OJEA 2GTWA 3CSPA 3PDGA 3EOTL 3MC0A 4RISL 2IMNA 3EYUL 4WW2F 4R26H 3ARDB 2UUDH 1ZT4B 1XZ0B 4WUUE 5IQ7L 3IB4A 1I3VA 3UTSD 3BPNB 4EXKA 4M7ZC 3U4BH 5F7WC 5KSBE 2YPLD 3OR7B 5C09B 4UT9L 3DRQB 1KCVH 2BNQE 4HWUA 2EYRB 5DURD 5D70L 1I1AA 1FZKA 2O61A 2HA1A 2HFTA 2DQTH 3DYMA 2R1YB 3HE6C 4KKAC 1OAUL 3PP3H 5IV2B 2PO6C 4U6YB 1TETL 3ORJA 3JUZA 1S3KH 3P3YA 1MCJA 1U92A 3SDDC 3HE6B 2C3VA 3MOAH 2NY7L 3UDWC 3CUPB 5GZOD 1BF2A 1H5BA 2X4RA 1IM3B 1EHLH 1I9JH 4I0PA 4R2GC 3QDME 5TH2B 3MYJA 2W65B 3CZFA 4OD3H 3RY6C 4NHUA 5IMOB 3RZCD 4HLJA 1D5ZA 1AGDA 1E27A 1MQKL 1MCKA 3OKDB 3TH4T 4Y16D 3L5XL 3GKWH 5KVGL 1L9MA 3FHQA 1L0QA 3ARGD 4WWKD 1K4DA 4MD5B 5IJKC 5HYFA 4X4ZA 2R4SL 5C0CE 3X14B 1H3VA 3KLAB 1YEGL 5DMIH 2J8UE 4X6CF 2XN9A 4MA1C 3LZFL 1CG9B 4J3XA 2EYSA 7CGTA 5MENA 5H37G 4RFNB 3MRGB 3O9WB 5HVHC 2B7DT 2M2DA 4F3FB 3D87B 2CO6B 3K4AA 4WY7L 5GGRB 1ACZA 1P7QB 1I8MB 1DBML 2XQBL 3FRPA 3BT2H 3O2VH 5CJ5A 2FO4A 3LKOB 3TCLA 1KLFA 4G3YL 5ETUA 1CFTB 1FIGH 3PHOB 5E9DD 1J5OL 1CDIA 4X99B 4KDTA 4K7FA 4RIRA 2IANA 3GSOB 5IW1B 4YXKL 1G6RA 5DD1L 4F7MA 4PJIB 4PGEA 1EHLL 3K74B 4KK9C 4TN9A 3C08L 4XB7A 1CD9B 1BQLL 4G6KL 4LDLB 1D9KB 2VTFA 5TH2A 1RZ7L 1T1XB 4YZFF 4P5MA 5MI0B 3I50L 4APQB 4MA7H 3TN0B 3MO1B 4HHAB 3FB5B 1I9EA 2JELH 3THML 3G5ZA 4OGYH 5CSBA 3B9KC 4MZ3A 2CLVA 3UPRB 3JXAA 4XC1L 3NFNB 2NY6D 1FHGA 4NRXA 1R3HA 1YEGH 5JIIA 1ZAGA 2YN3A 5LGKA 3B9KB 2NY0D 4IRSC 3C5SB 1ZT7A 5IB3B 4LVHB 4YHLL 4CADB 4KFZC 4X7SL 5CZVL 1OM3L 1EEYA 4UAOC 5GS2D 4LLYA 3NABL 2Y36H 3VCLB 2CLZA 3QEQE 1MJ8L 1RUAH 3WNPA 4KXZH 3U83A 3O2VL 4C56E 1OVZA 3IGAB 5DT1H 4KHTH 4YHPB 4BUGA 3QSKB 4HV8A 4QT5A 4DAGL 2EDKA 4PYHA 2F9BT 4QHLA 4MCYA 3PE9A 2A6JB 2X9XA 4NKDA 4LKXA 1PDKA 4EI5B 4JRWA 1LDPH 2OMBA 3A67H 5T5NG 4DUXA 3QXVA 3QDGE 2OBGA 5E6ZA 4GKNB 3UTQB 4LCWD 4Z77B 3K7UA 2PW2B 3N50A 1BQLH 1UXSB 3A67L 3Q48A 4Z0BL