4P5OA

Structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3-e2~ubiquitin-like protein-substrate intermediate trapped in action
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
361
structure length
327
Chain Sequence
SKSPEELARYCDSLLKKSSKNPEEAELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLYTVQQLTDSTQIKMDILAQVLQILLKSKLPDTLIRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMRMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a RING E3 Trapped in Action Reveals Ligation Mechanism for the Ubiquitin-like Protein NEDD8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Cullin-1
total genus 96
structure length 327
sequence length 361
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4p5oA03
1.10.10.2620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4p5oA02
1.20.1310.10 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like Cullin Repeats 4p5oA01
1XN7A 3TO6A 1W5TA 1SD4A 2O0YA 3F8MA 4KA4A 4G7OF 2ZXJA 1W5SA 4LFUA 2EWNA 2DQLA 4M9ZA 4LLLA 4MEYF 5FB2A 3HTSB 3KLOA 4K2EA 1U2WA 5JHUA 1UHMA 3TKYA 2XVCA 2VOPA 3QAHA 5DD8A 2V6CA 5CJ9A 2DPDA 3GFMA 1Z91A 3IL2A 2ZFWA 4RGSA 5HLHA 5A2QZ 5EEGA 3GWZA 4YFXF 4UV8A 2HQNA 4ESFA 4N9IA 4EJOA 2H6BA 3R61A 1TBXA 3ULQB 1XGNA 5DCMB 2OZUA 2GXBA 4ESBA 3BPVA 1HXDA 3ERED 4O6JA 2JT1A 2FOKA 3V7CA 2ZMEA 5E20A 5H20A 3T5XA 4CDGA 4E70A 3KP4A 4RB1A 3MZYA 1V4RA 3LFKA 5D6FA 2ESNA 3M1EA 1PUEE 3DP7A 1IF1A 1YG2A 2VT2A 1S8NA 3ZQ7A 4ESJA 1U5TA 1F1ZA 1YLFA 5J8FA 2FBHA 3FWEA 4G8XA 3HSRA 1I1GA 2D2WA 1FSEA 3H92A 3QRFF 1ZRFA 1Z1DA 2P6SA 1K6OA 1U5TB 4LK0F 5JR3A 2EFOA 4IJAA 5A2QK 2OD5A 4P9FA 4HAMA 2NS0A 5JVTA 3QP5A 4OINF 3OV8A 3RKWA 3F3XA 2WV0A 1OYIA 1LDKA 1KYZA 2Z99A 1MZBA 4KICA 2O6GE 1YS7A 2ISZA 2EFQA 2XAHA 5D5VB 4Y13A 3N97A 1AOYA 1FWZA 5ED4A 1KU9A 4L9VA 2M87A 4ZYDA 2L54A 2W84A 2C6YA 3CO7C 3V7RA 4KN4X 2DLLA 2BGCA 4D0PA 2ZCWA 3U9GA 4P5OA 3BP8A 4ZZLA 2JTVA 4GGGA 5F6FA 3REOA 2KIUA 1P4AA 2PJPA 5DUIA 2XRNA 2GZWA 5CVIA 1IN5A 3V7SA 3KEQA 1ZRDA 3FZVA 1D8JA 5LHHA 3WTZA 1FY7A 3VB2A 5FLXZ 1EH8A 3R60A 1EH6A 4OIOF 2DW4A 1BM9A 3L2CA 3M9AA 1TW3A 3M8FA 2IJLA 4NB5A 4Z2YA 5K5OA 4OOIA 1FP2A 1IXSB 3CUQB 2VE9A 5J8CA 3IKVA 4RAYA 4A0ZA 2W24A 4LLGF 2W85A 3CTAA 2V1DA 4Y15A 3GFLA 2H6CA 2CSOA 3HSEA 3GF2A 1HW2A 3EDPA 4B09A 2P5KA 1LB2A 4WX9A 1PDNC 1MDMA 3HYIA 3Q9SA 5HLIA 3WTWC 1FP1D 5LRSA 4UVAA 4U7BA 3KE2A 4UVBA 2NNYA 5LRRA 2Y0MA 1Z6TA 2AXLA 2W57A 2H94A 1BBYA 1LEAA 2VODA 1G3TA 2QBYB 2VXZA 1LQ1A 3MQ0A 2Y48A 1GXQA 3JW4A 4BYYA 3F72A 3KFWX 1EH7A 4F52A 4HX7A 4OMYA 2PBIA 2FBKA 1S3JA 3K0LA 1P2FA 4G94A 3JSPA 1OKRA 3F8CA 3E3VA 2P7VB 1I5ZA 5LEKA 1XMAA 4BNCA 5LHGA 1OPCA 1XGOA 2RDPA 2FNAA 2QLZA 3WE3A 3LA7A 2K02A 5E1WA 1G6NA 1Z9CA 4BQAA 3P9CA 2NYXA 1S7OA 1REPC 4PCQA 4NHJA 3FX3A 5CVRA 4KT5C 4XSXF 1BI2A 4OMZA 1BN5A 5IT9K 4HYEA 4LLNA 1XCVA 3CDHA 3HRMA 1FC3A 2A6EF 5CYVA 3ECOA 2V79A 2DT5A 3L09A 4AVPA 2RNJA 2L01A 3J81K 3V8JA 1ZLKA 1SD6A 3GX4X 3ZMDA 1RUNA 1KQ9A 3COAC 3LQRA 2WZKA 3I64A 4HW0A 1W4MA 1ZLJA 1XSVA 1T6SA 3V4GA 4EGZA 1MJ9A 2ISYA 4MQ9F 1DUXC 4APFB 5L3GA 2FE3A 3TO9A 4HOBA 3CUQC 5ICFA 1SFUA 2M30A 1TNSA 2BV6A 3C7JA 4Q5SF 4EMSA 2FXAA 2COMA 4IRHA 2XAGA 3WTXC 3WG9A 2ZKZA 4IF4A 1K78B 2X0LA 4RGXA 3T8TA 3ABUA 3F22A 3J80Z 3FMQA 2VN2A 3TDUC 3GZ5A 3C1DA 2HKOA 1J59A 1S29A 3MEXA 1RI7A 2YU3A 2E7WA 1HKTA 1OYWA 4GCVA 1KA8A 1IN4A 1O3TA 1Z6RA 1J7KA 5BQTA 4OIQF 4AIKA 3L7WA 1ZARA 1KGSA 2YX4A 5FFXA 2DK8A 1YO5C 1ON1A 3GYHX 5BMZA 3AAFA 2XV4S 3VODA 3I5UA 1H0MA 2OBPA 3D5LA 2XKOA 4KUMA 5D5XB 1ZRCA 3F8BA 2XAFA 4EGYA 2ZJ2A 2FMYA 3WE2A 2A68F 5FO5A 3DEUA 3CO6C 1LDKB 2MLGA 4L5IA 1HBXG 2MH2A 4ENMA 1FBUA 5L3FA 1O57A 2QQAA 2ZNYA 2NRAC 3BJAA 4EJTA 1TQMA 3FF5A 2KIMA 2ACJA 3I4PA 1QZYA 3KZZA 3HRUA 3FHZA 2JZYA 4A0XA 4H0EA 5HOOA 5K5RA 2CQKA 3ISPA 1HSTA 3IWZA 4HDVA 1SFEA 2L3DA 3C3WA 1O3RA 3Q5FA 3OOPA 2EK5A 2BE5F 3E97A 3K1MA 3T1BA 2Z3YA 5DD4A 3W6JB 5E1ZB 4EJWA 2VT3A 1E2XA 1JGSA 3BOQA 5D4RA 4BH9A 3JTGA 5LGNA 1SAXA 2RVCA 4HA8A 4AP2B 5BPIA 3MCZA 4QWQA 3K1PA 4F7ZA 2K4JA 5DCMA 2VOOA 1Z7UA 2P6TA 3EETA 3ELKA 3VOEA 4HLYA 4LD5A 4M9XA 2QM3A 4JBAA 2M8EA 3CLOA 4HZFA 2P8TA 2HGCA 3RYPA 1SD7A 2FNPA 4YIIA 2DBBA 5ERIA 5IT9Z 1P4XA 1FYLA 1L3LA 1P92A 1F9NA 2IA0A 3WTUC 4IPAA 2IVMA 5D8KB 1BIBA 2PMHA 4UNOA 1T39A 3E6BA 3RJPA 3J81Z 5FGMA 4U0YA 3R4KA 3M8EA 1R58A 2P5VA 2OA4A 2W25A 2XAJA 2PN6A 3HTUA 2A07F 5HDGA 2LKPA 3ZMZA 3DF8A 2EFPA 3H3UA 5AIQA 3GFIA 5LGUA 4YIFA 3HOTA 1VTNC 1K79A 1IUYA 2STWA 1BI1A 1UB9A 2F5DA 1OYYA 2XGXA 4LGWA 2DQRA 3MFKA 2F2EA 5HS8A 4ON0A 1CF7A 2DPUA 4KYWA 1XSXA 4G9YA 1D8KA 1R7JA 5F1RA 1ZG1A 2MH9A 4BHCA 2XROA 3I53A 2M45A 2A5YB 3J80K 1B4AA 4CO8A 2HFHA 1I1SA 1F5TA 4LB5A 4GO1A 4U0WA 2GAUA 1FYMA 4KDPA 3QU3A 1TNTA 4FHTA 4EOZB 5TJJA 3KP7A 3QP6A 1LVAA 1K78A 4QLCU 2ZO4A 4Q4ZF 3E5QA 1IW7F 4HX8A 2HYFA 4L0ZB 3I71A 2Y75A 2L4AA 1V3FA 3KZYA 4S04A 3DXJF 2PMUA 2E1NA 4XSZF 2YX7A 2YPRA 1ZHFA 5E8GA 1MKMA 4G6QA 4HXIB 1USSA 2K4BA 1H9GA 4A64A 1ZG5A 1J5YA 4PZJA 4HF1A 3E6CC 3GEZA 3BPXA 2G7HA 5LEJA 3ZMTA 1R1TA 3R6SA 4TV7A 1W7PD 1ULYA 2XKPA 1ZN2A 5D8LB 4BAYA 4HDUA 2KJCA 3K69A 4UHTA 1ONVA 2CGPA 1IAWA 1WWXA 1SD5A 2FQ3A 5E18F 3KEOA 4HLXA 3DPLC 4HBLA 2CYYA 3D0SA 3S2WA 3KP5A 1PP8F 4ZYHA 4EJUA 2J5PA 3WTYC 5JFRA 1E17A 2MLKA 5CVUA 4CXFA 3ZP5A 4N0BA 1DPRA 1U8RA 2P7CB 3WTTC 2RN7A 1WI9A 1R00A 2MC3A 2O3FA 2R3SA 3EUHA 2V9VA 1J75A 5L3EA 1B9NA 1XD7A 3EQLF 2R7FA 3H3ZA 3WTVC 2OU2A 4WXCA 2LNBA 2X4HA 1LNWA 2OQGA 3FMRA 4MGRA 4CHUA 4ETSA 2EB7A 1SFXA 3JAMK 1GXPA 2OQRA 4UXNA 4XBFA 4KFCA 5E17F 4LG0B 1HSJA 1OMIA 2J5OA 3LAJA 3TOBA 2MBFA 3I0TA 4OIPF 2EV6A 3GZ6A 4KN7X 4MQVA 4WCGA 4WQOD 1TQIA 3BY6A 4A6DA 3K1NA 2QUFA 3R0JA 5EEHA 4FX0A 4I7HA 2TDXA 3EYYA 3LWFA 1HKQA 1FBQA 5E8IA 2PQ8A 3G3ZA 3PFIA 3HHGA 3T8RA 4LG0A 3WTSC 4Q48A 5DEQA 2B0LA 3GXOA 4GXOA 5H6RA 2EFNA 2JRTA 3WU0A 1LEBA 2PG4A 1XMKA 4I2OA 2G9WA 1XGMA 4DNCA 1O3SA 3GFJA 3JTHA 5AIPA 2KRFA 4L9NA 1YIOA 1MD0A 5LHIA 5LGTA 3BROA 2JPCA 3E6MA 5HLGA 4EM2A 2RGVA 1BOAA 3L9FA 2XUBA 2HR3A 3IKTA 1FZPB 2D45A 1MJBA 1XDUA 5DUKA 2Z33A 4G7HF 3KLNA 2FMLA 2DI3A 5ICCA 4I02A 3LA3A 4KIFA 1FLIA 2VE8A 2DTRA 1IXRC 1SMYF 2O03A 1J0RA 5CVVA 3ECHA 4R8HA 2KJBA 5KK1A 3KP2A 4EM0B 4HF0A 3JSOA 1T38A 1IN8A 1MJAA 1UCRA 4EVIA 3CJNA 4KIBA 3BJOA 3E6DA 4A12A 1XGSA 1S6LA 2EA2A 3K2ZA 4N9HA 2EV0A 5KVRA 4IVNA 2V1XA 2RV8A 4N9F3 3P9KA 3MAJA 3FXQA 2AS5F 5K5QA 1TTYA 4M73A 1R5GA 1YW8A 3KETA 2WTEA 1UHWA 1BIAA 4R79A 3IRQA 1RUOA 2IW5A 1JE8A 2EFWA 3ZPLA 2PLYA 4XRFA 2VBYA 2XASA 4MNUA 2QQBA 3F23A 1I6XA 2Z5UA 4UUVA 1T0FA 3F6OA 2ZNZA 1G3SA 1FPQA 1A04A 4G6DA 2GWRA 4CICA 1TW2A 2NAZA 2HKXA 4HQMA 5BPDA 2G7UA 1YTYA 1AWCA 3K9TA 2YSRA 3WGIA 4I0AA 5DCFA 2DAOA 4U0VA 4OU0A 4U88A 1BJAA 1ZGAA 3TOAA 2PFBA 4ENKA 4AWXB 3N4MA 1D5VA 2FRHA 3J7AO 2BYVE 3JAMZ 4FX4A 2GIVA 1IRFA 2Z9OA 3BZ6A 2NNNA 1B9MA 2GXGA 3KP6A 2RC4A 4RAZA 2FSWA 2HEOA 1YFHA 2JSCA 4IHSA 3DPTA 4I09A 1KQ0A 2HQRA 3R0AA 3ZN0A 4RB2C 1QNTA 4KMUX 2EA4A 2FBIA 4O5VA 3GW2A 3L00A 1DDNA 1O7FA 1EV7A 4GYGA 2ZBKA 3QPHA 3HHHA 1FOKA 3U1DA 4A0YA 2RKHA 5K1YA 1R36A 3LQQA 3RKXA 2UZKA 5HDNA 2F5EA 3SZTA 2BBYA 1Y0UA 2QVOA 2LF7A 1DP7P 3ZMSA 5D4SA 4XLPF 5D5UB 4EQQA 3MZHA 2QQ9A 2VC0A 3IHUA 3B73A 2A6HF 2L4MA 4G7ZF 2HTJA 5IT3A 5FLXK 2DK5A 1J2XA 1QZZA 2YR2A 1O7LA 1RNLA 3P9IA 1D3YA 1XB4A 4ENNA 2VBXA 1I27A 5CVJA 6PAXA 2MA3A 5LBQA 5AONA 4BHBA 2IA2A 1ZH5A 4HX4A 1KQ8A 4P9UA 1K7AA 2O61A 1KU7A 2L02A 3WODF 2LSOA 3ABTA 3TGNA 3SFZA 3V8KA 1U6GA 5D5WB 3CUQA 4AD9A 4DQ2A 2Q0OA 1HW5A 3NRVA 4PDKA 3SQNA 4M72A 1WQ2A 2UWMA 1LDDA 4HV5A 1XSDA 3ROUA 3IRRA 1QO0D 3EYIA 1P4WA 5ILVA 1WKMA 4ZYEA 3RKYA 4EV0A 3HRTA 3QU6A 1ODDA 4MTDA 2KIFA 3B02A 3V8LA 2VBWA 1F4KA 4BXUA 4RB3C 3TO7A 3WGHA 2VBZA 3SHFA 4Q47A 1NHAA 3PQJA 5FD5A 3E5XA 3NQOA 2ELHA 4IRGA 1GVJA 4Y17A 4YG2F 3QPTA 2OZ6A 4JQFA 2IA1A 2HZTA 3WU1B 1ON2A 2ESHA 2ETHA 2GA1A 3DQVC 2PEXA 3E5UA 3PQKA 1B1BA 3I58A 2HWVA 2IRFG 4AIHA 1HQCA 4JK1X 3HSFA 2CWEA 4O3MA 4PGHA 2GA2A 2F5CA 2DU9A 2P5LC 5E1XA 5DDGA 4L9JA 1H9TA 1ZREA 2QYOA 3RPUA 1FT9A 2Q2EA 4I01A 4HQEA 4A5MA 1Z05A 4JGHD 2D1VA 1XDSA 3VFZA 2UXNA 4UVCA 3Q9VA 2A69F 4CZZA 4LJZF 3O6BB 4M9SA 3LAPA 1PP7U 3RPQA 1FYKA 2Q8KA 1CGPA 2K86A 4IXAA 4L5JA 2EV5A 5BS6A 4RGRA 4A6EA 3SXYA 1ZYRF 1DPUA 1QBJA 2IPQX 4L18B 4YFKF 4KNYA 5HS7A 4KMFA 4FT8A 3O3KA 3RYRA 3NEUA 3MWMA 5J6XA 2GQQA 1JHHA 1YQAA 1G3WA 1R23A 1IXCA 2ZMEB 1G3YA 4MEXF 1CF7B 4IRIA 3RTRA 5JI6A 2R7DA 1BI3A 4KIGA 4LB6B 3ZN1A 2STTA 1TLHB 2KKOA 3F6VA 2VC1A 3HUGA 1FBSA 2QBYA 5D6EA 1G4DA 1IN6A 3P7NA 1STZA 3ZMVA 4S05A 5F64A 1LDJA 1BC8C 1BI0A 1W7PB 2D1HA 1U78A 4WWCA 5TRDA 2K27A 2HDCA 5H6QA 1MGTA 1R1VA 4OIRF 1ZG3A 5HVQC 2H27A 4M74A 1HKSA 3BJ6A 1JXSA 4UV9A 3U2RA 1RIOH 2WC2A 5FFZA 4XLNF 1B6AA 1U3EM 1R22A 2ADUA 2DO7A 3FM3A 2XAQA 3ML6A 3I59B 2CW0F 2RQPA 4LMYA 5HDKA 1X3UA 4ENJA 4WK8F 3F21A 3KP3A 3LA2A 1TQPA 1ZAOA 2H09A 1USTA 3T0YA 4YFNF 1JHFA 2CG4A 4GYIA 1MDMB 1QPMA 4ZZDA 2HTSA 3CUOA 4B8XA 3DFGA 1L0OC 1YS6A 4RB0A 3I59A 3SZPA 4P55A 1KYWA 3VEPA 2FU4A 3TQNA 2HOEA 3W6KB 1W7PA 1T98A 4WF2A 5L3DA 3QOPA 3FM5A 2K7LA 2HS5A 4M6XA 1QGPA 4RGUA 4HF2A 2JPBA 5ILUA 4M6YA 1S7AA 4LK1F 3F8FA 4ASNA 4A5NA 4WXDA 2FEZA 1IZ1A 3FXUA 3GUDA 3FXRA 1J9IA 4MTEA 1FSHA 3HRSA 2HYGD 3KCCA 1R1UA 4CYDA 2LF8A 2E1CA 1RZ4A 3G73A 4I98B 3RDIA 5DV5A 1FX7A 1UFMA 5L3CA 2O8XA 1HW1A 4P96A 2FF4A 3BWGA 2FA5A 3C18A 1B59A 4HV6A 2F5FA 4WXHA 2A61A 4M71A 4A2UA 3RI4A 4BHPA 1R5HA 2UXXA 4MHGA 4IHTA 3LSTA 5HS9A 3ZMUA 2M5WA 5ICGA 1LJ9A 4L9TA 5BOXA 1P6RA 3GVAA 1KU3A 1ZGJA 5CLSA 2VONA 3DV8A 3RIRA 1T2KA 3O2PE 1IRGA 3I54A 1WSUA 5L3BA 4L0YB 3TDZC 3GO5A 5ICEA 1YYVA 5ILSA 3M7GA 1BC7C 1C0WA 3FMSA 2BEOA 2XIGA 1QQIA 2MD5A 4U7DA 5FD6A 1YW7A 2CO5A 3HIFA 3GLXA 1KU2A 4CGZA 2WWYA 1IN7A 2PI0A 2XHKA 3IWFA 4ZYGA 2IT0A 1U5TC 4PGGA 1YW9A 2CFXA 2IP2A 3HOSA 2A3SA 3IC7A 4EJVA 5LLQA 4I0BA 1SMTA 1O3QA 1GHCA 4RS8A 2QENA 1Q1HA 2EJRA 2V1UA 1FNNA 5DYMA 2OAZA 3DKWA 3WGGA 1WRJA 3F8NA 2QWWA 2DFIA 4ZH4F 4R1HA 3BDDA 2LDUA 1XCBA 4NQWA 1OR7A 4EM1A 2P4WA 2E7XA 2QZ8A 2M1BA 4AIJA
chains in the Genus database with same CATH superfamily
4MO7A 1XN7A 3TO6A 3OYIA 1W5TA 1SD4A 1WVRA 2O0YA 3F8MA 4KA4A 2K85A 3EUHC 4G7OF 3MKLA 2ZXJA 5FLVA 1W5SA 4UUTA 4LFUA 2EWNA 2DQLA 4M9ZA 4LLLA 2M8GX 4MEYF 5TGTA 2HYJA 3MKWB 2CH0A 3LSGA 2HPMA 3SDBA 3HUGB 3CCUI 2R5ZA 2DJNA 5FB2A 4Z6YA 3HTSB 3KLOA 4K2EA 1U2WA 5JHUA 1OCTC 2R4GA 1NG6A 5E3OA 3I56I 1UHMA 4XKCA 3TKYA 2XVCA 3ZXSA 2VOPA 1AKHA 2DFFA 3G71I 3QAHA 5DD8A 1TWCJ 2OJED 2V6CA 3OL4A 2FD5A 5CJ9A 4UY8I 1DU6A 2DPDA 3GFMA 5F0HA 3M4OJ 1Z91A 3IL2A 2ZFWA 4RGSA 5HLHA 2HVRA 1SVOA 5A2QZ 5EEGA 1WJFA 2A5WA 3GWZA 4M6VA 4YFXF 2CMPA 4UV8A 1OLTA 4A3BJ 2HQNA 2ID3A 2R7RA 1V54H 1N75A 2PFVA 2DA2A 4ESFA 4N9IA 2RAEA 4EJOA 2H6BA 4HPQA 3R61A 2IS4A 2X6YA 1TBXA 3HPHA 2IS2A 3ULQB 1XGNA 3UR3C 5DCMB 1WJEA 3CC7I 1NTCA 1SVLA 2OZUA 5IOZA 2GXBA 4BACA 3FISA 4ESBA 3H3VK 1SAUA 3BPVA 5EEAA 1HXDA 3ERED 4O6JA 1HA8A 2JT1A 2VUMJ 2FOKA 1LKXA 3V7CA 2QKLB 2ZMEA 2CFOA 2XRLA 5E20A 3OS2A 3PO3J 5H20A 3T5XA 3OSFA 3FBNB 4CDGA 4LOCA 1A5JA 4E70A 3IH2A 3KP4A 3MZYA 3TP0A 2GBYA 4RB1A 1VQKI 1V4RA 1X2MA 3LFKA 5D6FA 2ESNA 3M1EA 1PUEE 3DP7A 1IF1A 4B48A 1MNDA 4C2MJ 1YG2A 4IQ4A 4F93B 3RQ4A 2VT2A 2JVHA 1S8NA 3A03A 1R4MB 3ZQ7A 4ESJA 5B1AH 1U5TA 4KITB 3H9GA 1F1ZA 1YLFA 5J8FA 2FBHA 2OCEA 3W2AA 3FWEA 4G8XA 3GLLA 3HSRA 1A35A 1I1GA 4XORA 2D2WA 1FSEA 3H92A 3E0JB 1K83J 4Y52J 3QRFF 1OCRH 1ZRFA 3GTQJ 1Z1DA 2LH9A 2P6SA 2CS3A 3U21A 1K6OA 1U5TB 2QCOA 2WAUA 4LK0F 3VYSB 4BY7J 5JR3A 2EFOA 4IJAA 4JX6A 5A2QK 4RDUA 2OD5A 4P9FA 3SJMA 4HAMA 2NS0A 4DZPA 1LVKA 5JVTA 3DEEA 3QP5A 4OINF 2F4IA 2XPUA 3OV8A 3OYEA 3RKWA 3F3XA 2WV0A 1OYIA 1B8IA 2ELJA 4MFDA 1LDKA 2LYCA 1KYZA 2Z99A 2NVQJ 1MZBA 4KICA 4CCJA 2O6GE 1FMVA 1YS7A 3TBIA 2ISZA 2HPIA 5B3SH 3ZQHA 1HF0A 2LY1A 2EFQA 2XAHA 5D5VB 4Y13A 3N97A 3W2VA 1AOYA 5DM7F 3S17J 1FWZA 2XGDA 5ED4A 4HNVA 1KU9A 4LG3A 2PX9A 4L9VA 5IP6A 2M87A 4ZYDA 2L54A 4MFEA 2W84A 4X6AJ 2C6YA 2Y30A 4D5FA 3DKYA 1OQYA 3V7RA 2KFDA 3CO7C 1VQMI 2NVXJ 4KN4X 5DM6F 2DLLA 4UUSB 1QU3A 3K4KA 5M3FJ 1JKPC 4ZDOA 2BGCA 4D0PA 2ZCWA 3U9GA 4P5OA 4NUVA 1R49A 3BP8A 4HRIA 3LSJA 4ZZLA 1I3QJ 3BZKA 2JTVA 1MIJA 4GGGA 5F6FA 5F3JA 1Z3YA 2CQ7A 3REOA 2KIUA 1P4AA 3S1RJ 4F92B 2PJPA 5DUIA 2VXDA 2XRNA 4B43A 3PNYA 4E7KA 2GZWA 4XRSG 5CVIA 1IN5A 3BCAA 2ZXHA 4JP0A 1F43A 2DDAA 4UB8C 2W4SA 3V7SA 3KEQA 1ZRDA 3FZVA 1D8JA 5LHHA 3HL2A 3WTZA 2R7OA 1OJLA 3MVPA 1QZEA 3HBLA 1FY7A 3VB2A 5FLXZ 1N78A 2LY2A 1EH8A 1Y1WJ 2HZDA 4GDFA 1D0YA 4A3JJ 2ZJQF 2E1MC 1ENHA 3R60A 1EH6A 2O7OA 1MBEA 2KL4A 1YHQI 1RC9A 4OIOF 1YOVB 1S72I 2DW4A 1BM9A 5C4JJ 3L2CA 1P7IA 3M9AA 1TW3A 3M8FA 2VQGA 2IJLA 1WZ2A 3D5SC 4NB5A 1CQTA 4Z2YA 5K5OA 5EG0A 3ONQA 4OOIA 1FP2A 3OMYA 2ZXIA 5J3LA 1IXSB 3CUQB 2VE9A 5J8CA 3IKVA 4DYQA 4RAYA 4D5CA 2QGUA 4A0ZA 1RPWA 2W24A 3O8HA 4LLGF 2W85A 3CTAA 3DBLB 2V1DA 4Y15A 3GFLA 1VNDA 1A6IA 4C3IJ 2GOMA 2H6CA 3BQYA 2CSOA 3FK7A 3PUBA 4DIQA 3HSEA 3GF2A 1HW2A 3K4CA 3EDPA 4YELA 4B09A 4F55A 2P5KA 3S93A 2IGNA 1LB2A 2NOGA 4WX9A 1PDNC 1MDMA 2IGKA 4IO9F 2VQLA 4EATA 3HYIA 3Q9SA 5HLIA 5DS9A 3M8JA 3HPGA 3WTWC 3BLYA 3DPUA 1FP1D 2PMZN 4UVAA 5LRSA 3KE2A 4U7BA 1AHDP 3OYJA 4UVBA 5B5EC 3JRAA 3Q0UA 2CV1A 1UHSA 5J1RA 2NNYA 4PJJA 2XF7A 5E79C 5LRRA 2Y0MA 1Z6TA 2AXLA 5DTDA 2E5ZA 2W57A 2HDWA 2MSYA 2H94A 2R7XA 1BOBA 1ETQA 1R4NB 1BBYA 1X2NA 3QYFA 4EEFG 3S1MJ 1IRZA 1LEAA 2VODA 1G3TA 2AHQA 2QBYB 2Z2SB 2VXZA 1LQ1A 1EKEA 2EZLA 1LE8A 2OCCH 3MQ0A 3QODA 2Y48A 2GLOA 5FKMA 5H2FC 1U9NA 1GXQA 3JW4A 3SZGA 4BYYA 4X1EA 3QPLA 3F72A 3IH4A 1LPQA 1VQNI 3L1PA 3KFWX 4PUSA 4ZDLA 3K2AA 1EH7A 3DTKA 4F52A 4HX7A 4OMYA 1S5LC 2PBIA 2WAQA 3BG7A 2FBKA 1S3JA 1R5ID 3K0LA 1P2FA 4G94A 3JSPA 1OKRA 3F8CA 5M5XJ 3E3VA 2P7VB 5F1JA 1I5ZA 1HDPA 2IXSA 1RRJA 5LEKA 1XMAA 3CMLA 2Q2EB 5LHGA 4BNCA 1OPCA 4KT6A 1XGOA 2RDPA 2IGOA 2FNAA 2QLZA 3WE3A 3ZQCA 3LA7A 3DTIA 3G1OA 1NK2P 2K02A 5E1WA 1G6NA 1Z9CA 1H89C 4BQAA 3P9CA 2NYXA 1S7OA 1REPC 2E71A 4D1QA 4PCQA 2DTZA 4A3IJ 4NHJA 1V5FA 1YJ9I 1YJWI 5CPRB 3FX3A 5CVRA 5CKTA 4KT5C 3LSIA 2HXIA 4XSXF 1BI2A 3M07A 1E0EA 4OMZA 1BN5A 2VB6A 4B3AA 2VKDA 5IT9K 4HYEA 3CC4I 2A05A 4LLNA 2GXAA 2X51A 5GAHJ 4XR6A 1XCVA 2CRGA 3CDHA 3HRMA 3J7YJ 1FC3A 2A6EF 5CYVA 3ECOA 3HOZJ 2V79A 3B6CA 1LUJB 5FLMJ 2DT5A 3L09A 4DW6A 2EBIA 1GDTA 4AVPA 2RNJA 2L01A 3J81K 3K70D 3HZJA 3V8JA 1ZLKA 4BXFA 2JSPA 3WG7H 1SD6A 4ITVA 5GAGJ 3KYLA 5JLWA 3OS0A 3GX4X 3ZMDA 4KISA 3HOWJ 2NS8A 4RBOA 1RUNA 1KQ9A 3COAC 3LQRA 4E7HA 3LMMA 3CF2A 3NAUA 2WZKA 3I64A 4HW0A 1W4MA 5F08A 3DBHB 1WJAA 2KDOA 2HU9A 3FXKA 1UZCA 1MNMC 1ZLJA 4S0HB 1T33A 2K9NA 1XSVA 1JUMA 5B66C 2R7SA 1T6SA 3N05A 3V4GA 3OYAA 1BR2A 3CMMA 4EGZA 4PFOA 1MJ9A 2ISYA 3G6EI 2DYSH 2ME0A 4MQ9F 3H9JA 1W36D 1DUXC 2ZSHB 2HQ5A 4APFB 4HEA2 5L3GA 2FE3A 2ELKA 3CP8A 3CCQI 1M1EB 3TO9A 2P0WA 4HOBA 4M3BA 3CUQC 4KJZA 4NUUA 1OCOH 2LY9A 2O9LA 5ICFA 2M30A 1TNSA 2BV6A 3C7JA 5C44J 1SFUA 4Q5SF 4EMSA 2COMA 2FXAA 4IRHA 1WI3A 3FXJA 2XAGA 3K4BA 2E36A 3WHCA 3WTXC 3WG9A 2ZKZA 3KEYA 5KCMA 3CLQA 4IF4A 2X0LA 1K78B 1YITI 4RGXA 4BEHB 2DODA 3T8TA 3ABUA 3F22A 3J80Z 3FMQA 1Z3XA 2AQFA 4AU7A 2OTJI 2VN2A 3TDUC 4Y33A 1IG7A 1VQPI 3GZ5A 3C1DA 3G2BA 1UAAA 2HKOA 3OYBA 4C2UA 4XLHA 4BL0B 5C3EJ 2L7ZA 3IH3A 1S29A 3MEXA 1RI7A 1NH3A 1J59A 2YU3A 2JA7J 2A6TA 2E7WA 2EZIA 1HKTA 1OYWA 4GCVA 1D0XA 3KYDB 4JX4A 1KA8A 2MW8A 2LG4A 5J4YA 1IN4A 1O3TA 1Z6RA 1J7KA 3DLAA 5BQTA 1ZQ3P 4AIKA 4OIQF 3FXOA 3L7WA 1ZARA 1KGSA 1ORKA 1K4TA 1QA6A 4XONA 2YX4A 2R7VA 5FFXA 2DK8A 4D9JA 2DOAA 4B4CA 1YO5C 1ON1A 2MABA 3GYHX 5BMZA 3AAFA 1ETKA 2XV4S 1PJRA 3VODA 3I5UA 1FJLA 1H0MA 3S16J 2OBPA 1UG2A 4RAFA 2I10A 3D5LA 2XKOA 4KUMA 5D5XB 1ZRCA 3F8BA 2XAFA 4XRMA 4EGYA 2E2HJ 2ZJ2A 2FMYA 3WE2A 2H8RA 3BR1A 2A68F 4C30A 1UMQA 5FO5A 2VKVA 3DEUA 1ETWA 1B8IB 3CO6C 4BE0A 1LDKB 2MLGA 2VJIA 4L5IA 1HBXG 2MH2A 1GUUA 1FBUA 3JR9A 4ENMA 1YI2I 3GMEA 5L3FA 3BG6A 1O57A 2QQAA 3GTPJ 2ZNYA 2NRAC 3BJAA 4EJTA 1TQMA 3SDGA 1G2HA 3FF5A 2FOWA 3BCBA 4ZTFA 2KIMA 2ACJA 1GVDA 3GTMJ 4RLFA 3I4PA 1QZYA 4YIRX 3P5JA 1Y39A 4PJ0C 3KZZA 3HRUA 3KPHA 3FHZA 2JZYA 1GV5A 1RKTA 4A0XA 4H0EA 3K6GA 1IC8A 5HOOA 3K4MA 2LRDA 2B1EA 5K5RA 2CQKA 3ISPA 1HSTA 3M1CA 3IWZA 4HDVA 1SFEA 1QHGA 2L3DA 3C3WA 1O3RA 3Q5FA 3OOPA 2EK5A 3I9V2 3PM1A 2BE5F 2OV7A 3E97A 2VJJA 3K1MA 3T1BA 1DP3A 2Z3YA 1G8XA 1GLNA 5DD4A 3W6JB 3ASOH 3BTJA 5E1ZB 1TT0A 2BOLA 2CV2A 4EJWA 1BJZA 3S2DJ 4M3DA 2VT3A 1E2XA 3HEFA 2VL8A 4A3DJ 1JGSA 3JRIA 1X58A 3BOQA 4XRSA 2XB0X 5D4RA 3OYGA 4BH9A 3JTGA 1I3AA 5LGNA 1SAXA 2RVCA 1HCRA 2K9QA 4HA8A 4AP2B 5BPIA 2KZGA 3MCZA 1LFBA 4QWQA 4A3MJ 3PFYA 3S1NJ 3FBIB 3K1PA 4F7ZA 3L2UA 2DN0A 2K4JA 3OIPA 3G1LA 5DCMA 2VOOA 1Z7UA 2P6TA 3EETA 4DBQA 3CQZJ 2O5RA 3ELKA 3VOEA 4HLYA 1MSFC 4LD5A 4M9XA 2QM3A 3OSGA 4JBAA 4XK4A 2KLOA 2M8EA 3CLOA 4HZFA 2P8TA 2HGCA 2KZVA 2JRMA 3RYPA 1SD7A 1IGNA 3OIQA 1ZK8A 2FNPA 4YIIA 2QEXI 2BXZA 2DBBA 5ERIA 5IT9Z 2LP0A 1P4XA 1FYLA 1L3LA 1P92A 4AC0A 1F9NA 2IA0A 3WTUC 4IPAA 2IVMA 5D8KB 3A01A 2R7ZJ 1BIBA 2PMHA 5EZHA 3H35A 1T39A 4UNOA 3E6BA 4BE2A 3K10A 2B7EA 1B72B 1VI0A 3RJPA 1UJ8A 3HOYJ 5FJ8J 3J81Z 3NWTA 5FGMA 4U0YA 1OCCH 2W48A 3R4KA 5GPAA 3M8EA 1R58A 2BY1A 1WPKA 2P5VA 2ZJPF 3A2KA 2OA4A 4AVZA 1FMWA 2W25A 2XAJA 2PN6A 3HTUA 2A07F 4OAYA 5HDGA 5FKNA 2LKPA 1FOXA 3ZMZA 2BHYA 3DF8A 3CCSI 2EFPA 3MN2A 5FKOA 3H3UA 5AIQA 3PL8A 1RETA 3GFIA 1ETOA 3VSLA 5LGUA 4YIFA 3HOTA 1VTNC 1K79A 1IUYA 4BQOA 3RKQA 1LE8B 4IHYA 2STWA 1E3HA 1BI1A 1UB9A 2OPTA 2FUG2 2XGXA 1OYYA 2F5DA 4LGWA 5IY5H 2DQRA 4RM2A 2LK2A 3MFKA 2KT0A 1SFOJ 2F2EA 5HS8A 4ON0A 1CF7A 4CH7A 2DPUA 4KYWA 3ZQGA 1ZTRA 3JRHA 1XSXA 2R7TA 4CCLA 4G9YA 1D8KA 1R7JA 5F1RA 4XN3A 3L2VA 1ZG1A 2M3AA 1VQLI 3HB9A 2MH9A 2KQRA 4BHCA 4NC6A 3WHBA 2XROA 1W0TA 5JHFA 3DU5A 4C3JJ 3I53A 4XN0A 3JRGA 4ANJA 2M45A 4A3LJ 1TWAJ 3RRCA 1IRXA 2ME6A 3S3MA 2A5YB 1XX5A 3J80K 2ID6A 3H0GJ 1B4AA 2BVMA 2HFHA 4XMYA 4CO8A 1F5TA 1I1SA 4LB5A 4GO1A 2CQNA 2DJIA 2GAUA 4U0WA 2VLAA 4A3CJ 4A3GJ 1FYMA 1T08B 4KDPA 3QU3A 3HXLA 1P9QC 2OF7A 2L2OA 1TNTA 4FHTA 4EOZB 5TJJA 4BY1J 3KP7A 3QP6A 1LVAA 4PFPA 4W1UA 1QPIA 1K78A 4QLCU 2ZO4A 4Q4ZF 5LD2C 3E5QA 1IW7F 4HX8A 2EILH 2HYFA 2MYSA 3TW6A 4IOAF 4CCKA 4L0ZB 3TEDA 3I71A 2Y75A 4LITA 1OCZH 1Y0NA 1V3FA 2L4AA 2E35A 3KZYA 4S04A 3PIOF 3DXJF 2PMUA 2E1NA 4XSZF 2YX7A 4HNUA 3C2BA 1ZKGA 2YPRA 4FETA 1R71A 1ZHFA 4FTHA 5E8GA 1MKMA 4G6QA 4HXIB 1USSA 2K4BA 3KX2A 1H9GA 2K40A 1FEXA 4A64A 4XLCA 1TWFJ 2OC6A 1E3PA 1ZG5A 2WAQN 2LMDA 1J5YA 3NARA 2HXOA 1X3ZB 4PZJA 2K9MA 1X1BA 2DFHA 1VF9A 3ERMA 4M3GA 2Y69H 3E6CC 4HF1A 2I5UA 3GEZA 3BPXA 4MLOA 5GADJ 4D7MA 2G7HA 5LEJA 3ZMTA 1R1TA 3R6SA 4E7IA 2HOTA 4TV7A 1W7PD 2GIZA 1ULYA 3IAM2 3DWLE 2XKPA 4II2A 3ZQQA 1ZN2A 5D8LB 4BAYA 5HLTA 1WFXA 2LBFA 3CDIA 4HDUA 2KJCA 3HGYA 4XIDA 3TMOA 3K69A 4UHTA 1ONVA 2CGPA 3S15J 1IAWA 1WWXA 1SD5A 2ZFUA 2FQ3A 5E18F 3KEOA 3VYUB 4HLXA 3DPLC 1Z7LA 3H0DA 3CCEI 4HBLA 1Y8RB 3KYCB 2CYYA 3SYTA 4BJ5C 1LFUP 3D0SA 4XLEA 3S2WA 5C4XJ 3KP5A 3VPRA 2W00A 1PP8F 3RSNA 1SANA 4ZYHA 4EJUA 2ZJRF 2J5PA 3WTYC 5JFRA 2DMNA 2CUJA 1E17A 2MLKA 5CVUA 4CXFA 2QSGX 3ZP5A 4RMNA 1UG0A 2LBFB 2X1DA 4N0BA 1DPRA 1U8RA 2P7CB 3BQIA 3WTTC 5B1BH 2HVSA 3I3LA 1Z21A 2RN7A 2DOEA 2F6CA 2PMZA 1WI9A 3LSPA 1R00A 2MC3A 3RZDJ 2O3FA 2R3SA 1QVUA 1BA5A 1JT0A 3EUHA 4CYCA 3AG1H 2V9VA 4IQJA 1J75A 5L3EA 1IJWC 4CUGA 1B9NA 1XD7A 2E1MB 3EQLF 2R7FA 3H3ZA 3WTVC 2OU2A 2XF5A 1WJDA 3PSFA 4WXCA 3AL0C 2M7AA 4BU2A 2LNBA 2X4HA 1LNWA 2B63J 2OQGA 3CDLA 1ERDA 3FMRA 4MGRA 5FKLA 4ZDPA 4MIMA 4CHUA 4ETSA 3AKZA 2EB7A 4FE7A 3LFUA 1SFXA 4E7SA 3JAMK 1GXPA 2E5NA 2DA3A 2OQRA 4UXNA 2JJ7A 4XBFA 1V55H 4KFCA 5E17F 4E7JA 2LREA 5FKKA 4LG0B 1HSJA 4LIVA 1OMIA 2J5OA 2L9NA 4Y4RA 1T0FC 3TOBA 3LAJA 2MBFA 2CW7A 2KMUA 3I0TA 4W97A 2EV6A 4OIPF 1QRYA 3GZ6A 5HNFA 1TZLA 1X1DA 3K7AJ 4KN7X 4MQVA 4WCGA 3HOXJ 3ZRGA 2AQEA 4WQOD 1TQIA 2XC7A 1IO2A 3L2WA 2BW3B 3BY6A 3H36A 3K1NA 4A6DA 3VDXA 1W5CC 2QUFA 3A0HC 3FKJA 3R0JA 5EEHA 1XTAA 2V9KA 4FX0A 3RPUD 4I7HA 1ETXA 2TDXA 1A6QA 3HOVJ 5JLXA 5J1YA 5GPCA 3EYYA 3LWFA 1HKQA 3A01B 1V5GA 1FBQA 2PQ8A 5E8IA 3G3ZA 3DKXA 4CCOA 1PUFB 3PFIA 5K7HA 4IX7A 3HHGA 3T8RA 3BQKA 2FQ4A 4LG0A 1X3WB 3IAS2 3WTSC 4BBRJ 4Q48A 3F9KA 3FHNA 4XLFA 5DEQA 2B0LA 3GXOA 2DYRH 2Y31A 4GXOA 4G12A 5EGOB 5H6RA 3JRDA 5F04A 2EFNA 2JRTA 3WU0A 3CCJI 3H1CA 1LEBA 2PG4A 3EUKL 1XMKA 1NG7A 4I2OA 2G9WA 4DZJA 1XGMA 1NK3P 5J47A 3W2WA 4DNCA 1O3SA 3GFJA 3JTHA 5AIPA 2KRFA 4IHVA 2I8DA 4L9NA 1YIOA 2FJ1A 1MD0A 5LHIA 5LGTA 1MBGA 1GV2A 3BROA 2JPCA 4C9YA 4XKBA 3E6MA 5GTIC 2X6XA 3DEWA 5HLGA 4EM2A 2RGVA 3KIOA 1BOAA 2ECCA 1F36A 3L9FA 2Y0SA 4CA0A 3HKZA 2XUBA 2HR3A 2RREA 2E60A 3IKTA 1MMDA 3CMEI 4BS9A 1FZPB 4BQQA 4IOCF 1K4SA 1DGWY 1A36A 3AG2H 2H8WA 2D45A 4PK4A 1MJBA 1RR7A 1XDUA 5DUKA 2Z33A 4G7HF 3KLNA 2R7WA 4AIDA 3HG9A 2FMLA 1EJ9A 3DBRB 3FK6A 1ETYA 3VYTB 1XG1A 1UELB 2DI3A 5ICCA 1JTYA 1OFCX 2XF6A 4I02A 4JYKA 3LA3A 4KIFA 2HOSA 1FLIA 3PO2J 2VE8A 2V1NA 1JTXA 2DTRA 1KZHA 1IXRC 1SMYF 2EH3A 1VFCA 3BG5A 1JUPA 2O03A 3PSIA 3VWBA 1J0RA 5CVVA 5FRMA 3ECHA 2Y8DA 4R8HA 3OYCA 3A0BC 2KJBA 5KK1A 3BR5A 3KP2A 4EM0B 1X4PA 4PJNA 4HF0A 1OISA 3HC7A 3CCLI 2F4OB 3JSOA 1IV8A 3FXLA 1T38A 1IN8A 3DU6A 4DJAA 3C2GA 1MJAA 1UCRA 2V4JC 4EVIA 3CJNA 3D5RC 1YRNB 1Y8QB 4KIBA 5K7ZA 3BJOA 4M3FA 4RM3A 3B6AA 3E6DA 4A12A 3BTLA 4IL6C 1X1PA 2TRTA 1XGSA 1S6LA 2EA2A 3ASNH 4FQGA 3J7ZI 1JGGA 3K2ZA 4N9HA 4QSHA 1WH7A 2NS7A 1IUFA 2EV0A 2WAFA 5KVRA 4IVNA 2DA5A 2V1XA 3GTGJ 2R7QA 2RV8A 3Q3SA 1D1CA 3P9KA 4N9F3 3MAJA 3FXQA 5F0FA 2EQRA 4YEJA 2W82A 1FTTA 2DA6A 2JA2A 3HGGA 2AS5F 5E3NA 5K5QA 3OR2C 3HOUJ 4A3EJ 1TTYA 1H88C 4M73A 1R5GA 1YW8A 4AM3A 3KETA 2HDDA 2K3PA 2WTEA 1UHWA 3GZNB 1BIAA 3ABLH 4R79A 3IRQA 1RUOA 2IW5A 1JE8A 9ANTA 3GTOJ 4PJMA 2EFWA 3LNQA 3ZPLA 2X48A 4XRFA 2PLYA 2VBYA 2XASA 3L2RA 4MNUA 2ZXWH 5IYBJ 2QQBA 4ZJZA 2JUGA 3F23A 1I6XA 1AU7A 3GTKJ 2Z5UA 4UUVA 2WBMA 3QYBA 1T0FA 3F6OA 2ZNZA 1ZGWA 1G3SA 3CF5F 1WJBA 3AL0B 1FPQA 1A04A 1VQOI 1MBHA 4I76A 4G6DA 1JUSA 2GWRA 4CICA 1TW2A 2WY7Q 4GFBA 2NAZA 2HKXA 4A3FJ 4HQMA 2RQQA 5BPDA 3IUOA 2G7UA 1XS9A 1Z0XA 4A3KJ 1YX5A 1YTYA 1WGXA 3CP2A 1AWCA 3K9TA 5IYDJ 2YSRA 1APLC 2XGCA 3WGIA 2DFEA 2HI3A 3Q0WA 4I0AA 5DCFA 2DAOA 5E3MA 4U0VA 5KAIC 4OU0A 4U88A 1BJAA 1ZGAA 3TOAA 1QHHD 2PFBA 3IV5A 3GTJJ 1Z67A 4ENKA 4AWXB 1IDYA 2KP6A 3N4MA 3MKYB 2WAEA 1D5VA 2FRHA 3OOUA 1EF4A 3J7AO 5M5WJ 2BYVE 1ITYA 3JAMZ 3MD2A 4FX4A 3S2HJ 4RA2A 2GIVA 3OY9A 1PYVA 5KAFC 1IRFA 4IHXA 2Z9OA 3BZ6A 2NNNA 2LVSA 5EYRA 1B9MA 1Y56A 2GXGA 1S7EA 3KP6A 2CV0A 2RC4A 3DCFA 4RAZA 2FSWA 3HJEA 2LKSA 5IOYA 1YE9A 3S14J 2NXNB 4B3XA 2UUZA 2HEOA 2XU0A 1YFHA 2JSCA 3OYFA 1FOYA 3PJRA 2XAUA 4IHSA 3DPTA 4I09A 3LOCA 2V9PA 1KQ0A 2HQRA 3R0AA 3ZN0A 1XMXA 2MD0A 4F91B 2TCTA 4RB2C 1QNTA 4KMUX 2BZTA 2LD5A 2EA4A 2FBIA 4O5VA 3GW2A 3L00A 1DDNA 2E19A 1ZR2A 3SFIA 1O7FA 3OL3A 1EV7A 4GYGA 1JKRC 2ZBKA 3QPHA 3HHHA 1FOKA 3U1DA 4H4KC 4DYRA 4A0YA 2RKHA 3FKIJ 1VQ6I 2GOXB 2EIMH 1R36A 3RCOA 3LQQA 5IPAA 5K1YA 3RKXA 2UZKA 2CQXA 5HDNA 2F5EA 2JA5J 3SZTA 2BBYA 1TC3C 1Q1VA 1Y0UA 3LSMA 2QVOA 3QQAA 2LF7A 2OUMA 1DP7P 5EG0B 3ZMSA 5D4SA 2KISA 4AYBN 4XLPF 2XPVA 2FX0A 5D5UB 3BQZA 2K3FA 4BDZA 5F0CA 4NC7A 4EQQA 3MZHA 4FCYA 5EDNA 2JVGA 2QQ9A 2VC0A 2JMWA 3EPZA 3IHUA 5GP9A 3B73A 1SC7A 2A6HF 2L4MA 1IDZA 2R0QC 3M3YJ 3OWTA 2ZB9A 2HTJA 4G7ZF 1MMAA 5KNLA 5IT3A 5FLXK 1X4OA 1J2XA 1QZZA 2DK5A 2YR2A 2YUSA 5GAEJ 2X9DA 1O7LA 4IZZA 2Y0SN 1RNLA 2CW8A 4BQNA 3P9IA 2QQ8A 2DDBA 1D3YA 1XB4A 3OYNA 4ENNA 2VBXA 3LSKA 1I27A 5CVJA 6PAXA 2MA3A 4A93J 3SEQA 5AONA 3CJTB 5LBQA 2W7NA 4BHBA 2IA2A 5HODA 4HX4A 1ZH5A 1KQ8A 4Y7NJ 1TT5B 2QSHX 4P9UA 1K7AA 2D5VA 2O61A 2CUZA 4G6TB 2KPMA 2ZC2A 1HC8A 1KU7A 2L02A 3WODF 5IYCJ 2Z1DA 2MG4A 2LSOA 3OYKA 1D1AA 3ABTA 3TGNA 3SFZA 3V8KA 1U6GA 5D5WB 3D1NI 2L9VA 4BXXJ 3FDYA 3CUQA 2UV1A 4BEHA 3HDDA 4AD9A 4DQ2A 3PIPF 5LFAA 2Q0OA 5F27A 1HW5A 3NRVA 2EZKA 4PDKA 3SQNA 4L5EA 4M72A 1WJ5A 1WQ2A 1YJNI 4UB6C 1VQ8I 2B9SA 1LDDA 4HV5A 4BBSJ 2UWMA 1XSDA 3ROUA 1BR4A 1VQ7I 2X1EA 3K70C 2DA1A 2AXTC 3IRRA 1QO0D 2JQ7A 2M2EA 3EYIA 1P4WA 1QVTA 2DMPA 5ILVA 4QPQA 1WKMA 4ZYEA 3RKYA 4IEJA 4EV0A 3HRTA 5EGOA 3FIWA 3H5NA 3QU6A 1ODDA 2WA0A 5M3MJ 4MTDA 2KIFA 3JRCA 1N25A 3B02A 4BDYA 5JVGF 3V8LA 2VBWA 3JREA 1F4KA 1PVEA 4BXUA 4RB3C 1PUFA 3TO7A 3WGHA 2VBZA 4B44A 2G0EA 3SHFA 4Q47A 1NHAA 3PQJA 3QPSA 3E5XA 3NQOA 5FD5A 2ELHA 4LIUA 4IRGA 1JKOC 1MBFA 3OYHA 1GVJA 5K7FA 4IKFA 2BY0A 3H5RA 4Y17A 3ZCOA 4YG2F 4B1RA 3QPTA 2OZ6A 4DBRA 4JQFA 1VQ4I 2IA1A 3BT9A 2HZTA 4XOTA 3WU1B 1MSEC 2EINH 2K9LA 1ON2A 1LFPA 3F0CA 2ESHA 3BR3A 2ETHA 2DCEA 2GA1A 2JUCA 2DMUA 2K5CA 1U0JA 2L5QA 4NC8A 3DQVC 3CCMI 2PEXA 1U8BA 3E5UA 3PQKA 1B1BA 2WB1N 2VQHA 3NWSA 3I58A 2O8KA 1IV6A 3J7AY 5FRNA 4YRVA 2BW3A 2HWVA 1HDDC 4QIWN 1MMSA 2IRFG 4AIHA 1HQCA 4JK1X 2VJ4A 1OR7C 2ZMEC 2AO9A 2RNGA 2N8GA 2H1KA 3W3CA 4JOMA 2LTPA 3CCRI 3HSFA 1HLVA 2CWEA 4O3MA 2X6WA 4PGHA 2GA2A 3MKZA 3ZGKA 2F5CA 2DU9A 2CU7A 2P5LC 2IS1A 5E1XA 5DDGA 3WU2C 3BR0A 5GTHC 2JK3A 2Y9ZA 4L9JA 1DU0A 1H9TA 3CJQB 1ZREA 1U9OA 2KIQA 2QYOA 3BR6A 3TW7A 3RPUA 3U1KA 2M4GA 1FT9A 4X0GA 3OS1A 3JRBA 3BC8A 2Q2EA 2ECBA 2L7KA 4I01A 4BE1A 5CQEA 4HQEA 4QPOA 4A5MA 1Z05A 3CC2I 2Y9YA 4JGHD 2D1VA 1XDSA 4YFSA 3VFZA 2UXNA 3LL7A 4UVCA 3K4LA 3Q9VA 3QOEA 1YIJI 3BQLA 2A69F 1E3OC 4E4HA 2IAIA 3E7LA 4CZZA 4E7ZA 4CCMA 1AKHB 4LJZF 2R93J 3O6BB 1HOMA 2L7MP 4M9SA 3LAPA 2JN6A 1PP7U 3RPQA 1FYKA 2Q8KA 3S1QJ 5HNHA 4C2TA 1CGPA 2K86A 4IXAA 4L5JA 2DMTA 1W36C 4U87A 2E34A 2EV5A 4ZTJA 5BS6A 4RGRA 4A6EA 3SXYA 4XOPA 1ZYRF 2VASA 2L7FP 2M0CA 1BR1A 1DPUA 2QA4I 1QBJA 2IPQX 3A1YA 4ZC3A 2ICWG 2R7UA 1DQUA 4L18B 4OWRB 4YFKF 3Q0VA 4KNYA 5HS7A 4KMFA 4FT8A 3O3KA 4FE4A 3RYRA 2R92J 3NEUA 4XL9A 3AG4H 3MWMA 5J6XA 1D5YA 2GQQA 1JHHA 1YQAA 1G3WA 1R23A 4NQWB 5EJCA 2DXIA 1AA7A 1IXCA 2QF7A 1MBJA 3ESWB 2ZMEB 3X2QH 3RQIA 5IP7J 2E2JJ 3K4NA 1G3YA 4MEXF 1CF7B 4IRIA 1WCMJ 3RTRA 5JI6A 3H5AA 2R7DA 1BI3A 5J40A 2BHZA 1BW5A 1YRNA 4KIGA 1O4XA 4LB6B 3ZN1A 2STTA 1TLHB 4HG2A 3S3NA 1XPXA 4AUXA 2R5YA 2EIKH 2KKOA 2R5ZB 3F6VA 4Y3OA 2VC1A 4CCNA 2JA6J 3HUGA 2WADA 5J4VA 4ZYAA 1ETVA 3PNVA 4DGWB 1FBSA 3BTCA 2QBYA 5D6EA 1G4DA 1FTZA 4XKWA 1IN6A 3P7NA 1STZA 2VKEA 4BGDA 3O8GA 1VQ9I 3ZMVA 4S05A 4XM3A 1H8AC 5F64A 1GT0C 1LDJA 2IGMA 1XC5A 3A02A 1BC8C 2V7FA 1Z77A 1BI0A 2E2IJ 3W6VA 1JJ6C 3HM5A 1W7PB 2D1HA 3HKZN 1U78A 4WWCA 5TRDA 2K27A 2HDCA 4BJ6C 5H6QA 3TL4X 1MGTA 1R1VA 4OIRF 1X1AA 3S8PA 1ZG3A 5HVQC 4RAGA 2H27A 4M74A 3GCMA 1OCPA 3GTLJ 1HKSA 3BJ6A 4HSTA 1JXSA 3FXMA 1K6YA 3OR1C 4UV9A 3U2RA 1RIOH 2WC2A 5FFZA 4XLNF 2LR8A 1MMNA 2F48A 2KRHA 1B6AA 1U3EM 1R22A 3A4CA 4XLAA 2ADUA 2DO7A 3BZCA 2KDZA 2IS6A 1T8IA 3FM3A 3ZR8X 4P1WA 2IEKA 2XAQA 4J01A 1VQ5I 4BUPA 3ML6A 3I59B 2KRCA 1ACIA 2CW0F 2RQPA 2VI6A 2X85A 4LMYA 2HVQA 1WH5A 3AFHA 2EIJH 5HDKA 2YS9A 3DTEA 4II3A 2DMQA 1X3UA 4ENJA 2OTLI 2BVLA 4XKVA 4WK8F 3F21A 2XSJC 3KP3A 3ABMH 3LA2A 2JWTA 1TQPA 3TP3A 2XB5A 1JT6A 3OYDA 1FIPA 1JI8A 4V19K 1ZAOA 2H09A 2Y2ZA 1USTA 2NVYJ 3T0YA 4YFNF 1JHFA 5FROA 2CG4A 4GYIA 1TP4A 3JCUC 1MDMB 2KHMA 1QPMA 2M4KA 4ZZDA 3MZ8A 1W1WE 3CESA 1JKQC 2HTSA 3CUOA 2GM4A 3S3OA 4B8XA 1RKWA 3K4JA 2COBA 3DFGA 4J19A 2LKXA 1L0OC 1YS6A 4RB0A 5CQGA 2BXYA 2MFZA 3I59A 2P81A 3SZPA 4DYCA 4P55A 3UNGC 1N77A 1B72A 2NVTJ 1KYWA 2QKMB 3CD6I 2VQCA 1Y6IA 3VEPA 2R5YB 4UUSA 2FU4A 1TWHJ 2VIXA 3TQNA 2HOEA 3PUFA 3OIOA 3W6KB 1W7PA 4A69C 3DLLF 3E1SA 4JX5A 1T98A 4DOZA 4WF2A 1MMGA 5L3DA 3I55I 2M7BA 3QOPA 2WB1A 3FM5A 2K7LA 1T95A 2HS5A 4M6XA 1SVMA 2DT7B 4HNTA 1FIAA 1MNEA 1QGPA 4RGUA 4HF2A 4HSRA 2JPBA 4ABZA 5ILUA 4M6YA 1S7AA 3H9QA 2CUFA 1D1BA 5BNGA 2IBDA 1BL0A 4LK1F 4N4OB 3F8FA 3ABKH 2EZHA 4ASNA 4A5NA 4D7NA 2DT6A 3CZ6A 4WXDA 2FEZA 1IZ1A 3FXUA 1S9HA 4B47A 3GUDA 3FXRA 1J9IA 2VPRA 3OYMA 1ZR4A 2F4MB 4MTEA 1FSHA 3HRSA 2HYGD 2LC2A 3KCCA 1R1UA 5EF6A 4CYDA 2LF8A 2E1CA 1RZ4A 1W0UA 3G73A 4I98B 2PJRA 2LOOA 3RDIA 2DA4A 1BW6A 2ZSIB 2NVUB 5DV5A 1FX7A 1UFMA 2MGQA 5L3CA 2O8XA 3ZOBA 1HW1A 1MBKA 3CCYA 5M5YJ 1K61A 3VYRB 1I39A 1P7JA 5E3LA 1MW7A 4P96A 2L0KA 2XGEA 2FF4A 3BWGA 2CUEA 2FA5A 4V2GA 2WV1A 3C18A 1B59A 3MMYB 3KZIC 4HV6A 2LLKA 2F5FA 4WXHA 1G59A 2A61A 4M71A 4GRIA 1ZELA 4A2UA 3RI4A 4BHPA 1R5HA 2UXXA 4MHGA 4IHTA 3LSTA 2HQAA 3BG3A 5EZGA 4FISA 5TISC 1POGA 1A31A 5HS9A 3ZMUA 2M5WA 2F5VA 5ICGA 1LJ9A 2E1OA 3I4NJ 1JJ8C 4L9TA 3SEZA 5BOXA 2MC4A 1P6RA 3GVAA 1KU3A 1ZGJA 5CLSA 3G1MA 2VONA 4PSXA 1I6HJ 3DV8A 3RIRA 2DOFA 3JRFA 2BY2A 1T2KA 3UKGA 3V42A 4BKXA 2X1CA 3O2PE 1FOWA 1IRGA 3I54A 1WSUA 4N4NB 3ZQIA 1V5EA 4BJTA 5L3BA 4M3EA 2L9SA 4L0YB 1YX3A 2LFBA 3TDZC 4CYCB 1X1CA 3GO5A 3IP4B 4XQFA 3ZQFA 2M9HA 3S32A 4E6KG 5J1UA 3AG3H 1X19A 4F3QA 5ICEA 2BY3A 2XDVA 1DGRM 2L9RA 3G4SI 1YYVA 3C2HA 5ILSA 4QTRA 3M7GA 1BC7C 2VKHA 3CJRB 3L2QA 1C0WA 3FMSA 2BEOA 2XIGA 4RLQA 5IP9J 1QQIA 2X6OA 4J00A 2MD5A 2XPWA 1VZ0A 4U7DA 1TL8A 1TWGJ 1T56A 5FD6A 1YW7A 4XNFA 2CQQA 3BTIA 2CO5A 3GBGA 1I50J 2V26A 2M34A 1J09A 3HIFA 4FASD 2H1LA 3PNTA 3GLXA 4AYBA 1KU2A 2WWYA 4CGZA 1IN7A 2PI0A 2EPFA 2HOAA 2XHKA 4NDLA 3EUAA 3BG9A 3CMAI 3IWFA 4ZYGA 2IT0A 4NNJA 2VJ5A 1U5TC 4PGGA 2HNHA 1YW9A 2CFXA 2IP2A 3HOSA 1KONA 1SEUA 2NOJB 2A3SA 3IC7A 4EJVA 5LLQA 4I0BA 3OYLA 2VPLA 1RESA 1SMTA 1O3QA 1GHCA 2WY8Q 3BR2A 4RS8A 3QYEA 2QENA 1Q1HA 2V6EA 2EJRA 1MH4A 1Y1VJ 2Q1ZB 2PJRB 1FNNA 2V1UA 4NUBA 1RR8C 3RZOJ 3VSKA 5DYMA 3LSHA 4CSWA 5KHDA 1WHUA 4PSWA 4I6ZA 4E7LA 2YU9J 1SFKA 2OAZA 2Z16A 2XSDC 3DKWA 1R6RA 4V2FA 3WGGA 4C3HJ 1WRJA 2QSFX 3CPZA 1R9TJ 2K9SA 3QWLA 3F8NA 3LSRA 3CCVI 2CJJA 3ZQLA 1MH3A 4XICA 4CZCA 2QWWA 2DFIA 4ZH4F 2M0MA 3I4MJ 1D0ZA 4PJLA 4R1HA 3BDDA 2DA7A 2LDUA 1XCBA 4NQWA 2JA8J 2W1OA 1OR7A 1WJCA 4EM1A 1EA3A 2P4WA 3CMYA 4NBQA 2E7XA 2QZ8A 4OAZA 4I99C 4IHWA 2M1BA 4AIJA
chains in the Genus database with same CATH topology
1XN7A 3TO6A 3OYIA 1W5TA 1SD4A 2O0YA 3F8MA 4KA4A 3EUHC 4G7OF 2ZXJA 1W5SA 4LFUA 2EWNA 2DQLA 4M9ZA 4LLLA 4MEYF 5TGTA 3MKWB 2CH0A 3LSGA 2HPMA 3SDBA 3HUGB 5FB2A 3HTSB 3KLOA 4K2EA 1U2WA 5JHUA 2R4GA 1NG6A 1UHMA 4XKCA 3TKYA 2XVCA 2VOPA 3ZXSA 3QAHA 5DD8A 2V6CA 5CJ9A 3OL4A 2DPDA 3GFMA 1Z91A 3IL2A 2ZFWA 4RGSA 5HLHA 2HVRA 5A2QZ 5EEGA 3GWZA 1WJFA 2A5WA 4YFXF 2CMPA 4UV8A 1OLTA 2HQNA 2R7RA 1N75A 4ESFA 4N9IA 4EJOA 2H6BA 4HPQA 3R61A 2IS4A 2X6YA 1TBXA 3HPHA 2IS2A 3ULQB 1XGNA 3UR3C 5DCMB 1WJEA 2OZUA 2GXBA 4BACA 4ESBA 1SAUA 3BPVA 1HXDA 3ERED 4O6JA 1HA8A 2JT1A 2FOKA 1LKXA 3V7CA 2QKLB 2ZMEA 2CFOA 5E20A 3OS2A 5H20A 3T5XA 4CDGA 3FBNB 4E70A 3KP4A 4RB1A 3MZYA 1V4RA 3LFKA 5D6FA 2ESNA 3M1EA 1PUEE 3DP7A 1IF1A 4B48A 1MNDA 1YG2A 4IQ4A 4F93B 3RQ4A 2VT2A 2JVHA 1S8NA 3ZQ7A 4ESJA 1U5TA 4KITB 3H9GA 1F1ZA 1YLFA 5J8FA 2FBHA 3W2AA 3FWEA 4G8XA 3HSRA 1I1GA 4XORA 2D2WA 1FSEA 3H92A 3E0JB 3QRFF 1ZRFA 1Z1DA 2LH9A 2P6SA 1K6OA 2CS3A 3U21A 1U5TB 4LK0F 3VYSB 5JR3A 2EFOA 4IJAA 5A2QK 2OD5A 4P9FA 4HAMA 2NS0A 1LVKA 5JVTA 3QP5A 3DEEA 4OINF 2F4IA 3OV8A 3OYEA 3RKWA 3F3XA 2WV0A 1OYIA 2ELJA 1LDKA 2LYCA 1KYZA 2Z99A 1MZBA 4KICA 2O6GE 4CCJA 1FMVA 1YS7A 3TBIA 2ISZA 2HPIA 2LY1A 2EFQA 2XAHA 5D5VB 4Y13A 3N97A 1AOYA 3W2VA 1FWZA 5ED4A 1KU9A 4LG3A 4L9VA 2M87A 4ZYDA 2L54A 2W84A 2C6YA 3CO7C 3DKYA 3V7RA 4KN4X 4ZDOA 2DLLA 1QU3A 3K4KA 2BGCA 4D0PA 2ZCWA 3U9GA 4P5OA 3BP8A 4HRIA 4ZZLA 2JTVA 4GGGA 5F6FA 1Z3YA 3REOA 2KIUA 1P4AA 2PJPA 4F92B 5DUIA 2XRNA 2VXDA 4B43A 3PNYA 4E7KA 2GZWA 5CVIA 1IN5A 3BCAA 2ZXHA 2W4SA 3V7SA 3KEQA 1ZRDA 3FZVA 1D8JA 5LHHA 3HL2A 3WTZA 2R7OA 1FY7A 3VB2A 5FLXZ 1N78A 2LY2A 1EH8A 2HZDA 1D0YA 3R60A 2E1MC 1EH6A 2KL4A 4OIOF 2DW4A 1BM9A 3L2CA 3M9AA 1TW3A 3M8FA 2VQGA 2IJLA 3D5SC 4NB5A 4Z2YA 5K5OA 3ONQA 4OOIA 1FP2A 3OMYA 2ZXIA 1IXSB 3CUQB 2VE9A 5J8CA 3IKVA 4RAYA 4A0ZA 2W24A 4LLGF 2W85A 3CTAA 2V1DA 4Y15A 3GFLA 2H6CA 2GOMA 2CSOA 3PUBA 4DIQA 3HSEA 3GF2A 1HW2A 3K4CA 3EDPA 4YELA 4B09A 4F55A 2P5KA 3S93A 2IGNA 1LB2A 4WX9A 1PDNC 1MDMA 2IGKA 2VQLA 4EATA 3HYIA 3Q9SA 5HLIA 3M8JA 3HPGA 3WTWC 3BLYA 3DPUA 1FP1D 5LRSA 4UVAA 4U7BA 3KE2A 3OYJA 4UVBA 2CV1A 2NNYA 4PJJA 2XF7A 5LRRA 2Y0MA 1Z6TA 2AXLA 2E5ZA 2W57A 2HDWA 2H94A 2R7XA 1BOBA 1BBYA 3QYFA 1LEAA 2VODA 1G3TA 2QBYB 2Z2SB 2VXZA 1LQ1A 3MQ0A 3QODA 2Y48A 1GXQA 3JW4A 3SZGA 4BYYA 3F72A 3KFWX 4PUSA 4ZDLA 1EH7A 3DTKA 4F52A 4HX7A 4OMYA 2PBIA 2WAQA 3BG7A 2FBKA 1S3JA 3K0LA 1P2FA 4G94A 3JSPA 1OKRA 3F8CA 3E3VA 2P7VB 1I5ZA 2IXSA 5LEKA 1XMAA 4BNCA 5LHGA 2Q2EB 1OPCA 4KT6A 1XGOA 2RDPA 2IGOA 2FNAA 2QLZA 3WE3A 3LA7A 3DTIA 2K02A 5E1WA 1G6NA 1Z9CA 4BQAA 3P9CA 2NYXA 1S7OA 1REPC 4D1QA 4PCQA 4NHJA 1V5FA 5CPRB 3FX3A 5CVRA 5CKTA 4KT5C 3LSIA 4XSXF 1BI2A 1E0EA 4OMZA 1BN5A 2VB6A 2VKDA 5IT9K 4HYEA 4LLNA 2X51A 4XR6A 1XCVA 3CDHA 3HRMA 1FC3A 2A6EF 5CYVA 3ECOA 2V79A 2DT5A 3L09A 4AVPA 2RNJA 2L01A 3J81K 3K70D 3V8JA 1ZLKA 4BXFA 2JSPA 1SD6A 4ITVA 3KYLA 3GX4X 3OS0A 3ZMDA 4KISA 1RUNA 1KQ9A 3COAC 3LQRA 4E7HA 3LMMA 3CF2A 2WZKA 3I64A 4HW0A 1W4MA 1WJAA 2KDOA 2HU9A 1ZLJA 2R7SA 1XSVA 1T6SA 3N05A 3V4GA 3OYAA 1BR2A 4EGZA 3CMMA 4PFOA 1MJ9A 2ISYA 4MQ9F 3H9JA 1DUXC 1W36D 2ZSHB 4APFB 5L3GA 4HEA2 2FE3A 3CP8A 3TO9A 2P0WA 4HOBA 3CUQC 4KJZA 5ICFA 1SFUA 2M30A 1TNSA 2BV6A 3C7JA 4Q5SF 4EMSA 2FXAA 2COMA 4IRHA 2XAGA 3K4BA 3WTXC 3WG9A 2ZKZA 3KEYA 5KCMA 4IF4A 1K78B 2X0LA 4RGXA 4BEHB 3T8TA 3ABUA 3F22A 3J80Z 3FMQA 1Z3XA 2AQFA 4AU7A 2VN2A 3TDUC 4Y33A 3GZ5A 3C1DA 3G2BA 1UAAA 2HKOA 3OYBA 4C2UA 4XLHA 4BL0B 1J59A 1S29A 3MEXA 1RI7A 2YU3A 2A6TA 2E7WA 1HKTA 1OYWA 4GCVA 1D0XA 1KA8A 2LG4A 1IN4A 1O3TA 1Z6RA 1J7KA 5BQTA 3DLAA 4OIQF 4AIKA 3L7WA 1ZARA 1KGSA 4XONA 2YX4A 2R7VA 5FFXA 2DK8A 4D9JA 2DOAA 1YO5C 1ON1A 2MABA 3GYHX 5BMZA 3AAFA 2XV4S 1PJRA 3VODA 3I5UA 1H0MA 2OBPA 3D5LA 2XKOA 4KUMA 5D5XB 1ZRCA 3F8BA 2XAFA 4EGYA 2ZJ2A 2FMYA 3WE2A 2A68F 4C30A 5FO5A 3DEUA 3CO6C 4BE0A 1LDKB 2MLGA 4L5IA 1HBXG 2VJIA 2MH2A 4ENMA 1FBUA 5L3FA 3BG6A 1O57A 2QQAA 2ZNYA 2NRAC 3BJAA 4EJTA 1TQMA 3FF5A 3BCBA 4ZTFA 2KIMA 2ACJA 4RLFA 3I4PA 1QZYA 3KZZA 3HRUA 3FHZA 2JZYA 4A0XA 4H0EA 3K6GA 5HOOA 3K4MA 2LRDA 5K5RA 2CQKA 3ISPA 1HSTA 3M1CA 3IWZA 4HDVA 1SFEA 1QHGA 2L3DA 3C3WA 1O3RA 3Q5FA 3OOPA 2EK5A 3I9V2 2BE5F 2OV7A 3E97A 3K1MA 2VJJA 3T1BA 1DP3A 2Z3YA 1G8XA 5DD4A 3W6JB 1GLNA 5E1ZB 1TT0A 2BOLA 2CV2A 4EJWA 2VT3A 1E2XA 2VL8A 1JGSA 3BOQA 5D4RA 3OYGA 4BH9A 3JTGA 5LGNA 1SAXA 2RVCA 4HA8A 4AP2B 5BPIA 3MCZA 4QWQA 3PFYA 3FBIB 3K1PA 4F7ZA 3L2UA 2K4JA 3OIPA 5DCMA 2VOOA 1Z7UA 2P6TA 3EETA 4DBQA 3ELKA 2O5RA 3VOEA 4HLYA 4LD5A 4M9XA 2QM3A 4JBAA 2M8EA 3CLOA 2KLOA 4HZFA 2P8TA 2HGCA 2KZVA 3RYPA 1SD7A 3OIQA 2FNPA 4YIIA 2DBBA 5ERIA 5IT9Z 1P4XA 1FYLA 1L3LA 1P92A 1F9NA 2IA0A 3WTUC 4IPAA 2IVMA 5D8KB 1BIBA 2PMHA 4UNOA 1T39A 3H35A 3E6BA 4BE2A 3K10A 3RJPA 3J81Z 3NWTA 5FGMA 4U0YA 3R4KA 3M8EA 1R58A 2P5VA 3A2KA 2OA4A 4AVZA 2W25A 1FMWA 2XAJA 2PN6A 3HTUA 2A07F 4OAYA 5HDGA 2LKPA 3ZMZA 3DF8A 2EFPA 3H3UA 5AIQA 3PL8A 3GFIA 3VSLA 5LGUA 4YIFA 3HOTA 1VTNC 1K79A 1IUYA 4BQOA 2STWA 1BI1A 1UB9A 2FUG2 2F5DA 1OYYA 2XGXA 4LGWA 2DQRA 3MFKA 4RM2A 2F2EA 5HS8A 4ON0A 1CF7A 4CH7A 2DPUA 4KYWA 1XSXA 2R7TA 4CCLA 4G9YA 1D8KA 1R7JA 5F1RA 4XN3A 3L2VA 1ZG1A 2M3AA 2MH9A 2KQRA 4BHCA 2XROA 5JHFA 3DU5A 3I53A 4XN0A 4ANJA 2M45A 1IRXA 3S3MA 2A5YB 3J80K 1B4AA 4CO8A 2HFHA 1I1SA 2BVMA 1F5TA 4XMYA 4LB5A 4GO1A 4U0WA 2DJIA 2GAUA 2VLAA 1FYMA 4KDPA 3QU3A 3HXLA 1P9QC 2L2OA 1TNTA 4FHTA 4EOZB 5TJJA 3KP7A 3QP6A 1LVAA 4PFPA 1K78A 4QLCU 2ZO4A 4Q4ZF 5LD2C 3E5QA 1IW7F 4HX8A 2HYFA 2MYSA 4CCKA 4L0ZB 3I71A 2Y75A 4LITA 2L4AA 1V3FA 3KZYA 4S04A 3DXJF 2PMUA 2E1NA 4XSZF 2YX7A 4HNUA 2YPRA 4FETA 1ZHFA 5E8GA 1MKMA 4G6QA 4HXIB 1USSA 2K4BA 3KX2A 1H9GA 4A64A 4XLCA 2OC6A 1ZG5A 1J5YA 4PZJA 2K9MA 1X1BA 4HF1A 3E6CC 3GEZA 3BPXA 4MLOA 2G7HA 5LEJA 3ZMTA 1R1TA 3R6SA 4E7IA 4TV7A 1W7PD 1ULYA 3IAM2 3DWLE 2XKPA 4II2A 3ZQQA 1ZN2A 5D8LB 4BAYA 5HLTA 1WFXA 2LBFA 4HDUA 2KJCA 3TMOA 3K69A 4UHTA 1ONVA 2CGPA 1IAWA 1WWXA 1SD5A 2ZFUA 2FQ3A 5E18F 3KEOA 3VYUB 4HLXA 3DPLC 1Z7LA 3H0DA 4HBLA 2CYYA 3SYTA 4BJ5C 3D0SA 4XLEA 3S2WA 3KP5A 2W00A 1PP8F 3RSNA 4ZYHA 4EJUA 2J5PA 3WTYC 5JFRA 2CUJA 1E17A 2MLKA 5CVUA 4CXFA 3ZP5A 4RMNA 1UG0A 2LBFB 2X1DA 4N0BA 1DPRA 1U8RA 2P7CB 3WTTC 2HVSA 3I3LA 1Z21A 2RN7A 2F6CA 2PMZA 1WI9A 1R00A 2MC3A 2O3FA 2R3SA 3EUHA 2V9VA 4IQJA 1J75A 5L3EA 4CUGA 1B9NA 1XD7A 3EQLF 2E1MB 2R7FA 3H3ZA 3WTVC 2OU2A 2XF5A 1WJDA 3PSFA 4WXCA 3AL0C 2M7AA 4BU2A 2LNBA 2X4HA 1LNWA 2OQGA 1ERDA 3FMRA 4MGRA 4ZDPA 4CHUA 4ETSA 3AKZA 2EB7A 3LFUA 1SFXA 4E7SA 3JAMK 1GXPA 2E5NA 2OQRA 4UXNA 4XBFA 4KFCA 5E17F 4E7JA 2LREA 4LG0B 1HSJA 4LIVA 1OMIA 2J5OA 3LAJA 3TOBA 1T0FC 2L9NA 4Y4RA 2MBFA 3I0TA 2CW7A 4OIPF 2KMUA 2EV6A 3GZ6A 5HNFA 4KN7X 4MQVA 4WCGA 1TZLA 1X1DA 3ZRGA 2AQEA 4WQOD 1TQIA 2XC7A 3L2WA 3BY6A 4A6DA 2BW3B 3K1NA 3VDXA 2QUFA 3R0JA 3FKJA 5EEHA 4FX0A 2V9KA 3RPUD 4I7HA 2TDXA 3EYYA 3LWFA 1HKQA 1V5GA 1FBQA 5E8IA 2PQ8A 3G3ZA 3DKXA 4CCOA 3PFIA 4IX7A 3HHGA 3T8RA 4LG0A 3WTSC 3IAS2 4Q48A 5DEQA 3F9KA 3FHNA 4XLFA 2B0LA 3GXOA 4GXOA 5H6RA 2EFNA 2JRTA 3WU0A 1LEBA 2PG4A 3EUKL 1XMKA 1NG7A 4I2OA 2G9WA 1XGMA 3W2WA 4DNCA 1O3SA 3GFJA 3JTHA 5AIPA 2KRFA 4L9NA 2I8DA 1YIOA 1MD0A 5LHIA 5LGTA 3BROA 2JPCA 4C9YA 4XKBA 3E6MA 5HLGA 2X6XA 4EM2A 2RGVA 1BOAA 3L9FA 2Y0SA 4CA0A 3HKZA 2XUBA 2HR3A 2RREA 2E60A 3IKTA 1MMDA 4BS9A 1FZPB 4BQQA 1DGWY 2D45A 4PK4A 1MJBA 1XDUA 5DUKA 2Z33A 4G7HF 3KLNA 2R7WA 3HG9A 2FMLA 3VYTB 2DI3A 1UELB 5ICCA 2XF6A 4I02A 3LA3A 4KIFA 1FLIA 2VE8A 2V1NA 2DTRA 1IXRC 1SMYF 2O03A 3PSIA 3VWBA 1J0RA 5CVVA 5FRMA 3ECHA 4R8HA 3OYCA 2KJBA 5KK1A 3KP2A 4EM0B 1X4PA 4PJNA 4HF0A 3HC7A 3JSOA 1T38A 1IN8A 3DU6A 4DJAA 3C2GA 1MJAA 1UCRA 2V4JC 4EVIA 3CJNA 3D5RC 4KIBA 3BJOA 4RM3A 3E6DA 4A12A 1XGSA 1S6LA 2EA2A 3K2ZA 4N9HA 2EV0A 2WAFA 5KVRA 4IVNA 2V1XA 2R7QA 2RV8A 4N9F3 1D1CA 3P9KA 3MAJA 3FXQA 4YEJA 2W82A 2AS5F 2JA2A 5K5QA 3OR2C 1TTYA 4M73A 1R5GA 1YW8A 3KETA 2WTEA 2K3PA 1UHWA 1BIAA 4R79A 3IRQA 1RUOA 2IW5A 1JE8A 4PJMA 2EFWA 3ZPLA 2PLYA 4XRFA 2VBYA 2XASA 3L2RA 4MNUA 2QQBA 4ZJZA 2JUGA 3F23A 1I6XA 2Z5UA 4UUVA 2WBMA 3QYBA 1T0FA 3F6OA 2ZNZA 1G3SA 3AL0B 1WJBA 1FPQA 1A04A 4G6DA 2GWRA 4CICA 1TW2A 2WY7Q 2NAZA 2HKXA 4HQMA 5BPDA 2RQQA 3IUOA 2G7UA 1YX5A 1YTYA 1AWCA 3CP2A 3K9TA 2YSRA 3WGIA 4I0AA 5DCFA 2DAOA 4U0VA 4OU0A 4U88A 1BJAA 1ZGAA 3TOAA 1QHHD 2PFBA 4ENKA 4AWXB 3N4MA 2KP6A 3MKYB 1D5VA 2WAEA 2FRHA 3OOUA 3J7AO 2BYVE 3JAMZ 4FX4A 3MD2A 2GIVA 3OY9A 1PYVA 1IRFA 2Z9OA 3BZ6A 2NNNA 1B9MA 1Y56A 2GXGA 3KP6A 2CV0A 2RC4A 4RAZA 2FSWA 1YE9A 4B3XA 2UUZA 2HEOA 1YFHA 2JSCA 3OYFA 3PJRA 2XAUA 4IHSA 3DPTA 4I09A 1KQ0A 2HQRA 3R0AA 3ZN0A 2MD0A 4F91B 4RB2C 1QNTA 4KMUX 2EA4A 2FBIA 4O5VA 3GW2A 3L00A 1DDNA 1O7FA 3OL3A 1EV7A 4GYGA 2ZBKA 3QPHA 3HHHA 1FOKA 3U1DA 4H4KC 4A0YA 2RKHA 5K1YA 2GOXB 1R36A 3RCOA 3LQQA 3RKXA 2UZKA 5HDNA 2F5EA 3SZTA 2BBYA 1Y0UA 3LSMA 2QVOA 2LF7A 2OUMA 1DP7P 3ZMSA 5D4SA 4XLPF 5D5UB 4BDZA 4NC7A 4EQQA 3MZHA 2QQ9A 2JVGA 2VC0A 3EPZA 3IHUA 3B73A 2A6HF 2L4MA 3OWTA 4G7ZF 2HTJA 1MMAA 5KNLA 5IT3A 5FLXK 2DK5A 1J2XA 1QZZA 2YR2A 1X4OA 1O7LA 4IZZA 1RNLA 2CW8A 4BQNA 3P9IA 1D3YA 1XB4A 3OYNA 4ENNA 2VBXA 3LSKA 1I27A 5CVJA 6PAXA 2MA3A 5LBQA 5AONA 3SEQA 2W7NA 4BHBA 2IA2A 1ZH5A 4HX4A 1KQ8A 4P9UA 1K7AA 2O61A 2CUZA 4G6TB 2KPMA 1KU7A 2L02A 3WODF 2Z1DA 2LSOA 3OYKA 3ABTA 1D1AA 3TGNA 3SFZA 3V8KA 1U6GA 5D5WB 3FDYA 3CUQA 2UV1A 4BEHA 4AD9A 4DQ2A 5LFAA 2Q0OA 1HW5A 3NRVA 4PDKA 3SQNA 4M72A 1WJ5A 1WQ2A 2UWMA 1LDDA 4HV5A 1XSDA 3ROUA 1BR4A 2X1EA 3K70C 3IRRA 1QO0D 3EYIA 1P4WA 5ILVA 4QPQA 1WKMA 4ZYEA 3RKYA 4EV0A 3HRTA 3H5NA 3QU6A 1ODDA 2WA0A 4MTDA 2KIFA 3B02A 4BDYA 3V8LA 2VBWA 1F4KA 4BXUA 4RB3C 3TO7A 3WGHA 2VBZA 4B44A 3SHFA 4Q47A 1NHAA 3PQJA 5FD5A 3E5XA 3NQOA 2ELHA 4LIUA 4IRGA 3OYHA 1GVJA 4IKFA 3H5RA 4Y17A 3ZCOA 4YG2F 3QPTA 2OZ6A 4DBRA 4JQFA 2IA1A 4XOTA 2HZTA 3WU1B 2K9LA 1ON2A 1LFPA 2ESHA 2ETHA 2GA1A 2DCEA 2K5CA 1U0JA 2L5QA 4NC8A 3DQVC 2PEXA 3E5UA 3PQKA 1B1BA 2VQHA 3NWSA 3I58A 3J7AY 5FRNA 4YRVA 2BW3A 2HWVA 2IRFG 4AIHA 1HQCA 4JK1X 2VJ4A 1OR7C 2RNGA 3W3CA 4JOMA 3HSFA 2CWEA 4O3MA 2X6WA 4PGHA 2GA2A 3MKZA 3ZGKA 2F5CA 2DU9A 2P5LC 2IS1A 5E1XA 5DDGA 4L9JA 1H9TA 3CJQB 1ZREA 2QYOA 3RPUA 2M4GA 1FT9A 4X0GA 3OS1A 3BC8A 2Q2EA 2L7KA 4I01A 4BE1A 4HQEA 5CQEA 4A5MA 4QPOA 1Z05A 4JGHD 2D1VA 1XDSA 3VFZA 2UXNA 4UVCA 3LL7A 3K4LA 3Q9VA 3QOEA 2A69F 4E4HA 4CZZA 4E7ZA 4CCMA 4LJZF 3O6BB 4M9SA 3LAPA 1PP7U 3RPQA 1FYKA 2Q8KA 5HNHA 4C2TA 1CGPA 2K86A 4IXAA 4L5JA 1W36C 4U87A 2EV5A 4ZTJA 5BS6A 4RGRA 4A6EA 3SXYA 4XOPA 1ZYRF 2VASA 1BR1A 1DPUA 1QBJA 2IPQX 3A1YA 4ZC3A 2R7UA 1DQUA 4L18B 4OWRB 4YFKF 4KNYA 5HS7A 4KMFA 4FT8A 3O3KA 3RYRA 3NEUA 4XL9A 3MWMA 5J6XA 2GQQA 1JHHA 1YQAA 1G3WA 1R23A 4NQWB 2DXIA 1AA7A 1IXCA 2ZMEB 3K4NA 1G3YA 4MEXF 1CF7B 4IRIA 3RTRA 5JI6A 3H5AA 2R7DA 1BI3A 4KIGA 4LB6B 3ZN1A 2STTA 1TLHB 4HG2A 3S3NA 2KKOA 3F6VA 4Y3OA 2VC1A 4CCNA 3HUGA 2WADA 4ZYAA 3PNVA 4DGWB 1FBSA 2QBYA 5D6EA 1G4DA 4XKWA 1IN6A 3P7NA 1STZA 4BGDA 3ZMVA 4S05A 4XM3A 5F64A 1LDJA 2IGMA 1BC8C 2V7FA 1BI0A 1W7PB 2D1HA 1U78A 4WWCA 5TRDA 2K27A 2HDCA 4BJ6C 5H6QA 3TL4X 1MGTA 1R1VA 4OIRF 1X1AA 3S8PA 1ZG3A 5HVQC 2H27A 4M74A 1HKSA 3BJ6A 1JXSA 4HSTA 1K6YA 3OR1C 4UV9A 3U2RA 1RIOH 2WC2A 5FFZA 4XLNF 1MMNA 2KRHA 1B6AA 1U3EM 1R22A 3A4CA 4XLAA 2ADUA 2DO7A 2IS6A 3FM3A 3ZR8X 4P1WA 2XAQA 4J01A 4BUPA 3ML6A 3I59B 2KRCA 2CW0F 2RQPA 4LMYA 2X85A 2HVQA 3AFHA 5HDKA 3DTEA 4II3A 1X3UA 4ENJA 2BVLA 4WK8F 4XKVA 3F21A 2XSJC 3KP3A 3LA2A 1TQPA 3OYDA 1JI8A 1ZAOA 2H09A 1USTA 3T0YA 4YFNF 1JHFA 5FROA 2CG4A 4GYIA 1MDMB 2KHMA 1QPMA 2M4KA 4ZZDA 3CESA 2HTSA 3CUOA 3S3OA 4B8XA 3K4JA 3DFGA 1L0OC 1YS6A 4RB0A 5CQGA 2MFZA 3I59A 3SZPA 1N77A 4P55A 3UNGC 1KYWA 2QKMB 2VQCA 3VEPA 1Y6IA 2FU4A 2VIXA 3TQNA 2HOEA 3W6KB 1W7PA 3E1SA 4DOZA 1T98A 4WF2A 1MMGA 5L3DA 2M7BA 3QOPA 2WB1A 3FM5A 2K7LA 1T95A 2HS5A 4M6XA 2DT7B 4HNTA 1QGPA 1MNEA 4RGUA 4HF2A 4HSRA 2JPBA 5ILUA 4M6YA 1S7AA 3H9QA 1D1BA 4LK1F 4N4OB 3F8FA 4ASNA 4A5NA 4WXDA 2DT6A 3CZ6A 2FEZA 1IZ1A 3FXUA 1S9HA 4B47A 3GUDA 3FXRA 1J9IA 3OYMA 4MTEA 1FSHA 3HRSA 2HYGD 2LC2A 3KCCA 1R1UA 4CYDA 2LF8A 2E1CA 1RZ4A 3G73A 4I98B 2PJRA 2LOOA 3RDIA