4P5OA

Structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3-e2~ubiquitin-like protein-substrate intermediate trapped in action
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
361
structure length
327
Chain Sequence
SKSPEELARYCDSLLKKSSKNPEEAELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLYTVQQLTDSTQIKMDILAQVLQILLKSKLPDTLIRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMRMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a RING E3 Trapped in Action Reveals Ligation Mechanism for the Ubiquitin-like Protein NEDD8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Cullin-1
total genus 96
structure length 327
sequence length 361
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4p5oA03
1.10.10.2620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4p5oA02
1.20.1310.10 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like Cullin Repeats 4p5oA01
4OIQF 4GXOA 4LG0A 2F5FA 2RN7A 5ILUA 3P9CA 1KGSA 3P7NA 3WTXC 2ZO4A 3BZ6A 4I7HA 3K9TA 4Z2YA 2HQNA 1FBUA 2DQRA 2Z99A 3CUQC 1IN6A 4EJUA 2CWEA 4OIOF 4ESFA 2QYOA 1SD6A 3GZ5A 4A5NA 5HS7A 2QENA 2P5VA 4GO1A 4FX0A 5IT9K 1T0FA 1FBSA 1R1VA 1MJ9A 5TJJA 5BS6A 3W6JB 1XSVA 3QU6A 2GWRA 5HLGA 1XDSA 4CXFA 5ICFA 2Q0OA 3ZPLA 3SZTA 1SFUA 3R6SA 2EV0A 4AIKA 2NS0A 2OQGA 4KT5C 1BI0A 4M9ZA 4G8XA 1HQCA 1FX7A 3ECHA 2PMUA 1LNWA 4Y15A 3J81K 3E6DA 2KRFA 3GFMA 1KA8A 1FWZA 3RI4A 4IF4A 1YS7A 3KEQA 4EJTA 2XKPA 1YYVA 1CF7B 4CHUA 2DTRA 2WWYA 4ASNA 1W5SA 3TQNA 3J7AO 2IJLA 3KLOA 4XBFA 3GXOA 1KQ0A 3J80K 1UCRA 3FX3A 4MTDA 3WE3A 3V7CA 4BHPA 1SFXA 2ISZA 3ELKA 2VONA 2P8TA 3NRVA 1YTYA 3ML6A 3FF5A 3I59A 5D5VB 4GYGA 5TRDA 1H9GA 2XKOA 4A6DA 3GVAA 5DCMB 1WSUA 5L3BA 1KYZA 5CVRA 5E8GA 2K7LA 3CUQA 3L7WA 4IHSA 2D2WA 1P2FA 1WKMA 3KP6A 4BHCA 2STWA 2XAFA 3WTUC 4ENNA 1R7JA 4XLNF 5HDNA 3RYPA 3WTSC 1R23A 2F5EA 1R1TA 3BWGA 4YFKF 5F64A 5LGNA 4EJWA 3HTUA 4NHJA 3FMRA 4MNUA 4G7HF 3EYIA 2CSOA 1NHAA 3LFKA 5BPIA 2LKPA 2D1HA 1XD7A 4U7BA 5DUKA 3BJ6A 4O3MA 2Q2EA 2CQKA 2Y48A 3TGNA 2K02A 2IW5A 2IA0A 2O3FA 4CICA 2FF4A 5BOXA 4APFB 3L09A 3PQJA 5FFXA 5KK1A 4LLLA 4F52A 5D5XB 3RYRA 1J2XA 2OD5A 4KMFA 2BEOA 1XDUA 1LDDA 4KDPA 4OMYA 3LAPA 1REPC 2CYYA 2ADUA 2H27A 1ULYA 3U9GA 1WRJA 4ESBA 1ZRDA 4P9UA 2R7FA 4A6EA 1BIAA 2IP2A 1MD0A 2HTSA 3JSOA 2GAUA 1BC7C 1R5HA 3G3ZA 2RVCA 5DCFA 1Z6TA 3K1PA 2A69F 1MKMA 4M74A 2DFIA 2CGPA 2L3DA 2Z9OA 2XHKA 4L9VA 1IAWA 2PLYA 1U5TC 5HLIA 2DK8A 4F7ZA 4KIFA 4WXHA 5IT9Z 3MWMA 4U7DA 1G3TA 1YFHA 5HS8A 3I5UA 3M9AA 5LEJA 2L4AA 4HLXA 4L0YB 2M30A 1P92A 2IA1A 1XCBA 3FZVA 3IL2A 2DPUA 4N9HA 4IXAA 4BYYA 3H3ZA 2WTEA 2OBPA 2XUBA 2FQ3A 3EQLF 5BPDA 1D8KA 3HSEA 2RC4A 5LHHA 3EYYA 2C6YA 2O8XA 2G7HA 4ENJA 3LQQA 1HSJA 5K5RA 3LA7A 4L0ZB 2HTJA 3QP5A 3FMQA 1BN5A 3R0JA 4LGWA 1ZYRF 4BXUA 1BOAA 1IN8A 4IHTA 2IPQX 1FSHA 4I01A 1RNLA 1MDMB 3E6CC 2H6CA 4N9IA 1B9NA 1U6GA 1FZPB 1PUEE 3ROUA 5D8KB 4EM0B 3IRRA 1UB9A 2QM3A 2DLLA 3E97A 4R1HA 1W7PA 2DO7A 3IWFA 4IRGA 2JSCA 2BE5F 3TKYA 2VE9A 2ZXJA 4WF2A 3SFZA 5DDGA 3T8RA 2P5KA 4LG0B 1A04A 5J8CA 3MEXA 2GA1A 1JXSA 1USTA 4M72A 1TBXA 1O3TA 3FHZA 1XCVA 1OPCA 2BYVE 5KVRA 2W85A 5HDGA 3AAFA 3KLNA 4I98B 3GFLA 5HLHA 1J0RA 2E7XA 3O2PE 2M45A 1WWXA 1H0MA 2VODA 1EH6A 2EFQA 2P6TA 1T38A 4WWCA 2HYGD 4Y13A 5L3CA 5FD6A 5FGMA 2MH2A 5ILVA 1USSA 1F5TA 1XB4A 1O7LA 2RQPA 4KMUX 3CLOA 4RS8A 1P4AA 3CTAA 1U5TA 3GWZA 1LEBA 1SMYF 2MA3A 4G6DA 1I1GA 2FU4A 1F4KA 2CG4A 4XSZF 5E1ZB 2ZJ2A 1Z6RA 5HVQC 4A0YA 2FXAA 1YO5C 2M87A 4UXNA 3FWEA 1RZ4A 5DD8A 4U0YA 4Q4ZF 5ERIA 2M1BA 4XLPF 2FA5A 2ESNA 3QPHA 1SD5A 3DV8A 1QPMA 2VC0A 2QBYA 1CF7A 1DP7P 1YS6A 4P5OA 2GZWA 3W6KB 4P9FA 2DBBA 5LGUA 1X3UA 3GFIA 5D4SA 3HHHA 4HLYA 4BH9A 3F8NA 1HKSA 2J5OA 3OV8A 4KICA 1KU2A 1OYYA 3ZN1A 4PGHA 2VT3A 1MJBA 2P5LC 4L5IA 4HOBA 2NNNA 4B8XA 1FSEA 3QPTA 2FNAA 5E8IA 3BROA 1SMTA 2UZKA 3ZQ7A 4I2OA 4MHGA 1L3LA 1Y0UA 2A5YB 1C0WA 4KN4X 3ZMTA 3M1EA 4UVCA 5BQTA 2O61A 1ZGJA 5L3DA 3DP7A 3K69A 1SD7A 1ZG1A 1Z05A 3E5XA 5L3EA 5LHGA 3F6VA 2Y0MA 5E1XA 3V8JA 1XGOA 2EWNA 1RIOH 2XRNA 4U88A 2XIGA 1CGPA 2HZTA 3HHGA 2RNJA 3BOQA 4RB2C 4HQMA 3K1MA 2FEZA 2PQ8A 3C3WA 4M9XA 4EQQA 1KQ8A 2OA4A 4EVIA 1K7AA 3EDPA 5AONA 2KIUA 5CVVA 5DYMA 1GXQA 1UHMA 4E70A 2DT5A 3QRFF 2XAHA 2KJCA 3M8EA 5AIQA 4RGRA 2EFWA 1XSDA 4A5MA 3O6BB 2PMHA 4OINF 2YX4A 4HZFA 3C18A 3H3UA 4U0VA 3WU1B 1P4WA 1HKQA 5ICEA 3TOBA 2X4HA 1LDKA 4HXIB 3WTYC 2ZBKA 1TW2A 2B0LA 2EFPA 3OOPA 3GEZA 3GX4X 2W25A 5ED4A 1HBXG 1VTNC 4UNOA 3QOPA 3R0AA 3ISPA 1Z91A 3KCCA 1QO0D 1S29A 4WXCA 4HF0A 2PEXA 4AIJA 3IC7A 2G7UA 3F21A 3HUGA 4BNCA 4LK0F 1SFEA 4HX7A 4JBAA 2ZNZA 4CYDA 3FXRA 3F3XA 4RB3C 3D5LA 3JW4A 3SHFA 1U3EM 2AS5F 2K86A 3DQVC 4A2UA 2ZKZA 5JFRA 2BV6A 1XMKA 3E3VA 3HOSA 4RAYA 5J6XA 1ZARA 2M5WA 5H6RA 1EH8A 2EFNA 2NYXA 3WGGA 1BBYA 1B4AA 2IA2A 2QLZA 1ZGAA 4M71A 1WI9A 3F8CA 3HRUA 5LEKA 3WTVC 1DPUA 1S8NA 2ACJA 1J5YA 3GF2A 2PBIA 3V7RA 2ETHA 1DDNA 2LF7A 2P7CB 1W5TA 4OMZA 4AIHA 3RPUA 3SQNA 3K0LA 1IN5A 4UUVA 3F8BA 3BPVA 4XRFA 1HKTA 4EM2A 2LSOA 4CZZA 3DEUA 3MZYA 2G9WA 3IRQA 4RAZA 5JR3A 3ZMDA 5HOOA 3C7JA 1LDJA 1O7FA 4RGXA 4G7ZF 4HDVA 5D6EA 4M6XA 3I64A 1ZRFA 1IUYA 3V8LA 3F6OA 1GHCA 4G9YA 5CLSA 2A3SA 3LQRA 2O6GE 5JI6A 1HXDA 3WTWC 1BI1A 2KIFA 5E1WA 1IRFA 4Y17A 4WXDA 3IKVA 3REOA 1EV7A 2CW0F 1I1SA 3I58A 3ZMZA 1IXSB 4FX4A 4LLGF 2R3SA 4P96A 4EJVA 4GYIA 2V1UA 3F72A 2VXZA 2WC2A 2PJPA 2X0LA 3F22A 4EGZA 5ICGA 1V3FA 4YIIA 3FMSA 3ABUA 2XV4S 3TO9A 1B6AA 3BP8A 3J81Z 3NEUA 1E17A 1ON1A 2PG4A 2FBKA 4YFNF 1K6OA 4KYWA 2MC3A 3ZMVA 3KP7A 1S7OA 2FMYA 1G6NA 2QVOA 3JTHA 4BAYA 1XMAA 2H94A 1FY7A 4KA4A 2W84A 1YW9A 1ZAOA 2CFXA 1R58A 2PFBA 1ZLKA 1YW8A 1P4XA 1ON2A 5D5WB 4KN7X 2EV6A 2EA4A 2A07F 4O5VA 1S7AA 3I71A 4L9JA 4Q48A 1IW7F 4ZYHA 2J5PA 2QQ9A 1QQIA 1XGNA 3N97A 1HW5A 4HX4A 1FP1D 1STZA 2K4JA 1BC8C 1IZ1A 2GIVA 3J80Z 2F5DA 3B02A 2NNYA 2QQBA 3ERED 1BM9A 1U5TB 5FO5A 1D5VA 1FLIA 2QUFA 3EUHA 3D0SA 5ILSA 3KP4A 1LJ9A 5FD5A 1I6XA 3HYIA 1RUOA 1I27A 4A12A 1R00A 1JHFA 3B73A 3E5QA 1FOKA 3K1NA 1G3SA 2L01A 1ZG5A 2XAGA 3T0YA 2BBYA 1I5ZA 2QBYB 1T39A 1FYMA 2H09A 2D1VA 3H92A 1H9TA 1QGPA 1R36A 5BMZA 3MCZA 2QQAA 4ENKA 1W7PD 2NAZA 3ABTA 2STTA 1ZREA 2HQRA 2JPBA 1IXRC 5HDKA 1F9NA 2E1NA 2IT0A 4HBLA 3CO6C 1KU3A 3WODF 5CVJA 1D8JA 4XSXF 2ELHA 5A2QK 5H20A 3ULQB 4EV0A 4ZYDA 3VFZA 2XASA 3JSPA 3R60A 5JHUA 3CUOA 4KNYA 4MGRA 1FPQA 4MQVA 3IKTA 5F1RA 1XGSA 3U1DA 4Q5SF 3MZHA 2UXNA 3CDHA 1WQ2A 2LF8A 4HQEA 3DFGA 3DPLC 4RB1A 1J59A 3M8FA 3VB2A 4FT8A 1YLFA 4EOZB 2V1DA 3I0TA 4UVAA 5D4RA 3HTSB 1TW3A 2HOEA 2HYFA 2XVCA 4K2EA 3GLXA 2WV0A 2H6BA 1O3RA 1W4MA 4BHBA 1U8RA 1AOYA 1K78B 2GXGA 3DPTA 1E2XA 4HF1A 4YG2F 1HW2A 2Z3YA 2OQRA 2UWMA 2GXBA 2VOOA 3V7SA 1O57A 2EV5A 4EM1A 3ECOA 1LDKB 4D0PA 4ZYGA 2HFHA 2JPCA 1ZHFA 2OZUA 3I54A 1XN7A 5D8LB 3E6BA 4ON0A 4HX8A 1R22A 4WQOD 5LHIA 4ZYEA 1TLHB 5FLXK 3VODA 3KFWX 2KJBA 4AWXB 1FYKA 2JRTA 2V9VA 3G73A 4AD9A 3I4PA 5K1YA 4HYEA 1T2KA 4L18B 3MQ0A 1FYLA 2HWVA 3Q9VA 5IT3A 1TQIA 1JHHA 3KP2A 2FMLA 4L5JA 4O6JA 1L0OC 1IF1A 2D45A 2E7WA 5A2QZ 2ZMEB 4A0XA 2FRHA 2OAZA 3HRMA 2DPDA 5FB2A 2Q8KA 1RI7A 1KYWA 1OKRA 2A61A 1OYIA 2VC1A 4S04A 2R7DA 4KIGA 4JQFA 4UHTA 2ESHA 2HR3A 3CJNA 1LEAA 3KE2A 3R61A 2XAJA 3WE2A 3F23A 4RGUA 3F8FA 3RKWA 4YIFA 4CGZA 3T1BA 4OIPF 1Z7UA 1U78A 4MEXF 1UHWA 1QBJA 3FXUA 4YFXF 3S2WA 4M9SA 5JVTA 1HSTA 2TDXA 5L3GA 4UVBA 2HKXA 3GFJA 1K79A 3CO7C 3LSTA 4ZH4F 1QZYA 2L54A 5F6FA 5FFZA 2HEOA 3KZYA 1FNNA 5DEQA 3WG9A 1YW7A 1XSXA 1J7KA 2ISYA 3QU3A 2W57A 1TNSA 2XGXA 5DUIA 1OR7A 3L2CA 1AWCA 1YIOA 3E5UA 4N0BA 1FC3A 3T5XA 1PP7U 1F1ZA 2YX7A 3GW2A 3WU0A 1LVAA 3DXJF 4IPAA 2AXLA 3LAJA 1JGSA 5CYVA 4H0EA 1YG2A 2MD5A 3MFKA 1ZRCA 2XROA 2FNPA 4R8HA 4U0WA 1BIBA 5FLXZ 4G7OF 1D3YA 3VEPA 2HDCA 4QLCU 4I09A 5LLQA 4IJAA 2RKHA 4IVNA 5D6FA 1PP8F 1BI3A 1PDNC 1TQMA 2EK5A 2OU2A 5LRSA 2RV8A 4JGHD 4S05A 4LJZF 3IHUA 1MJAA 4CO8A 5E17F 2DK5A 4I0AA 3ZMSA 3BJAA 3RKYA 1FP2A 1KU7A 3EETA 2QWWA 4NQWA 3TOAA 2YSRA 3V8KA 1R5GA 2V79A 3ZP5A 4HW0A 2YPRA 4NB5A 4OOIA 4PGGA 4LD5A 2MLKA 5ICCA 4UV8A 2P4WA 2FBIA 3LA2A 2DI3A 3FXQA 4Q47A 2VBWA 4EGYA 3GUDA 2DAOA 3SZPA 4R79A 2ZNYA 3WTTC 1OYWA 3RPQA 2Y75A 3DF8A 1O3QA 5L3FA 2E1CA 2VT2A 3WGHA 4KIBA 2P6SA 3NQOA 4CDGA 1R1UA 1EH7A 3RTRA 5AIPA 3JTGA 3E6MA 2GQQA 1RUNA 4IRHA 3RKXA 2HS5A 1ZH5A 4AP2B 2W24A 4LK1F 1QNTA 4AVPA 5H6QA 3PQKA 1Z9CA 5EEGA 3K2ZA 6PAXA 3I53A 4GGGA 2FBHA 2ZCWA 2A68F 4N9F3 4HF2A 2EB7A 5LBQA 4LMYA 2EJRA 2O03A 1O3SA 3I59B 4PDKA 2K27A 3RIRA 2KKOA 2F5CA 1Z1DA 1J75A 4MTEA 3HSFA 1B9MA 5DCMA 3HRSA 4HV5A 3RJPA 3CUQB 4HAMA 2HGCA 4LLNA 4BQAA 1LB2A 2PN6A 3QP6A 4MEYF 3R4KA 1ZN2A 3COAC 1U2WA 4UV9A 2WZKA 2DU9A 2L4MA 4EJOA 3SXYA 2A6EF 4DNCA 1B1BA 3C1DA 1ZLJA 2VBYA 3JAMK 4A0ZA 2M8EA 3BDDA 4I0BA 3HOTA 3GZ6A 1TQPA 2JZYA 5K5QA 2FOKA 3HSRA 4P55A 5DD4A 1IN4A 2F2EA 2KIMA 3QAHA 3BY6A 3JAMZ 3BJOA 1K78A 4B09A 3WTZA 1QZZA 1BI2A 2NRAC 1T6SA 1SD4A 2CO5A 2EFOA 3WGIA 1TNTA 1YQAA 1OMIA 3LA3A 2PI0A 2VBXA 5D5UB 2O0YA 3T8TA 4L9NA 3Q9SA 2VOPA 2OZ6A 4GCVA 1HW1A 3DKWA 1G4DA 3KEOA 4KFCA 1S3JA 1JE8A 2P7VB 4KUMA 3KETA 4QWQA 4FHTA 3LWFA 2VN2A 3N4MA 3ZN0A 3TO7A 4ESJA 2DW4A 3RDIA 5LRRA 2COMA 3PFIA 4I02A 3P9IA 3F8MA 2IRFG 1IXCA 1MZBA 1ONVA 3M7GA 3TDZC 3TDUC 4M6YA 3FM3A 5CVUA 2BGCA 2JT1A 3O3KA 2K4BA 1IN7A 5EEHA 2MBFA 4HV6A 2ZMEA 3HIFA 5K5OA 1P6RA 4WCGA 2RGVA 2GA2A 2MLGA 2LNBA 1KU9A 2DQLA 2Z5UA 4LFUA 2ZFWA 3KP5A 4JK1X 1BJAA 1MGTA 4M73A 1B59A 1GXPA 3KP3A 4A64A 1FBQA 1IRGA 3VOEA 4RGSA 3GO5A 3TO6A 1ODDA 1SAXA 1FT9A 3U2RA 3L9FA 2L02A 2JTVA 4RB0A 5CVIA 3L00A 3IWZA 5HS9A 4MQ9F 2MH9A 2XAQA 3HRTA 3V4GA 4LB6B 4LB5A 2UXXA 4G94A 1T98A 1G3WA 1ZG3A 2A6HF 3BPXA 3KZZA 4IRIA 4ZZLA 2LDUA 4WX9A 2V1XA 4L9TA 1GVJA 4TV7A 2FE3A 3ZMUA 4EMSA 5E18F 1TTYA 1UFMA 3MAJA 2V6CA 4OIRF 1XGMA 2RDPA 4WK8F 3GYHX 4HDUA 4ENMA 2FSWA 4OU0A 2Z33A 2YR2A 3FM5A 1LQ1A 2VBZA 5DV5A 4ETSA 4DQ2A 1MDMA 2EA2A 1V4RA 2VE8A 5LGTA 1KQ9A 4G6QA 1G3YA 1S6LA 3P9KA 4PZJA 1DUXC 1DPRA 1J9IA 4ZZDA 2IVMA 2YU3A 1Q1HA 5J8FA 1W7PB 5E20A 4HA8A 5CJ9A 2HKOA 2QZ8A 3Q5FA 4PCQA
chains in the Genus database with same CATH superfamily
1BJZA 4OIQF 5BNGA 1N25A 2VKHA 4GXOA 4LG0A 5F0CA 2F5FA 2RN7A 2WA0A 5ILUA 3P9CA 1B8IA 2JA2A 1KGSA 1SVLA 4F55A 4DGWB 3P7NA 5IOYA 1UG2A 3WTXC 3HXLA 2LH9A 2ZO4A 5TISC 1A36A 3BZ6A 4I7HA 3A2KA 2LYCA 4PJLA 1IRXA 3K9TA 2BHZA 2HQNA 1FBUA 4Z2YA 2DQRA 1Z3YA 2Z99A 1WI3A 3QYEA 2XF5A 3CUQC 1IN6A 4EJUA 3S16J 2CWEA 3M1CA 4II3A 4OIOF 4ESFA 4ABZA 2QYOA 1SD6A 1Z21A 2XAUA 3GZ5A 4A5NA 4NUUA 4IL6C 5HS7A 2QENA 2P5VA 2EIKH 4GO1A 4NQWB 4FX0A 3LMMA 4CYCA 2BVMA 5IT9K 1T0FA 2Y8DA 1MMDA 2B7EA 1FBSA 3BR5A 1R1VA 3BZCA 4J19A 3E7LA 3QYBA 2DFHA 3CDLA 1MJ9A 4DIQA 4CCKA 5TJJA 2CQQA 2VPRA 2HXIA 1UMQA 3DTEA 1GUUA 3W6JB 1FIAA 5BS6A 1XSVA 2CV2A 3QU6A 2GWRA 4F3QA 4H4KC 1RPWA 2L5QA 5HLGA 1Y56A 2JA7J 1XDSA 4CXFA 1FJLA 5ICFA 3HOXJ 1S9HA 2Q0OA 3ZPLA 1V54H 2HYJA 1K83J 3ZQQA 1YRNA 3SZTA 2QGUA 1SFUA 1WJFA 3I3LA 3R6SA 2EV0A 5M5WJ 3BQIA 4EEFG 4AIKA 2NOJB 2NS0A 2OQGA 4KT5C 3H5NA 1BI0A 2FQ4A 4M9ZA 1BL0A 1UAAA 5IY5H 4G8XA 4MFEA 1HQCA 1FX7A 4CH7A 3ECHA 2VKDA 2HNHA 3MKZA 2VXDA 3S93A 3H1CA 4XKWA 2PMUA 4NUVA 1LNWA 4JP0A 4NUBA 4Y15A 1BW5A 2RNGA 1YIJI 3J81K 3E6DA 2KRFA 5B3SH 1MIJA 3GFMA 1YITI 2MFZA 1KA8A 1OQYA 1FWZA 2LREA 3KZIC 3RI4A 1B72A 5GTIC 4IHVA 4IF4A 5C3EJ 1YS7A 1OISA 3KEQA 4NC6A 4XN3A 5FROA 2AXTC 1VZ0A 4EJTA 5E3OA 3S15J 2QKLB 2XKPA 1YYVA 1CF7B 4CHUA 5DS9A 4IOCF 2DTRA 3CMYA 2WWYA 4ASNA 1W5SA 3TQNA 3J7AO 3LNQA 2O8KA 3J7AY 2QSFX 4KISA 2IJLA 3KLOA 4XBFA 3GXOA 1KQ0A 4XR6A 3J80K 1UCRA 3MZ8A 4M3EA 3FX3A 4X1EA 2COBA 4D7NA 1CQTA 4MTDA 3AG3H 1TZLA 3OMYA 3WE3A 1WZ2A 2ECCA 3DEEA 1X1PA 3V7CA 3A1YA 4BHPA 3ZOBA 1SFXA 2ISZA 3ELKA 1QVUA 3AFHA 2VONA 1NG6A 2P8TA 2CV0A 3NRVA 1A6IA 1XC5A 1YTYA 3CCUI 3HOYJ 2K40A 1AHDP 3ML6A 3FF5A 4BJ6C 3I59A 2JRMA 2UUZA 5D5VB 4GYGA 5TRDA 1H9GA 2XKOA 1JT6A 1QU3A 1D1CA 2XGDA 4A6DA 4OAYA 2OF7A 3QWLA 3GVAA 1F36A 5FKNA 3H9QA 2HQ5A 5DCMB 1X1AA 2RQQA 3S8PA 1WSUA 2EZKA 5L3BA 3QOEA 1KYZA 5CVRA 5E8GA 2K7LA 5EZHA 3CQZJ 3CUQA 4C30A 4D7MA 3L7WA 1ZK8A 5FKKA 4IHSA 3H36A 2D2WA 5HLTA 3KEYA 2ID6A 1P2FA 1WKMA 3KP6A 4BHCA 2STWA 2XAFA 3OS1A 5HNHA 2TCTA 2EBIA 3WTUC 4ENNA 4B48A 1T0FC 1R7JA 4XLNF 5HDNA 3RYPA 1SFKA 2H8WA 2V9KA 2Z16A 3M8JA 3WTSC 3W3CA 1R23A 2F5EA 5GPCA 2OUMA 1R1TA 3AL0B 3BWGA 4MO7A 2LRDA 4BGDA 4YFKF 3ABLH 5F64A 5GAEJ 1K4SA 3OS2A 5LGNA 2QA4I 1LFBA 4YEJA 4EJWA 3HTUA 4NHJA 2IGNA 2L9RA 3FMRA 3HOWJ 4MNUA 2EINH 3BR6A 3OYAA 3PNTA 2Y31A 4G7HF 3EYIA 2CSOA 3BTCA 3JRHA 1NHAA 2JK3A 3LFKA 2OTLI 1NG7A 1S5LC 5BPIA 1JI8A 5F0HA 4YFSA 1KZHA 2LKPA 4XKBA 2D1HA 3VSKA 1XD7A 4U7BA 5DUKA 3BJ6A 4W1UA 4O3MA 2Q2EA 1E3HA 2CQKA 4E7HA 2Y48A 3TGNA 3BG7A 3LSPA 2K02A 2IW5A 2IA0A 2O3FA 5FKOA 4CICA 2FF4A 5BOXA 4APFB 1D0ZA 2JJ7A 3L09A 1QZEA 1AKHB 2M4GA 3PQJA 3FXLA 5FFXA 5KK1A 2O9LA 4LLLA 4F52A 5D5XB 2R7SA 4A3FJ 3HOUJ 1JGGA 3I4NJ 2R92J 3TP3A 3S1NJ 2KMUA 2HPMA 3RYRA 1PUFA 1J2XA 2OD5A 4KMFA 2R7OA 2BEOA 3A01A 1AU7A 1ZKGA 1WFXA 3LFUA 1XDUA 1LDDA 3ZQGA 3GTJJ 5EDNA 5IYCJ 4RLFA 4KDPA 4OMYA 3LAPA 1REPC 2CYYA 5CQGA 2ADUA 5B5EC 2H27A 1SANA 4XLCA 2ZXWH 1X2MA 1ULYA 2CFOA 3U9GA 1WRJA 4ESBA 1ZRDA 4E4HA 4HEA2 4ZTFA 2RREA 1GT0C 4P9UA 5EF6A 2HQAA 2R7FA 4A6EA 3H9GA 1BIAA 2IP2A 1MD0A 2LBFB 1SAUA 2HTSA 3OYLA 3MKLA 2LOOA 3JSOA 1GVDA 2GAUA 4AIDA 1BC7C 4IOAF 1R5HA 4PSWA 3G3ZA 2RVCA 4DYRA 5DCFA 1MMNA 3OYMA 1Z6TA 3K1PA 2A69F 2GOMA 1MKMA 1E3OC 2CQNA 4M74A 1I6HJ 2DFIA 2CGPA 2L3DA 2Z9OA 3KX2A 2XHKA 4LOCA 3BTJA 4PUSA 5F1JA 4L9VA 1LFPA 1IAWA 4GDFA 2PLYA 1U5TC 4PFOA 4C2MJ 4BDZA 3K2AA 1ETQA 5HLIA 2LKSA 2DK8A 3HDDA 4F7ZA 4ZTJA 2A5WA 1ETYA 4KIFA 3ERMA 5DTDA 4WXHA 5DM6F 5EGOB 2IBDA 5IT9Z 3HZJA 1Y8QB 3MWMA 4U7DA 2PFVA 1G3TA 3CDIA 4JYKA 4MLOA 5HS8A 1YFHA 3I5UA 3S17J 3M9AA 4CZCA 2L4AA 2DN0A 2LMDA 3OL4A 5LEJA 4HLXA 4D1QA 1LKXA 3CZ6A 4L0YB 1YJWI 2M30A 1HDPA 3FXJA 1SVOA 1P92A 5B1BH 1RR8C 2OC6A 2ZSHB 3KYCB 3M4OJ 4BY7J 3WG7H 3F9KA 5B66C 3IP4B 2IA1A 1XCBA 3FZVA 1ENHA 3JRAA 3HGGA 3IL2A 1A31A 2DPUA 4YELA 2ICWG 4N9HA 4A3JJ 2WADA 1VQKI 4IXAA 4BYYA 3RKQA 3H3ZA 2WBMA 2HXOA 2WTEA 4OWRB 2OBPA 2XUBA 4AYBN 1QVTA 4Z6YA 4BQOA 1ZTRA 2FQ3A 3EQLF 4CUGA 1SEUA 5BPDA 3RSNA 1D8KA 3HSEA 2NS8A 4PFPA 2HVSA 2RC4A 5LHHA 3EYYA 1ITYA 2HVRA 1P7JA 2C6YA 4YRVA 4CCJA 2CMPA 2G7HA 2O8XA 4ENJA 2DTZA 5IP7J 3Q0UA 2PMZN 1WPKA 3DKXA 3LQQA 1HSJA 1X19A 5K5RA 5FLVA 3LA7A 4L0ZB 2HTJA 3QP5A 3W2AA 4J01A 4HNTA 3FMQA 4BEHB 1BN5A 1D0YA 3R0JA 4LGWA 4RAGA 1ZYRF 3DWLE 2P81A 4BXUA 1BOAA 3GTMJ 2EILH 1IN8A 2HOSA 4IHTA 2IPQX 1FSHA 4HG2A 4I01A 1RNLA 1ETXA 3E6CC 2H6CA 1MDMB 2DJIA 3DTKA 4N9IA 3JRIA 1BR2A 3H35A 3CF5F 1B9NA 1U6GA 1FZPB 1K4TA 1PUEE 3ROUA 5E79C 1ZQ3P 5D8KB 2LY9A 2JN6A 4EM0B 3IRRA 1UB9A 1UHSA 1JJ8C 3ZGKA 2B1EA 4XONA 4FISA 2XU0A 3L2RA 5B1AH 2QM3A 2DLLA 2DT6A 3K4BA 5KAFC 1QHHD 3E97A 3FBNB 4NC7A 4R1HA 1W7PA 2Y0SA 2DO7A 3IWFA 4IRGA 2JSCA 2BE5F 1JUMA 3TKYA 3A0HC 2VE9A 2R5YB 2ZXJA 2WAEA 4WF2A 3SFZA 5DDGA 3T8RA 1GLNA 1FOXA 2P5KA 4LG0B 3ZQIA 3V42A 1A04A 3VSLA 5J8CA 1FMVA 2GA1A 2MG4A 3MEXA 1JXSA 1B8IB 1USTA 2PJRB 3IH3A 3D1NI 1I50J 2FJ1A 5C44J 4M72A 1TBXA 1YHQI 4XKVA 3KPHA 3G71I 4E7IA 1O3TA 2ZC2A 2VL8A 3FHZA 4EATA 1XCVA 4PJJA 2JSPA 1OPCA 1MNDA 3HC7A 2RAEA 2BYVE 5KVRA 1VQ8I 4RA2A 2W85A 2R7TA 2DDBA 5HDGA 3AAFA 3VDXA 3KLNA 4I98B 3GFLA 5HLHA 2E60A 2W48A 4CYCB 1WJAA 3GTKJ 1J0RA 3HEFA 4BS9A 2E7XA 3O2PE 1IV8A 2WV1A 5FKMA 2M45A 3CP2A 3RQIA 4QTRA 1WWXA 1H0MA 2UV1A 3L2QA 2VODA 3LSJA 1EH6A 2EFQA 4JX5A 1JKOC 3TMOA 2P6TA 1T38A 4WWCA 1OCRH 4UUSA 2HYGD 2E2HJ 4Y13A 4PK4A 5L3CA 5FD6A 5FGMA 2MH2A 5ILVA 1USSA 2X1DA 3K7AJ 1XB4A 1F5TA 1O7LA 1MBEA 1YRNB 2RQPA 2CRGA 4KMUX 1X1CA 1VQMI 3CLOA 4RS8A 4IEJA 4AVZA 2LY1A 2E36A 5K7FA 1P4AA 3CTAA 2HOTA 1U5TA 3GWZA 3OYFA 1LEBA 1Y1VJ 1SMYF 1OCZH 2L7FP 2MA3A 4G6DA 1I1GA 5HNFA 2FU4A 2DOAA 2F4IA 3C2BA 2F4MB 2LY2A 1XS9A 1F4KA 2CG4A 4XSZF 5E1ZB 2ZJ2A 3JRCA 1Z6RA 3CC2I 3OYJA 2BY1A 2KIQA 2M4KA 5HVQC 2V4JC 4A0YA 3S14J 4B44A 2FXAA 1YO5C 1VQ4I 3PJRA 2M87A 1N78A 4UXNA 3FWEA 1RZ4A 1VQOI 3G1MA 5EZGA 5DD8A 4U0YA 4Q4ZF 1B72B 5ERIA 2OPTA 2M1BA 5JVGF 1MNMC 5TGTA 4XLPF 4E7ZA 2FA5A 3G1LA 2AQEA 2ESNA 3QPHA 3PUBA 1SD5A 2DA5A 1BA5A 3DV8A 2DYRH 3VYRB 1G59A 3W2VA 1QPMA 2VC0A 2KZVA 2QBYA 3G6EI 4RDUA 4N4NB 1CF7A 1DP7P 1YS6A 3B6CA 4P5OA 1RESA 2GZWA 3W6KB 5GAGJ 2HDDA 2QSHX 4P9FA 3CCQI 2DBBA 2L9SA 1P9QC 5LGUA 1X3UA 3UKGA 3GTQJ 3GFIA 5D4SA 3HHHA 3NARA 4NNJA 1ZR2A 2ZXHA 4HLYA 3JCUC 2LG4A 3F8NA 4BH9A 1HKSA 2J5OA 3OV8A 2X6OA 3FKIJ 4KICA 2HI3A 1KU2A 2LVSA 4XL9A 1OYYA 1XG1A 2FX0A 3ZN1A 4IHYA 4PGHA 2VT3A 2L9VA 1MJBA 2LR8A 2P5LC 4L5IA 2I8DA 3BC8A 4HOBA 2NNNA 5C4JJ 4B8XA 1FSEA 4BDYA 3QPTA 2FNAA 2JA6J 5E8IA 5J1YA 3BROA 1SMTA 2UZKA 1W0UA 1I3AA 3AG2H 3ZQ7A 3K4CA 4XK4A 3TBIA 4I2OA 4MHGA 1L3LA 1Y0UA 2A5YB 1C0WA 3OR1C 4KN4X 3ZMTA 1U9NA 3M1EA 4UVCA 5FKLA 4CCMA 3BQKA 1NK3P 3BLYA 1RKWA 5BQTA 2O61A 2YU9J 1ZGJA 5L3DA 3DP7A 3K69A 4GRIA 1SD7A 2R7XA 2FD5A 1PJRA 1ZG1A 2JVHA 4DW6A 3LSGA 2X6YA 1EA3A 4MFDA 1Z05A 3E5XA 5L3EA 1G8XA 2Y2ZA 4BQQA 5LHGA 3F6VA 2DMUA 3A0BC 2Y0MA 5E1XA 5K7HA 3V8JA 1XGOA 2EWNA 1BOBA 3L2UA 1U0JA 1RIOH 2BW3A 2XRNA 4U88A 2XIGA 4BBRJ 1CGPA 2HZTA 3HHGA 3HBLA 2JA8J 2RNJA 3BOQA 4RB2C 1TC3C 4HQMA 3K1MA 2FEZA 2PQ8A 2VQHA 3C3WA 4M9XA 4EQQA 1KQ8A 3BTIA 4ZDPA 4BJTA 4J00A 2OA4A 4EVIA 1K7AA 2A05A 2A6TA 4C2TA 3EDPA 4AU7A 3FXMA 5AONA 2KIUA 5CVVA 1ZLKA 5DYMA 1GXQA 1UHMA 1FOYA 3CJRB 2DT5A 3OIQA 4CSWA 4E70A 2XAHA 3QRFF 4A3DJ 1XTAA 2KJCA 4XLEA 3PIOF 3M8EA 5AIQA 2DODA 4RGRA 1T33A 3CJTB 3KIOA 3AKZA 1U9OA 4W97A 2EFWA 1XSDA 3FKJA 3O6BB 2PMHA 4OINF 4A5MA 2R7QA 2ZB9A 3VWBA 2K9MA 2YX4A 4HZFA 3DTIA 1MH4A 3C18A 4BUPA 3H3UA 4U0VA 1X58A 1R5ID 3WU1B 1P4WA 1HKQA 3OYBA 5JLXA 4QPQA 1KONA 5ICEA 3TOBA 2X4HA 3QODA 1LDKA 1NTCA 4HXIB 3SZGA 1AKHA 3WTYC 3JRFA 5KAIC 2ZBKA 3DU6A 1DGRM 1TW2A 5FRMA 1YJNI 2QQ8A 3CCYA 2B0LA 2EFPA 3IH2A 3ZQFA 3OOPA 3GEZA 3GX4X 2DMTA 2W25A 4XKCA 5ED4A 2XF6A 3W2WA 1VTNC 1HBXG 4UNOA 3QOPA 3R0AA 2X6XA 3ISPA 1Z91A 1FTZA 3KCCA 1QO0D 3JR9A 1S29A 4WXCA 4HF0A 2PEXA 4AIJA 2DCEA 3S32A 3I56I 1RKTA 3OYDA 3IC7A 2W4SA 4RMNA 3CCMI 2G7UA 3F21A 2DT7B 2DXIA 3HUGA 4BNCA 4LK0F 3ABMH 2E2JJ 1SFEA 4HX7A 4JBAA 1J9IA 2ZNZA 4D5CA 2EZIA 5E3MA 1VQ7I 4CYDA 1R49A 4IO9F 3PFYA 3FXRA 2JVGA 3BTLA 1UZCA 3F3XA 3X2QH 4RB3C 2LBFA 3VYSB 2XPUA 3D5LA 2ME6A 4BACA 4BBSJ 2KDOA 1FIPA 3JW4A 1F43A 2NVQJ 4E7JA 2EH3A 3SHFA 3CCSI 2AO9A 1U3EM 2ZJRF 2DA6A 1ZELA 3QQAA 3BG3A 2AS5F 2K86A 3DQVC 3W6VA 2M7AA 4A2UA 2ZKZA 5JFRA 2BV6A 5IPAA 1GV5A 1XMKA 2BY0A 3E3VA 3IUOA 1W1WE 2X9DA 3HOSA 3PM1A 4RAYA 3S3NA 4ANJA 5J6XA 1ZARA 2M5WA 2BVLA 5H6RA 1EH8A 2VQCA 2EFNA 2NYXA 3WGGA 5EGOA 4A3EJ 3G1OA 1BBYA 1B4AA 3S3MA 4V2FA 5F0FA 2IA2A 1D1AA 2EIJH 2QLZA 3L2WA 4F91B 1LFUP 2LFBA 1ZGAA 4M71A 1WI9A 1WH5A 3F8CA 3HRUA 4KITB 5LEKA 3WTVC 1DPUA 1S8NA 4FASD 1WHUA 2ACJA 1J5YA 3GF2A 2HZDA 3OSGA 2PBIA 5K7ZA 3V7RA 2I10A 2ETHA 2E19A 1Z0XA 2LF7A 2K9QA 1DDNA 1ACIA 2P7CB 2W1OA 1W5TA 5J1UA 4OMZA 2JWTA 4AIHA 3RPUA 3SQNA 1U8BA 4UB8C 2ME0A 4RBOA 4YIRX 3K0LA 1IN5A 4UUVA 1WVRA 3F8BA 2ZJPF 3BPVA 1MMSA 4XRFA 1HKTA 4EM2A 2LSOA 4CZZA 3DEUA 2Y69H 1HOMA 3MZYA 4AM3A 2G9WA 2F6CA 1OCTC 3B6AA 3IRQA 4RAZA 5JR3A 3ZMDA 3CLQA 5HOOA 3H9JA 3C7JA 1LDJA 2IXSA 5F27A 1O7FA 4RGXA 4G7ZF 4HDVA 2HVQA 5D6EA 4M6XA 3H3VK 3I64A 3HM5A 1ZRFA 2L2OA 2R0QC 2X6WA 1IUYA 5GPAA 3V8LA 2DA4A 1X1BA 3F6OA 1GHCA 4G9YA 2M9HA 1AA7A 5CLSA 3DBRB 1IRZA 2A3SA 4BEHA 4XICA 3OWTA 3LQRA 2O6GE 5JI6A 2YUSA 2CQ7A 3FK6A 1HXDA 3LSKA 2LP0A 3FIWA 3U21A 3WTWC 5LD2C 1O4XA 1BI1A 2KIFA 2QF7A 3U1KA 5E1WA 1IRFA 1OLTA 4C9YA 4Y17A 4WXDA 3IKVA 3REOA 4RLQA 1VQNI 2IGKA 1I3QJ 3BR3A 1TWHJ 4BXFA 3K70C 1EV7A 2K5CA 2WY8Q 2CW0F 1I1SA 3I58A 2DMNA 1IXSB 3ZMZA 4FX4A 4LLGF 3NWTA 4XN0A 2R3SA 4P96A 4EJVA 1V5FA 5E3LA 1Z7LA 4GYIA 2B9SA 2V1UA 3F72A 2VXZA 3O8GA 2WC2A 3DPUA 4BY1J 2PJPA 2X0LA 3F22A 4EGZA 5ICGA 2V26A 1V3FA 4YIIA 2R5YA 1W0TA 3FMSA 3ABUA 2XV4S 3TO9A 2GLOA 1B6AA 3CP8A 3BP8A 3IAM2 2JA5J 2NOGA 3PL8A 2EZLA 3J81Z 1XMXA 3NEUA 1E17A 1PVEA 2PJRA 3RRCA 1ON1A 2PG4A 4DZPA 1P7IA 2FBKA 3ZQLA 2CUFA 4YFNF 1K6OA 2XDVA 4D9JA 4KYWA 2MC3A 3ZMVA 2CUEA 3KP7A 2IS1A 2MC4A 1S7OA 2FMYA 1JTXA 1G6NA 1T56A 2QVOA 3JTHA 4BAYA 1XMAA 1RETA 2H94A 3ASOH 3ZXSA 1FY7A 4KA4A 1DU0A 2W84A 1YW9A 1DP3A 1ZAOA 4XM3A 2CFXA 1R58A 2F4OB 2KL4A 1YW8A 2PFBA 3DBHB 5DM7F 2CS3A 2V7FA 1P4XA 1ON2A 5D5WB 4KN7X 5LFAA 2EV6A 5CQEA 1WJEA 2KRHA 5IYDJ 2EA4A 1R71A 1IDYA 3PUFA 2R93J 2A07F 4XNFA 5EYRA 4O5VA 3VYTB 3GLLA 1S7AA 3I71A 4G6TB 4L9JA 2FOWA 4Q48A 2Y30A 1IW7F 3GTOJ 4ZYHA 2BXZA 2J5PA 2BY3A 2QQ9A 1QQIA 1XGNA 2XGCA 4UUSB 3N97A 1HW5A 2LLKA 4HX4A 1FP1D 1STZA 2K4JA 2OCCH 4BQNA 3IV5A 4NBQA 1BC8C 1MSFC 1IZ1A 3H5AA 2GIVA 3J80Z 2F5DA 1VQ9I 4AYBA 2VJIA 3B02A 2KDZA 2NNYA 3EPZA 1X4PA 2QQBA 3ERED 1U5TB 1BM9A 3C2HA 2V9PA 3ZQHA 4A93J 4DOZA 5FO5A 1D5VA 1FLIA 3OY9A 2ZXIA 2QUFA 2Z1DA 3EUHA 3NAUA 3D0SA 3GBGA 2M7BA 5ILSA 2F5VA 3KP4A 1LJ9A 1FOWA 2CUZA 5FD5A 1I6XA 3HYIA 3OYKA 1RUOA 1I27A 2R7UA 1UELB 1MBJA 4A69C 2MD0A 1IC8A 4A12A 3TW6A 1R00A 1JHFA 3B73A 3E5QA 3FDYA 1FOKA 2ELJA 2W00A 4NC8A 2JQ7A 2KP6A 3K1NA 1G3SA 3DEWA 1POGA 2L01A 2YS9A 2DFFA 1ZG5A 2XAGA 2L9NA 3T0YA 3OSFA 2BBYA 3JRBA 3ESWB 1I5ZA 2QBYB 1T39A 1N77A 1FYMA 1OJLA 2H09A 4DYQA 2D1VA 3H92A 1H9TA 1QGPA 4FQGA 1R36A 5BMZA 1LVKA 3MCZA 3S1QJ 1JKRC 2QQAA 4ENKA 4JX6A 1W7PD 2NAZA 3ABTA 2STTA 2KPMA 3GZNB 1ZREA 1E3PA 4XOTA 2HQRA 3BQLA 2JPBA 1IXRC 5HDKA 2XB0X 1F9NA 2E1NA 3ABKH 1V55H 2IT0A 4HBLA 3CO6C 1MBKA 1KU3A 3FBIB 3K4MA 4CA0A 3WODF 5GTHC 5CVJA 4M3DA 1D8JA 4XSXF 4LG3A 3S1RJ 2K3PA 2ELHA 4QPOA 5A2QK 4A3BJ 5H20A 3ULQB 4EV0A 4ZYDA 4LIVA 3PSFA 3VFZA 3JRDA 2XASA 3MMYB 4E7LA 1S72I 1RR7A 3JSPA 4X0GA 3R60A 3LSRA 4PSXA 1DGWY 3SJMA 5JHUA 4V19K 1YE9A 3CUOA 4KNYA 1ETWA 1Y0NA 1OCCH 4MGRA 1T08B 1FPQA 3HGYA 4MQVA 3IKTA 3PO2J 2DOEA 1IGNA 5F1RA 1XGSA 3U1DA 4Q5SF 4B1RA 4NDLA 3MZHA 3CD6I 5IOZA 1WGXA 2UXNA 2CH0A 1K6YA 3CDHA 1WQ2A 2R7ZJ 2DA3A 3A02A 2LF8A 5EEAA 3TEDA 2BW3B 5J4YA 4HQEA 4ZJZA 1ETVA 3DFGA 3DPLC 4RB1A 1HDDC 1J59A 3I9V2 3M8FA 3VB2A 4FT8A 1YLFA 2OJED 4EOZB 2WB1A 2BY2A 2V1DA 3I0TA 5JLWA 4V2GA 4JOMA 4UVAA 5D4RA 3HTSB 3JREA 1TW3A 1V5GA 2HOEA 2HYFA 5C4XJ 2XVCA 4K2EA 3GLXA 3H5RA 4HRIA 3DBLB 2WV0A 5M5XJ 4G12A 3Q0VA 2H6BA 3MVPA 4Y3OA 1IDZA 3VYUB 2Y0SN 3D5SC 3BZKA 2M2EA 4XRSA 2XPWA 1O3RA 1W4MA 2OV7A 5CPRB 4BHBA 1R4NB 1U8RA 3S2DJ 2M3AA 1AOYA 1K78B 2GXGA 1APLC 3DPTA 1E2XA 4HF1A 4YG2F 1HW2A 2Z3YA 3GTPJ 1K61A 1DQUA 2OQRA 1UJ8A 3OS0A 2H8RA 1MNEA 3HL2A 2UWMA 5J47A 2GXBA 2VOOA 3V7SA 1O57A 4HSRA 1WJ5A 2EV5A 4EM1A 3J7ZI 1E0EA 3G4SI 3ECOA 1LDKB 4D0PA 4ZYGA 2HFHA 1T8IA 2JPCA 1ZHFA 2GOXB 2OZUA 4JX4A 3DLLF 3I54A 1XN7A 2VJJA 3K70D 3UNGC 3A4CA 5D8LB 3E6BA 3L1PA 1UG0A 4ON0A 4OAZA 4HX8A 1R22A 3CMAI 3CC7I 1YJ9I 5IYBJ 4WQOD 5LHIA 2JUCA 3J7YJ 4ZYEA 2K9NA 1TLHB 1TWAJ 5FLXK 1DU6A 4IX7A 3LSMA 4PJ0C 3VODA 1BW6A 3BR0A 2QCOA 2H1KA 5J40A 3KFWX 3FISA 5M3FJ 2KJBA 4AWXB 1FYKA 2TRTA 2JRTA 2V9VA 3G73A 1JUPA 3I4PA 4AD9A 5K1YA 3ZRGA 4HYEA 1T2KA 4U87A 3HUGB 4L18B 5FRNA 3SEQA 3FHNA 3MQ0A 1FYLA 4F93B 2CW7A 2HWVA 4D5FA 2CV1A 3AL0C 3CCRI 2B63J 3Q9VA 5IT3A 2E1OA 3LL7A 1TQIA 1R4MB 2E5NA 1JHHA 3OYCA 4DJAA 4A3IJ 4E7SA 1GV2A 3KP2A 4Y52J 1OCOH 2FMLA 2AQFA 4B3XA 4IQJA 4L5JA 1FEXA 2NXNB 4Y7NJ 3QPLA 4O6JA 1L0OC 1IF1A 3K6GA 2D45A 1ERDA 2E7WA 2ID3A 5A2QZ 1WH7A 2ZMEB 3HB9A 4A0XA 2FRHA 4XLAA 1Y39A 1OFCX 2KLOA 2OAZA 3HRMA 5EG0B 2DPDA 5FB2A 2E34A 4C3JJ 2Q8KA 2GM4A 1RI7A 1KYWA 1YX3A 1OKRA 4L5EA 2A61A 1XX5A 1OYIA 2FUG2 4XRSG 1LE8A 2VC1A 3GCMA 2VPLA 4S04A 4UUTA 2R7DA 4KIGA 4JQFA 4UHTA 2VI6A 2ESHA 2R5ZB 2E35A 3OYNA 2HR3A 2EZHA 3CJNA 2QSGX 2PX9A 1LEAA 3KE2A 3R61A 2XAJA 3WE2A 2CW8A 3F23A 1QA6A 4RGUA 2XRLA 3F8FA 1QRYA 1SVMA 2KT0A 4QSHA 3RKWA 4YIFA 2Z2SB 2XF7A 3HJEA 3T1BA 4CGZA 4OIPF 5GP9A 1Z7UA 1U78A 2DJNA 2DMQA 4MEXF 1UHWA 4XMYA 2XSDC 4GFBA 1QBJA 2OTJI 2O5RA 2XPVA 3MKWB 1NH3A 1VNDA 2R7WA 3FXUA 3E1SA 2DMPA 4YFXF 1HF0A 2R4GA 3S2WA 1JT0A 2JMWA 4M9SA 4N4OB 2AHQA 3OYHA 1W36D 5JVTA 4M6VA 1HSTA 3LOCA 4XRMA 2TDXA 5L3GA 4UVBA 3HKZA 2HKXA 3GFJA 4I6ZA 1S7EA 4QIWN 2D5VA 3FXKA 1GDTA 1A5JA 5JHFA 1K79A 1WJDA 3CO7C 3SEZA 3LSTA 4ZH4F 1QZYA 2L54A 5F6FA 1N75A 5FFZA 2HEOA 1TWGJ 3KZYA 1FNNA 2GXAA 5DEQA 3WG9A 1YW7A 2BZTA 4RM2A 1XSXA 1J7KA 2ISYA 3K4LA 4CCOA 4E7KA 1TP4A 2K85A 3QU3A 2W57A 1TNSA 2XB5A 2XGXA 5DUIA 1OR7A 3L2CA 1RRJA 1AWCA 1D1BA 1YIOA 2KHMA 3E5UA 4N0BA 1FC3A 3T5XA 4C2UA 1PP7U 1F1ZA 2VASA 3CPZA 2YX7A 3GW2A 4X6AJ 2WAFA 1LVAA 1PYVA 3WU0A 2LC2A 3TW7A 2MGQA 3DXJF 3ZR8X 2X1CA 5J4VA 3ASNH 2MABA 2CQXA 3CJQB 1QPIA 4IPAA 2AXLA 2LTPA 3LAJA 5M3MJ 2DOFA 1JGSA 5CYVA 3F0CA 4DBRA 4H0EA 4IHWA 1YG2A 2ECBA 2KRCA 2MD5A 3MFKA 1ZRCA 3FK7A 3D5RC 2HU9A 2XROA 2FNPA 3CCLI 4R8HA 4U0WA 1BIBA 5FLXZ 1NK2P 4C3HJ 4G7OF 1D3YA 3VEPA 1IV6A 2HDCA 4QLCU 4I09A 3GTGJ 5LLQA 4IJAA 1WJBA 2RKHA 4IVNA 5D6FA 2PMZA 3BR1A 1PP8F 1BI3A 3RZDJ 1PDNC 1TQMA 2EK5A 2O7OA 2F48A 1R6RA 5KHDA 2OU2A 3RQ4A 5LRSA 2RV8A 1TWCJ 3CMMA 4JGHD 4M3BA 4LJZF 4S05A 1YX5A 2OCEA 3IHUA 1TT0A 4Y33A 1MJAA 4Y4RA 4CO8A 2GBYA 5E17F 2HOAA 2DK5A 4I0AA 2M0MA 2W7NA 1Z67A 3ZMSA 1VQ5I 3BJAA 2IS4A 3RKYA 5EJCA 2KZGA 1FP2A 3S3OA 3EETA 1KU7A 3HOZJ 2QWWA 2VJ5A 2V6EA 4NQWA 3L2VA 2K9LA 2VKVA 3EUAA 1JKPC 3TOAA 2YSRA 3N05A 3V8KA 1R5GA 1BR1A 1ZR4A 1QHGA 1T95A 2IGMA 2V79A 3OIPA 3ZP5A 3Q3SA 1Q1VA 4HW0A 1IO2A 2WAQA 4HNVA 2YPRA 4NB5A 3K4NA 4OOIA 4PGGA 4LD5A 1LPQA 4IHXA 3NWSA 4FE4A 1Z77A 1SC7A 3LSIA 2V1NA 1IUFA 4M3FA 2MLKA 5ICCA 3CCEI 4UV8A 1HLVA 5F3JA 4XLHA 2P4WA 3CCVI 2NVTJ 4B4CA 3IAS2 3BG6A 4I76A 3DKYA 2FBIA 2VUMJ 3LA2A 3WHCA 2DI3A 3FXQA 4KJZA 1YI2I 3OIOA 4Q47A 1FMWA 3S1MJ 3DLAA 2VBWA 5GAHJ 3H0DA 4EGYA 3GUDA 2DAOA 3SZPA 3KYDB 4R79A 2ZNYA 4RAFA 2L7KA 3WTTC 4FCYA 1OYWA 2L7ZA 3RPQA 4IZZA 2N8GA 3SDBA 2Y75A 3BCAA 3DF8A 1G2HA 1O3QA 3HKZN 4PJMA 3SFIA 3BQZA 5FLMJ 1FTTA 5L3FA 3BQYA 1HCRA 2E1CA 1YOVB 2VT2A 4KIBA 3WGHA 2P6SA 3NQOA 4FETA 4CDGA 3MKYB 1R1UA 1EH7A 2EIMH 4XORA 1XPXA 3IH4A 3K4JA 3MN2A 3RTRA 1MH3A 5AIPA 3JTGA 3E6MA 2GQQA 1RUNA 3HOVJ 2DA1A 2VJ4A 4IRHA 3RKXA 2HS5A 1VQPI 1ZH5A 4A3CJ 4AP2B 2W24A 4LK1F 1QNTA 3GMEA 4AVPA 9ANTA 5H6QA 3I4MJ 3PQKA 1Z9CA 2Q1ZB 3OYIA 2HPIA 2IS2A 5EEGA 3K2ZA 6PAXA 3TL4X 3I53A 4A3LJ 1RC9A 3PO3J 4GGGA 2FBHA 4UB6C 2ZCWA 2A68F 2WAUA 4N9F3 4HF2A 3I55I 3TP0A 4BE0A 3AG1H 1Y8RB 1IJWC 2EB7A 5LBQA 1ORKA 2XSJC 4LMYA 2EJRA 2O03A 3M07A 1O3SA 1VQLI 3I59B 2E1MC 4PDKA 2K27A 3RIRA 3GTLJ 2KKOA 1X2NA 2F5CA 1Z1DA 2XGEA 2ZJQF 1J75A 2LKXA 4MTEA 3PSIA 3HSFA 5HODA 1B9MA 3HG9A 3CESA 5DCMA 2M8GX 3HRSA 4HV5A 3QYFA 3PNYA 2QKMB 3RJPA 3HPGA 3O8HA 3BG5A 1BR4A 2E1MB 3CUQB 1EKEA 4HAMA 2HGCA 3RZOJ 4LLNA 4BQAA 2ZMEC 1MMGA 4CCLA 1LB2A 2PN6A 3QP6A 4MEYF 2K3FA 2DDAA 2HDWA 1V5EA 5F04A 4CCNA 3R4KA 2WY7Q 1TWFJ 3FXOA 1ZN2A 3COAC 2WB1N 5FJ8J 2BOLA 2MYSA 1U2WA 2E71A 4UV9A 4DBQA 2WZKA 2DU9A 2L4MA 4EJOA 1JTYA 2A6EF 3SXYA 4DNCA 5F08A 1B1BA 2X51A 4S0HB 5IP6A 3C1DA 3E0JB 1ZLJA 2VBYA 4A0ZA 3JAMK 2M8EA 3BDDA 4I0BA 3VPRA 3SYTA 5E3NA 2G0EA 2M0CA 3OL3A 3HOTA 3GZ6A 2KQRA 1TQPA 4FE7A 3RPUD 2JZYA 5K5QA 1WJCA 4ZDOA 2FOKA 3HSRA 1MSEC 4BXXJ 4P55A 5DD4A 1IN4A 2F2EA 1JUSA 3DCFA 3RCOA 1X3WB 2ZFUA 1VI0A 2KIMA 3QAHA 2BXYA 3A03A 3BY6A 4KT6A 2M34A 3JAMZ 2P0WA 3BJOA 2NVUB 1K78A 3BR2A 1A35A 4B09A 3WTZA 4A3GJ 1ETOA 2CU7A 2H1LA 1QZZA 1BI2A 2NRAC 2Q2EB 1T6SA 1SD4A 2CO5A 2EFOA 4IQ4A 2KISA 3WGIA 3OR2C 3KYLA 1TNTA 1YQAA 1OMIA 3LA3A 4UY8I 1H8AC 1MBGA 4XIDA 2PI0A 2LK2A 3OOUA 2VBXA 2X48A 4XLFA 5D5UB 2O0YA 2L0KA 3T8TA 1MW7A 2NVXJ 5M5YJ 4L9NA 3Q9SA 1Y6IA 2VOPA 2IS6A 2OZ6A 2E2IJ 4GCVA 1VFCA 1HW1A 3QPSA 2DYSH 3DKWA 3LSHA 2LD5A 2QEXI 1EJ9A 1G4DA 2W82A 2BHYA 3KEOA 2I5UA 1PUFB 4KFCA 3A01B 1S3JA 2DA7A 5KNLA 1JE8A 2P7VB 2NVYJ 3EUKL 4KUMA 3ZCOA 3KETA 4QWQA 3SDGA 3AG4H 1M1EB 4FHTA 3LWFA 4B43A 2VN2A 3N4MA 3ZN0A 3TO7A 3PIPF 4PJNA 4ESJA 2NS7A 2DW4A 3RDIA 1TT5B 4ITVA 2IEKA 5LRRA 2COMA 3WU2C 1VQ6I 2ZSIB 3PFIA 1MBFA 4I02A 3K10A 4RM3A 3P9IA 4ZYAA 3F8MA 1D5YA 1W5CC 2X85A 4P1WA 2IRFG 1IXCA 2KFDA 1MZBA 4HNUA 1W36C 1ONVA 3M7GA 3TDZC 3TDUC 4M6YA 1LUJB 2VLAA 5J1RA 3FM3A 5CVUA 2BGCA 2VKEA 2JT1A 3O3KA 2K4BA 1IN7A 1VF9A 2MBFA 5EEHA 1J09A 1JJ6C 2E5ZA 4HV6A 2ZMEA 3HIFA 5K5OA 1P6RA 4I99C 4WCGA 2RGVA 2IGOA 2GA2A 4DYCA 2MLGA 5EG0A 2LNBA 1EF4A 1KU9A 2CUJA 1Z3XA 2DQLA 2Y9YA 2Z5UA 4A3MJ 4LFUA 3S2HJ 2ZFWA 1MBHA 2K9SA 3KP5A 4JK1X 3DU5A 2Y9ZA 3ZQCA 4XQFA 1ZGWA 1BJAA 3BG9A 1I39A 1X4OA 1LE8B 5KCMA 3CMLA 1MMAA 2EPFA 3M3YJ 1MGTA 1R9TJ 4M73A 1B59A 2L7MP 1GXPA 4XOPA 2VB6A 3KP3A 2R5ZA 4A64A 1FBQA 1IRGA 4HSTA 3VOEA 4BE1A 4LIUA 4RGSA 3GO5A 3TO6A 1ODDA 2CJJA 4E6KG 3G2BA 1SAXA 2MW8A 3CCJI 1FT9A 4BJ5C 2IAIA 3U2RA 3OYGA 1X1DA 3CF2A 2DA2A 3L9FA 4FTHA 3WHBA 2L02A 1TL8A 3P5JA 2JTVA 4RB0A 2EQRA 5CVIA 3L00A 3IWZA 3JRGA 5HS9A 2X1EA 2ELKA 4MQ9F 2MH9A 3BCBA 3UR3C 2XAQA 3HRTA 3V4GA 4LB6B 4LB5A 2GIZA 2UXXA 4G94A 1JKQC 4ZDLA 1ETKA 1T98A 1OR7C 4BU2A 1G3WA 1ZG3A 2A6HF 4B47A 3BPXA 3KZZA 4A3KJ 3CMEI 1HC8A 4AUXA 4IRIA 4BKXA 4ZZLA 4BL0B 2LDUA 4WX9A 1D0XA 2V1XA 1Y1WJ 3K4KA 2R7VA 2R7RA 3C2GA 4L9TA 3EUHC 1GVJA 1OCPA 4TV7A 2FE3A 4B3AA 3ZMUA 4EMSA 5E18F 3BT9A 3HPHA 5J3LA 1TTYA 1UFMA 3MAJA 2V6CA 4OIRF 1XGMA 4ZC3A 2RDPA 5CKTA 4WK8F 3H0GJ 3GYHX 4HDUA 4ENMA 2FSWA 3ONQA 2WAQN 4OU0A 2Z33A 3FM5A 2YR2A 2VQLA 1LQ1A 2VBZA 5DV5A 2JUGA 4BE2A 1SFOJ 1H89C 4ETSA 4F92B 4M3GA 4DQ2A 1MDMA 2EA2A 1V4RA 2VE8A 3MD2A 5LGTA 3OYEA 4IKFA 1KQ9A 2VQGA 2VIXA 1H88C 4G6QA 4AC0A 1G3YA 3PNVA 4DZJA 5IP9J 1HA8A 4MIMA 4LITA 1S6LA 2MSYA 3P9KA 4PZJA 2DFEA 1DUXC 1DPRA 4II2A 1X3ZB 1WCMJ 4HPQA 4ZZDA 2IVMA 1A6QA 2YU3A 5H2FC 1Q1HA 5J8FA 2XC7A 3CC4I 1W7PB 5E20A 4HA8A 5CJ9A 2HKOA 2QZ8A 3Q5FA 5GADJ 4C3IJ 1IG7A 3Q0WA 4PCQA
chains in the Genus database with same CATH topology
4OIQF 4GXOA 2VKHA 4LG0A 2F5FA 2RN7A 2WA0A 5ILUA 3P9CA 2JA2A 1KGSA 4F55A 4DGWB 3P7NA 3WTXC 3HXLA 2LH9A 2ZO4A 3BZ6A 4I7HA 3A2KA 2LYCA 4PJLA 1IRXA 3K9TA 4Z2YA 2HQNA 1FBUA 2DQRA 1Z3YA 2Z99A 3QYEA 2XF5A 3CUQC 1IN6A 4EJUA 2CWEA 3M1CA 4II3A 4OIOF 4ESFA 2QYOA 1SD6A 1Z21A 3GZ5A 2XAUA 4A5NA 5HS7A 2QENA 2P5VA 4GO1A 4NQWB 4FX0A 3LMMA 2BVMA 5IT9K 1T0FA 1MMDA 1FBSA 1R1VA 3QYBA 1MJ9A 4DIQA 4CCKA 5TJJA 5BS6A 3DTEA 3W6JB 1XSVA 2CV2A 3QU6A 2GWRA 4F3QA 4H4KC 2L5QA 5HLGA 1Y56A 1XDSA 4CXFA 5ICFA 1S9HA 2Q0OA 3ZPLA 3ZQQA 3SZTA 1SFUA 1WJFA 3I3LA 3R6SA 2EV0A 4AIKA 2NS0A 2NOJB 2OQGA 4KT5C 3H5NA 1BI0A 4M9ZA 1UAAA 4G8XA 1HQCA 1FX7A 4CH7A 3ECHA 2VKDA 2HNHA 3MKZA 2VXDA 3S93A 4XKWA 2PMUA 1LNWA 4Y15A 4NUBA 2RNGA 3J81K 3E6DA 2KRFA 3GFMA 2MFZA 1KA8A 1FWZA 2LREA 3RI4A 4IF4A 1YS7A 3KEQA 4XN3A 5FROA 1VZ0A 4EJTA 2QKLB 2XKPA 1YYVA 1CF7B 4CHUA 2DTRA 2WWYA 4ASNA 1W5SA 3TQNA 3J7AO 3J7AY 4KISA 2IJLA 3KLOA 4XBFA 3GXOA 1KQ0A 4XR6A 3J80K 1UCRA 3FX3A 4MTDA 1TZLA 3OMYA 3WE3A 3DEEA 3V7CA 3A1YA 4BHPA 1SFXA 2ISZA 3ELKA 3AFHA 2VONA 1NG6A 2P8TA 2CV0A 3NRVA 1YTYA 3ML6A 3FF5A 4BJ6C 3I59A 2UUZA 5D5VB 4GYGA 5TRDA 1H9GA 2XKOA 1QU3A 1D1CA 4A6DA 4OAYA 3GVAA 3H9QA 5DCMB 1X1AA 2RQQA 1WSUA 3S8PA 5L3BA 3QOEA 1KYZA 5CVRA 5E8GA 2K7LA 3CUQA 4C30A 3L7WA 4IHSA 2D2WA 5HLTA 3KEYA 1P2FA 1WKMA 3KP6A 4BHCA 2STWA 2XAFA 3OS1A 5HNHA 3WTUC 4ENNA 4B48A 1T0FC 1R7JA 4XLNF 5HDNA 3RYPA 1SFKA 2Z16A 2V9KA 3M8JA 3WTSC 3W3CA 1R23A 2F5EA 2OUMA 1R1TA 3AL0B 3BWGA 2LRDA 4BGDA 4YFKF 5F64A 3OS2A 5LGNA 4YEJA 4EJWA 3HTUA 4NHJA 2IGNA 3FMRA 4MNUA 3OYAA 3PNTA 4G7HF 3EYIA 2CSOA 1NHAA 3LFKA 1NG7A 5BPIA 1JI8A 2LKPA 4XKBA 2D1HA 3VSKA 1XD7A 4U7BA 5DUKA 3BJ6A 4O3MA 2Q2EA 4E7HA 2CQKA 2Y48A 3TGNA 3BG7A 2K02A 2IW5A 2IA0A 2O3FA 4CICA 2FF4A 5BOXA 4APFB 1D0ZA 3L09A 2M4GA 3PQJA 5FFXA 5KK1A 4LLLA 4F52A 5D5XB 2R7SA 2KMUA 2HPMA 3RYRA 1J2XA 2OD5A 4KMFA 2R7OA 2BEOA 1WFXA 3LFUA 1XDUA 1LDDA 4KDPA 4RLFA 4OMYA 3LAPA 1REPC 2CYYA 5CQGA 2ADUA 2H27A 4XLCA 1ULYA 2CFOA 3U9GA 1WRJA 4ESBA 1ZRDA 4E4HA 4HEA2 4ZTFA 2RREA 4P9UA 2HQAA 2R7FA 4A6EA 3H9GA 1BIAA 2IP2A 1MD0A 2LBFB 1SAUA 2HTSA 3OYLA 2LOOA 3JSOA 2GAUA 1BC7C 1R5HA 4PSWA 3G3ZA 2RVCA 5DCFA 1MMNA 3OYMA 1Z6TA 3K1PA 2A69F 2GOMA 1MKMA 4M74A 2DFIA 2CGPA 2L3DA 2Z9OA 3KX2A 2XHKA 4PUSA 4L9VA 1IAWA 1LFPA 2PLYA 1U5TC 4PFOA 4BDZA 5HLIA 2DK8A 4F7ZA 4ZTJA 2A5WA 4KIFA 4WXHA 5IT9Z 3MWMA 4U7DA 1G3TA 1YFHA 5HS8A 4MLOA 3I5UA 3M9AA 5LEJA 2L4AA 4CZCA 3OL4A 4HLXA 4D1QA 1LKXA 3CZ6A 4L0YB 2M30A 1P92A 2OC6A 2ZSHB 3F9KA 3IP4B 2IA1A 1XCBA 3FZVA 3IL2A 2DPUA 4YELA 4N9HA 2WADA 4IXAA 4BYYA 3H3ZA 2WTEA 2WBMA 4OWRB 2OBPA 2XUBA 4BQOA 2FQ3A 3EQLF 4CUGA 5BPDA 3RSNA 1D8KA 3HSEA 4PFPA 2HVSA 2RC4A 5LHHA 3EYYA 2HVRA 2C6YA 4YRVA 4CCJA 2O8XA 2G7HA 4ENJA 2CMPA 3DKXA 3LQQA 1HSJA 1X19A 5K5RA 3LA7A 4L0ZB 2HTJA 3QP5A 3W2AA 4J01A 4HNTA 3FMQA 4BEHB 1BN5A 1D0YA 3R0JA 4LGWA 1ZYRF 3DWLE 4BXUA 1BOAA 1IN8A 4IHTA 2IPQX 1FSHA 4I01A 4HG2A 1RNLA 1MDMB 3E6CC 2H6CA 2DJIA 3DTKA 4N9IA 1BR2A 3H35A 1B9NA 1U6GA 1FZPB 1PUEE 3ROUA 5D8KB 4EM0B 3IRRA 1UB9A 3ZGKA 4XONA 3L2RA 2QM3A 2DLLA 2DT6A 3K4BA 1QHHD 3E97A 4R1HA 3FBNB 4NC7A 1W7PA 2Y0SA 2DO7A 3IWFA 4IRGA 2JSCA 2BE5F 3TKYA 2VE9A 2ZXJA 2WAEA 4WF2A 3SFZA 5DDGA 3T8RA 1GLNA 2P5KA 4LG0B 3V42A 1A04A 5J8CA 3VSLA 3MEXA 2GA1A 1FMVA 1JXSA 1USTA 2PJRB 4M72A 1TBXA 4XKVA 1O3TA 4E7IA 2VL8A 3FHZA 4EATA 1XCVA 4PJJA 2JSPA 1OPCA 1MNDA 3HC7A 2BYVE 5KVRA 2W85A 2R7TA 5HDGA 3AAFA 3VDXA 3KLNA 4I98B 3GFLA 5HLHA 2E60A 1WJAA 1J0RA 4BS9A 2E7XA 3O2PE 2M45A 3CP2A 1WWXA 1H0MA 2UV1A 3L2QA 2VODA 1EH6A 2EFQA 3TMOA 2P6TA 1T38A 4WWCA 2HYGD 4Y13A 4PK4A 5L3CA 5FD6A 5FGMA 2MH2A 5ILVA 1USSA 2X1DA 1F5TA 1XB4A 1O7LA 2RQPA 4KMUX 1X1CA 3CLOA 4RS8A 4AVZA 2LY1A 1P4AA 3CTAA 1U5TA 3GWZA 3OYFA 1LEBA 1SMYF 2MA3A 4G6DA 1I1GA 5HNFA 2FU4A 2DOAA 2F4IA 2LY2A 1F4KA 2CG4A 4XSZF 5E1ZB 2ZJ2A 1Z6RA 3OYJA 5HVQC 2M4KA 2V4JC 4A0YA 4B44A 2FXAA 1YO5C 3PJRA 2M87A 1N78A 4UXNA 3FWEA 1RZ4A 5DD8A 4U0YA 4Q4ZF 5ERIA 2M1BA 5TGTA 4XLPF 4E7ZA 2FA5A 2AQEA 2ESNA 3QPHA 3PUBA 1SD5A 3DV8A 3VYRB 1G59A 3W2VA 1QPMA 2VC0A 2QBYA 2KZVA 1CF7A 1DP7P 4N4NB 1YS6A 4P5OA 2GZWA 3W6KB 4P9FA 2DBBA 2L9SA 1P9QC 5LGUA 1X3UA 3GFIA 5D4SA 3HHHA 4NNJA 2ZXHA 4HLYA 4BH9A 3F8NA 2LG4A 1HKSA 2J5OA 3OV8A 4KICA 1KU2A 4XL9A 1OYYA 3ZN1A 4PGHA 2VT3A 1MJBA 2P5LC 4L5IA 4HOBA 2I8DA 3BC8A 2NNNA 4B8XA 1FSEA 4BDYA 3QPTA 2FNAA 5E8IA 3BROA 1SMTA 2UZKA 3ZQ7A 3K4CA 3TBIA 4I2OA 4MHGA 1L3LA 1Y0UA 2A5YB 1C0WA 3OR1C 4KN4X 3ZMTA 3M1EA 4UVCA 4CCMA 3BLYA 5BQTA 2O61A 1ZGJA 5L3DA 3DP7A 3K69A 4GRIA 1SD7A 2R7XA 1ZG1A 1PJRA 2JVHA 3LSGA 2X6YA 1EA3A 1Z05A 3E5XA 5L3EA 1G8XA 4BQQA 5LHGA 3F6VA 2Y0MA 5E1XA 3V8JA 1XGOA 2EWNA 1BOBA 3L2UA 1U0JA 1RIOH 2BW3A 2XRNA 4U88A 2XIGA 1CGPA 2HZTA 3HHGA 2RNJA 3BOQA 4RB2C 4HQMA 3K1MA 2FEZA 2PQ8A 3C3WA 2VQHA 4M9XA 4EQQA 1KQ8A 4ZDPA 4BJTA 4J00A 2OA4A 4EVIA 1K7AA 2A6TA 4C2TA 3EDPA 4AU7A 5AONA 2KIUA 5CVVA 5DYMA 1GXQA 1UHMA 4E70A 3CJRB 2DT5A 3OIQA 3QRFF 4CSWA 2XAHA 4XLEA 2KJCA 3M8EA 5AIQA 4RGRA 3AKZA 2EFWA 1XSDA 4A5MA 3O6BB 2PMHA 4OINF 3FKJA 2R7QA 3VWBA 2K9MA 2YX4A 4HZFA 3DTIA 3C18A 4BUPA 3H3UA 4U0VA 3WU1B 1P4WA 1HKQA 3OYBA 4QPQA 5ICEA 1KONA 3TOBA 2X4HA 3QODA 1LDKA 4HXIB 3SZGA 3WTYC 2ZBKA 3DU6A 1DGRM 1TW2A 5FRMA 2B0LA 2EFPA 3OOPA 3GEZA 3GX4X 2W25A 4XKCA 5ED4A 1HBXG 2XF6A 1VTNC 3W2WA 4UNOA 3QOPA 3R0AA 2X6XA 3ISPA 1Z91A 3KCCA 1QO0D 1S29A 4WXCA 4HF0A 2PEXA 4AIJA 2DCEA 3S32A 3OYDA 3IC7A 2W4SA 4RMNA 2G7UA 3F21A 2DT7B 2DXIA 3HUGA 4BNCA 4LK0F 1SFEA 4HX7A 4JBAA 2ZNZA 4CYDA 3PFYA 3FXRA 2JVGA 3F3XA 4RB3C 2LBFA 3VYSB 3D5LA 4BACA 2KDOA 3JW4A 4E7JA 3SHFA 1U3EM 1ZELA 2AS5F 2K86A 3DQVC 2M7AA 4A2UA 2ZKZA 5JFRA 2BV6A 1XMKA 3E3VA 3IUOA 3HOSA 4RAYA 3S3NA 4ANJA 5J6XA 1ZARA 2M5WA 2BVLA 5H6RA 1EH8A 2VQCA 2EFNA 2NYXA 3WGGA 1BBYA 1B4AA 3S3MA 2IA2A 1D1AA 3L2WA 2QLZA 4F91B 1ZGAA 4M71A 1WI9A 3F8CA 3HRUA 4KITB 5LEKA 3WTVC 1DPUA 1S8NA 4FASD 2ACJA 1J5YA 3GF2A 2HZDA 2PBIA 3V7RA 2ETHA 1DDNA 2LF7A 2P7CB 2W1OA 1W5TA 4OMZA 4AIHA 3RPUA 3SQNA 3K0LA 1IN5A 4UUVA 3F8BA 3BPVA 4XRFA 1HKTA 4EM2A 2LSOA 4CZZA 3DEUA 3MZYA 2G9WA 2F6CA 3IRQA 4RAZA 5JR3A 3ZMDA 5HOOA 3H9JA 3C7JA 1LDJA 2IXSA 1O7FA 4RGXA 4G7ZF 4HDVA 2HVQA 5D6EA 4M6XA 3I64A 1ZRFA 2L2OA 1IUYA 2X6WA 3V8LA 1X1BA 3F6OA 1GHCA 4G9YA 1AA7A 5CLSA 2A3SA 4BEHA 3OWTA 3LQRA 2O6GE 5JI6A 1HXDA 3LSKA 5LD2C 3WTWC 3U21A 1BI1A 2KIFA 5E1WA 1IRFA 1OLTA 4C9YA 4Y17A 4WXDA 3IKVA 3REOA 4RLQA 2IGKA 4BXFA 3K70C 1EV7A 2K5CA 2WY8Q 2CW0F 1I1SA 3I58A 3ZMZA 1IXSB 4FX4A 4LLGF 3NWTA 4XN0A 2R3SA 4P96A 4EJVA 1V5FA 4GYIA 2V1UA 1Z7LA 3F72A 2VXZA 2WC2A 3DPUA 2PJPA 2X0LA 3F22A 4EGZA 5ICGA 2V26A 1V3FA 4YIIA 3FMSA 3ABUA 2XV4S 3TO9A 1B6AA 3CP8A 3BP8A 3IAM2 3PL8A 3J81Z 3NEUA 1E17A 2PJRA 1ON1A 2PG4A 2FBKA 4YFNF 1K6OA 2XDVA 4D9JA 4KYWA 2MC3A 3ZMVA 3KP7A 2IS1A 2MC4A 1S7OA 2FMYA 1G6NA 2QVOA 3JTHA 4BAYA 1XMAA 2H94A 3ZXSA 1FY7A 4KA4A 2W84A 1YW9A 1DP3A 1ZAOA 4XM3A 2CFXA 1R58A 2PFBA 1ZLKA 1YW8A 2KL4A 2CS3A 2V7FA 1P4XA 1ON2A 5D5WB 4KN7X 5LFAA 2EV6A 5CQEA 1WJEA 2KRHA 2EA4A 2A07F 4XNFA 4O5VA 3VYTB 1S7AA 3I71A 4G6TB 4L9JA 4Q48A 1IW7F 4ZYHA 2J5PA 2QQ9A 1QQIA 1XGNA 3N97A 1HW5A 4HX4A 1FP1D 1STZA 2K4JA 4BQNA 1BC8C 1IZ1A 3H5AA 2GIVA 3J80Z 2F5DA 4AYBA 3B02A 2VJIA 2NNYA 3EPZA 1X4PA 2QQBA 3ERED 1BM9A 1U5TB 3C2HA 4DOZA 5FO5A 1D5VA 1FLIA 3OY9A 2ZXIA 2QUFA 2Z1DA 3EUHA 3D0SA 3GBGA 2M7BA 5ILSA 2F5VA 3KP4A 1LJ9A 5FD5A 2CUZA 1I6XA 3HYIA 3OYKA 1RUOA 1I27A 2R7UA 1UELB 2MD0A 4A12A 1R00A 1JHFA 3B73A 3E5QA 3FDYA 1FOKA 2ELJA 2W00A 4NC8A 2KP6A 3K1NA 1G3SA 2L01A 1ZG5A 2XAGA 3T0YA 2L9NA 2BBYA 1I5ZA 2QBYB 1T39A 1N77A 1FYMA 2H09A 2D1VA 3H92A 1H9TA 1QGPA 1R36A 5BMZA 1LVKA 3MCZA 2QQAA 4ENKA 1W7PD 2NAZA 3ABTA 2STTA 2KPMA 1ZREA 4XOTA 2HQRA 2JPBA 1IXRC 5HDKA 1F9NA 2E1NA 2IT0A 4HBLA 3CO6C 1KU3A 3FBIB 3K4MA 4CA0A 3WODF 5CVJA 1D8JA 4XSXF 4LG3A 2K3PA 2ELHA 5A2QK 4QPOA 5H20A 3ULQB 4EV0A 4ZYDA 4LIVA 3VFZA 3PSFA 2XASA 3MMYB 4E7LA 3JSPA 4X0GA 3R60A 4PSXA 1DGWY 5JHUA 3CUOA 4KNYA 1YE9A 4MGRA 1FPQA 4MQVA 3IKTA 5F1RA 1XGSA 3U1DA 4Q5SF 3MZHA 2UXNA 2CH0A 1K6YA 3CDHA 1WQ2A 2LF8A 4HQEA 2BW3B 4ZJZA 3DFGA 3DPLC 4RB1A 1J59A 3I9V2 3M8FA 3VB2A 4FT8A 1YLFA 4EOZB 2WB1A 2V1DA 3I0TA 4JOMA 4UVAA 5D4RA 3HTSB 1TW3A 2HOEA 2HYFA 1V5GA 2XVCA 4K2EA 3GLXA 3H5RA 4HRIA 2WV0A 2H6BA 4Y3OA 3VYUB 3D5SC 1O3RA 1W4MA 2OV7A 5CPRB 4BHBA 1U8RA 2M3AA 1AOYA 1K78B 2GXGA 3DPTA 1E2XA 4HF1A 4YG2F 1HW2A 2Z3YA 2OQRA 1DQUA 3OS0A 1MNEA 3HL2A 2UWMA 2GXBA 2VOOA 3V7SA 1O57A 4HSRA 2EV5A 1WJ5A 4EM1A 1E0EA 3ECOA 1LDKB 4D0PA 4ZYGA 2HFHA 2JPCA 1ZHFA 2OZUA 2GOXB 3I54A 1XN7A 2VJJA 3K70D 3UNGC 3A4CA 5D8LB 3E6BA 4ON0A 1UG0A 4OAZA 4HX8A 1R22A 4WQOD 5LHIA 4ZYEA 1TLHB 5FLXK 4IX7A 3LSMA 3VODA 3KFWX 2KJBA 4AWXB 1FYKA 2JRTA 2V9VA 3G73A 4AD9A 3I4PA 5K1YA 3ZRGA 4HYEA 1T2KA 4U87A 3HUGB 4L18B 5FRNA 3SEQA 3FHNA 3MQ0A 1FYLA 4F93B 2CW7A 2HWVA 2CV1A 3AL0C 3Q9VA 5IT3A 3LL7A 1TQIA 2E5NA 1JHHA 3OYCA 4DJAA 4E7SA 3KP2A 2FMLA 2AQFA 4B3XA 4IQJA 4L5JA 4O6JA 1L0OC 1IF1A 3K6GA 2D45A 1ERDA 2E7WA 5A2QZ 2ZMEB 4A0XA 2FRHA 4XLAA 2OAZA 2KLOA 3HRMA 2DPDA 5FB2A 2Q8KA 1RI7A 1KYWA 1YX3A 1OKRA 2A61A 1OYIA 2FUG2 2VC1A 2VPLA 4S04A 2R7DA 4KIGA 4JQFA 4UHTA 2ESHA 3OYNA 2HR3A 3CJNA 1LEAA 3KE2A 3R61A 2XAJA 3WE2A 2CW8A 3F23A 4RGUA 3F8FA 3RKWA 4YIFA 4CGZA 2Z2SB 3T1BA 2XF7A 4OIPF 1Z7UA 1U78A 4MEXF 1UHWA 4XMYA 1QBJA 2O5RA 3MKWB 2R7WA 3FXUA 3E1SA 4YFXF 2R4GA 3S2WA 4M9SA 4N4OB 3OYHA 1W36D 5JVTA 1HSTA 2TDXA 5L3GA 4UVBA 3HKZA 2HKXA 3GFJA 5JHFA 1K79A 3CO7C 1WJDA 3SEZA 3LSTA 4ZH4F 1QZYA 2L54A 5F6FA 1N75A 5FFZA 2HEOA 3KZYA 1FNNA 5DEQA 3WG9A 1YW7A 4RM2A 1XSXA 1J7KA 2ISYA 3K4LA 4CCOA 4E7KA 3QU3A 2W57A 1TNSA 2XGXA 5DUIA 1OR7A 3L2CA 1AWCA 1YIOA 1D1BA 3E5UA 2KHMA 4N0BA 1FC3A 3T5XA 4C2UA 1PP7U 1F1ZA 2VASA 2YX7A 3GW2A 3WU0A 1LVAA 1PYVA 2WAFA 2LC2A 3DXJF 3ZR8X 2X1CA 2MABA 3CJQB 4IPAA 2AXLA 3LAJA 1JGSA 5CYVA 4H0EA 4DBRA 1YG2A 2MD5A 2KRCA 3MFKA 1ZRCA 2HU9A 3D5RC 2XROA 2FNPA 4R8HA 4U0WA 1BIBA 5FLXZ 4G7OF 1D3YA 3VEPA 2HDCA 4QLCU 4I09A 5LLQA 4IJAA 1WJBA 2RKHA 4IVNA 5D6FA 2PMZA 1PP8F 1BI3A 1PDNC 1TQMA 2EK5A 5KHDA 1R6RA 2OU2A 5LRSA 3RQ4A 2RV8A 3CMMA 4JGHD 4S05A 4LJZF 1YX5A 3IHUA 1TT0A 4Y33A 1MJAA 4Y4RA 4CO8A 5E17F 2DK5A 4I0AA 2M0MA 2W7NA 3ZMSA 3BJAA 2IS4A 3RKYA 1FP2A 1KU7A 3EETA 3S3OA 2QWWA 2VJ5A 2V6EA 4NQWA 3L2VA 2K9LA 3EUAA 3TOAA 2YSRA 3V8KA 3N05A 1R5GA 1BR1A 1QHGA 1T95A 2IGMA 2V79A 3ZP5A 3OIPA 4HW0A 2WAQA 2YPRA 4NB5A 4OOIA 4PGGA 3K4NA 4LD5A 3NWSA 3LSIA 2V1NA 2MLKA 5ICCA 4UV8A 4XLHA 2P4WA 3IAS2 3BG6A 3DKYA 2FBIA 3LA2A 2DI3A 3FXQA 4KJZA 4Q47A 1FMWA 3DLAA 2VBWA 3H0DA 4EGYA 3GUDA 2DAOA 3SZPA 4R79A 2ZNYA 3WTTC 2L7KA 1OYWA 3RPQA 4IZZA 3SDBA 2Y75A 3BCAA 3DF8A 1O3QA 4PJMA 5L3FA 2E1CA 2VT2A 3WGHA 4KIBA 2P6SA 3NQOA 4FETA 4CDGA 3MKYB 1R1UA 1EH7A 4XORA 3K4JA 3RTRA 5AIPA 3JTGA 3E6MA 2GQQA 1RUNA 2VJ4A 4IRHA 3RKXA 2HS5A 1ZH5A 4AP2B 2W24A 4LK1F 1QNTA 4AVPA 5H6QA 3PQKA 1Z9CA 2Q1ZB 3OYIA 2HPIA 2IS2A 5EEGA 3K2ZA 6PAXA 3TL4X 3I53A 4GGGA 2FBHA 2ZCWA 2A68F 4N9F3 4HF2A 4BE0A 2EB7A 5LBQA 2XSJC 4LMYA 2EJRA 2O03A 1O3SA 3I59B 2E1MC 4PDKA 2K27A 3RIRA 2KKOA 2F5CA 1Z1DA 1J75A 4MTEA 3PSIA 3HSFA 1B9MA 3HG9A 3CESA 5DCMA 3HRSA 4HV5A 3QYFA 3PNYA 2QKMB 3RJPA 3HPGA 1BR4A 2E1MB 3CUQB 4HAMA 2HGCA 4LLNA 4BQAA 1MMGA 4CCLA 1LB2A 2PN6A 3QP6A 4MEYF 2HDWA 1V5EA 4CCNA 3R4KA 2WY7Q 1ZN2A 3COAC 2BOLA 2MYSA 1U2WA 4UV9A 4DBQA 2WZKA 2DU9A 2L4MA 4EJOA 3SXYA 2A6EF 4DNCA 1B1BA 2X51A 3C1DA 3E0JB 1ZLJA 2VBYA 3JAMK 4A0ZA 2M8EA 3BDDA 4I0BA 3SYTA 3OL3A 3HOTA 3GZ6A 2KQRA 1TQPA 3RPUD 2JZYA 5K5QA 1WJCA 4ZDOA 2FOKA 3HSRA 4P55A 5DD4A 1IN4A 2F2EA 3RCOA 2ZFUA 2KIMA 3QAHA 3BY6A 4KT6A 3JAMZ 3BJOA 2P0WA 1K78A 4B09A 3WTZA 1QZZA 1BI2A 2NRAC 2Q2EB 1T6SA 1SD4A 2CO5A 2EFOA 4IQ4A 3WGIA 3OR2C 3KYLA 1TNTA 1YQAA 1OMIA 3LA3A 2PI0A 3OOUA 2VBXA 4XLFA 5D5UB 2O0YA 3T8TA 1MW7A 4L9NA 3Q9SA 2VOPA 1Y6IA 2IS6A 2OZ6A 4GCVA 1HW1A 3DKWA 3LSHA 1G4DA 3KEOA 2W82A 4KFCA 1S3JA 5KNLA 1JE8A 2P7VB 4KUMA 3KETA 3EUKL 3ZCOA 4QWQA 4FHTA 3LWFA 4B43A 2VN2A 3N4MA 3ZN0A 3TO7A 4PJNA 4ESJA 2DW4A 3RDIA 4ITVA 5LRRA 2COMA 3PFIA 4I02A 2ZSIB 3K10A 4RM3A 3P9IA 4ZYAA 3F8MA 2X85A 2IRFG 4P1WA 1IXCA