4P5MB

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
199
Chain Sequence
QAYDGKDYIALKGPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 43
structure length 199
sequence length 212
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5mB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5mB01
3MRHA 3DHJA 2MCG1 2CO7B 4KPHL 4YO0A 2DKSA 4LEXL 4PJDE 1T4KB 2EH8L 4ZUVB 3T0EC 4EI5B 1MI5A 3HAEH 4M62L 4IMLB 2GK0B 1QFWH 1YN6B 2VLLB 5JOPD 3JV5A 2ICWB 4G6AC 3C8KB 3U0TA 4O58L 4WFHD 3CDYA 2CRZA 5J9PA 2JELH 4KJYA 4KMTH 4RZCB 4YXHL 2BVQA 1KXQE 3BP4A 2J6EA 5F21B 2LABA 3QWRA 3F5WB 2NW3B 3QI9B 2HRPL 5BZWA 1QA9A 5MHSD 5GRUH 5J8OA 2NYYC 2WQRA 3MRRB 1NJ9A 1IAKA 2A38A 1R24A 3M8OH 5D1XC 4JZNB 4QRPE 4F15C 2H32A 3I6KB 1JI1A 4ZTPH 2P45B 4DGVH 1T22B 1OW0A 2WIIA 4DZ8A 3C5ZC 4HCRA 4PJCA 3TVMD 4LHQB 1T5WA 4OLYH 1J1OL 5E8DH 3OBAA 2HJKB 1FVEA 4N0YH 1ES0A 4XPFH 4UOW1 1CCZA 3G5YA 4RMTA 4OUOA 3TM6A 5LGJB 1I8LC 3TT1H 1FVCB 2NY5L 5K9OB 5FGRA 2C1PB 2NY4D 4JFDD 5KSBB 1QSZA 2VDRH 4KUZL 3HE6A 2JELL 2NY4C 5F96L 3BD5A 3GSVB 3F7PC 4DN3H 5B8CA 5FHBL 2EEBA 4YLQT 4PGCA 3VXNA 4R0LC 4ALAL 3PQYD 1S8DB 1GZPB 2E7MA 1N2RB 5EO9A 5DURB 1AR2A 1UB6A 5HYJE 3UTZA 2VE6A 4JPWL 2WWKO 1T89A 1B3JA 4HEPG 3VFVB 2BC4A 1A7OL 2ZG2A 3D6GA 5K9JL 4D8PA 4Q9QH 3G6AA 2W59A 4QRQB 5GGTH 3BGFB 2WSKA 4Z0XA 1MAML 1PD6A 2FYYB 3N06B 3ORJA 3SBWC 3V52L 1FV1B 3UTPE 4DFHA 1YUHB 1FO0A 2DM4A 3HE6D 5ID0A 1BF8A 1WWWX 4JFEB 4TSAL 1IC5H 3S36H 1YA5A 2AJZA 3PV6A 2D9CA 1T20A 2AEPH 1VFAB 1A1MB 3O6MH 4UT6L 1GC1L 3VA6A 3EGSB 4NO5B 3H7LA 2AK4B 5LVEA 2RCSL 5IVOA 4O51A 5GGUB 5EA0H 1X5GA 2VXVL 3G6JA 3M8OL 5H94B 3BVNA 4D3CH 4NQEA 2I26N 4YUEH 5DZLA 1UWGH 1LEGA 4UAOC 5ISZE 2C3VB 5EU5B 1CICD 5KN5A 4FOMA 2VDOL 4XCEB 5I1EH 3MBXL 3D0VB 1EZVX 3FQUA 4JDZB 3WSQH 4JQXC 4EEEA 1YZZA 3GI8L 4PRIA 1IM9A 4FS0A 4LCWE 2LU3A 4JZJC 4PGBB 5FM5M 4M7JH 4HMCA 3A0OA 2JF1A 1PQZB 3GSNB 3SGJC 4GSDH 3SGDI 3GO1L 3F62A 4HFUH 3VGAB 5BV7H 3ZHLA 1CICA 1I8KA 3HI1B 5I8EB 3K80A 3RGHA 4ZUSB 3VG9C 5DQDH 4JHAL 2G9HB 3DVGA 3O2VH 3P11L 4GKSA 1A9EB 2NR6D 1U3YA 5CEYA 4WU7B 3BYTA 3GKWL 4DGIH 1XF1A 4DK6A 2NY4B 1NGXA 4HH8A 2VZ1A 4JFDB 1NAMB 3DMMA 3FQNB 2X4OB 3VXUE 4E41E 1IGFL 3TBYA 1I8KB 3HI1A 3O9WC 4R7NB 3NGBB 3WO4B 2R2EB 3MRFA 2J8UA 3CH8A 1X5LA 2EDJA 4B50A 2AKRA 4MZ2A 4L3CB 5ID1B 3VMOA 4YHZH 1SEBB 1FORL 3MLYL 4KHXL 3QCUH 2K3TA 2NYYD 4R0LA 3B9VA 3BPOC 3AS1A 4LP4A 2CLVA 4FN0A 3LVEA 2EEAA 4NO3A 5BCAA 1G9MC 4QF1A 4LAQL 4UOW0 2XYCA 3ARSA 4I48A 4GRLD 3T3PF 4PG2C 1EH9A 1IAOB 2DJUA 4Y4FC 4PR5A 5DC9B 1G6RB 2B0SH 5AG9A 5ACMA 5F9JB 4F7TA 1AHWB 5GGUA 2L7UA 4LKXB 5E2VL 4YZFF 4IM8A 3KPPA 5FF6B 3C2AH 4UT7L 3UJIL 1K2DB 1T0MB 1NCAH 1INEL 2GJJA 1A6PA 1I1RA 1OPGH 3MRIA 1VFAA 4N1EA 3P30H 4OD3H 1FFPA 2AS5M 3RNKB 2LV4A 3O11B 5C07E 4OGYH 5TGBB 3UZEA 3AB0C 2I5YL 5SX4H 5DUPH 5CEYB 5IVZB 4S1DC 4IOIB 3KLHD 3DX8B 4D0DB 3OR7A 2VXTL 2HT3D 1ACZA 4RNRB 1G9NL 5D1QC 5IFJB 2JJVA 1HI6A 1OAQL 2OTPA 3VGEA 4QHNA 5D2LA 3BHBB 2YUXA 3HS0A 5DA4A 3K4DA 5BOZG 4G8IA 1A4KA 1ZANH 3V7AG 3B3IB 3BSZH 1D5ZB 3OV6A 5I74C 3MGOA 3S97C 3MNWB 1TZIA 3PV7A 1YEGH 1KPUB 4OZFG 1FVDB 1CFTA 3L3KA 5AZ2L 5J6GB 5D8JL 4C58B 2I9TA 1LEGB 3V0WH 1D9KA 3WO4C 4LVEA 5I2IA 3MRQB 2J5LC 4U7SA 4YR6A 3X11A 3FFCB 1DUYA 5C0NC 2V2TB 1WITA 3F65A 4CRPA 1ZK9A 3S5LG 5IVNA 5F71A 3TESA 3U9UB 2KH2B 4LSPL 2XACC 4WW1A 2GSGA 1UVQA 1IGML 2V7HA 5JW5B 3EO0A 4KH2A 5IFHL 4G6FB 5D7KD 3D9AH 1X4YA 5EO1A 4HJJL 4HBCL 1A0QH 4V2CB 2FBJH 2UUDK 3MGTA 3JTSA 4G8FB 2BSED 4XCNA 1T03L 3GI8H 2O5YH 4FP8H 5E5MA 3LN5B 5ENWA 3QXUA 4JG0H 3MLVH 1AY1L 5A2LH 3H9SA 1FSKC 3IXTB 2VDQL 2FJGA 3FOMA 5IMMA 1G9NC 1LILA 5TE6H 1CXIA 3TV3H 1A7QL 1PLGH 1SY6A 2DQIL 2NX5E 4Z78B 1YEJH 4XP4L 1UCBH 3KPRB 1GGBH 1OP5K 4K7PX 2FSEB 3ZKSD 4AT6B 3Q6FB 4QCIB 1WCQA 3WLBB 1CDYA 4HK3N 5DJ8A 2Y7QB 3U0PB 4IMKA 4PJ5E 2DTSA 4KKCD 4GW1A 3JSSA 3NH7L 1T7WA 4M4RA 4YQXH 3RVVD 3F6LA 4GW5B 1AGFA 4MA8L 4B0MM 2HFEA 2GY5A 5F1IA 2FWOB 1BD2B 1GVIA 3CFDB 3LKRA 2EZ0D 2GIYA 3VRJB 2Y5TA 5E08L 3IGAA 3FB7A 3MXVL 1OGAA 3T8XA 3OAZH 4OLUH 2OZ4H 1G6RL 4CKVX 4DOHE 1KJ2H 3H9HA 4FQIH 2APBA 1HXMA 5F70A 1GGYA 4H1LH 4NN5C 2LTQC 2DS4A 3EDEA 4TNWF 5FB8B 1IC1A 2XTJC 3N1FC 2XKNB 1YEDA 2YZ8A 1LP9B 4WFEE 2Q20A 2CK0L 3LMJL 3F58L 4LF3A 1QBLH 1B4JL 4DN3L 4AEHL 3WNMA 2GJ6B 3DV4B 3ELAT 4M6NL 1OAKH 5I1KL 4ZPTB 1P9MA 2QQNL 4K8RC 3MLSL 4Y4HC 1TVBA 2EKSB 4HKBA 4HIXH 3FQTA 1A2YB 4E5XB 3J8F7 4HZLA 3SKJH 3KPSB 4OAWB 5C9JB 3RU8H 5KG9A 4LQFH 1DFBH 4PP2B 2ZCHL 1FQ9C 4XVSH 4FQXC 1FNAA 2NY3C 2A6JB 4MAYA 1KTLB 1S9XB 1MREH 4FMKA 2D3VA 3B5HA 4OZHB 3DXAA 4JVWA 1CT8A 4MQXC 2V5TA 4PP2A 1HYSD 1ZEAH 4HPYL 5JUEH 1FIGH 3DVNA 4HZLB 2E8ZA 1ZHBB 4HIIA 4ZSOE 5CINH 1MCKA 1H15B 4DVRH 5IEHB 4HCRH 4RAHA 2XNAB 1NCUA 4GMTH 3O6LL 1J88A 5IROC 1W0WB 2FH6A 3MRKB 3IKCB 2VDML 2VDLH 4DK3A 4P9ML 4RFOL 5HHXL 4LVHB 4M6OH 1EGJA 3SDXB 1ZT1A 2YN3A 4HGKC 4J3SA 4UBDC 2CIIB 4HT1H 1HEZA 1ZT4A 2MSPA 1RZGA 2SEBB 4PJAF 3V6ZA 1E4JA 5GGRA 3WKNA 5DMIH 1DN2A 2C26A 4XNUH 3MNVB 4PBWD 3B2VL 3HNSL 5FHAL 5J1AA 3MLVL 4PG9B 3BPCA 5EWIH 3IGAB 4K2UL 4DJMA 3A67L 4TPRL 1IRAY 4P2OB 3MACH 5I1LB 1BIIA 4EI6A 1EK3A 4LLQA 3BT2H 3VFRA 1UACH 3IAPA 5HVHC 3WO3B 5EBLA 1U8LA 4LSPH 3U2SA 1KCKA 5DQJA 3UTTA 5ADPL 3DETC 2EDRA 2ZUYA 2Q86B 4YHOH 1D5MB 1Z9OA 1OTUD 2NY2D 5GGVL 1S9XA 3PL6A 3PWVA 1AO7D 3KNBB 3MXVH 3H3PH 2W1NA 1FGVL 1X5AA 3QUXC 2PW1B 4U1IA 2RFXB 1JTTA 1WV7T 3WXWH 4H5SB 2A6DA 2APFA 4HS6B 4LCYB 5FGCB 1S7SA 1JZ2A 1F3RB 2CRIA 4X5XA 5SX5K 5HDLA 2OXHA 4ZPTA 5AUMB 4NQDD 4AM0A 5HYFA 2GITB 5ICYB 2ATKA 2HJFA 2Z93B 3MGTB 2YUWA 4B53A 3CC5A 3V6OA 4KDTA 5AAWA 1NGWB 1WC7A 2UWEB 1JN6A 3MLPA 1GGBL 1SYVA 1JNHB 4HEME 5FDYA 3RIFK 4R7DA 2BNUB 1LK3L 3TV3L 2BFVH 3KPQA 4XHQA 1G9NH 3H9HB 1DCLA 2A74A 5C70A 1DEDA 2IH3B 4I2XB 3BP5A 1KC5H 4NZDA 2H26A 2DWEA 4M61B 1SHMA 4Z7UE 3RWJB 4ZG1A 4NRXA 2EDXA 1RZKC 4KKCC 4OF0A 5MEND 1A7NH 4HJJH 1CDJA 1IQDA 2VQ1B 3H9SD 1F8TL 2IQ9L 1OWRM 3LZFH 1U3JA 3UTPD 1KLGA 3BXNB 4JDVB 4GJTB 4KRNA 4L8SA 3S34L 1R5IA 3ZO0A 5GSVA 4FQXA 3B3IA 2OL3H 2G2RB 3HCVB 2H2SD 4PJDB 2H9GB 3QQ4B 4I18A 4OKDA 1JFQL 1MFEH 2XKUA 1J0JA 1MRDH 4HJ0C 2MCPL 1QFUL 3E6FB 1AGDA 5I66B 3QSKB 3P9MA 1N7MH 1J8HB 1EZVY 2BJMH 3QR2A 2M26A 1UQSA 3C5JB 1V3LA 4RAUB 1EHLL 3FOMB 4PJCF 4OLVL 4S1QH 2PXYA 3H9SB 4Y5VC 4ZAKB 4V2BA 1QSEE 4D9QD 1UADC 4P9HH 4GFTB 5CZXC 1KB5L 1N3NA 3PWJB 3HUJE 5FEBA 2AEIT 1D3CA 1DVFA 2QQKL 5IHLB 2DTML 1JYWA 3KPLB 1ZVSB 5E8OA 1U93A 4LLYB 3WN5B 5FF6A 2X2YA 4GBXC 1RUAL 3BKJL 3CX5K 3D3VB 3VGBA 1TJHL 5KJRL 5ESVA 1FYTE 1XGPA 2HH0H 2X89D 2EE6A 3W82A 4PV8B 2NY3D 1T5XA 2FLRT 5TF1H 3FB6B 3U7YL 4WI7A 7FABL 4I4WA 3CFKA 3ZYJA 4WI4A 5LG1A 5TH2A 5JIIA 2FH8A 4OD3L 3TC9A 1OPGL 1M05B 1KPUA 1MHEB 2CRYA 5D7JB 1UB5B 4CN4A 3QDMA 4U2ZA 3IDYC 5DRXA 4U6HA 1AFVL 1ZHKB 1T1YB 1NMCC 2VR5A 3TBSA 4HC1L 3QUZA 1GH7A 2L4OA 4L3CA 1V5JA 4EQ2A 4UV4H 5C0CE 4ZYKB 4HKZB 4OGXH 3T2OA 1FN4B 3MYZA 4YDJB 3U0WL 5HHME 4DN4H 3O3EA 1K8DB 2FEDC 3D0LA 3MBXH 4RISL 1I7TB 3N9GL 5IFAH 4ZS6C 4QXUH 2AJSH 1EEYB 1E4KA 3G08A 3L7FB 1I4FB 1X5IA 2R2BA 3G6JF 2BY1A 4APQC 1EBAA 1LO0H 1MHPL 4P2RB 2Z91A 3WFCH 3MO1B 4I9WD 4D3CL 4ENED 4RMVA 4ONOA 2EDFA 1K6QL 2P8PB 1EEYA 4BFBD 1MJ7L 4K3EL 3CZFB 4Y16B 1CFSB 3LV3A 4HF5H 4MJ6A 5J89A 1PQZA 1QEWB 3JV4B 3RZCD 2AJYH 2HLAA 1WEJL 1PGRB 1NEZB 1OSZA 4KDWA 1XF5A 3QI9D 1YN7A 1S9KC 5IB1A 3QUZB 4PJFA 1GGCL 5DZOA 1ORSA 4HKXB 3OSKA 1A7RL 1YNLH 5L2JB 2F19L 1EUTA 4PJIA 2Y06L 2YA2A 1NEZG 1MHEA 3O2DA 4R8WH 1HKFA 4PGEB 5C07D 4TTGA 4PJIB 2D0FA 5MERB 3WNNA 4GSDL 3QEGH 2Z4QA 1WFOA 3RVXC 4X6FB 3FOLA 3SQOH 3WN5C 4GBXB 5FOBA 3MODL 1KCRH 1W72B 3TIEA 3KPNB 4XC3H 3UO1H 2GHWB 2ZWLT 3I75B 2BDNH 4GAGH 2PYED 4GBXA 5FOBB 1JWUA 3EOTL 4YAQB 2J88H 1LK3H 3T4AA 1OD9A 3IDUA 3PABB 2D7MA 5DJXA 3QFDA 4KRPC 4PJ7F 2DQJL 5I1EL 3DMMC 3GGWB 1A1MA 2K7PA 1J05A 1KENL 3OPZH 5HYIA 4OD2A 4OFYA 3NCEB 3MUGA 4G9FD 4KTDL 5JW3L 3DIFB 2YK1L 3LD8B 4E41A 2C1OA 2WBJD 2NY1D 3BGAA 3MRPA 4POYA 2PYEA 4GBXD 4IJ3B 5FYKD 1R3HB 3LSOB 1YPZB 3MC0A 5KOMC 4NWUL 3O0RL 1F6FB 2PO6B 3U82B 4LOUC 2P5WE 5DLMH 3EO9L 3CZFA 3ZT6A 5J06A 4FXKA 5KOVC 1KFAL 3MJ7A 4ZO8A 3U6RA 5DTFB 1OCWH 3K1DA 4RMUA 2EXYC 2XV6B 4P3WA 3MLXL 4QOKE 12E8L 5HHVL 3BESR 5MENE 4U6HB 1RY7B 4LQFL 1UEYA 1LDPL 3RGVA 3IU4H 1JRHH 1Y6NR 3TT3L 5H2BB 3R8QA 5B22A 5J56B 3QQ9C 4LDEB 3RWGA 4ZD3L 4TOYH 3CVHB 1IQDB 1JHLH 3Q3GA 4FMFA 2XICA 2CKBH 2J6EL 2GI7A 1I9IL 3QXDB 1DE4B 1KJ2B 3Q5OA 1ODAA 3GMPB 4NRYB 1MVFA 4QNPF 4A2MA 1WT5C 4UQ2B 2J6EH 4Z7WF 1BD2D 2E9IA 3L3HB 8FABA 5D7JA 3TCXA 1DBJL 2VLRB 1A8JH 4JO2H 2ZSWB 1PKOA 3RY5A 4P5TB 1FFOA 1M7DA 4JFXA 4X0KA 4GG8A 1R24B 4GMTL 1CF8L 3CC5B 1I8MA 1J0IA 1JNNL 4BFEA 1KXVC 4U3CA 3FB6A 5SWZE 5CJBA 4IOSD 5B3JF 2WUCL 5T33H 2V2XB 4TVPD 3LRGA 3OKMB 1S3KH 4IS6A 1VCAA 4U6YB 4CNIA 2XRAH 3HTLX 2A6DB 1IKNC 1KIQB 1VKXA 4PJFE 1UB6B 3BUTA 1IGTB 5D5MB 1ZGLA 1LEKB 1EDQA 1U2CA 4LSRH 4FTVD 4HUVA 3SGEH 4KKBD 3CDFA 5GRXG 3DSFH 5DVNA 5IVXA 3PDOA 5HYQA 4HDIA 3LKOA 2DQIH 4JY6B 1JZ6A 3WFDH 4JFFE 2QQLH 4NBXB 2DQJH 3MRHB 1A02N 2IPKA 3PGDB 2A0LD 1ZTXH 4OI9A 4FNLL 1SEQH 1YEHL 3IFOB 4M61A 2NY7L 1UZ8A 3QQ4A 4NDMA 4XT1C 2CSPA 4MJ4A 5ISZA 1RHHA 3F12A 4ZODA 3U30B 3HNTL 4OM1L 2QADB 1JNHA 1WTGT 2D2OA 3O4LB 2B5IB 5I0ZA 1JN6B 3EYOA 3D48R 1NC4B 3VDBA 4HFWB 7CGTA 4TNWK 4WW2C 2W65B 1MCNA 5F7HA 2H2PC 3WUWA 4N5UA 3NCJL 5I1GH 3EYUL 3U1SL 2O5ZL 4JM4L 4BSWA 3VJ6B 1AP2B 2BVOA 2LQRA 3WL9A 3DHMA 3KLAB 1RUKL 4P4KA 3L5IA 3PHSA 4LSTH 5E8OB 4FA8A 1WC7B 1FFNB 5EOQL 2VH5L 2HYMA 3IJHB 1MQKL 1WBXA 4NHUA 1RZKH 1HHKA 4O02L 2JJTA 3LQMA 2F8OA 5EDXA 2OSLA 3P4OA 3SDCC 5BZDB 2JCCA 2APTA 4TUKH 3OWEA 3MOQA 1QO3B 4L8SC 4GAYB 3ZHDA 1WWAX 4LCWA 1PLGL 1UQSB 1XGQA 4FQLL 4N90E 1BIIB 4EI6B 2VIRB 3L5WB 3RPIB 1KGCE 2DI8A 4WU5B 1YECL 3JTTA 3KNBA 4NZRL 3BPCB 1UKSA 4PG9A 1KIRA 3RTQD 5C0EB 2NTSP 4G6JL 4Q0XL 1N8ZB 1C16A 4C83B 4JDVA 4PJBE 1RV6X 1JWMA 2MQ0A 4BFIA 2BCKB 4UT7H 4MYWB 1OARH 2EZ0C 5L88H 4UDTB 4LSUL 1Z5LA 3AM8A 5HY9A 5JPMB 2C3XA 3RNQA 2Q7NA 5E8EA 3FB8B 2E7LC 3RY4A 1DZBA 3SJVD 2KBGA 1CL7I 5EC2A 5JR1L 5T3ZE 5I8KL 5HDOA 3WIFA 4IDJL 1T04B 1NC2B 3BKJH 1TJGL 1PSKL 1NDGA 4F9LA 5BJTA 4LVNC 1EVTC 1S7TA 3FN9A 2C5DC 2XA8H 4JDTL 1AGFB 2DLGA 3DUSB 3WCYA 2ICES 3MRKA 1N8ZA 3OX8B 4XWGH 5DMGC 5GRZA 5JXAH 3DVFA 2AI0L 2Z92A 2ARJB 5B4MC 3TO4C 5I19H 4OQTA 1PAMA 3ULUH 3KPRA 2EYTA 4PJIF 3PHQB 3KPSA 1YMMA 1SJEA 4OZ4B 5CJXA 2Z8VC 5GPRA 1RU9L 1CD1A 4KQ3H 4K7FA 4U0QB 3PHQA 2VDKL 2PW1A 4G8GE 1K3ZA 5F9OH 3FMGH 4ZAKD 1NBQA 2ZJSH 3WHE0 1PKQA 1G7MA 1G7JA 5ENWB 5TDPB 2P5ED 3MLWH 3NPZB 4TULL 3V5DB 2A6JA 5GGVY 4LVHC 1FYHB 1F13A 4Z7WE 1UEMA 2OL3L 3B4NA 4TSBL 4CADA 2YXMA 3S96B 3MRDB 5CUSL 1P6FA 1NH6A 4X4XB 5EZOL 3BGMB 4AIZB 5L9DH 3PNWB 2Q1EA 3KWWB 2F54E 2HKHL 4LGSB 4YE4H 4BH8B 4P59L 3DPBA 1JGEB 1PYWB 4X5WA 4G43B 3FO0H 3BWAA 4OCXL 3QISA 4ZUUA 4LPWA 4AIXA 1V3KA 2FWOA 4IOFC 5ICXB 3PGFL 1CFVL 3V6ZB 1P7QA 2CDFA 1JGLL 3L6FB 43C9A 3DVIA 4YXKH 2VUOA 3QNYB 3VFMB 1UENA 5GS1B 3QEQE 3A6BH 2YEZA 3KR3L 3DO7B 4N8CL 4DTGH 5KVDH 3SO5A 4OCLC 1G1CA 3IDMA 1GGTA 3O3BA 2Z0BA 1SQ2N 3IETA 3IFOA 1CLOL 4KI1A 4L4VB 4J4PD 4UIMB 3MUY1 4NKOB 3OGCB 5E8PA 3WNOA 1GC1H 3SKMB 1Q72H 2DLFH 1JZ7A 3NMEA 1KOAA 5IVXB 1MEXH 4OFDA 5DR5L 4QXGH 4QRPD 3DRQB 2P47B 1X3DA 4YK4B 3H3PL 4F57H 5GS0C 5FO7B 4WEBH 4OB5H 4NC0B 5GGVH 4X9IA 5BO1H 4MWFA 1FG2A 5GZOC 1QTYT 4PRAA 5KSBE 5D7LD 5JHDE 3KXFA 5E2JA 4AZ8A 4ODSL 1KCSL 4PRAB 5B3JE 5IKCB 4HUUB 1JUFA 3V4PL 3BZFA 5DD6B 5GIRA 4CDGC 3B6SA 3IT8D 3BZ4A 4WI9A 4G8EB 1J12A 4WI2A 5HI5C 2JKXA 1FAIH 3ULUF 5CP3H 4NQEE 4QHLA 3QEUB 2Y9RT 5C9KA 2ZNXA 5J6GA 3VFWA 1F5WA 1WZ1L 4JZOB 4G7VH 4NO2B 2DLIA 4ZS7L 3SKMA 1RFDH 3BKYL 5DRNA 3BH8A 2DQDH 5BV7C 4ZXBB 2MNUA 4L9DA 5B4MD 3WFHA 3HE7B 12E8H 5HHVH 4HUWB 1T7ZA 1S9VB 2DF3A 2YD9A 1MRCH 3FFCA 1Y0LB 4D9LH 4G8IB 4FQCH 1WJ3A 2V7NA 1MSPA 4OCSL 4QRRB 1Z2KA 3BE1L 5IF0B 5DLML 1IGIL 3L3KB 4AENB 1MH5A 2YUZA 3TA3B 1HZHH 3K2UH 2CDFB 2BHUA 1U8KB 1VERA 4F3FB 1OLZA 5ECJE 2DLHA 2EIZB 4QRUA 4YDIL 5D2LE 1I75A 5DRWB 2PF6A 2FHBA 4HS3B 1ZGLB 2ITDA 3EYVB 1E0OB 4PP1D 4EIGB 3MJ7B 1QR1A 2VQUA 4JHZA 2GCYB 5EIIA 1DBJH 1FPTH 4Z78A 3QHTC 1CG9B 2BSRA 4LVOB 1MAJA 5C1MB 3EOTH 3P40A 1F2QA 4NQSB 4AK1A 3QWOB 2VLKA 2OX5A 1L7TH 4F7TB 4N8PA 5CSBA 4EDWH 3LN5A 2C1OB 4N5ED 5H37G 2XZCH 1C08B 3JTSB 1QFWL 5CS7A 4PRIB 1IL1A 4JFPA 4NNPL 4J3UA 2DYPA 5I1IH 4MA3A 4KUZH 1VGKB 2J3SA 2JB6A 4U7KA 1SBSL 5EO0B 2OJZH 2AW2A 4TTDD 2A77H 5F1OB 2W0KA 3LIZH 1YMMB 4OZ4A 1K4CA 5BS0E 3TT1L 3QPQC 4HIEA 1QLFB 1QSFB 4JGJA 1I1AB 4ZPVA 5HGBB 2YKLL 3WLWC 4PR5B 2JJSC 1BHGA 3D85B 1SEBA 3VXUB 4JHWH 3P0GB 4ETQB 4HULB 5HGBA 3O3DB 1N5AB 4AEEA 4Z76A 4XWOD 4HG4J 2VISB 3V4VH 2AK4A 5I1JH 3RWGB 1EHLH 3PWPD 1BBJA 3KPSD 3IDGA 4M6MH 4YHIB 3WIFB 2WK2A 1KEML 2Q76A 5A3ID 3LRSA 5C08D 5JOFA 4KU1A 3SKUD 1MHCB 2ESVB 2JJWA 3V6BR 3QDME 4MXWL 5EORH 1A9EA 1TTUA 2V9TA 1QEWA 3OJDB 4ZUSA 3VFNB 1S78C 2YMXH 4Q2ZA 1CG9A 2NNAA 5EULV 4Y8AA 2H8PB 5IFJA 4Y16D 1YPZA 3BZDA 5IW3A 3VI3F 4BZ1L 1WF5A 1FL5B 3NIFF 4AH2A 4ZQKB 4O58H 3DX7B 1RI8A 2VLKE 1T2JA 1RUQL 1JWSB 1YMHA 1ZSDB 2FGZA 4HD9A 2R56L 4M5ZL 4PLNC 2LU4A 3UCRA 3WNPA 1VADB 4K23L 3ULSB 2V17H 4FQHA 3ALPA 3PDGA 4ODXB 4V1DA 1P7QD 5TE4H 3TJHC 4KTEH 4ZFFB 4TVPH 1A7RH 1YNLL 4GAYA 3V0VA 4LKXA 1WBYA 3D2UD 1PX3A 4YGAB 4FXGA 2WLZA 1QLRB 5HHOA 4LLWA 1A3LL 3QUYD 3CX5J 1XZ0A 1WEJH 3MCLL 3IJHA 4UTBH 4Z7UA 4P5TD 4XBGB 2WQ8A 3QUXD 4QF1B 4P46B 2IANA 4KY1L 5ANME 4FQ1H 4MVBC 3QUYC 5EU6A 3QHFL 3HC0A 1RIHL 2OK0H 3MRJB 4LU5H 2OK0L 3HUJF 4ZXBD 2DI7A 4LAJH 5I17B 1B9ZA 3TPUB 3BKMH 5HYJA 1JGDB 4RGOL 4NZUH 3BKML 4CL7A 5IOPB 2XZZA 1OT1A 4PJDF 3OKEB 3VXQB 4Y8DC 3ILQC 1B2WL 4QXUL 1NC4A 3MREB 5DI8A 3ZSSA 2AJVH 4TVPL 1U93B 4R7NA 1HSBB 4O5LL 4BFGA 4ZSOA 4NN7C 1T83C 1U8HA 3REVB 1N5YH 3U36B 4A6YL 3MRBB 5J12C 1UZ8B 4YDKL 4XWOC 3PP3H 3RVWC 3B2VH 3G08B 4MVBD 4QO1A 1T4KA 1B88A 1R3KA 3CZJA 4MXQC 5C0DB 2VZ3A 2R23B 2V17L 3MCG1 4FG6C 4N1HB 2C1PA 1NCAL 4HXBH 4JY6A 3MBEA 4OCRL 5I74B 1FVCA 1P84K 1GGUA 4WY7L 2VDMH 3TBWB 1YC7A 2X10A 1TZHB 4KKAD 2CRMA 5DDHB 4UINH 1CDHA 3HE6B 3HG1B 4OTXH 2CIKA 2NX5B 3NAAL 5IESH 3H3BC 4OZGA 2YMXL 5JIPA 3E6HB 3GSQA 3PIQA 4JRXA 1P7QB 3L9RA 5K9OA 4XNMB 3GMRA 3OJ2C 3OKMA 4J2XA 3WFEL 1EV2E 1I1YA 1IAKB 4PJXB 3FN0H 3D18B 2Z31B 1LO5A 3UBXG 1U92A 4POUB 1IILE 4ZNEE 3BI9X 4ZS6D 4TQEL 4NQTA 4DZ8B 4R7DB 1SYSB 3L3IB 2ADGA 1KGCD 1EMTL 3QUYB 4JY5H 2WIMA 4Q74A 1MJJA 2OJZL 2IG2L 2CDGA 1DVFB 4IRSC 4O2CB 5E9DB 5I1KH 1AD9A 4U1HA 3RDTC 5AD0A 5EU7E 1R5WA 4JGUA 5FV2A 4XI5C 4OSUL 4AL8L 9CGTA 3U4BH 4XC1L 1L7TL 1PBYA 3MOAL 5FA3B 1F02I 3L9RB 5LAXB 3C5JA 3TO2A 2YBRA 4KK9D 3LEVL 2DKUA 5ITFA 3ARYA 1RK1B 3O81A 1FZOA 3F7RA 4JO4L 2GJ6E 4MD4A 5E56A 3UTSD 15C8H 3CMOH 1P5UA 2AAVA 4WTXA 1QPPA 3TBWA 2B4CL 4MJIE 1M6OA 5JO5A 5SWZA 1EX0A 2F74B 4PTTA 5DUBA 2AJUH 4EI5A 3MOBL 3C09C 1O5DT 4XMKH 4UQ3B 3F8UB 1UC6A 5BJTB 2AK4D 5C0AA 1UXWB 1TETL 4NQUA 3BZEB 2WANA 4JRXE 2VQ1A 2FR4A 1YY8B 1I7RB 1HHGB 1IC4L 3L5JA 1FH5H 4JAMB 4XPHH 3T1FB 3DIFA 4OBRA 2Z8RA 2OI9B 1DANU 1BJ8A 4JJ5B 3RNQB 3HNVH 4JO1H 5JPNB 3NABL 4FFWD 2A74B 2BX5A 1FJ1A 3IF1A 1IGJA 5IQ7L 4BH7B 1W0VB 2K1MA 4A6YA 3O45A 3QDHA 1GC1C 1RZ7L 4XHJD 2Q3ZA 3L5XH 4GUPB 1EO8H 2YA1A 3OKEA 1OP5H 2Z93A 5HHPA 3ZKXC 3GBML 4G6AD 5ANMA 2UYLB 4P59H 3VXMD 3SDXE 3TBTB 5ADPH 1HIML 5CJ8A 2HRLA 5MI0C 3QJHA 4UV7L 4BQ8A 4X5XB 1XGQB 2NY3B 4G7VL 4LCIH 1GSMA 3HI5H 2DQUH 3O8XD 1ZLUH 5EU6B 4P2CG 3KJ4B 3D3VD 4TVSa 4L4VD 5F7WC 2FHCA 3GMQA 5A2IH 3NN8B 4OZHA 5BO1L 2OQJA 4J3TA 5BZDA 5ALBH 4ALAH 3L3DB 3VXRA 1B4JH 4JB9H 4WEBL 5A2JH 1QYGH 2BOCA 5F89A 1KBGL 3MV11 2OQJB 1YEKH 1SM3H 3FZUD 3S4SA 4DAGH 1MCIA 4WGVB 4QRPB 2X5PA 3TZVD 2IANE 1CGYA 2EIBA 4RGNE 5I1LA 2F15A 2FJFA 4PJAA 5A2FA 4OCWL 4X98B 1EJ6A 4R6UA 4MLIA 3I9GH 3FL7A 2QSCH 3HZMB 5I19L 4PYGA 1WBZA 3MO1A 4WV1B 4UZGA 2X4TA 5DJ0B 5DR5H 5E00B 1T6WA 3TNMB 4GXVH 4FZ8L 4POZD 5HHOE 3EYOB 3SGDH 1A4JB 3TH2T 1JPFA 2ITCB 2E6PA 1EEQA 3OAZK 1I7ZB 2X40A 1K5NA 3N1QC 4NNYA 4YDJA 5FO9A 1SJXA 1AR1D 5HHQA 4O9HL 4Z6AT 4M43H 2DDQH 5CAYB 4JVUA 1G7IB 3EHBC 3EUUA 4OCXH 5AWNH 4LSVH 4RX4D 4S1SH 5IBTL 1HHGA 3MJGX 4MAUL 3LOWA 5EUKA 1F11A 1LE9A 4AEIL 1JHTB 1QVOB 4ZOAA 1B6UA 4OKVB 1ZHBA 3MLSH 1E28A 2NY6D 2HLFD 2BSTA 4B7LA 4RRPG 3QUXB 2ENYA 4KMTL 2DYPD 2YRZA 5D2NE 3BEWA 1HH6A 3GMOA 1MLBB 4C57C 1LEKA 4G8GB 1KJMA 5FIEA 4XX1G 2ZOLB 1JJUA 3L7EA 3ZKNC 2ZJSL 1KT2B 4L9LC 1ORQA 2VZOA 3LS5L 4OAWA 3WN5A 1EXUB 3QIBC 2C4FT 3FT2B 2EE2A 4KQ3L 5DC4B 4XCYA 1G6RH 3ARGD 1J87A 4WUKL 4L8BB 4JFPB 1IL1B 1N6VA 3OKOA 4F57L 3KPMB 3AUVA 5TQ2H 3NCBB 2RJMA 4G8FA 3CDGA 5KANG 5F9WB 3OKOB 5BS0A 3EOYG 3ULVE 2IMMA 1FFOB 1EERB 1M7DB 1Z3GH 3VXOB 3S88L 5DVLA 3QHZH 1WAAA 4N68A 1SYSA 4HWBH 3FO9A 5CBEA 1DBKL 3QHZL 4OGZA 1BM3H 2FBOJ 3GSOA 3UYPA 3UTQA 3E6FA 3QO0B 1QRNE 1KJMB 3ZYIA 3I6LD 5I0DA 4F80A 2ADFL 3VGGA 3VRJA 4MAYD 5KVDL 2AXFB 5INDA 5IB4B 3KR3H 4I0PC 2PR4L 1J0HA 2VXUH 1B6DA 1RIUH 4I18C 3EBAA 5CIPB 3TYGL 4NQVA 1KB5B 4JN1H 2VSCA 3PG2A 5KVGH 2R1YB 4JLRA 2O5YL 4FP8L 2OMBA 5D9SB 3LN4A 4Q7DA 3BOVA 1A6ZA 2NY7H 5JHLL 3VI3E 1FE8H 4XAKD 4J3VA 5FYKU 3WFHB 3BH9A 3J7HA 1GZQB 1U36A 5KVGL 4ZFZA 1U8PB 5CBEB 3DUUB 3PDDA 5DMYA 2XWTB 5F7FA 1NBVL 2HVJB 1JNLL 3UMTA 4M8QB 2DIBA 5CSZB 5EIQA 4OI7A 2UUDH 3N0PB 4I0CC 5DJ2B 2PYEB 3WEXA 4J6RL 4FRWA 4Q0XH 4KK8D 3GSUA 4JZJB 4O02H 2AJ3A 1UM5L 5C6TL 1W8OA 1U8HB 3LB6D 4P3CL 1WIUA 4K94H 1RURL 1J05B 1RU9H 3UPRA 3C9NB 1XCTA 3STZA 2LE9A 5B39A 5BOPA 3O4OB 1TQBC 4C59B 1PY4A 1WCBB 1OAXH 1ZANL 3OKNA 4RMRA 4IRJD 5LQBL 1OD7A 3I75A 2P1YA 3NIDF 4YHZL 2BOCB 5F89B 1KNOB 5LQBH 5HDQH 4YR6B 3VCLB 5KVMC 2VABA 4RAVA 4X9HA 1CXEA 1D9KB 1T0PB 1WAAF 5T1MB 2IBZY 3TZVC 3BQUA 1FNGB 4X6DF 4XZUA 4XB8A 3SY0B 5IEKB 1EAPA 5EUKB 3FQWB 4P46A 4RWYL 4L4VA 4JM4H 5F3BB 1QFHA 3GMMB 4EVNB 2GT9B 4G9DB 5GISH 4DKEH 4F9PA 1QLRA 2DLTA 3U83A 3O2VL 5HGDB 1RJYA 1ED3B 5D2LB 4GUPA 3DO7A 5A40E 3D39D 2Y6SC 3GIZL 2ERJB 1JHLL 3GO1H 2B20A 3QO1B 1A7PL 1ZT1B 3KHOA 2IGFH 4YDLB 2MJWA 1NAMH 1NKRA 4WHYH 4AEIH 3O2WH 3TT3H 5JHLH 4MA7H 2YD4A 1R3JB 3A6OA 4NCC2 3OAYK 5LJYH 4NZRH 4IOIA 4ZFGH 2BVPB 5J57B 3ROLA 5D7IA 1PX4A 3D39B 1H15A 2J12B 2VDOH 2CUMA 5CBAA 1L0XA 2A2QT 4UQ3A 4HUKB 4X7SL 2R0KH 3ALWA 5FECB 4WHYG 5GGSB 4GW4B 1FRGH 2ADFH 2XN9E 3G9AB 4MX7B 4WHCA 5I16A 1IM9B 4XCFH 4F33A 4PTUB 3NOIA 4JM2A 5CEZE 2P5WB 3ARZA 3QRFM 3CU7A 4NKMB 3SPVA 4CAGA 2BNRB 3JBG7 3OTTA 4Y1AE 5IK3B 4XVUC 4F7MB 2OCFD 1PEZA 3LQZB 4PB0H 1Z3GL 4RGMB 5TF0A 5SX5H 1A6WH 4Z95H 2D7TH 1BLNB 1UGNA 4X6CA 1BMGA 4S1DD 5DYOB 3EYUH 1I3GH 4MNHA 1X5KA 5HBBA 2D03L 4FZEH 1KCRL 4ZUTA 1BF2A 5DQDL 4LKCA 3OF6A 1S5IL 3SO3C 1MJJB 2CGRH 2W38A 3QDJB 3LEVH 4HLZG 3LD8C 4BH7A 5CZVL 1E4XL 3ZTJG 1T20B 4OZIA 5D6CB 4FQ2L 3ARGA 2VLJA 4Y7MA 3DI2B 2R15A 3KPRE 1LO5B 4AL8H 4O00A 4EIZC 1N3NB 3HAEB 5ABDE 3IJSB 2GYSA 1NLBH 4M7ZB 4FNLH 2VL4A 4M7KH 4IRZH 1YY8A 5GRVK 1HHHA 4NM4H 4WI8A 3VE0A 2P48B 2PUQT 1F45A 2ERJC 1JWMB 3BN9C 4BFIB 2HT4C 4K3EH 4QGYA 4YUEL 5AAMA 3EJZC 2R4RL 2AGJH 4KC3B 5TE7L 3U7WH 4JY4A 4CVUA 5B8CB 1VGEL 1LO0L 5EBWB 4P3DA 1XGUA 3L5WA 2VR9A 3HR5B 3AU1B 3S35X 5E8NB 2VLJE 3TO2B 1XIWD 1CFQA 4NWUH 3TA3A 3JWDL 3LQAC 4ZTPL 3VFSA 4HUXA 4KUCF 3MV8E 3OG4B 5D2NA 2JCCB 1O0VA 1A22B 5MEPB 3PGCA 5IM7A 3T77B 2RB8A 3D69B 1NAML 1DQDL 3QEHB 3UPAA 1T7YA 5JORA 1A7PH 2P5EB 5ESAB 1SYVB 5F7EL 4YXHH 1U8QA 4NRZB 4HG4K 3VFWB 4EUPB 2CQVA 3OKLA 5I15L 2V2TA 3VXQA 3GHBH 3SCMD 3OKDB 5DYOA 1YUHA 2R69L 2E27H 1F3JA 3IU3B 4TOYL 4YFDB 4MCZA 4EUPG 3F5WA 2EDWA 4WENB 4PJGF 1MFBH 1FVDA 5A1AA 4WFHE 3GMNA 1CFQB 4L29B 4PRBA 1RHHB 2XTJB 5DJCB 3T0EB 4L4TA 4QHUA 1K6QH 5T1LB 2XTLA 4XPFL 3TYFB 3OB8A 2NY6B 1A4KB 4MXQD 3AGVA 1MWAA 3PWUB 1YN6A 4TTDC 4NQED 1WBYB 2KUTA 5FECA 4XXDA 4RGNC 1ZLWH 1T3FA 3VD9A 4NUJA 4X7EC 5F7DA 3VFSB 4OCYH 3N9GH 5C0DA 1RZ8B 3KS0J 4M02A 2APXA 3UDWC 2YS4A 5DHVA 4EZMA 3BWUC 5J13C 3HZYA 5T1LD 4OGXL 4R3SA 4ORGB 4JFOB 3U30C 4TYUA 5DGRA 1LO4H 3N85L 4IMKC 4H26B 4J6RH 1E27A 3NCFB 1QSVA 1HE7A 3ESVF 2AJSL 3M45A 4ODUA 5EPMA 1BAFH 1R6VA 2HRPH 3B43A 5JZ7C 1FL3A 3C5SA 2O5XL 4BSVB 3MRIB 3O3AA 5CJQL 1XCQA 2WIIB 2NNAB 5FM8A 3WNKA 3U0WH 3FO2B 3RI5K 3FHQA 4L8DA 2DAVA 3EZ8A 4XXCC 3VDCA 4BSJA 2L7JA 2BXZA 3DX9B 2WM0A 4KXZH 3MXWH 1KCVL 3OKDA 3T0VA 2Q8AH 1J10A 2AXJA 3U7YH 1JF6A 1UYWL 1ZS8B 1P69B 4GRLC 4IBLT 3FQWA 5GJTH 1OF2B 5IK3A 3ES6A 2VXQH 2P5EA 1KN4H 4NUGL 3AAZA 4NQCE 1MCHA 3MPCA 1TXKA 2VABB 2VNCA 1I9RH 4LASL 4MX7A 5EORL 5TDPA 2D7QA 4MXWH 2BNQA 3QUML 4BQCA 1K8IA 5LBSH 1QLFA 1QSFA 5FKPA 5C9JA 1KEMH 4PB9L 3BP6B 1BQHG 4WNQB 4HUNB 3TNNB 3W2DH 2P46B 4OIIL 4PRNA 5DEGB 3BGFC 2ICWJ 4O2FB 3NA9L 4C54A 3P0YL 2VZVA 4NYLA 5EBWA 5GGQL 1NGQH 1BVKA 5L7XL 4S0SD 3QJFB 2EDNA 4G6KH 2UV3A 4GRMB 4PJFF 2VC2H 3SOBL 1JZ4A 2ZUXA 2R2HA 1WTLA 1NCWL 2X6MA 4MNGB 4DN4L 2J8HA 4N0FB 3WXVH 2F54D 3HPLB 3NFNB 1B0RB 4L3ED 5HYSG 3IAGC 1WFNA 5IBLD 1YEFH 1LO2H 4AJ0A 4U33A 4OUUA 2MHAB 2Q8AL 4JN2B 4TUOA 4QRUB 2R1YA 3C87A 4OD2B 2X41A 3GBNL 2YD6A 2GSIA 1Z0NA 3LZFL 2IQ9H 1GRWA 1MJ8H 2YR3A 4LIQL 3QIUC 1L9MA 1GPOH 1ZT7A 2HN7B 3GIVB 1JPTH 1A7NL 1MWAL 5FXCH 3WIIH 3TO4B 3ZDXE 2EDHA 43CAB 4YAQA 4LKCB 2GAZA 4Z0BL 3P77B 3W9DB 1D7FA 2X4RA 5AWNL 2V7NB 1JBJA 2NY5C 4CUCA 4QHKI 4KRMB 2GT9A 1W72A 3OG6B 1SY6L 4FFYH 1JPST 2EYRB 3OZ9H 5DK0A 1CQYA 4K07A 4PJ8C 4HWNA 4NQXB 4QRTB 2GTWA 2XWBB 4Z7NF 1Z9MA 1K4DA 2BHYA 1MCLA 5DEFA 1N0XH 1VGKA 1M7IB 4WWKC 1QO3A 3VG9B 2DB8A 3VH8B 3AS3A 3PV6B 3LPWA 3B9KC 25C8L 5FUCC 3T2PA 2IBGA 4G8EA 2DQGH 1KB5H 3QUKB 3VFOA 1ADQA 3BDXA 3K0WA 2R39A 1JYNA 3G6AB 4M8QA 5DJ6A 4IHOB 3VFVA 2NLJA 4G6FD 3K4AA 3U9UA 5TQ0H 1LE5B 1MFBL 5IMLA 4ZAKC 4QTHA 5F1SA 4OD1L 2OXGA 4PJ9D 5KSVB 1PG7X 1OAKL 1CIDA 3S37L 3VJ6A 4KZDL 1T21A 2AJ3B 3MJ9A 2M8XA 3VXSE 4CU7A 2GJZA 1R3JA 3FRUA 2YOCA 4D0CA 3RVTC 4GMSL 1AXSA 1AE6L 2WUBL 2OL3B 1U3HD 1U8KA 5DJZB 5CZVH 1CE1H 2NCMA 4LHUG 4XH2A 1FZJA 1X6LA 5E8PB 5JMRA 5E6ZA 2YPKB 2YRLA 4YJZL 3MGOB 4DQOH 2VWEC 4OQTL 5HGDA 3WS3B 4EXPX 1WK0A 2RGSA 3MCKB 1CS6A 1NGZA 4RFNC 1L0YA 4UTAL 2E6QA 3QO0A 1RPQA 1T5WB 1VDGA 1EAPB 1X5ZA 1JGUL 4JFYB 3BUYA 4MD0A 4XZUB 5BVJB 2XPGA 5FO8B 4HDIB 1R3LA 5GS0L 4OFPA 1CZ8H 4S2SB 3CDGB 1CLOH 2VERN 3GB7B 2R29L 4BH8A 1HOCA 1QKZH 3P4MA 2R4RH 5TE7H 5KSAD 4M6ML 4RA0C 4Z77A 2R9HD 1ZEAL 3BKYH 2LAGB 4KJPD 2I24N 2FIKA 5DZNA 3P4MB 1MREL 5A16A 4M5YH 3LB6C 3GB7A 2ICWA 3FO0L 1MVUB 4KHTL 1X5YA 2GK0A 5BV7B 3AXLA 2CK0H 3HE7C 3O2WL 1WISA 2XPGB 1NMAL 2RIKA 1E4XH 1V7NH 1YEEH 1FNEA 1MCFA 3O6FB 1NMAH 3PHOB 4JM2F 4NT6A 1JHKL 1D5XB 2GFBA 3QULA 4M6NH 1LE9B 4UQ2A 1WAAE 5F7MC 3L1OL 5CMAB 3SE8L 3BH9B 4YDVA 4WWKA 4ELMB 5KS9B 3QUZC 4FZEL 5FHAH 3SGEI 2HAZA 3GNMH 2AQ1A 5SWSB 2IG2H 4RDQF 1GXEA 3ME0A 5C6WH 2ARWA 1BFSA 3Q3GB 3V0WL 4NBYB 3GJEB 3WJLC 3CSYB 4UI2A 1QSFE 4JCMA 3HMXA 3RZWA 1H8NA 2IJ0C 1KJ2L 5GS3A 2PW2B 1P2CA 1BP3B 4WHTB 3NTCH 3T0WA 3TVMA 5J7CC 3ZYOA 2CJUL 3QCVL 3QZWG 2JJSA 5C0CD 5E8EB 4V1DD 4OM0H 4M93C 4CMHC 2UY7A 1HILA 5IMLB 4FXKB 3V2AR 5TJWK 3UP1A 1UXWA 4AIZA 3X17A 4X6BA 4JDTH 3RWCB 3GEWB 4HAGA 5FDWB 4XNQB 3FJTA 3S4SB 3BRFA 3WKML 2X44D 2C3GA 3BIKA 1M6OB 3HRZB 4PBXA 1SJHA 2P7TA 1UM5H 3ZDXF 3UC0L 1OOAA 1PKQB 5C0CA 3F7VB 1A0QL 3RPIA 2KQMA 4CVXB 3STBA 2Z9TA 3CSGA 1CE1L 2V2WA 4L3EB 2VIRA 3TIDB 4KKBC 3M1BB 4HS6A 4NZTL 2GTWB 3IDXH 2IAND 4OV5B 4L4TD 3V4UH 4N9GB 3V8OA 1LHZA 4PJ5B 5C07A 4PRDA 4AEHH 2B0SL 5D1ZC 5AD0B 3TCLB 2JIXA 3LMJH 5CCKH 4O2CA 4M3JA 2Z4QB 1AD0B 3GMQB 4YDLC 5F9OL 1LMKA 1KB9K 4O5LH 1CLCA 5JLZA 3L3JB 4A6YB 4J7RA 5JDJA 1XGRA 1QVOA 4NQDB 2FL5A 3MSPA 1FLTX 2WBJA 1W72L 3WBDA 5M7QA 1KTRL 2ZP0T 2B1HH 3BYYA 1RUPH 1DLFH 4MXVE 3X12A 4JJ5A 4J4PC 4PJFB 1XGTB 1X5FA 2IALA 5HHPB 3C08L 2XZQL 5I8CA 4G8GD 3LEYH 1OSZB 3CXDL 3QIBD 4NFCA 4DVBB 2FGWL 3RWIA 5D8JH 4WO4B 3SJVE 4Z0XB 3W2DL 4XNMA 3GSWB 2ATPA 1FNSH 3C8HA 1ZT4B 5LCVL 3CFJB 3PIQB 2IPTL 4MNGA 5FYLE 1TZGH 5F6HI 2EICA 1JNJA 4LLDA 2BCKA 4JPKH 3BDYH 3OZ9L 5C0AE 5IWLA 4G9FE 4X6CF 4LMQE 5C6PB 4ZO6A 1JGVL 1S9YA 3KYKL 5ALCL 1HHIB 1CL7H 4R3SB 1RK1A 3PP4H 3CLEH 4HGWA 1ZAGA 2W92A 2OZ4A 2ICWI 1U8JB 4CMHB 3DRTA 4HIIB 4XCCL 1L4IA 3DMMD 5TDOA 3WJJC 3PGFH 3HNTH 4OM1H 5F6IB 4PTTB 5DUBB 4J23A 4GAFB 1BQSA 5TFSH 3Q6GH 4Y5XA 4M7JL 1U3HB 5BQ7B 1LEIB 4JRYE 5C09B 1ZLSH 4OGYL 1D5BA 5CKAA 1TJIH 3DGGB 4ZUWA 5DA0B 3WNLA 5C08B 1INEH 2RR3A 3BPNB 2CLZB 1NC2D 5CUSH 1TCRB 2X7LB 5IB2A 5EOTA 1OAYH 1ZVYA 1KULA 3ARFB 3QDJE 1IT9H 1VPOL 1ZS8A 3CGTA 4PLOB 1NGQL 3KYKH 5ALCH 4YWGL 1TFHA 1MQKH 4LPVA 4JFXB 4X0KB 1XGYL 4EUPA 4KUCD 1FO0L 3ZTJH 2HJLB 5IB2B 4LSTL 5D7LE 3QEHA 3SDYH 4R4ND 2G75B 4WW2B 2EC8A 5I1AA 3GDBA 8CGTA 5JXAL 4UILH 1NFDA 2EO1A 2FGWH 3AY4C 5I30L 5CZXD 3VWJC 3CXDH 4LLWB 3OKKB 3WHE1 3FRPG 3B9KD 1ULVA 1PVHA 4PJXA 3MBEC 2FATL 4I0PD 4QY8A 5GRWA 4WUKH 4M48L 3MR9B 1XF4B 4KKLC 5T3XE 4OZHE 4PJBB 1ONQB 5DK2B 5IIEA 1B4RA 1EHNA 5FCUH 4AIOA 3LN9A 1VADA 3EIFA 4JPWH 4QY8B 4P0DA 3VXPA 5DDHA 1A6UH 3WUZA 4DGIL 3G04B 1CQKA 4P49A 3T1WA 1XIWA 2VL5A 3P73A 5HTSA 2JCCE 4MD4B 1G7HB 1V3JA 4N9OB 4K9EC 1OARL 1FPTL 4LIQE 1NGYB 4NO0D 1BBDH 2P24A 1R3HA 3O41B 3OMZA 3RWIB 4KJWD 5BW7A 3DTXB 1OTTC 4YIQA 1Y6MR 3EHBD 4U1GB 5HDBF 4MDIA 2IH3A 3F6IA 1J7VR 3ARDA 3ARGB 3T3MF 1DVFC 2DDQL 3SKOA 4FQQA 1RJCA 1U8QB 4NRZA 4N1CA 4NQDA 3AY4A 4BUGA 4GKZA 3VXMA 1CD0A 4LHJB 2E6JA 3BPNC 5HYSB 4TUKL 3MREA 5DI8B 3R8BB 3D1MC 1U92B 5BRZB 2XTJE 3KPNA 3TIEB 4TSAH 4F7EA 3MRQA 4P23C 5I2IB 1NGPH 3AM8C 5FYJE 1NCDL 2J1KA 1IAMA 4NKDA 1YDPB 3BW9B 4YEFA 3CVHA 4ZFFA 1BQHA 3OPZL 5INCB 3MYJA 3MNZB 3MRJA 1IZKA 5FM5O 3E6HA 2EKJA 5EU6D 3RL1A 4G5ZL 4PD4J 2JB6B 4JRYA 3HR5A 4M1CC 4PJHB 5KVFL 1E4WL 1XGUB 2H6PB 4Y5VB 3TZVA 3QFJA 3THMH 2GEEA 3SJVA 2J8UE 1NFKA 3HS0B 3QWOA 3W5MA 1F4YH 5J3HD 3MRLB 3TJHD 1UA6H 4YNYB 4N0CC 3MBEB 1AKJD 4Z18A 3CPLA 1NMBL 1U9KA 4KPHH 1UA6L 2WW8A 3MRNB 3QAZC 4Y4FA 4GRWB 2D03H 3B8SA 4ODHL 1EAJA 4H88H 1DBMH 2I07A 3H42H 4GG6B 4U6XA 3MNVA 2HFFA 5KSAA 5H35A 2Q76B 1MI5D 2XOTA 3D3VE 4HZAA 3JWDH 2X4SA 4L4VE 3TN0D 1F42A 1MH5B 5JNYB 2BSSA 1P6AB 3VFNA 1MCOH 4DKAA 2DQTL 1AD0A 3MBED 1VENA 1YC8A 5MI0B 4XCFL 3RGVC 4ETQA 2X9XA 4G9DA 4I5BA 4HH9B 1AIFB 5JW3H 4N8CH 3N1MC 4DTGL 4ELMA 4B7IA 5KS9A 2HMIC 4XB7A 5T3ZD 4NO3B 3MLRH 3TBVB 4U1MA 2RHEA 4YHIA 1LDSA 1MIEL 3OHXA 4HWZA 3HC0B 3CK0H 3I85A 2NXYB 5C0JB 4XNZC 3QEUA 5IESL 1IC5L 3S36L 2WUCH 4G42A 3MQIA 5JA9A 5SV3A 1ZLSL 3H9SE 2OR9L 3BPLC 3TGXA 2FRGP 5E9DD 2WINA 4DQOL 2FIKB 1VACB 1BVZA 2D31A 2XN9A 4Y16A 5K9KA 1A2YA 4E5XA 1JV5B 4X6DA 1OTTD 3BKCH 4LEOB 5EIIB 4F9PC 2QHLA 2GW5A 1QR1B 2KDGA 3PP4L 4JQXA 4OJFL 2GY7B 3H9YA 5K59F 3GHEH 4DGYL 3PWJA 1ZSDA 1MRFL 3DRQA 4HQQL 1P84J 3ULVF 3ARDC 2VDKH 4A6YH 5DRZA 1U8OB 2XKNA 4WHTA 1I8IB 1UZ6F 4I77L 3QQ3B 1NAKL 2HVJA 3MLUL 4NO0B 2DD8L 4KWUA 4E42B 1LDPH 2AJVL 1NGPL 1P4BH 1QBBA 2DKMA 1ZHNA 2HT4D 4JFYA 4RFEB 1QRND 4HKZA 3RWEA 1NPUA 4KK5C 2ITDB 1QSEA 1VSCA 1Y0LA 1CK0H 4KI5E 4Y4KD 5FYJU 2H3NA 5D9SA 3FONB 4HX1A 3WS3A 2V5RA 2JCCF 4X6DE 2NZ9C 5GJSL 1E4XI 1BPVA 1ZHNB 1H3PL 4RFEA 3FQUB 4RCAA 4K3HA 1I3RA 3RX7A 4F3FA 5B38G 3C2SA 1E6OL 5CP3A 3UYRH 1M1SA 4X9BA 1RIHH 2VISA 1WQVT 4K94L 4L9LB 5IB5A 4RAVB 1NLDH 4UINL 5HD8D 4G43A 4EQ3A 1U8IA 4ELMF 4OQ1A 5KS9F 1MFEL 3L5HA 5H94A 4MA7L 1Q1JH 3BZFB 5DD6A 5FM4A 2FX9L 4YHPA 2H1PL 3OB0H 1YQVL 5C0GA 3UZQA 4LGPB 5IKCA 5J4MA 3BN3B 4PJ9B 4HKJA 4IJ3C 4KQ4L 3BEVA 1K4CB 3Q5YA 2BNRD 4NO5A 2JJUA 5D72H 2IAMD 2G60L 3MV8D 2J88L 4Z77B 1J9CT 5FOJA 5J1TC 1G7LB 4H25A 4EN3A 1FG2B 3L95B 4TUJB 1H3GA 1DEEB 4UIKL 5F9AC 2IAMA 3U4EB 3VFOB 5B39G 2ATKB 1FFRA 2NPLX 5MP6L 1URLA 4PS4L 4H25B 4N0UB 1G7LA 3U46A 3IJYB 1OY3B 5KSUA 5D7LA 4R97B 4R96B 4NQCA 4JFQB 4M48H 3HG1D 4U1MB 2MPAH 1CL7L 3KDMA 5E2TL 1GZPA 4RFNB 5GRVL 4F7CA 4FABH 1P4IH 2MQ3A 1NGZB 3VWKB 2ZUQB 4I18B 1JL8A 1MF2H 4HWEL 3F7YA 4LCUB 4WUUE 4YHMH 2AVGA 1DANT 3VXSA 4XX1E 5L8KB 3ZL4L 2FZ3B 5KSBA 4NPYA 3BMVA 3VFTB 5DJZA 1HQ4B 1JYXA 5C0RH 1RURH 2V9QA 4R4BB 1XGYH 2D7NA 5I1JL 1F11B 5IB3B 2JK5B 1MHPH 3C08H 2MHAA 4XVJL 3SDDD 3VGHA 3QUMH 4KVNL 1S9WA 3FB8A 1NCBL 1MELA 4GH7B 4WIQA 4NJAL 4KAQH 3KWWA 5C3TA 4OLEA 1RK0A 5A43C 5FO9B 5IV2A 2EDOA 3E3QC 1BWMA 3AROA 2F58L 4P48A 1DJSA 4XNXH 5FCSH 1A14H 1OGAE 1LK2B 2VXQL 2VDPL 4Y4HD 3JWDC 3LQAL 4APQD 2D4FA 1SBSH 3I6KA 4J3XA 4JFFD 2UWEA 1FE8L 1NGWA 4W4OC 3HZVB 1TDQA 1AKJB 1UYWH 2XNAA 3B6SB 5EWIL 2XZCL 4PJEB 1HKLH 4K9EH 5IT2L 3PNWA 4O4YH 4X4XA 4WEMB 5DD1H 3MFGB 3E0GA 1MHHA 4B41A 4JJHA 4HMDA 2C7UB 2VAJA 3S35H 5HJ3A 3W39B 4F7EB 3RA7H 3OF6D 1L6ZA 5CP7A 5FYKE 3D39E 3KYOA 5FYKL 3C6SA 4JFFB 5E1AB 35C8H 1LD9A 2AERT 2P5WD 2R1WB 1ZVHA 4RBPH 1OAUL 4DVRL 4PJGA 4JCLA 2WBKA 1QR4A 1YMMD 1JI2A 4X7DC 3RKDD 1KJVB 4EBQL 1WZLA 5AYUL 4BM7A 4NM8L 1FL6B 3IETB 3Q1SL 4NHCL 1FGVH 2CKBB 5DK3A 3UTTE 4Q58C 5EU3B 2QSCL 5HGAB 3U4AA 3WUWB 2OR8A 3NTCL 2Y1VA 5HY9B 1Z5LB 1Q0YL 4HPOL 3DUSA 3O45B 3E8UL 3IDIA 3CFEA 3RU8L 4IEFB 4NO0A 4NJ9H 4O2EB 3L6FA 1QBML 3O3AB 1ADQL 4PV9A 1SVCP 5JOPE 2AK1H 3K81A 5CCKL 1EUUA 5K59E 2ADIB 5I75B 1IAII 3G5XB 3G6JE 4JFDA 3ZLQC 1T1WA 4N0RA 2MKWA 3HZMA 4ORGA 3IFLH 2V9RA 5K9QG 1DQQA 2FB4H 3VRIA 3F58H 3W81A 4D9RE 2IPKB 4PJAB 2IC2A 2A83A 1F97A 4QXTB 3VGFA 2IFGA 4JO3L 4WNQA 4YX2L 3ZSTA 4HT1L 4LPTA 3V6OE 4DEPB 2EDYA 4RFOH 3JWNC 1FC1A 3CDCA 5I9QC 1KIRB 4LPXA 3LHPL 4D0BB 1ZLWK 4PJXE 3ARFD 4Y5VA 1NFIB 1Y18A 3L3OA 5FUOH 2YRPA 2I27N 4OLWH 1N0XL 2HTKD 3GMNB 2O61B 1GCFA 2UZYB 4MQ7B 3T0BA 2R29H 4LBEA 3NH7H 2Q6WB 1MUJB 4FFWC 1OM3L 3V5KB 4HH9A 1CD9B 5FYKH 4FQCL 4G7YH 1N6QH 3HZVA 5T3XD 2ICCA 3ARFA 3MJ9L 2ZUWA 5LGHH 4LLAA 3ALXA 3O4LA 1DFBL 1YYLL 3INUH 1JPTL 4PREB 1AXTL 5ESAA 1I7UB 1MFDL 4K7PH 5F97E 3SE4A 1RHFA 1RZIA 1RIVL 2UWEF 1GJIA 4BQ9A 1KF9B 4JFEA 2D9QB 3T2NH 3GSXB 2F5AH 5ADOH 3TEUA 4BZYA 4P5KB 4Z7OF 4NKQB 1S7UB 1YEFL 2W9EH 3RX5A 4U6TA 1BFVH 5E6YA 3ULVD 3MOAH 3RZCB 3KYMB 3V79C 3HHRB 4W4NA 4F37K 4OZFA 1P9MC 1EFXB 2HTLD 5L0QC 3HG1A 4JRWA 2A73A 3H2WA 5JO5B 1CDUA 1NBYA 3C5ZB 2UZXB 2EDKA 3HNSH 5DTFA 4X80H 5T1LA 5GGRY 4DKFL 1ZGLM 4P57A 3ARVA 3NA9H 4PJHA 5IHBA 5IJKA 4FTVB 3EFDH 3MLTA 3RL1B 2F53D 2PETA 3MV9B 3T0EE 5EB9A 5ACLA 3P3YA 4YH6A 1J11A 2ATPB 2WMPA 3MR9A 2VZSA 3IU3A 2CKNA 2YD3A 4DCQA 2V2XA 4P5KA 1IMHC 3PL6C 4N8VG 5D2LF 5BRZA 1C7SA 3EW3B 4NHUB 5I9QB 3U36A 5DHYB 5E9DA 3OKLB 2Y72A 2CDGB 4KDVA 5IFAL 3UZVB 4F7PB 5E4EC 4GXUN 1KJ3H 5DJAB 4FQPA 4EXKA 1OAUH 1S7RB 4G3YH 4R9HA 2FO4B 3V0AC 3R0NA 1YPZF 2OJEB 3KPPB 1ZE3C 3VWJB 1C8PA 4WI6A 5CILL 4IRSA 2OM5A 4J3WA 1BQLH 2Z31D 1ACYH 3FQRA 4JG0L 1DE4A 3I6LE 5EU4B 3PGCB 5IM7B 4OQTH 3VMPA 3QG6A 5C0FA 2P24B 2VAAB 3QEQB 2PO6D 2CLVB 4CVZA 4X4ZA 4F7MA 2X7LA 1KTDB 2CLZA 1FNFA 2BVQB 3R1GL 1HINL 1I3RB 5C0BE 5LKNA 1J1PH 3IVKA 1A6TA 4F33B 2ICEB 5L2KE 4KAQL 1XIWB 5KANI 1YN7B 2WWMD 3N85H 3S37H 5ERWA 4KZDH 3QPXL 3I6GB 4NOBA 4QWWD 4PBVC 4V1DE 4XVJH 4ENEC 3DGCR 1ADQH 4EN3C 4ZUVA 4WGWB 2HFGH 3RY6A 1TVHA 3MA7B 5DVMA 2PO6A 4NP4H 3E8UH 4QT5B 2DTMH 5T1KB 1E6OH 4HPOH 1Q0YH 3EYSL 1R3KB 3WJJA 5H2BA 1OLLA 3OR7B 3RBSA 1NFDF 1IKFL 4CU6A 4NHCH 1YMHB 3DNKA 1NFDB 2ZZUT 3QXAB 5ICZA 1RZKL 3GJFB 5E0QA 4FABL 3SE9H 4KZEH 2DQCH 2BJML 1CE6B 5DJXB 2G5BB 4KY1H 1AO7A 4H20L 3SGKC 3MCLH 4UTBL 1SY6H 4FFYL 5D7SH 3I6GA 4WV1C 4KJQC 2XQBH 5JQ6L 4G42B 2X42A 3K46A 5D5MF 3GHEL 3LRSB 1FCCA 3ZYZA 2MPAL 3KLDA 3O6KH 3Q0HA 5D70H 3P0VH 4KROD 4G6MH 3HRPA 4ODVH 3QDGA 1J1XL 1J8HD 1M05A 4JFHE 1MCBA 3VXUD 1G0XA 1RULH 4KRLB 4MB5A 5L2JA 1U0QA 1HKLL 1YQVH 3VXUA 1XZ0B 4HW6A 3MXWL 4C55A 2FBJL 1N5YL 1YNKH 3BVNB 4BQ6A 4LPCA 3VW3L 1X5HA 5A16B 1AQDB 2C9AA 5ESVB 1X4XA 4H1LB 4OCNC 4YBLC 3QAZB 2J8UB 4X99A 3SE3C 1XCTB 3EJZD 3NCYP 3STZB 4F7PA 3RTQA 3OAYH 1A5FH 3FQNA 1A6VL 2QSQA 2DL9A 2I07B 4KJQD 1C08A 4RGOH 1JPGA 4YEEA 1AKJA 1HWHB 1OGTB 1AGBA 5D6DA 1NDMA 1H8SA 3KPOA 5EA0L 3S7GA 4AH2B 4GQ9L 3IDJB 2AEWA 4Y4KB 4GG6E 4WDIA 3IS0X 3HC3H 3QO1A 1EO7A 3O4LD 4X6BB 3BDBA 3NBNA 2NY0D 4Q6YA 2R2CA 1P7KB 4YGVA 1N2RA 4PRHA 1J0KA 3RWDA 1P4LA 1RD6A 1L7IL 2IADB 1OGTA 1Q0XH 5T33L 2PO6C 3TWCH 1KIPA 4JFZL 1EGJL 1A6TB 2PYFA 3S36X 5IB3A 5ETUA 5IBUB 3FHAA 1RJLB 2JE8A 1P53A 2PW2A 4NOFA 2J7LA 4R4BA 1BREA 4QRRE 3MROA 4P2YA 4LLMB 4LFHD 3MACL 4X99B 2BNQE 4BKLB 5HHNB 2EXWC 5LWYL 1FN4A 4NKDB 1A7BA 5MP6H 2E27L 3VXSB 4Z5RB 3JWOL 4LCCA 3FT4A 1JP5A 5C07B 2WNGA 3TJEL 1AJ7H 4I0PB 5F96H 3WD5L 1I1AA 1AC0A 3GI9H 3DROB 3P30L 5CD3B 3UJTL 2GFBB 5EUOA 4NSKB 4MNQA 4LARH 3CK0L 3M1BA 3QDGB 4JZOA 2VDLL 5EO0A 4PJBF 1QLEH 2AXGB 4D9QE 2DYPB 4PLKC 1TQCC 1LO4L 3EYQC 5IBTH 5JIHA 1YY9C 4N0CD 1OCWL 2I9LA 4ZAKA 4P5TC 4OIAA 1T6VN 5GRJH 4XPAH 1AHWC 2O61A 4OLXL 2BP3A 5JUEL 3KJ6L 2NW2A 5BMFL 2XQYG 3GMLA 2DM3A 2OP4H 3O6ML 4UT6H 3BAEH 3QCUL 2AEPL 4MB3A 5D4QA 3BD3A 3M07A 5FO7A 5JXEA 4RSVA 4KFZC 3H3KA 3GSVA 1IBGH 4F8TA 4NGHH 4OCWH 5IW1B 1QRNA 1KLGB 1QHPA 4YO0B 5T1KA 1L0QA 4NM4L 4PGDA 2VJXA 1QSED 1A1OA 3GJEA 5MEQB 4M6AA 4Y4KC 4P2OA 1YJDH 1QFWM 4XMLL 4NRXB 4YXLH 2ESVD 2MTPA 2H26B 3UBXI 3UTSA 2WWKT 3V4PH 3TBSB 3CJJA 3O3BB 4YXLL 5CKGA 2ADIA 5K93A 3SGKA 5HHMD 3ARXA 3HB3D 4XMLH 3W11D 3QZWA 1RZGB 2SEBA 2BNUA 3SKNB 43C9B 4PREA 5JMOC 1T22A 5LGKA 5KBNC 3HI5L 1CGVA 4OLUL 1R0AL 4UV7H 5CEXA 3QG6B 2ADJA 1JRHL 5TH2B 3MX0A 3GUTA 3I2CL 3ILQD 5HGAA 3MRRA 5GZNC 4ACPA 3KXFD 2Q8BH 1CDIA 5ILTH 5F6HJ 3T0XA 4W68A 4Y88A 2VLRE 4IOFD 4JR9H 4OLYL 3ULUE 1E4KC 3VWJA 3ZE0F 4NNXA 2FNBA 3BIAX 4XVUD 3RQ3A 3JXAA 4N0UE 1NCDH 1DQLL 4YHLL 3VD4A 4GKNB 5DO2C 4FFZH 3PWPB 4BELD 1HQRA 3MV8A 3VXRB 3ZKMD 2AGJL 1FRGL 3PL6D 2V5YA 4YWGH 1T1ZB 4WI5A 4AM0B 5HJ3B 3NIGF 1MI5B 1M7IA 5DXWA 2BSTB 2CPCA 1GHFH 4X4MA 1BBDL 1AC6A 4AYFA 5BVJA 3MV9A 4L4TE 1SJEB 2A83B 4WRLA 3BUYB 5IJVB 2QTEA 4NKOA 3TBTA 1ZLUK 1I85A 5CWSB 1OTUC 4CW1B 1T03H 3PWVB 4X5LA 1HCVA 1LP9E 2Q3AA 2H45A 5SWQB 1D6EB 4PJXF 4FQXB 2XY2A 5L9DL 1EFXA 1IGMH 4HMEA 4PJ8D 4Q9QL 5GS1A 4XH2B 5SV4A 2AV1A 4LEXH 3CFEB 3IDIB 3DURA 4ODTL 5EC2B 2HFFB 5KSAB 4P46D 3T8XB 3BWAB 2X4TB 2DQEL 3MUHL 2IALB 1S9WB 4ONHB 1G0YR 4JM2D 5I30H 2FD6L 4PUBL 1B0RA 1CFNB 2EYSA 4QXWA 1JIBA 2NXZC 3DX6A 3KPQB 1KJVA 3BDYL 5I71B 1BQUA 3BZEA 3SCMC 3O4LE 2X70B 1I7UA 4HF5L 2PN5A 5DJ6B 1HXYB 1FCGA 2FEEL 4K71C 5CFHA 4GRMA 3A6CL 4KGLA 3Q5TA 4YC2C 4OF6A 2Z8SA 3KYOB 4D2NA 3SJVB 4LVNB 3CFBB 1G7MB 1G7JB 5IMKA 5HGHA 4LBEB 4P9HL 2VXSH 4Q6IC 4AT6A 1DLFL 5DJCA 3ZE0E 3TNNA 1SBBA 2DICA 4LK4A 5D1ZB 1UWEH 1VFMA 2J2ZA 4LCYA 3BP6A 2XWBA 3MYJB 4UDUA 4P2OC 4X8XA 2YD7A 2XT1B 4YFLI 3HMXH 3WS6C 5B8CC 1TPXB 1GGIH 2A9ML 3HPJB 3TO4A 1UM4L 3P4LA 1BZQK 2QQQA 2GSGB 5DQJB 3UTTB 1DL7L 2EIDA 3UX9B 3IDXL 1YQ2A 2HVKA 1IGJB 2OBGA 1UT9A 4ODWB 4U1KA 3GI9L 5E03A 1U8MB 4F37F 4JN2A 4MDJB 4TUOB 5D1ZD 1VA9A 4ONHA 4MS8D 3T1FA 4NC2B 4RWYH 4L8CB 3KS0H 5E9DE 4QEGA 3TYGH 5E1HB 1LNUB 3OXRA 3CSPA 4MJ2A 2QLVB 1ROWA 4IDLA 4PJAE 4H8WC 5E8NA 3WFBH 3ARQA 1FNSL 2DM2A 1U91A 2VN4A 2VL5B 1T83A 5I76A 1VEPA 3QCVH 3C60D 4WFGD 3B2UD 4S0TD 3STLB 3N1GC 3GRWH 3VMNA 4Q9BA 1AGEB 1EIBA 4E42A 3MV7B 3RWFA 4ETYA 1CDGA 3HC3L 5L8JB 3EYSH 1FYTD 5HHOD 3ARRA 1BX2A 5I8KH 5IMMB 4KGJA 2OR7A 4MSWB 4Y2DC 2Y23A 3L3GA 2IAMC 5FGCE 5C7XL 3HZKA 2PKDA 4K71B 3DLQR 1MWAB 1YEKL 3H9ZA 3HAEA 4H0HB 2NY6C 4KTYA 1QG3A 1MCDA 3TYFA 4X6EB 4YC2B 1DEEA 3VD5A 5EO1B 4RGNB 4NZJA 3PWNA 5E2WH 1KIQA 3ROOB 4KMQA 3H7BA 2VO5A 2EC9U 1HNGA 3LS5H 2NX5D 1BFVL 4YFLF 3UYOD 5D93C 3RRQA 3VW3H 1G0DA 1YNKL 4QLRA 5IHUL 4Z7WB 1JGDA 4K3DL 5HYJB 5MENA 1RUQH 2AK4E 1C5DB 1R3LB 3QNZB 3FO2A 1JPSH 3WFDL 3FCTB 1XCQB 4G3YL 4MNQB 3EO1A 4XTRC 4PJ7A 5IR1A 2OTUB 3IYLW 4M6OL 3TBVA 4HWBA 3RJQB 4R0LB 4XI5D 4PTUA 4Q9RL 3VA2C 3FONA 4HX1B 3HR6A 5BQ7A 4FFVD 1LEIA 5HYJD 5D7SL 1QSEB 2VH5H 3MFFB 4O9HH 5J1SC 4LCCB 3TH4T 4JPKL 3KVQA 2AKRB 4H20H 2BVTA 4Q9CA 3MRGB 1BEYL 5CBAB 4PP1C 1WFTA 1TETH 3QIBB 4J8RA 4R26L 2D7PA 4OLWL 4GW5A 1FIGL 2YPLE 4OF3A 3VU2A 3NIGE 3MV9E 5DRZB 2Q8BL 5ILTL 3WFZA 1FGNL 1PG7W 4PY8J 4GG6A 3BX7C 4WU7A 4HUVB 1CF8H 2YWYA 5AYQA 1MFCL 1MAMH 5TGBA 3REVA 5F7KC 1I1FB 3EDJA 4PRHB 1NMCB 3RNKA 1N6UA 4NP4L 2H8PA 5CGYD 5KSUB 1J0ZA 5JXEC 2YD5A 2A77L 4P9HC 4YNYA 1UH3A 1SM3L 4M9PA 4JEGB 1ED3A 2YZ1A 2FB4L 5FGSA 3O6FD 4MQTB 4NNPH 5FYJD 4E41B 2KQNA 5F44A 4M00A 4UAOB 1WWBX 2IAMB 1I9IH 3FQXA 1J1PL 3NPSB 1XR9A 1I8MB 3VH8A 2AXGA 4XNUL 2VN7A 3SY0A 1GOGA 1A47A 3S8WA 1D5IL 3O8XC 4GRWE 1IKNA 4OV6F 2C4XA 4RMSA 1YDPA 3BW9A 4ONFH 2HTLC 4WWKD 1NKOA 2MWCA 4PJGE 3VCLA 1MFCH 5C0BB 3HN3A 3PUCA 4G7YL 4LSDA 4NQEB 3UAJD 1BQLL 3EJJX 4I48B 5IBUG 1EVUA 5HD8C 3BRDA 2XWJB 1IAIL 4NM8H 5GS0H 1MPAH 2I9TB 1I1AC 3G5ZB 2WBWB 3HE7D 4JREC 4HUXB 5B39B 3KJ6H 4EBQH 1N4XH 4ODXA 4V1DB 4GKZB 1IEBA 1QSFD 2V2WB 4L3EA 3F7VA 5D7JC 2DL2A 3FQXB 1VFUA 1ZLVH 3V95A 1P7HL 5T5NG 2GTZA 1KUMA 2NY0B 4PFEA 4YIQB 4H8WL 3I9GL 1MRCL 5GS2D 5GGSA 1T1XA 2JTDA 4P2QB 4XVSL 4WY7H 5F7YC 2VRAA 2B2XL 3CNKA 3C60C 5D7IF 4XMKL 3IAQA 1KG0B 1JMZA 2XWTA 4P2RD 4Y4KA 5DEZA 3LSOA 3PF2A 1TENA 1WZ1H 3OJDA 5D7IB 1T1XB 1F58L 4JANA 1KTKE 1NAMA 3DMMB 4EKXA 5ICZB 5E24E 3E2HC 3RL2B 1PY9A 1OAZL 3HLAA 2EIZA 3P9WB 1D9KC 1KB5A 4ZD3H 3RTQB 2MFNA 4OI8A 2UVEA 4K8RL 5F7NC 1QBMH 1KCSH 2WP3T 4R2GC 1F00I 1HIMH 3SHSA 1RQ5A 2IBBA 5CEZL 4PRIE 4TVPE 3TWCL 4KI5D 3G5YB 3GBLA 2X4NA 1FVEB 3ULVC 4GT7A 3DYMA 1UB5A 3NPSC 1FC2D 5DRNB 5SX4I 1YYLH 1BFTA 3AB0B 3OR6A 5IHZB 3GRWL 1N6QL 3BZ4B 4WVRA 1FH5L 4XPHL 5GGTA 2P8LB 5ID1A 5GIRB 4L8BA 1P4IL 1CXLA 3JV4A 2WP3O 4D8PB 1QPXA 1S7RA 4NUGH 1NGYA 4OGAC 4YXKL 3KXFB 4JREB 1DN0A 1H9VA 1UJ3A 3T65B 3ROOA 2ESVE 4RZCA 4KJYB 1KT2A 4KROB 4ODUB 2VXTH 5EPMB 3GJFA 4HWUA 2R0WL 4HSQA 3I84A 3VXRD 5ID0B 3CVIH 2I5YH 1VFBA 1REIA 2G9HA 4F58L 2KPNA 3E3QE 1S7WB 3MRMA 1PZ5B 3K1KC 4R8WL 5AEAA 3QG7H 1NANH 1NSNL 3OQ3B 4NFDA 3X14B 3GSNA 1AGDB 4LDLB 3H8NA 5LGJA 1RJYB 3VFPA 5L2KA 2VC2L 3SOBH 3S6CA 1JVKA 3VWKD 3ARPA 4NJAH 2UVFA 1DQML 2VDNH 1MQ8A 1S9YB 5KVEL 5HSFA 2ZCKH 2BNRE 5ESQB 4JDZA 2LTQB 1H0DA 5CHNB 4PJCB 1FZJB 4OIIH 2LVCA 4LOUD 1XH3A 4XCEA 4OBSA 4XPGH 3DSNA 4TQEH 5CD5C 4CVZB 4HC1A 1A4JA 4JZNA 3ZE1F 4PJ9C 3ULUL 4XMPL 5GJSH 3RWJA 2YPVH 4P23D 3DYOA 2QSVA 4KHXH 3RHWK 1T5XB 4XMPH 1T21B 4LASH 3X12B 4YPGB 2H2PD 4HUUA 4X98A 1SJVA 4XP9L 4ERSH 2WBJB 3FAXA 5IVXF 2Y4SA 4FQJL 5FYLL 3PQYE 1TCRA 3R4DA 1SMOA 2OTWB 3CXHK 3TN0A 2BOBA 5DJYA 1I1AD 3MRDA 1FZKA 5EZJA 3S96A 5C71A 1KB9J 1J86A 4U1JA 3S3PA 2ZUVA 2UZIL 5KW9H 4Y2DD 2P49B 1B0GA 4PPTA 3T77A 5I1IL 3NCYS 3IXAB 3GSNH 1FBIL 3G5VB 3HI6L 5JW4R 1R5VB 4OJFH 1CBVH 3T2QA 1F4WH 4ZOBA 4RAUA 4ZFOL 2EDEA 2AEQH 2IPUG 2G60H 5A2KH 5BS0D 4PJ7E 5F7EH 2VITA 3QNXA 4L1DA 1OTSD 2I25N 3HUJA 2NY2B 1H3TA 1VFOA 3WDHA 2R56H 4M5ZH 3UTOA 1ACYL 3LN4B 1LO2L 1F90H 1SJHB 2B39A 2G2RA 3C6LA 4PYHA 5GSRB 3LQAH 1NLDL 1KV3A 4IRJB 2YEZB 3DXAD 3G6DH 3U2SB 4LLDB 3KPSE 1FYTA 3CCHA 2NTFB 3C6LD 3UYRL 2XN9D 4UB0H 3RY6C 4L8CA 3QDMD 4ZUUB 2HKFL 3LKNB 5IJKC 4OCSH 2YPVL 1YY9D 3MLYH 1RZJL 1OP3K 4FFZL 3X3FH 1WZMA 4ESKA 2CD0A 2RCSH 2HVKB 5HI3C 3I3EA 1LP9F 3EFDL 5E5UB 4ZTOH 1JPFB 3JUYA 1X44A 4EOWL 2HJLA 1U8NA 2MCPH 4P2OD 4X80L 3AREA 4JM2C 2F54A 3V5HB 2B5IC 3C6LB 5JHDA 3CU1A 5DVOA 3LKQA 3GKWH 1WWCA 3OAUH 4PJ5A 1HH9A 3I2CH 3QH3A 3PWPE 4P5MA 5IEHA 3PJSB 4FQ2H 1QACA 1GOHA 4XCYB 5GGTL 1UACL 1S7SB 1FNEB 5K9JH 2E9JA 5GJTL 4K23H 4ODSH 1Z9SA 2EYTB 5DMKA 4PS4H 3QFJD 3IFPA 1W8NA 1K8IB 3QH3B 5ADOL 1DUZA 2OSLB 4G8GA 1RUMH 1KC5L 3P4OB 1KCVH 3EKCA 4L5FH 5C09A 5TDNA 4MAYB 4UIKH 3MV8B 1I3GL 3CAFA 1ZA6A 2EH7H 4CN1A 4AG4L 3AAZB 5IW6B 1UH4A 3ES6B 4OKVA 3DRTB 2ZUTA 1TVBB 3WLWD 2H1PH 1EJOH 4Y5YC 3MGAA 4YPJA 1HOCB 3CUPA 3RUGA 1I1CA 5DGQA 1RVFH 3FFDA 3SCMB 1G7IA 3S5LB 4HJ0D 5HHQB 5I75C 3OJMB 5LXGL 2X4PA 4U49A 2DQTH 1CN4A 3ARBC 3QXVA 4X7SH 5DSCB 1IGIH 3V7MA 1W0VA 4QRRD 3HC4H 3U79A 3CCHB 4YBHA 4KRPD 2A9NL 1EEUA 4YHNA 1RK0B 4M7LT 3O2DL 3AS2A 4Z7VB 1NL0L 2EXWD 4EUPH 5EFIB 1PJ9A 3EFFB 1PW3A 1MCCA 4Z7OE 4Z7VF 2DBLH 5CJOH 1BD2A 4YDVB 4EI5C 1I7RA 2HG5A 1DQJA 1Y6KR 4ONFL 4OZGE 5I1DB 3V52H 1TNMA 5EOCH 4KK6C 4ZS7H 3BT2L 1XGRB 4M9OA 2X4UA 1X9QA 3TF7C 4I77H 1CGTA 2R1WA 3S3JA 3ZMRA 3MRMB 3E1F1 1I3VA 3DECA 2CGRL 2WZPD 4YBQC 1OAZH 5GSRA 2ARJQ 1HHJB 1MRFH 3F7YB 1A1NB 4LCUA 3WD5H 4TRPL 5GS1C 4EDWL 5EZLB 3U48A 2M2DA 3VWKA 5AG8A 1F58H 1KPVA 4QHMA 3MLWL 1IGTA 4TULH 3C6LC 4TRPH 2ZUSA 4W81A 3RWHB 1A6UL 1P1ZA 4Z95L 2F53E 2YBRB 2FJHB 4L29A 2VDRL 4PRBB 3TN0B 5HVFB 4U6YA 3EOBB 4RIRA 5I1CH 2I9LB 4H8WH 1WIPA 2DBLL 1R5WB 3QQNA 1V7ML 4XP5L 4FTVE 1AD9B 2F54B 3V5HA 1MJUL 4AQOA 5KAQF 3C8DA 2DLFL 5FDWA 1LK2A 1WICA 2YPLD 3BAEL 3QDAA 2VWEE 3SKNA 3REWA 4ZFZB 3ZDZE 4M1CD 1G6VK 2W9DH 4XNYL 1CLYH 4I0PA 4Y0GA 3GMPA 4NRYA 4PJEF 5SWZD 4Y5YB 2X05A 5ELIA 4U1GC 2IMNA 5HHOB 2X4RB 2JK5A 3CFDA 3S35L 2DQDL 1MCOL 3QUMB 5GZOD 1PEWA 3GMRB 3SKJL 4Y2DB 4XTRD 1U95B 5SWSD 1NANI 4X7CC 4NPYB 4KVCH 1FYTB 5JOEA 3HMWL 3ULSA 1A6AA 1AY1H 3WIHA 3NCCB 1OQXA 4Y1AA 2AXFA 5C2BL 5INDB 2EH7L 4WHDA 2HP4A 3FRUB 2HT2C 4EDXA 2QHRL 3V7AE 4ODHH 3M17B 5GISL 1QFPA 4F7CB 1A9BA 3LS4L 4ELKA 1AGCB 5FGBA 5KTEH 5IMOB 4XPBL 5HPMB 5L6YL 1LQSR 5FKAB 2ZPKH 4PGZA 4U1NA 4ZDHA 5ACZA 3CIQA 3EAKA 4R4FH 5FA3A 1HHHB 5DFVD 4G6ML 1NDMB 3KPOB 1R5VA 4IIQC 2PR4H 4P2QA 1F4HA 5F1NA 1ZHLA 4DKEL 4MA1C 2EO9A 2NY1B 1KPRB 3ET9F 1HSAB 1EGJH 3QUKA 2NZIA 2XQBL 1L7IH 3D2UA 4OT1H 5D6CA 5IHZA 3OR6B 1JZ5A 5AZ2H 4KDTC