4P5OA

Structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3-e2~ubiquitin-like protein-substrate intermediate trapped in action
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
361
structure length
327
Chain Sequence
SKSPEELARYCDSLLKKSSKNPEEAELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLYTVQQLTDSTQIKMDILAQVLQILLKSKLPDTLIRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMRMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a RING E3 Trapped in Action Reveals Ligation Mechanism for the Ubiquitin-like Protein NEDD8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Cullin-1
total genus 96
structure length 327
sequence length 361
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4p5oA03
1.10.10.2620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4p5oA02
1.20.1310.10 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like Cullin Repeats 4p5oA01
2LKPA 1XGOA 4EJWA 2V1DA 5LEJA 4R79A 4HX8A 5BQTA 2P6SA 4ESJA 4CYDA 5ED4A 3GLXA 2GXBA 3P9IA 4F52A 1BM9A 2EFNA 4LLLA 3TO6A 2OA4A 4BAYA 3KEQA 3CJNA 2P7CB 3N4MA 1XB4A 3C18A 1SMYF 4YG2F 4HQMA 1OKRA 2J5OA 3KLNA 2UXXA 1FT9A 2XKOA 1FBSA 1LDJA 2E7WA 1PP7U 1SFUA 5DDGA 2PN6A 1IXRC 4IXAA 2FA5A 3G3ZA 1F5TA 2HQRA 1HKSA 2DW4A 4BHCA 4APFB 3GZ6A 2VT2A 2ACJA 1QPMA 3OV8A 4EVIA 3F6OA 3T5XA 3LQQA 2OAZA 2NAZA 1HBXG 2O0YA 5K1YA 1KGSA 2KJBA 2V6CA 4FX0A 4L0YB 2ZJ2A 3KETA 4QLCU 2V1XA 1W5SA 4M73A 3F8FA 3TOAA 3CUOA 2VODA 1B4AA 4BQAA 1YS6A 1U5TB 4PZJA 1STZA 3ULQB 1ZG5A 5D8KB 2WTEA 3CO7C 5CVVA 1WQ2A 4UVCA 4EM0B 1T6SA 3R61A 1DP7P 1B9NA 3ZQ7A 1IXSB 1GVJA 2G7HA 3B02A 1SFEA 5FO5A 2HR3A 3R60A 1P4AA 5DUKA 3T1BA 2D2WA 3TDUC 3K0LA 1ZH5A 1BBYA 1B6AA 2GA2A 4UV9A 2NNNA 1J75A 4KMUX 3ISPA 2DK5A 2R7DA 1TNTA 5LHIA 3MZYA 1YIOA 2HS5A 5DYMA 3FMRA 3J80K 4LB6B 3H3UA 1SAXA 2FEZA 4N9IA 2Z33A 1FP1D 1L3LA 2P8TA 2KIFA 4HZFA 4ENNA 1K6OA 4N0BA 3T8TA 3KEOA 4G94A 1MGTA 2KJCA 2M45A 2CW0F 4G9YA 1WSUA 3WGIA 3R4KA 2M30A 3GWZA 2KIUA 2FMLA 4OIRF 3FM3A 2V79A 5L3CA 2E1CA 4LGWA 3LSTA 1H9TA 3I53A 5FD5A 1BI1A 3JTGA 3S2WA 2Y75A 2C6YA 2STTA 4CZZA 1QO0D 1Z7UA 2FNAA 1D5VA 1WKMA 2IW5A 2DU9A 2O03A 1TLHB 3LA3A 1BIAA 2V9VA 5JHUA 4U7DA 5IT9Z 5FLXK 5H6QA 3KP4A 5LRRA 4KUMA 5A2QZ 1OMIA 3BOQA 1T0FA 2H6CA 4EJVA 3R6SA 3BJ6A 3WGHA 1YQAA 3WG9A 2QWWA 3VODA 3I58A 4HV6A 3JW4A 3D0SA 3J81Z 1UHWA 1BI2A 4RS8A 3E5XA 3E6DA 5L3EA 3ZMDA 1UB9A 1ZAOA 2YSRA 4RGSA 2FMYA 5CYVA 4N9HA 3QPTA 2V1UA 1ZARA 1H9GA 2A07F 3QP6A 5H6RA 2W25A 6PAXA 1XDUA 1ULYA 3L09A 2FXAA 2QM3A 4KFCA 2M87A 1LVAA 3TO7A 4AIHA 4PGHA 2RVCA 3HTUA 4I7HA 5E1WA 1LEBA 3H3ZA 4UHTA 4ZYDA 3G73A 5EEGA 1XN7A 1ZGAA 2LDUA 2QVOA 3DEUA 4IPAA 4LFUA 2CG4A 2L4AA 3L7WA 4EJTA 2XAHA 5LLQA 4NHJA 2YR2A 1F1ZA 2D1HA 3U9GA 1LJ9A 3E6MA 4LLGF 4OIOF 1G3SA 4YFKF 1UHMA 4XLNF 3QPHA 1VTNC 2P4WA 5D4SA 1OYWA 4YFNF 5J8FA 4FT8A 4CXFA 2CWEA 1P92A 4MNUA 2A61A 1W7PB 1REPC 3KCCA 5L3FA 2WZKA 4L9TA 5J6XA 2ZBKA 2BV6A 1CF7B 2W85A 4YFXF 1ZG1A 3BPXA 5KK1A 1ZGJA 3B73A 4LG0B 4LLNA 2E1NA 2VXZA 2MD5A 5HLHA 3WGGA 1F9NA 2XHKA 4YIIA 4EQQA 3GXOA 3BY6A 2XV4S 4TV7A 4Y13A 3SHFA 4G7ZF 1QGPA 1I1SA 4BHBA 3GF2A 2GAUA 4UVBA 4Y17A 4P9FA 4XLPF 3IKVA 2OU2A 3KP6A 4KA4A 2AXLA 3F23A 2Y48A 5LGNA 5D4RA 1EH8A 1ZYRF 4KNYA 2YX4A 2HKXA 5AIQA 2PI0A 2XGXA 3IC7A 1ZRDA 1RIOH 5DD8A 2DAOA 3VB2A 3JTHA 3VEPA 4ON0A 2RV8A 4MTDA 4R1HA 1B59A 3HRTA 3KE2A 3F22A 2NNYA 3W6KB 5DCMA 3ZMZA 2YPRA 1SFXA 5HDKA 4ASNA 2OD5A 1KU9A 1GXPA 2RKHA 2GWRA 4L5IA 2MA3A 3WODF 2HTJA 3K1NA 2CGPA 4PCQA 2EB7A 2P6TA 4MEYF 2IVMA 3C7JA 1U5TC 3ZMVA 2Z9OA 2DI3A 3CLOA 4IRGA 5D6EA 2AS5F 1I5ZA 1ZLJA 2BBYA 1CGPA 1IN8A 2CFXA 3ZMSA 2KIMA 1BN5A 1OYIA 2DTRA 4L9JA 3T8RA 4PDKA 4AIJA 5HS7A 3SZPA 1YW9A 1P2FA 2JPCA 2H27A 3WTUC 1WWXA 2HZTA 2EFPA 3I64A 2EFOA 1F4KA 3RPQA 3KP7A 1R5HA 1EH7A 3KLOA 3WTTC 1W4MA 1DPRA 3KFWX 4P96A 2DPUA 1FNNA 1XGMA 1G3WA 4CO8A 3BP8A 5AONA 4XBFA 4KIFA 3EQLF 3CUQA 4UXNA 2ADUA 3EDPA 3WE3A 2VOPA 1MKMA 2VT3A 2LSOA 1FBQA 4HXIB 2ZFWA 1T38A 4IHTA 3Q9VA 3TQNA 5E20A 3ZMTA 3QU6A 5DCFA 2XUBA 2HOEA 1Z9CA 1S7OA 2ZKZA 3D5LA 4HX7A 2K27A 3OOPA 3ROUA 1S29A 3JAMK 5LGUA 1KYZA 1XCBA 1R58A 4R8HA 2JT1A 1HKQA 2VBYA 3FX3A 3T0YA 4F7ZA 1U5TA 4HDVA 1HSJA 5J8CA 3M8FA 2F5CA 4MHGA 4RGXA 2XVCA 2RDPA 3C1DA 2ETHA 4EGZA 2QBYB 2Q8KA 4OMYA 5E8GA 3RJPA 3I71A 1SD5A 4IVNA 1ON1A 5A2QK 2QQBA 3SFZA 2L4MA 3M7GA 2P5VA 1C0WA 3WTVC 3DKWA 3C3WA 3QU3A 4KICA 3KZYA 2ISZA 4Q47A 1TW2A 2B0LA 1AWCA 2FQ3A 1DDNA 4EJOA 4MQ9F 4ESFA 3J7AO 1O7LA 2K7LA 4WXHA 1FYMA 1YG2A 3EETA 2EV0A 3IHUA 5D5XB 3K1MA 3TO9A 2Q2EA 3V7CA 4HDUA 3ABUA 5CVIA 4RGUA 4ZYEA 4G7OF 2K4BA 2OZ6A 1KQ9A 3E5QA 3BDDA 2EJRA 1LDKA 4M9ZA 1ON2A 4WXDA 4EOZB 1TTYA 1JE8A 3PQJA 3IL2A 1BI3A 3ML6A 1RI7A 3DPTA 2VBZA 4KT5C 1K79A 2W57A 3F8CA 2VBWA 2P5KA 1IRGA 2HTSA 1QQIA 3WTSC 4JGHD 3NEUA 1IRFA 4MTEA 4RGRA 1IN5A 4Q5SF 1PP8F 1TBXA 4HF0A 2DBBA 2DLLA 3GFJA 4WF2A 4WX9A 3ZP5A 2H6BA 2UWMA 1ZG3A 2F5EA 4IJAA 4WQOD 1B9MA 2A5YB 2KRFA 5HVQC 2FU4A 2MH9A 4HLXA 3V8JA 2DPDA 3ECOA 1K78B 4A12A 1SMTA 1IN6A 3GFIA 1FYLA 1QBJA 4IF4A 5DCMB 4U88A 4EV0A 1S3JA 2KKOA 2WC2A 4Y15A 1MD0A 2G7UA 4BYYA 5LHGA 1V4RA 3MCZA 2IA0A 2FBIA 3TOBA 1LEAA 4ESBA 1AOYA 2L01A 5H20A 4A6DA 4A0YA 2HEOA 4MQVA 5L3GA 2EA4A 4HF1A 3QP5A 1SD6A 1USSA 1UFMA 2XKPA 2Y0MA 5L3DA 2MH2A 2XAQA 3FWEA 1MDMB 2XAFA 3PFIA 4RB3C 3IKTA 3LFKA 1G6NA 5CJ9A 3NRVA 2LF7A 3HOSA 4BNCA 3HSFA 1B1BA 3I54A 1KQ8A 2R7FA 3O2PE 5E1ZB 4JBAA 1Z1DA 2IJLA 4L5JA 4OU0A 1YLFA 2R3SA 4M9SA 4GO1A 1XDSA 3V4GA 3P9CA 3ZN1A 1XGSA 3R0JA 4CICA 4M72A 1Z05A 2HYGD 2O8XA 1IAWA 2FBKA 3F72A 3BROA 3RPUA 1O3RA 3Q9SA 3HUGA 3I0TA 1D8JA 1QZYA 2ZCWA 2HFHA 4G6QA 2JRTA 2HKOA 3CUQB 1BI0A 4JK1X 2FSWA 2QLZA 4CHUA 1IF1A 1IXCA 1T2KA 2A68F 3MZHA 3KP2A 3ZN0A 2FOKA 3M9AA 1EV7A 1FBUA 2ZMEB 5CVRA 3H92A 1S7AA 5BPDA 3WU0A 1R1TA 4WK8F 3I5UA 2PG4A 3MWMA 2QUFA 4L9VA 4L0ZB 5LBQA 3HHHA 4P55A 5KVRA 5ICEA 2ESHA 2OBPA 2OQGA 1Z91A 1KYWA 3RKXA 4A0ZA 4U7BA 3VOEA 3PQKA 2EWNA 2CO5A 4M71A 2MLGA 4GYIA 4KMFA 1T39A 1LDDA 3HYIA 5D6FA 2F5DA 5F1RA 2NS0A 3HIFA 1MJ9A 5LRSA 1SD4A 5FD6A 2NRAC 3F8BA 1U3EM 1R1VA 4LD5A 5D5WB 1HXDA 3VFZA 1O3SA 1J9IA 1IN7A 1TQPA 1TNSA 2FF4A 2RNJA 3GEZA 1FC3A 5D5VB 2A69F 4UVAA 1W7PA 2PQ8A 1NHAA 3E6BA 4UNOA 5FFZA 2EK5A 4U0VA 3F3XA 3WTWC 1UCRA 3M8EA 3K1PA 1P4WA 2QENA 3HOTA 4BXUA 1J2XA 2K02A 4CGZA 1USTA 2D45A 2VC0A 4S04A 2HGCA 3I59A 5BOXA 4P5OA 5D8LB 3LWFA 1FSEA 1IN4A 1ODDA 1J5YA 3E5UA 3BWGA 1HQCA 5EEHA 4XSZF 2M8EA 4I98B 4AIKA 3FXQA 4M6XA 3O6BB 2Z3YA 1TQMA 2OZUA 2RC4A 3FZVA 2CSOA 3QAHA 4KIGA 1JGSA 4A2UA 1R22A 2ESNA 4AD9A 4RAZA 2PEXA 3FMQA 3WE2A 1XCVA 4YIFA 3EYYA 5BS6A 2GZWA 2Q0OA 3FF5A 2UXNA 3REOA 4NB5A 4KYWA 3WU1B 3QOPA 1RNLA 5TRDA 5ERIA 4HA8A 1TW3A 4I0AA 3NQOA 3R0AA 4LK1F 3L9FA 1YTYA 1D3YA 1ZRFA 3J81K 2PMHA 4EJUA 3HTSB 5HLGA 3IWZA 5DV5A 3U2RA 2J5PA 4LJZF 1BC7C 3HRMA 1YW7A 2LF8A 1GHCA 2IPQX 2JSCA 4RB2C 3RI4A 2PFBA 1G4DA 1U78A 4WWCA 1D8KA 2IRFG 4ENJA 4P9UA 3M1EA 1HW2A 3E3VA 3ELKA 2L3DA 2WV0A 4AP2B 1I27A 4HAMA 2FE3A 2NYXA 3GX4X 2XROA 4WXCA 3EYIA 2CQKA 4A5MA 4O6JA 2ZNYA 3DV8A 3F8NA 3AAFA 3CUQC 4O5VA 3J80Z 5LEKA 5E1XA 2IT0A 1OR7A 4LB5A 1P6RA 4I2OA 5F6FA 2P5LC 1E2XA 1LDKB 1HW5A 1H0MA 1IZ1A 4G8XA 2F5FA 2DFIA 4HQEA 4GCVA 2YX7A 3BJOA 3DFGA 3I4PA 3MQ0A 2BYVE 3HHGA 2RQPA 5E8IA 5DUIA 1LQ1A 5FFXA 2RGVA 2Z5UA 1R1UA 3V8LA 1R00A 3E6CC 5BPIA 1KU3A 2Z99A 1JHHA 5IT9K 3LA2A 3Q5FA 3F6VA 3BPVA 2EFWA 4KN7X 2PMUA 3HSEA 3ZPLA 5ICGA 1JHFA 4EM1A 4LG0A 3V7RA 1QNTA 4HX4A 3WTXC 4GYGA 1S6LA 4XRFA 1L0OC 4AVPA 3SZTA 1QZZA 2W24A 1O57A 4M6YA 4EMSA 2YU3A 3RKWA 1SD7A 2QZ8A 2GXGA 3GFMA 5CLSA 1HSTA 4GXOA 1K78A 1O3QA 1W5TA 1XMKA 5BMZA 3FM5A 1K7AA 3F21A 5FLXZ 5HLIA 5HS9A 1V3FA 2IA1A 3L00A 2X4HA 1LB2A 1O7FA 1FZPB 2FRHA 4ETSA 1ONVA 3FMSA 3RDIA 3GZ5A 1I6XA 5ILVA 1FOKA 4KIBA 1U2WA 3CDHA 3QRFF 1P4XA 2TDXA 3EUHA 2GIVA 5CVJA 2QQAA 2H09A 3LQRA 1YW8A 4IRIA 2VOOA 1KA8A 2A6HF 2K4JA 1BC8C 5ICCA 1OPCA 3WTZA 4U0WA 2DK8A 3V8KA 1J0RA 4A5NA 2M5WA 2EV6A 2XAGA 5K5QA 5E17F 4EM2A 3HRUA 4UV8A 5HS8A 3WTYC 4HW0A 4NQWA 3RYPA 4K2EA 1HW1A 3GW2A 4G7HF 1DPUA 5DD4A 4L9NA 1ZHFA 3TDZC 3W6JB 5DEQA 4I01A 4UUVA 2IP2A 2VC1A 1YYVA 3BJAA 2EFQA 1KU2A 3GFLA 4D0PA 2HDCA 1G3YA 2O61A 1WI9A 1ZLKA 3TKYA 3FHZA 5CVUA 4WCGA 4HYEA 1HKTA 1Z6TA 3GO5A 3O3KA 1ZN2A 4U0YA 2STWA 3ABTA 2FNPA 3LAJA 2DQLA 2UZKA 2VE9A 4KDPA 3LAPA 5JR3A 3GUDA 4HV5A 3DXJF 1IW7F 4RAYA 2OQRA 4H0EA 4EGYA 3DF8A 2L02A 4ZZDA 3ZMUA 4HLYA 5JFRA 1MJBA 1DUXC 1U8RA 1XSXA 2VE8A 3CO6C 1RZ4A 2G9WA 5JI6A 1EH6A 2A3SA 2MLKA 2A6EF 4OOIA 1R23A 1KQ0A 2PLYA 5HOOA 1BOAA 1FWZA 2ELHA 4O3MA 3K69A 3V7SA 5LHHA 4HOBA 2VN2A 3P9KA 2W84A 3MAJA 2EV5A 1XGNA 1Y0UA 2ZXJA 4XSXF 3HSRA 2JPBA 3F8MA 1T98A 3IWFA 4MEXF 4A64A 2BE5F 4DQ2A 3KP3A 4E70A 2DQRA 1J59A 1RUNA 2ZNZA 2QYOA 3ECHA 4M74A 2L54A 3K9TA 1FYKA 2QBYA 3N97A 3HRSA 1TQIA 2D1VA 2XRNA 2GA1A 4FHTA 3SXYA 4AWXB 2RN7A 2XASA 2BEOA 2IA2A 5HDNA 3RKYA 3E97A 1RUOA 2COMA 3FXRA 4Q48A 1MJAA 1FX7A 5ILSA 1R5GA 4BHPA 5L3BA 1W7PD 5K5RA 1CF7A 1WRJA 4BH9A 1Q1HA 2XAJA 1XMAA 2MBFA 4GGGA 4ENMA 3DP7A 4G6DA 2HQNA 5F64A 1R7JA 3JSPA 3MEXA 1XD7A 4B8XA 2QQ9A 5ILUA 2H94A 2F2EA 2HYFA 2GQQA 4ZYGA 2K86A 2E7XA 1U6GA 5FGMA 4LK0F 5FB2A 3KP5A 2PBIA 2BGCA 2X0LA 1A04A 2XIGA 2VONA 1FSHA 4Z2YA 1YFHA 3RYRA 5K5OA 2EA2A 4ENKA 3TGNA 2PJPA 3DPLC 3P7NA 4HBLA 1MDMA 4I02A 5JVTA 1S8NA 1MZBA 4I0BA 4QWQA 5D5UB 1FY7A 4HF2A 3CTAA 1E17A 1KU7A 4PGGA 1IUYA 4OIPF 1OYYA 4ZZLA 4I09A 2O3FA 1X3UA 3ERED 3K2ZA 5AIPA 4B09A 5HDGA 4MGRA 1FLIA 1XSVA 3I59B 1JXSA 3RIRA 4RB1A 2ZMEA 4M9XA 1PDNC 2DT5A 3SQNA 1J7KA 4JQFA 4FX4A 2LNBA 5IT3A 4A0XA 4DNCA 1G3TA 3RTRA 5ICFA 1BJAA 3IRRA 3GVAA 3COAC 5TJJA 1ZREA 2WWYA 2FBHA 4LMYA 3JSOA 3U1DA 2HWVA 1YS7A 1R36A 4IHSA 1BIBA 2DO7A 3MFKA 1YO5C 1I1GA 3LA7A 2JZYA 1ZRCA 2MC3A 2CYYA 4A6EA 3FXUA 4Q4ZF 4L18B 3JAMZ 3KZZA 1FPQA 4N9F3 1LNWA 2VBXA 3BZ6A 1Z6RA 2P7VB 4KN4X 4OIQF 4ZYHA 1O3TA 4CDGA 4ZH4F 3GYHX 3IRQA 5LGTA 1PUEE 4IRHA 1XSDA 1FP2A 1GXQA 2O6GE 2M1BA 3L2CA 4S05A 4RB0A 2JTVA 3DQVC 2ZO4A 4OMZA 4OINF 2ISYA 5E18F
chains in the Genus database with same CATH superfamily
2LKPA 3ZQGA 1XGOA 4NBQA 4EJWA 2V1DA 5LEJA 1RC9A 4R79A 4HX8A 5BQTA 2P6SA 4ESJA 2ELKA 4CYDA 5ED4A 3GLXA 5B3SH 3DBRB 4BUPA 2GXBA 3P9IA 4F52A 3OYLA 2CUZA 4IHVA 1BM9A 2EFNA 4LLLA 3TO6A 2OA4A 3AG4H 2Z1DA 4BAYA 1BA5A 3KEQA 4HNTA 3CJNA 2P7CB 4QPQA 3N4MA 1XB4A 3SJMA 4PJMA 5GP9A 2JUGA 3C18A 1SMYF 4YG2F 3PO3J 3G6EI 4B48A 2EIJH 1BOBA 4HQMA 1JUMA 1OKRA 2J5OA 3KLNA 4H4KC 2JA2A 4M3DA 2UXXA 1OFCX 1JKPC 4ANJA 1FT9A 2O8KA 1I39A 2XKOA 3CQZJ 5TGTA 2VJ4A 1FBSA 1LDJA 1OJLA 2E7WA 1PP7U 1SFUA 3FXOA 4ITVA 1Y0NA 5DDGA 2PN6A 1IXRC 4IXAA 4V2GA 4NC8A 1OLTA 3PJRA 1UAAA 2FA5A 3G3ZA 1F5TA 2HQRA 2MGQA 1HKSA 2DW4A 4IHXA 4BHCA 4APFB 5IPAA 3GZ6A 2XGDA 1T0FC 1I6HJ 3ESWB 2HPIA 2R7RA 3W2WA 3MD2A 3TBIA 2OTLI 2CMPA 4RAFA 2VT2A 5KHDA 2ACJA 1QPMA 3BG6A 1Z7LA 1R49A 3OV8A 2M7BA 4GFBA 3A02A 2NOJB 4EVIA 5B5EC 2K40A 3F6OA 3LQQA 4P1WA 3T5XA 2OAZA 2NAZA 3FHNA 1HBXG 2VXDA 2DCEA 2O0YA 4N4NB 5K1YA 1KGSA 2KJBA 1YX3A 1VNDA 3JREA 2V6CA 4FX0A 3CDLA 4L0YB 2ZJ2A 3H9JA 4QTRA 3KETA 5GAEJ 4QLCU 2V1XA 4JYKA 1W5SA 4M73A 2LOOA 5EJCA 2E1MB 3F8FA 3TOAA 3CUOA 3GTPJ 2VODA 1B4AA 4BQAA 3U1KA 2KISA 2LP0A 2DFEA 1YS6A 1U5TB 4PZJA 1STZA 3ULQB 5JHFA 4PFOA 1ZG5A 5DM6F 5D8KB 2WTEA 2LR8A 1IRZA 3CO7C 2VUMJ 5CVVA 1WQ2A 1SVLA 2CW8A 4UVCA 4EM0B 1T6SA 1OCOH 4XLCA 2O9LA 4XN3A 3R61A 2GLOA 1DP7P 4EATA 1B9NA 2KMUA 1PJRA 2ID6A 3ZQ7A 1IXSB 1GVJA 3FXJA 4GDFA 1SANA 3JCUC 2G7HA 1G8XA 3B02A 1SFEA 2H1KA 5FO5A 2HR3A 1SVMA 1P4AA 2QF7A 3R60A 5DUKA 3T1BA 3TL4X 2D2WA 3TDUC 3K0LA 1ZH5A 1BBYA 1B6AA 2GA2A 3CPZA 2KHMA 2HNHA 2VKDA 4IHWA 4UV9A 2NNNA 1J75A 5JLXA 5K7HA 3IV5A 4KMUX 3ABMH 3ISPA 2DK5A 1NG6A 2R7DA 1TNTA 5LHIA 3MZYA 1YIOA 2HS5A 5M3FJ 5J47A 5DYMA 3FMRA 4Y4RA 2IS4A 3J80K 2K9SA 5IOYA 4LB6B 3H3UA 1SAXA 1S72I 2FEZA 4N9IA 1H88C 2Z33A 1FP1D 1L3LA 2P8TA 4M6VA 2QQ8A 2KIFA 1NTCA 4DJAA 3BR1A 3H9GA 3A1YA 4HZFA 2CUEA 4ENNA 1K6OA 2GXAA 2CJJA 5HNFA 4N0BA 3T8TA 3KEOA 2F4OB 4G94A 2R5ZA 1MGTA 2KJCA 4NDLA 4ZDLA 2M45A 5GADJ 2CW0F 3CDIA 4G9YA 2L7ZA 2XPWA 1WSUA 2RAEA 4UY8I 5DTDA 3WGIA 4ZTFA 2Y30A 3R4KA 1K6YA 2M30A 3GWZA 2KIUA 2FMLA 4OIRF 3TEDA 3FM3A 2V79A 5L3CA 2E1CA 2VASA 1FIPA 4LGWA 2QEXI 3HOZJ 3OSGA 3LSTA 1H9TA 1POGA 3QYFA 2R5ZB 3I53A 2NVTJ 1GV5A 1SVOA 1JKQC 5FD5A 1BI1A 3JTGA 1RR7A 3S2WA 2Y75A 1PYVA 2C6YA 2STTA 3FKJA 4AM3A 2CUJA 4CZZA 4BL0B 1QO0D 1Z7UA 2FNAA 1D5VA 1WKMA 3IAM2 1OCPA 2IW5A 1E3HA 2DU9A 2O03A 1TLHB 3HPGA 3LA3A 3QYBA 4DZJA 4CYCB 2HQAA 3U21A 1BIAA 4C30A 3DBLB 2V9VA 5JHUA 4U7DA 3CMMA 5FLXK 2XGCA 5IT9Z 1GT0C 5H6QA 3HB9A 2NVXJ 3KP4A 2B7EA 5LRRA 4KUMA 4DBQA 5A2QZ 2E2HJ 5B1AH 1OMIA 2NS8A 4ZDOA 2JN6A 3BOQA 3W2AA 1V55H 1XPXA 1T0FA 3QQAA 2H6CA 5IYDJ 1WFXA 4EJVA 3R6SA 3OYKA 3A2KA 3BJ6A 3WGHA 1YQAA 5E3OA 3FBIB 3WG9A 1FTZA 2QWWA 1D1AA 3J7AY 3VODA 3I58A 4HV6A 3JW4A 3CJRB 4PJ0C 3D0SA 4KITB 1SEUA 3J81Z 1UHWA 3OSFA 1BI2A 1UG2A 3G2BA 1ETKA 3E5XA 1ZKGA 4RS8A 3E6DA 2E35A 5L3EA 2LD5A 4II2A 3AL0C 4QIWN 3ZMDA 1UB9A 2OUMA 1ZAOA 2YSRA 3BR5A 4RGSA 2EQRA 1YIJI 1I3QJ 2FMYA 2YUSA 3LMMA 5CYVA 4XR6A 4N9HA 2BY1A 3QPTA 4XQFA 2V1UA 1QU3A 1ZGWA 1TP4A 4NC7A 1GDTA 1ZARA 1H9GA 2A07F 1RPWA 3QP6A 2LREA 3A4CA 5H6RA 2W25A 6PAXA 1XDUA 3BTJA 4XOPA 1ULYA 3L09A 2FXAA 2QM3A 4KFCA 3FXKA 2M87A 1LVAA 3TO7A 3JRDA 4AIHA 3W2VA 2X1DA 4PGHA 2RVCA 3HTUA 4I7HA 5E1WA 1LEBA 3H3ZA 3LSRA 2EINH 1W36D 4UHTA 3ZQQA 2BY0A 3NAUA 1O4XA 1Z77A 4A3CJ 2NS7A 4JP0A 4HEA2 5FKLA 2R5YA 4BDYA 1RETA 2L0KA 4ZYDA 2X1CA 3G73A 5EEGA 2DA7A 1XN7A 4XORA 1ZGAA 4C3JJ 1ETQA 2BW3A 2LDUA 4NQWB 2QVOA 2R92J 3CP8A 1T8IA 1BJZA 3DEUA 2ZSHB 4IPAA 4LFUA 2CG4A 2L4AA 3K2AA 4V19K 2CFOA 2CQ7A 3K7AJ 3L7WA 4LITA 5B1BH 3FIWA 3HC7A 2GM4A 4EJTA 1YI2I 4HPQA 5LD2C 2XAHA 5LLQA 3JR9A 4NHJA 3TP0A 2YR2A 1F1ZA 3PFYA 2EZKA 4LIUA 2D1HA 3U9GA 1LJ9A 3E6MA 1X58A 1IV6A 2LLKA 4A3LJ 5F3JA 4LLGF 1E3OC 4X1EA 3L2UA 1G3SA 4OIOF 4YFKF 3GTKJ 4XRSG 1UHMA 4XLNF 1P7IA 2VQGA 3QPHA 4AC0A 1VTNC 2P4WA 2IBDA 1X2NA 1ZK8A 5D4SA 3OS0A 1OYWA 3S3OA 4YFNF 4XLFA 5J8FA 4DIQA 4FT8A 2DOAA 4CXFA 4BE0A 2CWEA 2Y31A 1P92A 1JGGA 3HGGA 3S2HJ 4MNUA 2F48A 2A61A 1W7PB 1REPC 3KCCA 5CKTA 5L3FA 3OYHA 2WZKA 4L9TA 5J6XA 1MBHA 2ZBKA 5DM7F 2BV6A 1Z0XA 3VYRB 1CF7B 2W85A 4JOMA 4MFEA 2MYSA 3S93A 3CCUI 4YFXF 5GPCA 1ZG1A 2MC4A 3BPXA 2KIQA 5KK1A 1ZGJA 2VL8A 3B73A 2OJED 4LG0B 3CC4I 4LLNA 2E1NA 2VXZA 2MD5A 5EYRA 3VYTB 4RA2A 3OMYA 4XM3A 5HLHA 3IH3A 3I3LA 2GOMA 4AUXA 4B47A 4NUVA 3WGGA 1F9NA 4X0GA 2XHKA 4YIIA 4EQQA 3GXOA 3OIPA 4J00A 3BY6A 2K5CA 1TZLA 1X3ZB 5F0CA 1Z67A 1E0EA 2XV4S 4TV7A 4Y13A 3CLQA 2WY8Q 3SHFA 1QGPA 4G7ZF 1I1SA 4BHBA 5F0FA 3GF2A 4AYBN 2GAUA 4UVBA 4Y17A 4P9FA 4XLPF 1SAUA 3IKVA 3HG9A 1VQ7I 1VQ5I 2OU2A 3KP6A 4KA4A 1K4TA 2AXLA 3F23A 2Y48A 2V7FA 5LGNA 1B72A 5D4RA 5GTIC 1OCTC 4A3JJ 1EH8A 3G71I 2DTZA 3MKZA 2KFDA 1ZR2A 4IEJA 1ZYRF 4KNYA 4IHYA 2YX4A 4GRIA 3VSLA 4I99C 2HKXA 3NWTA 2M0CA 5AIQA 2PI0A 2XGXA 3IC7A 1ZRDA 3PNVA 2E2IJ 3SDGA 1RIOH 1LKXA 5DD8A 2DAOA 3VB2A 2ZXWH 3JTHA 3VEPA 1PUFA 2E36A 4ON0A 5EF6A 1FIAA 2RV8A 2LFBA 4YRVA 4MTDA 4R1HA 1B59A 3HRTA 3KE2A 2XPVA 3F22A 2NNYA 3W6KB 4PSXA 3BT9A 5DCMA 3ZMZA 2YPRA 2XF5A 4Z6YA 2UUZA 4XLAA 1SFXA 1IJWC 2M4GA 3E7LA 5HDKA 1QZEA 1W5CC 2E1OA 4ASNA 1JKOC 3DKYA 2L7MP 1KU9A 2OD5A 1GXPA 2RKHA 3OR1C 2GWRA 2BXYA 2LVSA 4L5IA 2MA3A 3WODF 1QA6A 2HTJA 3K1NA 2CGPA 2DN0A 3S1NJ 3VYSB 3DU5A 4PCQA 2EB7A 2P6TA 4MEYF 2IVMA 3C7JA 1U5TC 3ZMVA 1MSFC 2Z9OA 3K70D 2IS2A 2DI3A 2ZJQF 2DOEA 3CC7I 3CLOA 3HXLA 4IRGA 5D6EA 2AS5F 1I5ZA 2CW7A 1ZLJA 2BBYA 2E5ZA 3K4CA 3WHBA 1M1EB 4PFPA 1CGPA 1IN8A 2CFXA 2WAEA 3ZMSA 1QHHD 2KIMA 1BN5A 1OYIA 2DTRA 3W3CA 4L9JA 4C2TA 3S2DJ 3T8RA 4PDKA 3OL4A 1WJ5A 3BR3A 5HS7A 1FMVA 4AIJA 3SZPA 1YW9A 1P2FA 2JPCA 3KIOA 2H27A 2G0EA 4PJNA 3DTIA 3WTUC 2JUCA 1WWXA 1IAWA 2HZTA 2EFPA 3I64A 2EFOA 1F4KA 3RPQA 5EZHA 3DLLF 3KP7A 4CZCA 1R5HA 5EDNA 1EH7A 2HOAA 3KLOA 3WTTC 2I10A 3GLLA 5DS9A 1W4MA 1DPRA 3KFWX 4P96A 1B8IA 5C4JJ 2DPUA 1FNNA 3OS2A 1XGMA 3Q0WA 1G3WA 3EPZA 4CO8A 1OR7C 3H36A 1KZHA 3BP8A 5AONA 4XBFA 2E1MC 1YJNI 3VWBA 4KIFA 2IXSA 4QPOA 1DGRM 4FISA 3EQLF 3CUQA 4UXNA 5EG0A 5JLWA 3RQIA 3CMEI 4BDZA 3LSKA 3CCEI 2ADUA 3EDPA 3WE3A 2QA4I 2VOPA 1MKMA 2VT3A 4E7IA 2LSOA 4B4CA 1FBQA 3PNYA 1AA7A 1IV8A 2ME6A 4HXIB 4F91B 2ZFWA 2EBIA 3MKLA 4E7LA 1T38A 4IHTA 3Q9VA 3TQNA 5E20A 2JRMA 1R71A 3ZMTA 3QU6A 3S1MJ 5DCFA 2XUBA 1MSEC 3HOWJ 4YFSA 2HOEA 3IP4B 1Z9CA 1S7OA 2ZKZA 3D5LA 3L2RA 4CYCA 4HX7A 2K27A 3OYGA 3OOPA 3ROUA 5M5WJ 3S15J 1S29A 1KQ8A 3JAMK 5LGUA 3ZQIA 1VI0A 1KYZA 1XCBA 2EZIA 3H0DA 1R58A 4R8HA 2JT1A 3G1MA 1HKQA 2VB6A 2VBYA 3FX3A 4BY7J 1R4NB 4E7HA 3T0YA 1SFOJ 3ERMA 1T56A 2P0WA 3ZCOA 4D7MA 4F7ZA 3N05A 2X6OA 2L7KA 2KDZA 1U5TA 2LY9A 4HDVA 1WJDA 1HSJA 4D1QA 3HM5A 1T08B 3KYLA 3ZOBA 5J8CA 3M8FA 5EEAA 2F5CA 2X6WA 4MHGA 4RGXA 2XVCA 2RDPA 2X51A 3BG9A 2ETHA 3C1DA 4EGZA 3HEFA 4FE7A 4OWRB 2FX0A 2Q8KA 2QBYB 4OMYA 3GBGA 5E8GA 3RJPA 3I71A 1SD5A 4IVNA 3A01A 2E2JJ 1ON1A 2WV1A 5A2QK 2QQBA 3SFZA 2L4MA 3M7GA 1GLNA 2P5VA 1YRNA 2QSFX 5J3LA 3SYTA 3JRBA 1C0WA 3RPUD 1VQ8I 4RLFA 3WTVC 3DKWA 4LOCA 3C3WA 3QU3A 3DTEA 2HOTA 4KICA 3BQKA 1MH3A 3KZYA 2ISZA 2DYRH 2XC7A 3QODA 1Y6IA 4Q47A 1TW2A 1PUFB 2B0LA 5F27A 1AWCA 2FQ3A 1AHDP 1DDNA 4EJOA 4MQ9F 1A31A 4IKFA 4ESFA 3CF5F 2HDWA 3BG7A 3J7AO 1O7LA 2K7LA 1ETOA 4NUBA 4WXHA 3S1RJ 1V5FA 1ZTRA 4XOTA 1YG2A 1FYMA 2JJ7A 3EETA 3H9QA 2EV0A 3IHUA 5D5XB 1BR2A 3K1MA 4NC6A 3TO9A 1OCRH 2Q2EA 3V7CA 4HDUA 3ABUA 5CVIA 3FXMA 4DYCA 1N75A 4RGUA 1ENHA 2BY2A 4ZYEA 2VLAA 4G7OF 1WI3A 2XDVA 2LK2A 4CCNA 1XG1A 2K4BA 2OZ6A 3S8PA 3LOCA 4E7ZA 1K83J 3K4NA 2LKSA 5C3EJ 1KQ9A 2X9DA 3BQYA 1GV2A 3GCMA 3E5QA 4DYQA 4QSHA 1HDPA 3BDDA 1A35A 2X6XA 1SFKA 4MLOA 2EJRA 1LDKA 1TT5B 2DMPA 4M9ZA 2NOGA 1ON2A 3QOEA 3BR6A 3HOYJ 4WXDA 4EOZB 1JUSA 2NVUB 1IUFA 1WCMJ 1TTYA 1JE8A 3PQJA 3IL2A 1BI3A 5JVGF 4ABZA 3ML6A 1RI7A 3K4MA 4C3HJ 3DPTA 2VBZA 4KT5C 1K79A 2WBMA 2W57A 2PJRB 1WHUA 3I55I 3HDDA 4RM3A 2QGUA 3W6VA 2CV0A 2VJIA 3F8CA 2VBWA 2P5KA 1IRGA 3CJQB 1YHQI 1OCCH 1G59A 4A3EJ 2HTSA 1W0TA 1QQIA 3K10A 1YJWI 3WTSC 4JGHD 2K9MA 3NEUA 2F4IA 1IRFA 4MTEA 1B8IB 2XU0A 3K4LA 4RGRA 1IN5A 4ZTJA 2W7NA 4Q5SF 3MKYB 1PP8F 1TBXA 4HF0A 2DBBA 1R4MB 2DLLA 3RCOA 3GFJA 4WF2A 5J1UA 4WX9A 3ZP5A 5GTHC 2JVGA 2H6BA 1YRNB 2UWMA 1HLVA 1OCZH 1ZG3A 4M3GA 2F5EA 4IJAA 4WQOD 1TWCJ 5GAGJ 1JTXA 1B9MA 9ANTA 3DEEA 2A5YB 1HF0A 4RBOA 3A0BC 2KRFA 5HVQC 3OYEA 2FU4A 4CUGA 2MH9A 4HLXA 3V8JA 1BR1A 3OL3A 4M3EA 2DPDA 3ECOA 1K78B 3NARA 3A03A 1OQYA 4XONA 2KQRA 4A12A 3OY9A 1SMTA 1IN6A 3GFIA 1FYLA 3CCLI 2L9SA 1QBJA 1IO2A 4IF4A 5DCMB 2M2EA 4U88A 4UUSA 2F6CA 5EZGA 1S3JA 4EV0A 1WJCA 2KKOA 2KL4A 5CPRB 2WC2A 3WHCA 2W1OA 4Y15A 1EJ9A 1MD0A 2G7UA 1ITYA 5KAFC 3V42A 1FEXA 4BYYA 5LHGA 1V4RA 4XKVA 1MNEA 3MCZA 2IA0A 4X6AJ 2FBIA 2LTPA 2WY7Q 1X1AA 2ZXHA 3TOBA 2XSDC 3LSIA 1LEAA 4ESBA 1Z3XA 4CCMA 1JI8A 2I8DA 2BW3B 3PNTA 2L01A 1AOYA 5H20A 5FLVA 1HOMA 4A6DA 1APLC 2Y9ZA 4A0YA 2HEOA 1Y56A 1UMQA 4CH7A 4MQVA 5L3GA 2EA4A 2KRCA 1VQKI 1ZQ3P 4HF1A 3QP5A 1SD6A 2BHYA 1USSA 1UFMA 3JRCA 2XKPA 2JSPA 1J09A 2Y0MA 5L3DA 2MH2A 2XAQA 1LFUP 4MFDA 3EUHC 3FWEA 1X19A 5FKOA 3AG1H 4XLEA 4B43A 2XAFA 3PFIA 4RB3C 1MDMB 2DXIA 2NVQJ 3IKTA 2M4KA 3LFKA 4XRSA 5E3NA 2XB5A 3HZJA 1G6NA 5CJ9A 4NUUA 5KNLA 5F1JA 2IAIA 3SFIA 1X3WB 3NRVA 2LF7A 3HOSA 4BNCA 2E60A 1A6QA 2W82A 3Q3SA 3HSFA 3GTGJ 3K4BA 4KISA 1B1BA 3PM1A 4MO7A 3MKWB 4J19A 3H5RA 3I54A 2BZTA 2R7FA 3TP3A 5IOZA 3OYFA 3O2PE 4HSTA 3E1SA 5E1ZB 4JBAA 1Z1DA 2IJLA 4L5JA 4AVZA 2KP6A 4OU0A 1MW7A 5FKNA 1YLFA 2R3SA 4M9SA 4GO1A 4XNFA 1X1PA 1XDSA 3V4GA 3GTQJ 3P9CA 3FBNB 3ZN1A 3GTOJ 3DPUA 1XGSA 3R0JA 4E7JA 1MNDA 1D0XA 1MBKA 4CICA 4M72A 3LSHA 2B63J 3BQIA 1Z05A 1VQ4I 2VPRA 2VPLA 3AL0B 2HYGD 1U8BA 2IS6A 2O8XA 4PSWA 2LRDA 3F72A 2FBKA 3BROA 2PMZA 3OOUA 3RPUA 4BACA 1O3RA 1QVUA 2DA4A 1VZ0A 2IEKA 2K3PA 5CQEA 3J7YJ 1W0UA 3Q9SA 1WVRA 1QHGA 3HUGA 3I0TA 1D8JA 1QZYA 2ZCWA 4L5EA 3PSFA 2HFHA 3Q0UA 4G6QA 2JRTA 2R93J 2HKOA 3CUQB 1BI0A 4JK1X 2FSWA 4BE1A 4CCKA 2QLZA 2N8GA 4CHUA 4XKCA 1IF1A 3BZKA 1IXCA 1T2KA 2A68F 1GVDA 2PJRA 3MZHA 4ZJZA 4XL9A 1Y1VJ 3KP2A 3ZN0A 2FOKA 3M9AA 3RKQA 2V4JC 1EV7A 1FBUA 1WJBA 2ZMEB 2Y69H 3LL7A 5CVRA 2Y2ZA 3H5AA 3H92A 1S7AA 1V5EA 4LIVA 5BPDA 3WU0A 2H8WA 2AQEA 4N4OB 4IOCF 1R1TA 4WK8F 3I5UA 3QYEA 2PG4A 2XF6A 3MWMA 2QUFA 2JA5J 3C2GA 3H0GJ 4L9VA 4L0ZB 5LBQA 2QSHX 1FTTA 3SEQA 1U9OA 3UKGA 3HHHA 4P55A 5KVRA 5ICEA 3ZQCA 2EZHA 3MN2A 4Y3OA 2ESHA 2OBPA 2OQGA 4IZZA 3ABLH 1LVKA 1KYWA 1S7EA 1Z91A 2XF7A 3RKXA 3OYJA 3OYNA 1BR4A 1S9HA 2OV7A 4A0ZA 4U7BA 2K9LA 2L9NA 1K4SA 3VOEA 2KZVA 2DT7B 4A3DJ 1WJFA 2BOLA 2EWNA 2CO5A 3PQKA 2HPMA 3S3MA 4M71A 4YEJA 1S5LC 2LY1A 1ZELA 2MLGA 3A01B 4KT6A 4GYIA 4ZYAA 2RNGA 4KMFA 2B1EA 1T39A 1LDDA 3HYIA 5D6FA 3CCJI 2Y0SN 2ID3A 2F5DA 5F1RA 2BHZA 2NS0A 3HIFA 1MJ9A 2WA0A 1SD4A 5FD6A 5LRSA 3KYCB 2NRAC 3F8BA 1U3EM 1JTYA 1R1VA 4LD5A 1H89C 3H3VK 1RKTA 1UHSA 5D5WB 3GZNB 1HXDA 3VFZA 4DZPA 1BW6A 1O3SA 1I3AA 4A3IJ 1Y8QB 3FK6A 1J9IA 1IN7A 3HGYA 2DFHA 3H35A 3K6GA 1ACIA 1YJ9I 3MVPA 1TQPA 1TNSA 2FF4A 3O8GA 3GEZA 2LC2A 1Z21A 1FC3A 2RNJA 4I76A 4JX4A 2JQ7A 1MH4A 5D5VB 1Z3YA 5C4XJ 2A69F 1NK2P 4UVAA 4DBRA 1W7PA 2PQ8A 2IGMA 3H1CA 1NHAA 3E6BA 2XSJC 4UNOA 2R7XA 5FFZA 5IP9J 2EK5A 3VSKA 2M9HA 1RESA 4U0VA 3F3XA 3WTWC 1UCRA 2LBFA 4BEHA 4II3A 3M8EA 3K1PA 1P4WA 2QENA 3HOTA 4BJ5C 4BXUA 1J2XA 2K02A 1LPQA 1I50J 1UZCA 4CGZA 3CMAI 3JRAA 1TWFJ 1USTA 3A0HC 4C2MJ 2O5RA 2D45A 2VC0A 4S04A 1JT0A 2KPMA 3BR2A 2HGCA 3I59A 1TWHJ 5C44J 5BOXA 4P5OA 3HKZA 5D8LB 4BBRJ 3LWFA 1FSEA 2OCCH 4IOAF 1IN4A 1ODDA 1J5YA 3BC8A 3BWGA 1HQCA 3E5UA 5EEHA 4HNVA 3HPHA 1WZ2A 3RRCA 2ME0A 4M3FA 3JRHA 2WB1N 4XSZF 2R7OA 2M8EA 4I98B 4A3FJ 2UV1A 2DJNA 3CC2I 2AXTC 4AIKA 3K70C 4W1UA 2R4GA 1WGXA 3FXQA 3HOVJ 2E19A 4M6XA 3O6BB 1TL8A 2Z3YA 3BZCA 1TWAJ 5FJ8J 1FJLA 1TQMA 2OZUA 2RC4A 3FZVA 2CSOA 2FD5A 3QAHA 5J40A 4KIGA 1JGSA 2ECBA 4A2UA 1R22A 2E5NA 2ESNA 4AD9A 2PEXA 4RAZA 1AKHA 3FMQA 3G1OA 2COBA 3WE2A 2HVQA 3TW6A 1XCVA 4YIFA 4F3QA 1AKHB 3RQ4A 3EYYA 5BS6A 3CCRI 2GZWA 2Q0OA 2XPUA 4A3GJ 4E4HA 3FF5A 2LMDA 2UXNA 3REOA 1YITI 4NB5A 4KYWA 2DA6A 3BCBA 3WU1B 3QOPA 1RNLA 5TRDA 5IP7J 4OAZA 5ERIA 4HA8A 4BBSJ 5IP6A 1LFPA 3OYAA 1TW3A 4I0AA 3NQOA 3CP2A 3R0AA 3L9FA 4LK1F 4BQOA 1YTYA 4AYBA 2R7SA 4F55A 5FKKA 1D3YA 1YX5A 4OAYA 1ZRFA 5K7ZA 3J81K 2PMHA 3ZQFA 4EJUA 3I9V2 3HTSB 5HLGA 3RSNA 2LY2A 3IWZA 5DV5A 3QPSA 3U2RA 2J5PA 4LJZF 1MMDA 3HRMA 1BC7C 4BXFA 3HUGB 3TW7A 1YOVB 4B1RA 1YW7A 2DYSH 1MBJA 2LF8A 1GHCA 2BVLA 2IPQX 3EUAA 2JSCA 3GTMJ 4RB2C 2O7OA 3RI4A 2PFBA 3BCAA 3JRFA 2CRGA 3PUFA 1G4DA 1U78A 4WWCA 1D8KA 2R5YB 2IRFG 2CH0A 4ENJA 2R0QC 4P9UA 3M1EA 1HW2A 3E3VA 1T95A 3BG3A 2L3DA 2WV0A 2TCTA 1I27A 3ELKA 4AP2B 4HAMA 2VJJA 3OWTA 1P7JA 2MW8A 2FE3A 2NYXA 3GX4X 1FMWA 4WXCA 2XROA 1FOWA 3HOUJ 3EYIA 2CQKA 4A5MA 2GOXB 2CQQA 4O6JA 2ZNYA 2WADA 3DV8A 3F8NA 3AAFA 3DU6A 3PIOF 3CUQC 4O5VA 4YIRX 2XAUA 3J80Z 4E6KG 3PO2J 5LEKA 5E1XA 2Z2SB 2H1LA 4PJLA 3D5RC 2IT0A 3S14J 1OR7A 4LB5A 1P6RA 1D1BA 3HJEA 3D1NI 5F6FA 2P5LC 4I2OA 1E2XA 5GAHJ 4BJ6C 4ZC3A 1LDKB 2A6TA 2VQLA 1JUPA 1HW5A 2OC6A 1H0MA 2W48A 2P81A 5CQGA 3HOXJ 5IY5H 1IZ1A 3ASOH 3WU2C 5KAIC 4G8XA 2F5FA 2DFIA 4HQEA 3CZ6A 4GCVA 1MMSA 2AO9A 2FOWA 4XK4A 3S3NA 2YX7A 3BJOA 1VF9A 2R7QA 3DFGA 3I4PA 3MQ0A 2WAFA 2BYVE 3HHGA 2RQPA 5E8IA 2R7VA 5DUIA 1ZR4A 2KZGA 1LQ1A 5FFXA 2RGVA 2IS1A 2OPTA 3FISA 2Z5UA 3QPLA 4RAGA 1R1UA 2K85A 3V8LA 1R00A 2JA6J 3S17J 2JMWA 2OCEA 3OYBA 3E6CC 5BPIA 1KU3A 2Z99A 5BNGA 1JHHA 1TC3C 3VPRA 5IT9K 3L2VA 1U9NA 3LA2A 3JRIA 3SDBA 3Q5FA 3PIPF 1VQPI 3F6VA 3BPVA 3LSGA 1R5ID 2EFWA 2DMUA 4KN7X 1IG7A 2EZLA 3KZIC 2PMUA 3HSEA 4BKXA 3ZPLA 1N25A 4FTHA 4FCYA 1X4PA 1LE8B 2R7UA 5ICGA 1JHFA 4EM1A 1Y39A 5M3MJ 1V54H 2DOFA 3IH4A 3L1PA 2Q1ZB 1XC5A 4LG0A 3QWLA 5F0HA 3V7RA 1YE9A 2VKEA 3CCMI 3HBLA 1QNTA 1F36A 4HX4A 5H2FC 2BY3A 1HA8A 1LFBA 2Y8DA 3WTXC 4C3IJ 2EPFA 4GYGA 1S6LA 4XRFA 3H5NA 1L0OC 4AVPA 3SZTA 4IO9F 1QZZA 2M7AA 2W24A 1O57A 4M6YA 2XRLA 4UUSB 2TRTA 4EMSA 2ZFUA 4XKWA 2YU3A 3RKWA 2F5VA 2V9PA 1FOXA 1X4OA 1SD7A 2DFFA 2QZ8A 5GPAA 2GXGA 3Q0VA 3CESA 3GFMA 4BS9A 3VDXA 5CLSA 1HSTA 4GXOA 2JK3A 1VFCA 2EILH 1K78A 1G2HA 4V2FA 4UB8C 1QPIA 1O3QA 1W5TA 4I6ZA 1XMKA 5BMZA 3I4NJ 3FM5A 1K7AA 3I4MJ 2VI6A 3F21A 5FLXZ 5HLIA 5HS9A 1V3FA 1A36A 2R7ZJ 2IA1A 2ZMEC 2BVMA 1QVTA 4IQJA 1IDYA 3L00A 2QCOA 4CCLA 1RRJA 4IX7A 2DT6A 2X4HA 1LB2A 1O7FA 1FZPB 2FRHA 4ETSA 1ONVA 3FMSA 3RDIA 1T33A 3GZ5A 1I6XA 3RZOJ 2L2OA 1ETXA 4KIBA 1U2WA 5ILVA 1FOKA 3CDHA 5FROA 3QRFF 1P4XA 2DODA 1V5GA 2TDXA 4FE4A 3S16J 5HODA 3EUHA 1IC8A 1MIJA 4E7SA 2GIVA 5CVJA 5E3MA 2QQAA 2V1NA 2LYCA 3S32A 4G6TB 2H09A 1DGWY 3LQRA 1YW8A 2E34A 3DLAA 4IRIA 2VOOA 3BQZA 2JA7J 1KA8A 3PSIA 3S1QJ 2A6HF 2K4JA 3BG5A 1BC8C 1WPKA 2GIZA 5ICCA 1DQUA 1OPCA 3WTZA 3K4KA 1X1CA 2L7FP 4U0WA 2JA8J 2V9KA 3G4SI 2DK8A 3DWLE 2Q2EB 3V8KA 1J0RA 4Y7NJ 2ECCA 4A5NA 1JJ8C 1EA3A 5EGOA 1ERDA 4CCJA 2M5WA 2EV6A 2CUFA 2XAGA 3FKIJ 2DDAA 3KEYA 2F4MB 3BLYA 5K5QA 5E17F 3PL8A 4EM2A 3HRUA 3OIQA 4UV8A 2KT0A 2L9VA 1K61A 1Y1WJ 3ABKH 5HS8A 5J4YA 3K4JA 3WTYC 4HW0A 1E3PA 3IH2A 2ELJA 4NQWA 3CMYA 3RYPA 3M1CA 4XMYA 1SC7A 4K2EA 1HW1A 3GW2A 3IAS2 4BE2A 2OF7A 4G7HF 5E79C 2CV2A 1IGNA 1DPUA 5DD4A 2LBFB 4PJJA 4L9NA 1ZHFA 1BW5A 3BR0A 2IGOA 3TDZC 3W6JB 5DEQA 4I01A 1H8AC 2VJ5A 4UUVA 5FRNA 3BTLA 4HNUA 2XB0X 5FLMJ 1A5JA 2IP2A 2VC1A 4PK4A 4F92B 1AU7A 1TT0A 4D5FA 1N77A 1YYVA 2H8RA 4CSWA 3ZGKA 3BJAA 1TWGJ 2EFQA 1KU2A 3GFLA 3DKXA 1ORKA 4HG2A 4D0PA 2HDCA 4NNJA 1G3YA 2O61A 2LH9A 4D9JA 2MG4A 5TISC 1WI9A 4DW6A 1ZLKA 1FOYA 1U0JA 3TKYA 5J1RA 3FHZA 4YELA 5CVUA 1X1DA 4DOZA 4WCGA 1DU6A 2Y9YA 1Y8RB 2R7WA 1WH5A 2B9SA 2Y0SA 4HYEA 3FXLA 4M3BA 1HKTA 1Z6TA 2VKVA 3GO5A 3O3KA 2DMNA 1ZN2A 4U0YA 2STWA 3ABTA 5F04A 2FNPA 3LSJA 2DQLA 3LAJA 2UZKA 1R9TJ 4W97A 2VE9A 3O8HA 2FQ4A 4KDPA 2ZXIA 3LAPA 3DTKA 5JR3A 3GUDA 3EUKL 3GTLJ 4HV5A 4Y33A 2EIMH 1XX5A 5J4VA 4A3KJ 2HI3A 3MZ8A 3BTIA 3DXJF 3TMOA 1IW7F 2ICWG 2I5UA 4FASD 1RR8C 4RAYA 4J01A 2OQRA 1P9QC 5IYCJ 1ETVA 4H0EA 2M34A 1IRXA 3GMEA 4EGYA 1F43A 3DF8A 1VQMI 2L02A 2IGKA 4ZZDA 5M5YJ 1HDDC 3ZMUA 4HLYA 5FRMA 5JFRA 1MJBA 1DUXC 1U8RA 2AQFA 3OYCA 1XSXA 2EIKH 2VE8A 3ASNH 3CO6C 1RZ4A 2G9WA 2WAQN 3AFHA 4E7KA 1W36C 1B72B 3OIOA 5JI6A 4RMNA 1EH6A 4A3BJ 2A3SA 3G1LA 3OYIA 4G12A 2MLKA 2A6EF 4OOIA 2HVSA 1R23A 2HXIA 2KRHA 4JX5A 1KQ0A 3HL2A 4B3AA 4CCOA 2PLYA 3AKZA 5HOOA 4BQNA 2YU9J 2A5WA 1BOAA 4RDUA 1FWZA 1D1CA 1JKRC 2ELHA 1N78A 4O3MA 3CCVI 3K69A 3V7SA 3DBHB 4B3XA 5LHHA 4HOBA 2VN2A 3P9KA 2QSGX 2W84A 3FDYA 3MAJA 4RLQA 4F93B 2EV5A 3X2QH 1XGNA 4IQ4A 1JT6A 2K9NA 3L2WA 1Y0UA 3CCQI 2VKHA 1MBFA 2HOSA 2ZXJA 1MMGA 4XSXF 2ZC2A 1VQOI 3HSRA 1RKWA 2JPBA 3AG3H 3CD6I 3F8MA 1T98A 3IWFA 4KJZA 4MEXF 4A64A 2L5QA 3FK7A 4DGWB 1XTAA 2BE5F 4DQ2A 3KP3A 2OTJI 4XLHA 3M8JA 4A3MJ 2LKXA 4E70A 2DQRA 1J59A 3AG2H 3P5JA 1RUNA 3NWSA 2ZNZA 4PUSA 1VQLI 2QYOA 3L2QA 3ECHA 4M74A 3ZRGA 2L54A 2MFZA 1NG7A 3K9TA 1D5YA 2CQXA 3ZR8X 2RQQA 4Y52J 3WG7H 3CF2A 3UNGC 1FYKA 5F08A 2M3AA 2QBYA 2VQCA 4S0HB 4RM2A 3N97A 3HRSA 1HCRA 3DEWA 3VYUB 1TQIA 1JJ6C 2D1VA 2DA2A 2GA1A 2QKMB 2XRNA 4FHTA 4UB6C 3SXYA 3BQLA 4AWXB 2RN7A 5M5XJ 2XASA 2BEOA 2IA2A 5HDNA 2V6EA 3RKYA 5FKMA 3E97A 1RUOA 2COMA 3LNQA 1Q1VA 1UELB 2VIXA 3FXRA 4Q48A 1MJAA 3CCSI 2CS3A 2WAUA 1FX7A 5ILSA 1R5GA 2PFVA 1WJAA 3RZDJ 5HLTA 4BHPA 1MBEA 2M0MA 5L3BA 3ZXSA 5KCMA 1W7PD 5K5RA 1UG0A 1CF7A 1WRJA 4UUTA 2A05A 4BH9A 2XGEA 2XAJA 1Q1HA 1XMAA 3GTJJ 2MBFA 4GGGA 4ENMA 4U87A 3SEZA 3DP7A 2PMZN 3B6CA 4G6DA 3OYDA 1VQ9I 1MMAA 2HQNA 5F64A 1R7JA 4XICA 4BEHB 3JSPA 4C2UA 1W1WE 2V26A 3MEXA 1XD7A 3CCYA 4B8XA 2QQ9A 4AIDA 4B44A 5ILUA 2QKLB 1LUJB 2H94A 2F2EA 2HYFA 2JWTA 2KDOA 1MNMC 3BTCA 3M07A 2GQQA 4ZYGA 3HKZN 2W00A 2ZJRF 2K86A 2E7XA 2NVYJ 2K3FA 2EH3A 3F9KA 1U6GA 5FGMA 4LK0F 5FB2A 3KP5A 5K7FA 2PBIA 2IGNA 1EKEA 2BGCA 2NXNB 2CQNA 2X0LA 2CV1A 2AHQA 2X48A 4JX6A 1A04A 2DJIA 2WAQA 4HSRA 1VQ6I 1X1BA 1R6RA 2DA1A 2XIGA 5HNHA 2X6YA 4A93J 3F0CA 2VONA 1FSHA 3OR2C 4BXXJ 4Z2YA 1CQTA 1YFHA 1XS9A 2DMTA 3RYRA 5K5OA 2EA2A 1BL0A 4ENKA 2ZSIB 3TGNA 3PUBA 2PJPA 1OISA 3DPLC 3P7NA 4HBLA 3JRGA 2L9RA 1MDMA 1X2MA 4I02A 1MMNA 5B66C 1VQNI 2FUG2 1NH3A 5JVTA 1S8NA 1MZBA 3ONQA 4I0BA 4QWQA 5D5UB 4XRMA 1FY7A 4XKBA 4HF2A 3CTAA 1E17A 1MBGA 1LE8A 1GUUA 1DU0A 1DP3A 2HYJA 2HXOA 1KU7A 4PGGA 1XMXA 1IUYA 4EEFG 5EG0B 4OIPF 1OYYA 4ZZLA 4I09A 2O3FA 1X3UA 1A6IA 2E71A 4BGDA 3LSPA 3ERED 3K2ZA 5AIPA 4HRIA 4B09A 3C2HA 5HDGA 2DA5A 4MGRA 1FLIA 2X85A 1XSVA 2GBYA 3MMYB 5IYBJ 3I59B 1JXSA 1WH7A 3RIRA 1D0YA 4RB1A 4BQQA 2ZMEA 2W4SA 4IL6C 4XIDA 2Z16A 4M9XA 2X1EA 1PDNC 4BY1J 2DT5A 4ZDPA 3SQNA 3CMLA 1J7KA 3LSMA 4JQFA 3J7ZI 3CJTB 4FX4A 2BXZA 2LNBA 5IT3A 3ZQHA 2FJ1A 4A0XA 4FQGA 4DNCA 1UJ8A 3LFUA 1G3TA 3B6AA 3RTRA 1ETWA 2HVRA 5ICFA 1BJAA 3IRRA 3C2BA 3GVAA 3COAC 2MSYA 5TJJA 2HU9A 4MIMA 1ZREA 2WWYA 3KYDB 2FBHA 2MABA 4LMYA 4FETA 3U1DA 2HWVA 1D0ZA 4LG3A 3JSOA 1YS7A 1R36A 3E0JB 4IHSA 3D5SC 1PVEA 1BIBA 1QRYA 2YS9A 2DO7A 3MFKA 1YO5C 1I1GA 3M3YJ 2HQ5A 5LFAA 1IDZA 3KPHA 5E3LA 3I56I 2JVHA 3LA7A 1ETYA 3KX2A 2ZJPF 4CA0A 3DCFA 4AU7A 1KONA 5J1YA 2D5VA 2JZYA 1ZRCA 4D7NA 2MC3A 2CYYA 1NK3P 4A6EA 4C9YA 3FXUA 4Q4ZF 2CU7A 4L18B 3JAMZ 2RREA 3ZQLA 3KZZA 1FPQA 2ZB9A 2HZDA 4N9F3 1LNWA 2HDDA 2VBXA 2VQHA 3M4OJ 3BZ6A 1Z6RA 2P7VB 4KN4X 3IUOA 3SZGA 4OIQF 4ZYHA 2KLOA 1O3TA 4CDGA 3OS1A 2K9QA 2DMQA 4ZH4F 2DDBA 2PX9A 3GYHX 3IRQA 2WB1A 4D5CA 5LGTA 1PUEE 4IRHA 3OYMA 1XSDA 1EF4A 1HC8A 1FP2A 2R7TA 1WJEA 1GXQA 5EGOB 2O6GE 2M1BA 3L2CA 4S05A 4A69C 3UR3C 2M8GX 4BJTA 4RB0A 2JTVA 3DQVC 2ZO4A 2LG4A 4OMZA 4OINF 2DA3A 2ISYA 4BU2A 5E18F 2MD0A 4XN0A 4DYRA
chains in the Genus database with same CATH topology
2LKPA 1XGOA 4EJWA 2V1DA 5LEJA 4R79A 4HX8A 5BQTA 2P6SA 4ESJA 4CYDA 5ED4A 3GLXA 4BUPA 2GXBA 3P9IA 4F52A 3OYLA 2CUZA 1BM9A 2EFNA 4LLLA 3TO6A 2OA4A 2Z1DA 4BAYA 3KEQA 4HNTA 3CJNA 2P7CB 3N4MA 4QPQA 1XB4A 4PJMA 2JUGA 3C18A 1SMYF 4YG2F 4B48A 1BOBA 4HQMA 1OKRA 2J5OA 3KLNA 4H4KC 2JA2A 2UXXA 4ANJA 1FT9A 2XKOA 5TGTA 2VJ4A 1FBSA 1LDJA 2E7WA 1PP7U 1SFUA 5DDGA 4ITVA 2PN6A 1IXRC 4IXAA 4NC8A 1OLTA 3PJRA 1UAAA 2FA5A 3G3ZA 1F5TA 2HQRA 1HKSA 2DW4A 4BHCA 4APFB 3GZ6A 1T0FC 2HPIA 2R7RA 3W2WA 3MD2A 3TBIA 2CMPA 5KHDA 2VT2A 2ACJA 1QPMA 3BG6A 1Z7LA 3OV8A 2M7BA 2NOJB 4EVIA 3F6OA 3T5XA 3LQQA 4P1WA 2OAZA 2NAZA 3FHNA 1HBXG 2VXDA 2DCEA 2O0YA 4N4NB 5K1YA 1KGSA 2KJBA 1YX3A 2V6CA 4FX0A 4L0YB 2ZJ2A 3H9JA 3KETA 4QLCU 2V1XA 1W5SA 4M73A 2LOOA 3F8FA 3TOAA 2E1MB 3CUOA 2VODA 1B4AA 4BQAA 1YS6A 1U5TB 4PZJA 1STZA 3ULQB 5JHFA 1ZG5A 4PFOA 5D8KB 2WTEA 3CO7C 5CVVA 1WQ2A 2CW8A 4UVCA 4EM0B 1T6SA 4XLCA 4XN3A 3R61A 1DP7P 4EATA 1B9NA 2KMUA 3ZQ7A 1PJRA 1IXSB 1GVJA 2G7HA 1G8XA 3B02A 1SFEA 5FO5A 2HR3A 3R60A 1P4AA 5DUKA 3TL4X 3T1BA 2D2WA 3TDUC 3K0LA 1ZH5A 1BBYA 1B6AA 2GA2A 2KHMA 2HNHA 2VKDA 4UV9A 2NNNA 1J75A 4KMUX 3ISPA 2DK5A 1NG6A 2R7DA 1TNTA 5LHIA 3MZYA 1YIOA 2HS5A 5DYMA 3FMRA 4Y4RA 2IS4A 3J80K 4LB6B 3H3UA 1SAXA 2FEZA 4N9IA 2Z33A 1FP1D 1L3LA 2P8TA 2KIFA 4DJAA 3H9GA 3A1YA 4HZFA 4ENNA 1K6OA 5HNFA 4N0BA 3T8TA 3KEOA 4G94A 1MGTA 2KJCA 4ZDLA 2M45A 2CW0F 4G9YA 1WSUA 3WGIA 4ZTFA 3R4KA 2M30A 1K6YA 3GWZA 2KIUA 2FMLA 4OIRF 3FM3A 2V79A 5L3CA 2E1CA 2VASA 4LGWA 3LSTA 1H9TA 3QYFA 3I53A 5FD5A 1BI1A 3JTGA 3S2WA 2Y75A 1PYVA 2C6YA 2STTA 3FKJA 2CUJA 4CZZA 4BL0B 1QO0D 1Z7UA 2FNAA 1D5VA 1WKMA 3IAM2 2IW5A 2DU9A 2O03A 1TLHB 3HPGA 3LA3A 3QYBA 2HQAA 3U21A 1BIAA 4C30A 2V9VA 5JHUA 4U7DA 5IT9Z 5FLXK 3CMMA 5H6QA 3KP4A 5LRRA 4KUMA 5A2QZ 4DBQA 1OMIA 4ZDOA 3BOQA 3W2AA 1T0FA 2H6CA 1WFXA 4EJVA 3R6SA 3OYKA 3A2KA 3BJ6A 3WGHA 1YQAA 3FBIB 3WG9A 2QWWA 1D1AA 3J7AY 3VODA 3I58A 4HV6A 3JW4A 3CJRB 3D0SA 4KITB 3J81Z 1UHWA 1BI2A 3G2BA 4RS8A 3E5XA 3AL0C 3E6DA 5L3EA 4II2A 3ZMDA 1UB9A 2OUMA 1ZAOA 2YSRA 4RGSA 2FMYA 3LMMA 5CYVA 4XR6A 4N9HA 3QPTA 4XQFA 2V1UA 1QU3A 4NC7A 1ZARA 1H9GA 2A07F 3QP6A 2LREA 3A4CA 5H6RA 2W25A 6PAXA 1XDUA 4XOPA 1ULYA 3L09A 2FXAA 2QM3A 4KFCA 2M87A 1LVAA 3TO7A 4AIHA 3W2VA 2X1DA 4PGHA 2RVCA 3HTUA 4I7HA 5E1WA 1LEBA 3H3ZA 1W36D 4UHTA 3ZQQA 4HEA2 4BDYA 4ZYDA 2X1CA 3G73A 5EEGA 1XN7A 4XORA 1ZGAA 2BW3A 2LDUA 4NQWB 2QVOA 3CP8A 3DEUA 2ZSHB 4IPAA 4LFUA 2CG4A 2L4AA 2CFOA 4LITA 3L7WA 3HC7A 4EJTA 4HPQA 5LD2C 2XAHA 5LLQA 4NHJA 2YR2A 1F1ZA 3PFYA 4LIUA 2D1HA 3U9GA 1LJ9A 3E6MA 4LLGF 4OIOF 1G3SA 3L2UA 4YFKF 1UHMA 4XLNF 3QPHA 1VTNC 2VQGA 2P4WA 5D4SA 3OS0A 1OYWA 3S3OA 4YFNF 4XLFA 5J8FA 4DIQA 4FT8A 2DOAA 4CXFA 4BE0A 2CWEA 1P92A 4MNUA 2A61A 1W7PB 1REPC 3KCCA 5CKTA 5L3FA 3OYHA 2WZKA 4L9TA 5J6XA 2ZBKA 2BV6A 3VYRB 1CF7B 2W85A 4JOMA 2MYSA 3S93A 4YFXF 1ZG1A 2MC4A 3BPXA 5KK1A 1ZGJA 3B73A 2VL8A 4LG0B 4LLNA 2E1NA 2VXZA 2MD5A 3VYTB 4XM3A 3OMYA 5HLHA 3I3LA 2GOMA 4B47A 3WGGA 1F9NA 4X0GA 2XHKA 4YIIA 4EQQA 3GXOA 3OIPA 4J00A 3BY6A 2K5CA 1TZLA 1E0EA 2XV4S 4TV7A 4Y13A 3SHFA 4G7ZF 2WY8Q 1QGPA 1I1SA 4BHBA 3GF2A 2GAUA 4UVBA 4Y17A 4P9FA 4XLPF 1SAUA 3IKVA 3HG9A 2OU2A 3KP6A 4KA4A 2AXLA 3F23A 2Y48A 2V7FA 5LGNA 5D4RA 1EH8A 3MKZA 1ZYRF 4KNYA 2YX4A 4GRIA 3VSLA 2HKXA 3NWTA 5AIQA 2PI0A 2XGXA 3IC7A 1ZRDA 3PNVA 1RIOH 1LKXA 5DD8A 2DAOA 3VB2A 3JTHA 3VEPA 4ON0A 4YRVA 2RV8A 4MTDA 4R1HA 1B59A 3HRTA 3KE2A 3F22A 2NNYA 3W6KB 4PSXA 5DCMA 3ZMZA 2YPRA 2XF5A 2UUZA 4XLAA 1SFXA 2M4GA 5HDKA 4ASNA 3DKYA 2OD5A 1KU9A 1GXPA 2RKHA 3OR1C 2GWRA 4L5IA 2MA3A 3WODF 2HTJA 3K1NA 2CGPA 3VYSB 3DU5A 4PCQA 2EB7A 2P6TA 4MEYF 2IVMA 3C7JA 1U5TC 3ZMVA 2Z9OA 3K70D 2IS2A 2DI3A 3CLOA 3HXLA 4IRGA 5D6EA 2AS5F 1I5ZA 2CW7A 1ZLJA 2BBYA 2E5ZA 3K4CA 4PFPA 1CGPA 1IN8A 2CFXA 3ZMSA 2WAEA 2KIMA 1QHHD 1BN5A 1OYIA 2DTRA 3W3CA 4L9JA 4C2TA 3T8RA 4PDKA 4AIJA 1WJ5A 3OL4A 5HS7A 1FMVA 3SZPA 1YW9A 1P2FA 2JPCA 2H27A 4PJNA 3DTIA 3WTUC 1WWXA 2HZTA 2EFPA 3I64A 2EFOA 1F4KA 3RPQA 3KP7A 4CZCA 1R5HA 1EH7A 3KLOA 3WTTC 1W4MA 1DPRA 3KFWX 4P96A 2DPUA 1FNNA 3OS2A 1XGMA 1G3WA 3EPZA 4CO8A 1OR7C 3BP8A 5AONA 4XBFA 2E1MC 3VWBA 4KIFA 2IXSA 4QPOA 1DGRM 3EQLF 3CUQA 4UXNA 4BDZA 3LSKA 2ADUA 3EDPA 3WE3A 2VOPA 1MKMA 2VT3A 4E7IA 2LSOA 1FBQA 3PNYA 1AA7A 4HXIB 4F91B 2ZFWA 1T38A 4E7LA 4IHTA 3Q9VA 3TQNA 5E20A 3ZMTA 3QU6A 5DCFA 2XUBA 2HOEA 3IP4B 1Z9CA 1S7OA 2ZKZA 3D5LA 3L2RA 3OYGA 4HX7A 2K27A 3OOPA 3ROUA 1S29A 3JAMK 5LGUA 1KYZA 1XCBA 3H0DA 1R58A 4R8HA 2JT1A 1HKQA 2VB6A 2VBYA 3FX3A 4E7HA 3T0YA 4F7ZA 2P0WA 3ZCOA 3N05A 2L7KA 1U5TA 4HDVA 1WJDA 1HSJA 4D1QA 3KYLA 5J8CA 3M8FA 2F5CA 2X6WA 4MHGA 4RGXA 2XVCA 2RDPA 2X51A 3C1DA 2ETHA 4EGZA 2QBYB 4OWRB 2Q8KA 4OMYA 3GBGA 5E8GA 3RJPA 3I71A 1SD5A 4IVNA 1ON1A 5A2QK 2QQBA 3SFZA 2L4MA 3M7GA 2P5VA 1GLNA 3SYTA 1C0WA 4BACA 3RPUD 3WTVC 4RLFA 3DKWA 3C3WA 3QU3A 3DTEA 4KICA 3KZYA 2ISZA 2XC7A 3QODA 1Y6IA 4Q47A 1TW2A 2B0LA 1AWCA 2FQ3A 1DDNA 4EJOA 4MQ9F 4IKFA 4ESFA 2HDWA 3BG7A 3J7AO 1O7LA 2K7LA 4NUBA 4WXHA 1V5FA 1FYMA 4XOTA 1YG2A 3EETA 3H9QA 2EV0A 3IHUA 5D5XB 3K1MA 1BR2A 3TO9A 2Q2EA 3V7CA 4HDUA 3ABUA 5CVIA 1N75A 4RGUA 4ZYEA 2VLAA 4G7OF 2XDVA 4CCNA 2K4BA 2OZ6A 3S8PA 4E7ZA 3K4NA 1KQ9A 3E5QA 3BDDA 2X6XA 1SFKA 4MLOA 2EJRA 1LDKA 4M9ZA 1ON2A 3QOEA 4WXDA 4EOZB 1TTYA 1JE8A 3PQJA 3IL2A 1BI3A 3ML6A 1RI7A 3K4MA 3DPTA 2VBZA 4KT5C 1K79A 2WBMA 2W57A 2PJRB 4RM3A 2CV0A 3F8CA 2VJIA 2VBWA 2P5KA 1IRGA 3CJQB 1G59A 2HTSA 1QQIA 3K10A 3WTSC 4JGHD 2K9MA 3NEUA 2F4IA 1IRFA 4MTEA 3K4LA 4RGRA 1IN5A 4ZTJA 2W7NA 4Q5SF 1PP8F 3MKYB 1TBXA 4HF0A 2DBBA 2DLLA 3RCOA 3GFJA 4WF2A 4WX9A 3ZP5A 2JVGA 2H6BA 2UWMA 1ZG3A 2F5EA 4IJAA 4WQOD 1B9MA 3DEEA 2A5YB 2KRFA 5HVQC 3OYEA 2FU4A 4CUGA 2MH9A 4HLXA 3V8JA 1BR1A 3OL3A 2DPDA 3ECOA 1K78B 4XONA 2KQRA 4A12A 3OY9A 1SMTA 1IN6A 3GFIA 1FYLA 2L9SA 1QBJA 4IF4A 5DCMB 4U88A 2F6CA 4EV0A 1S3JA 1WJCA 2KKOA 2KL4A 5CPRB 2WC2A 4Y15A 2W1OA 1MD0A 2G7UA 3V42A 4BYYA 5LHGA 1V4RA 4XKVA 1MNEA 3MCZA 2IA0A 2FBIA 2WY7Q 3TOBA 1X1AA 2ZXHA 3LSIA 1LEAA 4ESBA 1Z3XA 4CCMA 1JI8A 1AOYA 2BW3B 2I8DA 2L01A 3PNTA 5H20A 4A6DA 4A0YA 2HEOA 1Y56A 4CH7A 4MQVA 5L3GA 2EA4A 2KRCA 4HF1A 3QP5A 1SD6A 1USSA 1UFMA 2XKPA 2JSPA 1J09A 2Y0MA 5L3DA 2MH2A 2XAQA 3EUHC 3FWEA 1X19A 4XLEA 1MDMB 4B43A 2XAFA 3PFIA 4RB3C 2DXIA 3IKTA 2M4KA 3LFKA 1G6NA 5CJ9A 5KNLA 3NRVA 2LF7A 3HOSA 4BNCA 2E60A 2W82A 3HSFA 3K4BA 4KISA 1B1BA 3MKWB 3I54A 1KQ8A 2R7FA 3H5RA 3OYFA 3O2PE 5E1ZB 3E1SA 4HSTA 4JBAA 1Z1DA 2IJLA 4L5JA 4AVZA 2KP6A 4OU0A 1MW7A 1YLFA 2R3SA 4M9SA 4GO1A 4XNFA 1XDSA 3V4GA 3P9CA 3FBNB 3ZN1A 3DPUA 1XGSA 3R0JA 4E7JA 1MNDA 1D0XA 4CICA 4M72A 3LSHA 1Z05A 2VPLA 3AL0B 2HYGD 2IS6A 2O8XA 4PSWA 1IAWA 2FBKA 3F72A 3BROA 2LRDA 2PMZA 3RPUA 3OOUA 1O3RA 1VZ0A 2K3PA 5CQEA 3Q9SA 3HUGA 3I0TA 1QHGA 1D8JA 1QZYA 2ZCWA 3PSFA 2HFHA 4G6QA 2JRTA 2HKOA 3CUQB 1BI0A 4JK1X 2FSWA 4BE1A 4CCKA 2QLZA 4CHUA 4XKCA 1IF1A 1IXCA 1T2KA 2A68F 2PJRA 3MZHA 4ZJZA 4XL9A 3KP2A 3ZN0A 2FOKA 3M9AA 2V4JC 1EV7A 1FBUA 2ZMEB 1WJBA 5CVRA 3LL7A 3H5AA 3H92A 1S7AA 1V5EA 4LIVA 5BPDA 3WU0A 2AQEA 4N4OB 1R1TA 4WK8F 3I5UA 3QYEA 2PG4A 2XF6A 3MWMA 2QUFA 3C2GA 4L9VA 4L0ZB 5LBQA 3SEQA 3HHHA 4P55A 5KVRA 5ICEA 4Y3OA 2ESHA 2OBPA 2OQGA 4IZZA 1Z91A 1KYWA 1LVKA 2XF7A 3RKXA 3OYJA 3OYNA 1BR4A 4A0ZA 4U7BA 1S9HA 2OV7A 2K9LA 2L9NA 3VOEA 2KZVA 2DT7B 3PQKA 2EWNA 1WJFA 2CO5A 2BOLA 2HPMA 3S3MA 4M71A 4YEJA 2LY1A 2MLGA 1ZELA 4KT6A 4GYIA 4ZYAA 4KMFA 2RNGA 1T39A 1LDDA 3HYIA 5D6FA 2F5DA 5F1RA 2NS0A 3HIFA 1MJ9A 5LRSA 1SD4A 5FD6A 2WA0A 2NRAC 3F8BA 1U3EM 1R1VA 4LD5A 5D5WB 1HXDA 3VFZA 1O3SA 1J9IA 1IN7A 3H35A 3K6GA 1TQPA 1TNSA 2FF4A 2RNJA 3GEZA 1Z21A 1FC3A 2LC2A 5D5VB 1Z3YA 2A69F 4UVAA 4DBRA 1W7PA 2PQ8A 2IGMA 1NHAA 3E6BA 4UNOA 2XSJC 2R7XA 5FFZA 2EK5A 3VSKA 4U0VA 3F3XA 3WTWC 1UCRA 2LBFA 4BEHA 4II3A 3M8EA 3K1PA 1P4WA 2QENA 3HOTA 4BJ5C 4BXUA 1J2XA 2K02A 4CGZA 1USTA 2O5RA 2D45A 2VC0A 4S04A 2KPMA 2HGCA 3I59A 5BOXA 4P5OA 5D8LB 3HKZA 3LWFA 1FSEA 1IN4A 1ODDA 1J5YA 3E5UA 3BWGA 1HQCA 5EEHA 3BC8A 3HPHA 4XSZF 2R7OA 2M8EA 4I98B 2UV1A 4AIKA 3K70C 2R4GA 3FXQA 4M6XA 3O6BB 2Z3YA 1TQMA 2OZUA 2RC4A 3FZVA 2CSOA 3QAHA 4KIGA 1JGSA 4A2UA 1R22A 2ESNA 4AD9A 2E5NA 4RAZA 2PEXA 3FMQA 3WE2A 2HVQA 1XCVA 4YIFA 4F3QA 3RQ4A 3EYYA 5BS6A 2GZWA 2Q0OA 4E4HA 3FF5A 2UXNA 3REOA 4NB5A 4KYWA 3BCBA 3WU1B 3QOPA 1RNLA 5TRDA 5ERIA 4OAZA 4HA8A 3OYAA 1LFPA 1TW3A 4I0AA 3NQOA 3R0AA 4LK1F 3L9FA 3CP2A 4BQOA 1YTYA 4AYBA 2R7SA 4F55A 1D3YA 1YX5A 1ZRFA 4OAYA 3J81K 2PMHA 4EJUA 3I9V2 3HTSB 5HLGA 3RSNA 2LY2A 3IWZA 5DV5A 3U2RA 2J5PA 4LJZF 1BC7C 3HRMA 1MMDA 4BXFA 3HUGB 1YW7A 2LF8A 1GHCA 2BVLA 2IPQX 3EUAA 2JSCA 4RB2C 3RI4A 2PFBA 3BCAA 1G4DA 1U78A 4WWCA 1D8KA 2IRFG 2CH0A 4ENJA 4P9UA 3M1EA 1HW2A 3E3VA 1T95A 3ELKA 2L3DA 2WV0A 4AP2B 1I27A 4HAMA 2VJJA 3OWTA 2FE3A 2NYXA 3GX4X 2XROA 4WXCA 1FMWA 3EYIA 2CQKA 4A5MA 2GOXB 4O6JA 2ZNYA 2WADA 3DV8A 3F8NA 3AAFA 3DU6A 3CUQC 4O5VA 3J80Z 2XAUA 4E6KG 5LEKA 5E1XA 2Z2SB 4PJLA 3D5RC 2IT0A 1OR7A 4LB5A 1P6RA 1D1BA 4I2OA 5F6FA 2P5LC 1E2XA 4BJ6C 4ZC3A 1LDKB 2A6TA 2VQLA 1HW5A 2OC6A 1H0MA 5CQGA 1IZ1A 4G8XA 2F5FA 2DFIA 4HQEA 4GCVA 3CZ6A 3S3NA 2YX7A 3BJOA 2R7QA 3DFGA 3I4PA 3MQ0A 2WAFA 2BYVE 3HHGA 2RQPA 5E8IA 2R7VA 5DUIA 1LQ1A 5FFXA 2RGVA 2IS1A 2Z5UA 1R1UA 3V8LA 1R00A 3E6CC 3OYBA 5BPIA 1KU3A 2Z99A 1JHHA 5IT9K 3L2VA 3LA2A 3Q5FA 3SDBA 3F6VA 3BPVA 3LSGA 2EFWA 4KN7X 2PMUA 3HSEA 3ZPLA 1X4PA 2R7UA 5ICGA 1JHFA 4EM1A 4LG0A 2Q1ZB 3V7RA 1YE9A 1QNTA 4HX4A 1HA8A 3WTXC 4GYGA 1S6LA 4XRFA 3H5NA 1L0OC 4AVPA 3SZTA 1QZZA 2M7AA 2W24A 1O57A 4M6YA 4EMSA 2ZFUA 4XKWA 2YU3A 3RKWA 2F5VA 1X4OA 1SD7A 2QZ8A 2GXGA 3CESA 3GFMA 4BS9A 3VDXA 5CLSA 1HSTA 4GXOA 1K78A 1O3QA 1W5TA 1XMKA 5BMZA 3FM5A 1K7AA 3F21A 5FLXZ 5HLIA 5HS9A 1V3FA 2IA1A 2BVMA 4IQJA 3L00A 4CCLA 4IX7A 2X4HA 2DT6A 1LB2A 1O7FA 1FZPB 2FRHA 4ETSA 1ONVA 3FMSA 3RDIA 3GZ5A 1I6XA 5ILVA 1FOKA 4KIBA 1U2WA 2L2OA 3CDHA 5FROA 3QRFF 1P4XA 2TDXA 1V5GA 3EUHA 4E7SA 2GIVA 5CVJA 2QQAA 2V1NA 2LYCA 3S32A 4G6TB 2H09A 1DGWY 3LQRA 1YW8A 3DLAA 4IRIA 2VOOA 1KA8A 3PSIA 2A6HF 2K4JA 1BC8C 5ICCA 1DQUA 1OPCA 3WTZA 3K4KA 1X1CA 4U0WA 2V9KA 2DK8A 3DWLE 3V8KA 2Q2EB 1J0RA 4A5NA 1EA3A 1ERDA 4CCJA 2M5WA 2EV6A 2XAGA 3KEYA 3BLYA 5K5QA 5E17F 3PL8A 4EM2A 3HRUA 3OIQA 4UV8A 5HS8A 3K4JA 3WTYC 4HW0A 2ELJA 4NQWA 3RYPA 3M1CA 4XMYA 4K2EA 1HW1A 3GW2A 3IAS2 4BE2A 4G7HF 2CV2A 1DPUA 5DD4A 2LBFB 4PJJA 4L9NA 1ZHFA 2IGOA 3TDZC 3W6JB 5DEQA 4I01A 4UUVA 2VJ5A 5FRNA 4HNUA 2IP2A 2VC1A 4PK4A 4F92B 1TT0A 1N77A 1YYVA 4CSWA 3ZGKA 3BJAA 2EFQA 1KU2A 3GFLA 3DKXA 4HG2A 4D0PA 2HDCA 4NNJA 1G3YA 2O61A 2LH9A 4D9JA 1WI9A 1ZLKA 1U0JA 3TKYA 3FHZA 4YELA 5CVUA 1X1DA 4DOZA 4WCGA 2R7WA 2Y0SA 4HYEA 1HKTA 1Z6TA 3GO5A 3O3KA 1ZN2A 4U0YA 2STWA 3ABTA 2FNPA 3LAJA 2DQLA 2UZKA 2VE9A 4KDPA 2ZXIA 3LAPA 5JR3A 3DTKA 3GUDA 3EUKL 4HV5A 4Y33A 4FASD 3DXJF 3TMOA 1IW7F 4RAYA 4J01A 2OQRA 1P9QC 4H0EA 1IRXA 4EGYA 3DF8A 2L02A 4ZZDA 2IGKA 3ZMUA 4HLYA 5FRMA 5JFRA 1MJBA 1DUXC 1U8RA 2AQFA 3OYCA 1XSXA 2VE8A 3CO6C 1RZ4A 2G9WA 3AFHA 4E7KA 1W36C 5JI6A 4RMNA 1EH6A 2A3SA 3OYIA 2MLKA 2A6EF 4OOIA 2HVSA 1R23A 2KRHA 3HL2A 1KQ0A 4CCOA 2PLYA 3AKZA 5HOOA 4BQNA 2A5WA 1BOAA 1FWZA 1D1CA 2ELHA 1N78A 4O3MA 3K69A 3V7SA 5LHHA 4B3XA 4HOBA 2VN2A 3P9KA 2W84A 3MAJA 3FDYA 4RLQA 4F93B 2EV5A 1XGNA 4IQ4A 3L2WA 1Y0UA 2VKHA 2ZXJA 4XSXF 1MMGA 3HSRA 2JPBA 3F8MA 1T98A 3IWFA 4KJZA 4MEXF 4A64A 2L5QA 4DGWB 2BE5F 4DQ2A 3KP3A 4XLHA 3M8JA 4E70A 2DQRA 1J59A 1RUNA 3NWSA 2ZNZA 4PUSA 2QYOA 3L2QA 3ECHA 4M74A 3ZRGA 2L54A 2MFZA 1NG7A 3K9TA 3ZR8X 2RQQA 3CF2A 1FYKA 3UNGC 2QBYA 2M3AA 2VQCA 4RM2A 3N97A 3HRSA 3VYUB 1TQIA 2D1VA 2XRNA 2GA1A 4FHTA 3SXYA 2QKMB 4AWXB 2RN7A 2XASA 2BEOA 2IA2A 5HDNA 2V6EA 3RKYA 3E97A 1RUOA 2COMA 1UELB 3FXRA 4Q48A 2VIXA 1MJAA 2CS3A 1FX7A 5ILSA 1R5GA 1WJAA 5HLTA 4BHPA 2M0MA 5L3BA 3ZXSA 5KCMA 1W7PD 5K5RA 1UG0A 1CF7A 1WRJA 4BH9A 1Q1HA 2XAJA 1XMAA 2MBFA 4GGGA 4ENMA 4U87A 3SEZA 3DP7A 4G6DA 3OYDA 1MMAA 2HQNA 5F64A 1R7JA 3JSPA 4BEHB 4C2UA 2V26A 3MEXA 1XD7A 4B8XA 2QQ9A 4B44A 5ILUA 2QKLB 2H94A 2F2EA 2HYFA 2KDOA 2GQQA 4ZYGA 2W00A 2K86A 2E7XA 3F9KA 1U6GA 5FGMA 4LK0F 5FB2A 3KP5A 2PBIA 2IGNA 2BGCA