4P5OA

Structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3-e2~ubiquitin-like protein-substrate intermediate trapped in action
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
361
structure length
327
Chain Sequence
SKSPEELARYCDSLLKKSSKNPEEAELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLYTVQQLTDSTQIKMDILAQVLQILLKSKLPDTLIRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMRMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cullin-1
publication title Structure of a RING E3 Trapped in Action Reveals Ligation Mechanism for the Ubiquitin-like Protein NEDD8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 96
structure length 327
sequence length 361
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4p5oA03
1.10.10.2620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4p5oA02
1.20.1310.10 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like Cullin Repeats 4p5oA01
2M45A 2HOEA 2ISYA 2OQGA 5ERIA 1S29A 2W57A 3BPVA 1CF7B 4RGSA 2BE5F 1BC8C 1G3TA 1ZREA 1I1GA 2MC3A 5HS9A 3N97A 2GWRA 4N9HA 2VOPA 3ABUA 4OIPF 3WGHA 2HGCA 1FY7A 3KZYA 5CVUA 1OYYA 2A69F 4OMYA 2FNPA 1MJBA 1SAXA 2DW4A 2V1XA 3O6BB 2VBZA 1R1VA 3BJAA 2HWVA 2H6CA 4CXFA 2NYXA 3F8BA 3J80K 4G7OF 4HF2A 2DT5A 2O03A 4G9YA 5FFZA 2BEOA 5LBQA 3HTSB 4AIHA 2IT0A 3L7WA 2ZXJA 3R6SA 4RB3C 2XUBA 4EM0B 3IKTA 3ML6A 1ZG3A 5HS8A 2JPCA 3QAHA 1I6XA 3F23A 3TGNA 2O3FA 3JSPA 4PZJA 3V7SA 2QLZA 5J6XA 1ZLJA 1AOYA 1EH8A 2QQAA 4CHUA 3GO5A 4U0WA 2AS5F 4YFNF 2IVMA 4IRHA 5BMZA 1IXRC 1D3YA 4F52A 4MHGA 1KQ0A 3FWEA 1HQCA 2ZNZA 1FPQA 3E6BA 3I53A 4A6EA 4BNCA 1KU2A 1R7JA 3WE3A 4MQ9F 2EV5A 3ZMSA 1XMAA 4EM2A 2MLKA 3FMQA 4Q4ZF 3G73A 1LDKB 1QNTA 4L9JA 4KN7X 3ZP5A 1QZYA 4L5IA 3RDIA 1TLHB 2XKPA 2EFPA 4HBLA 3M7GA 3F72A 4EJWA 2UXNA 3HSEA 1XN7A 3HHGA 1YS6A 3RIRA 5E1XA 5BPDA 1SMTA 1G6NA 1HXDA 2BV6A 3D0SA 3U1DA 1H9GA 1XCVA 2WZKA 4RGUA 3ZMZA 5DD4A 4RAYA 3SZTA 3ZQ7A 2RV8A 3KLNA 4ENJA 3IWZA 3WTSC 1KQ8A 2DU9A 3BWGA 4GYGA 1W7PD 5TJJA 5D6FA 4GYIA 3DPLC 2Z5UA 1QZZA 1D5VA 2P5VA 2VE8A 3U2RA 2KJCA 1P6RA 1TNSA 1D8KA 3K1NA 2EFWA 4YFXF 4ESFA 3J81K 3TOBA 4ZH4F 4Y15A 3VFZA 1TNTA 1T2KA 1YFHA 1ZARA 3RTRA 3HRMA 5EEGA 1XGOA 4M71A 2DQRA 4AIJA 1T39A 1FSHA 1H0MA 4I7HA 4EM1A 2F5FA 3E6CC 1H9TA 2CFXA 1SFUA 5JR3A 2LNBA 4L5JA 4FX0A 1ODDA 3B73A 4BAYA 3HHHA 2BYVE 1K78B 2PQ8A 2ZBKA 1PP7U 2LF7A 5FLXK 3E5XA 4HF0A 1PP8F 2Z33A 2P6TA 5L3EA 3BPXA 1MZBA 1ONVA 4RB0A 3HRSA 4MQVA 4FT8A 4UHTA 1BN5A 3I4PA 5LGTA 2Z9OA 2UXXA 4OIRF 4NHJA 3R0JA 3VB2A 2F5CA 1GXQA 1BIAA 2LKPA 2QQBA 1ZAOA 3W6JB 1ZGJA 4BYYA 4PGGA 1HW1A 1LB2A 2H94A 2J5OA 4M9XA 2JRTA 2HYGD 3I54A 4I01A 4KYWA 4RGRA 1V4RA 3WU1B 4ZZDA 3GXOA 4WXCA 4OU0A 3H3ZA 4IHTA 2PN6A 3C7JA 2Q0OA 1J0RA 5HVQC 4A64A 3JTGA 1ZYRF 1Q1HA 3TO6A 4U7BA 2A07F 4ESBA 4WCGA 1Z6RA 2D1VA 4ENNA 4Y17A 3F8MA 5JFRA 4DQ2A 3K1MA 3GFJA 1XGMA 3FMRA 4XBFA 1B9MA 5D4RA 3GEZA 3LFKA 5HDGA 4TV7A 3K69A 1FP2A 4LB5A 1IZ1A 1RI7A 1ZLKA 3KZZA 2W25A 4UV8A 3SZPA 3EQLF 1YW8A 2FBIA 2HFHA 1T98A 1Z05A 5D5VB 1ZG1A 3WE2A 4QLCU 4KMFA 3FXRA 4PCQA 1JHFA 4LFUA 4Q48A 2HS5A 3DP7A 4N9F3 1YG2A 3EYIA 2DLLA 4MEYF 4R8HA 3WTWC 5BOXA 1F9NA 3E6DA 3QU6A 3HIFA 2IA2A 1TTYA 1MJAA 3M8FA 1K6OA 2DTRA 3SQNA 2RKHA 1K79A 3GW2A 1E17A 1FWZA 3FF5A 4ENKA 2CGPA 4FHTA 3T8TA 4HLXA 1BI0A 1WI9A 1BIBA 3QPHA 2A68F 1YW7A 1RUNA 3FXQA 3FM3A 1S6LA 4KA4A 3FX3A 3K0LA 3HYIA 2QYOA 3ZPLA 4M6XA 1UHMA 1U3EM 3KCCA 3O2PE 2FMLA 4A12A 1IF1A 2GXBA 4DNCA 3QP5A 5LHHA 1FYLA 3DF8A 3L9FA 4GO1A 3WTYC 2QENA 5HS7A 1FSEA 1QGPA 5LRSA 1DDNA 2D1HA 4CDGA 1GHCA 4EJVA 2XAJA 4LG0A 2HEOA 5BS6A 2HDCA 1R1TA 3L2CA 1QBJA 2VOOA 1SD4A 3ELKA 4IHSA 5FFXA 5HDNA 5DCMA 1JE8A 1B6AA 1LVAA 2OQRA 4CYDA 1OKRA 4KIBA 2ZKZA 3KETA 2OZUA 1U5TB 4GGGA 5E17F 4UVCA 3WG9A 4U88A 1GVJA 2P7VB 3LAPA 3I59A 2DPDA 1O7LA 4KMUX 1FT9A 3R60A 5CVRA 1IRFA 2KRFA 4OIOF 2P7CB 4AD9A 1MJ9A 4G6QA 3IKVA 4I0BA 2ISZA 2PBIA 4ZYDA 4A0ZA 4LJZF 3SHFA 3WTTC 5FGMA 4JBAA 2ESHA 5D5XB 2DAOA 1RUOA 4GCVA 2G9WA 4PDKA 2KJBA 3QU3A 3KFWX 2RC4A 3TDZC 2FEZA 3IWFA 1S3JA 3VEPA 3C3WA 2QQ9A 4R79A 4IRIA 4XLPF 4MTEA 5AIQA 1OMIA 5ICFA 2JPBA 3MFKA 2J5PA 2VODA 5F6FA 1P4XA 2P5LC 4M74A 3F6OA 1CGPA 2EFQA 1T0FA 3BZ6A 2VBWA 4BXUA 3WTVC 1FZPB 2VN2A 2R3SA 1SFXA 1LDJA 1EH7A 1FC3A 2PJPA 2MH9A 5HLGA 1FBSA 2Y48A 1YS7A 5TRDA 3RYPA 3ABTA 4M9SA 2CQKA 2E7XA 1UFMA 2HQRA 2Y75A 2ZMEB 3MZYA 4S04A 2L4AA 4ZYHA 4HDVA 3DPTA 3LWFA 3MQ0A 1BBYA 4RAZA 2GA1A 3QP6A 4KDPA 2ZO4A 1ZRCA 1BM9A 4I0AA 1XCBA 2P6SA 5LRRA 1HSJA 3HTUA 5LEJA 5E18F 5H6RA 3TQNA 6PAXA 1O57A 5D4SA 1W7PA 1WWXA 1J75A 2JTVA 3CUQB 2QWWA 4K2EA 3E6MA 4BHCA 4HYEA 3HSFA 3RJPA 1F5TA 4A6DA 1TBXA 1FYKA 2G7HA 4HW0A 4F7ZA 3KEQA 3SXYA 4LLGF 4L0YB 5A2QZ 3TDUC 1ZHFA 4ZZLA 3G3ZA 2OZ6A 2XGXA 2CYYA 1LEBA 2FRHA 2JT1A 1TQMA 3JAMZ 3COAC 4HQMA 4I02A 1G3SA 4N0BA 1WRJA 2V9VA 1T6SA 4EV0A 2PG4A 2YR2A 3P9KA 4EOZB 3EYYA 2QVOA 5CLSA 1HW5A 2L02A 2O6GE 1CF7A 1WKMA 4XLNF 2F5DA 1TQIA 2VE9A 4I2OA 3BDDA 5ILSA 4RB2C 5AIPA 1ZG5A 1O7FA 2ESNA 1PDNC 3F8CA 1R22A 2W24A 2IW5A 2H09A 5K5RA 2VT3A 1MKMA 3Q9SA 4MEXF 3VOEA 2HQNA 3ZMTA 1XDSA 5LHGA 4M6YA 1XB4A 2M1BA 2QBYB 1LQ1A 1T38A 1L3LA 1DPRA 2VC0A 2XAFA 2GQQA 1V3FA 3GFMA 4M73A 2XVCA 2VBYA 2CSOA 2A6EF 3R61A 5D8KB 3M1EA 3RKYA 2O0YA 3K9TA 5DD8A 1ZH5A 2OAZA 4G7HF 3P7NA 1J59A 1JGSA 4WXDA 2XV4S 1XGSA 4UUVA 2MA3A 3EETA 4M72A 3NRVA 4P5OA 4HLYA 2P8TA 5IT9Z 1ON2A 3L09A 1W5TA 2XAHA 4I09A 3GFLA 2A61A 4RS8A 4NB5A 3V7CA 3HRUA 2CG4A 5DUIA 1Z1DA 1LDKA 2ETHA 1MDMB 3U9GA 5K5OA 1LNWA 1IN6A 3MZHA 5ICCA 5AONA 3P9CA 3V8LA 4CICA 2K27A 1R5HA 2QUFA 2R7FA 1L0OC 4CO8A 1XSDA 4M9ZA 3BROA 2FA5A 4ZYEA 1KGSA 3E5UA 5FD5A 1SFEA 5DYMA 1S8NA 3S2WA 2EV0A 1B4AA 2DK8A 4LGWA 2NNYA 2IJLA 3J80Z 5E20A 1R5GA 3GZ6A 1BI3A 4L9NA 3M8EA 4LD5A 5D5WB 5FB2A 2EV6A 2UZKA 4U0YA 2BBYA 2P4WA 3GX4X 4UV9A 4B8XA 4G94A 4B09A 4XSZF 3M9AA 4QWQA 4HX8A 1BI1A 4HQEA 4HV5A 3KEOA 3SFZA 2RNJA 4KNYA 2PMHA 5ED4A 1MGTA 2EK5A 2EA2A 2HKXA 2V1UA 1OPCA 1OYIA 2FU4A 3RPUA 2O61A 5HLHA 3LSTA 3ZMDA 3I0TA 1HKSA 5JVTA 1IUYA 3K1PA 3OV8A 1P92A 2GIVA 5KK1A 1Y0UA 3BJOA 3J7AO 1SD7A 4HZFA 4EJUA 2LSOA 4IJAA 4KFCA 1WSUA 1KQ9A 3CDHA 1AWCA 3MAJA 1K78A 3F22A 5KVRA 2OBPA 4O6JA 4HF1A 3BP8A 2MH2A 4R1HA 1O3QA 4EQQA 3V4GA 2PLYA 3LAJA 1KA8A 2STTA 1NHAA 5DEQA 3RI4A 2E1CA 1JHHA 1FOKA 2E1NA 4WQOD 2ZFWA 3GYHX 2FMYA 2Q8KA 1BOAA 3WTUC 4WK8F 3T0YA 2A5YB 5A2QK 4U0VA 2M8EA 2LF8A 3QRFF 3T1BA 5CYVA 5LEKA 2XASA 2MD5A 3O3KA 2XAGA 4CZZA 3JAMK 2FE3A 5BPIA 1PUEE 3GUDA 3ECHA 3QOPA 2WC2A 3F8NA 2DI3A 4HX7A 3PFIA 2FNAA 1MD0A 2BGCA 3IRRA 3TO7A 3BJ6A 5DV5A 2DFIA 2C6YA 1XD7A 4KIFA 1U2WA 3ROUA 3IRQA 3GLXA 1OR7A 1ZN2A 5D6EA 4Z2YA 3N4MA 3F8FA 1FBQA 2K7LA 3FM5A 3LA3A 2NAZA 3V8JA 2KIUA 4EJOA 1XDUA 2L01A 2FXAA 1F1ZA 1P2FA 3OOPA 1BC7C 5CVJA 1UCRA 3LA2A 3H92A 2MBFA 2YPRA 3R4KA 3I64A 1Z6TA 1U5TC 4UNOA 2DK5A 3CJNA 4BHBA 1Z9CA 3V7RA 1VTNC 3JW4A 4MTDA 2VC1A 1IN7A 4H0EA 2ADUA 2ELHA 1C0WA 3E5QA 5J8FA 1J2XA 2X0LA 5BQTA 1RZ4A 2L4MA 1HSTA 4O5VA 1R00A 4KN4X 3B02A 2FBKA 3FXUA 4JQFA 5LGUA 4YG2F 3WODF 1J9IA 2YX7A 1DUXC 1XSVA 3PQKA 1LDDA 2A3SA 2F5EA 2CW0F 4HXIB 1TW3A 1YIOA 2YX4A 5IT9K 3JTHA 1Z7UA 1LEAA 4EJTA 2D2WA 3DEUA 5DDGA 1IXSB 2PEXA 4A5NA 5DUKA 3CTAA 2OA4A 3KP4A 2FQ3A 1YO5C 4ON0A 1FX7A 2HTJA 5L3DA 5DCFA 2P5KA 1KYWA 2CO5A 3ECOA 1QPMA 3W6KB 2D45A 2OU2A 4OIQF 4KUMA 2O8XA 1J5YA 4IVNA 2PFBA 3HOSA 1G3WA 2EFOA 4FX4A 1HKQA 3HUGA 1U5TA 4PGHA 3GVAA 4BQAA 3WGGA 1I1SA 2RN7A 1HKTA 1FBUA 1W4MA 3LQQA 3WTZA 4I98B 3ZN0A 2YSRA 3KP2A 2XRNA 2HZTA 1G3YA 1USTA 1EH6A 3BY6A 4ASNA 3AAFA 2L3DA 5HDKA 4LLLA 3FHZA 4JGHD 5LLQA 4WF2A 2DO7A 2IP2A 4EMSA 3ZMVA 2NRAC 5JI6A 4MGRA 3GZ5A 3IC7A 4ESJA 3CUQC 5EEHA 3TKYA 2M30A 2HYFA 1TQPA 1UB9A 2GAUA 2NS0A 4IXAA 4G6DA 2ZJ2A 5LHIA 2IA1A 1X3UA 2GXGA 3E97A 3HSRA 4IRGA 1IN8A 4AP2B 5E1WA 2R7DA 2STWA 3Q9VA 4A0XA 3KP3A 1XMKA 3DXJF 1U8RA 2Z99A 4S05A 1IRGA 1ULYA 1FYMA 1FP1D 1STZA 1HW2A 2HR3A 2XIGA 1O3TA 4XRFA 3T8RA 1BJAA 2L54A 5HOOA 2XROA 2ZMEA 4RB1A 5JHUA 3I5UA 3FMSA 3RKXA 3MCZA 5ILUA 4HAMA 2ZCWA 4AIKA 4LB6B 1IN4A 2W85A 3C18A 2JSCA 5IT3A 1USSA 1TW2A 1O3RA 3LA7A 4WX9A 3GF2A 4L9TA 5ILVA 3CO7C 3BOQA 3P9IA 5H20A 1ZRFA 2PMUA 4RGXA 2PI0A 2OD5A 3CUQA 4KICA 4APFB 2HTSA 1ZGAA 1S7OA 4IPAA 2G7UA 4UVAA 4HA8A 3NQOA 3LQRA 5E1ZB 5HLIA 3PQJA 1SD6A 4P9FA 2RDPA 3DV8A 3REOA 3CUOA 3MEXA 2B0LA 3RKWA 3NEUA 4OMZA 1A04A 2H27A 2Y0MA 3KP5A 1HBXG 2K86A 4BHPA 1REPC 5F64A 4N9IA 2RVCA 3ZMUA 5ICGA 2KIMA 1B9NA 1R1UA 1Z91A 5CVIA 3V8KA 1B59A 2FOKA 2XKOA 4G7ZF 2GA2A 5J8CA 1YW9A 3JSOA 3MWMA 2W84A 4P9UA 1JXSA 4YIIA 2EWNA 3KLOA 5L3GA 4ETSA 2VBXA 5K5QA 2F2EA 2FBHA 2RQPA 4A0YA 1KYZA 3R0AA 4EGYA 1RIOH 4HOBA 1ZRDA 4HV6A 2FF4A 1QQIA 2V1DA 4LG0B 4LMYA 4UVBA 3F21A 1I27A 2AXLA 4JK1X 2KKOA 1XGNA 2QBYA 2GZWA 4ENMA 1XSXA 2MLGA 5LGNA 4HX4A 1E2XA 1OYWA 5DCMB 1KU7A 1R36A 5D5UB 4LK1F 3EUHA 1YYVA 1LJ9A 1YQAA 1WQ2A 5ICEA 1R23A 4WXHA 4Q47A 2V79A 1KU9A 5L3FA 4WWCA 4NQWA 2QM3A 3I59B 3KE2A 2CWEA 2ZNYA 2DBBA 4OOIA 4U7DA 5F1RA 5D8LB 4HDUA 3D5LA 3WGIA 3E3VA 1O3SA 1FNNA 2VONA 1IW7F 1SMYF 1BI2A 1U6GA 1S7AA 3I71A 3WU0A 4E70A 5CVVA 3DQVC 2XAQA 2JZYA 1YTYA 4L9VA 1P4AA 3ISPA 1I5ZA 4XSXF 2EJRA 2V6CA 1GXPA 3RPQA 2KIFA 2DQLA 1EV7A 1MDMA 4ZYGA 2EA4A 1IXCA 2TDXA 2LDUA 4UXNA 5L3CA 1J7KA 2WWYA 2FSWA 1B1BA 5K1YA 3WTXC 3I58A 2H6BA 1FLIA 5E8GA 3ERED 2K4BA 1D8JA 3DFGA 4Y13A 4G8XA 4L18B 4KT5C 1R58A 2EB7A 1SD5A 4OINF 3K2ZA 3QPTA 1DPUA 5CJ9A 3Q5FA 3J81Z 2ACJA 2E7WA 4D0PA 2XHKA 4BH9A 2IA0A 1F4KA 3TOAA 2NNNA 1RNLA 4LK0F 1P4WA 2VT2A 4EGZA 2EFNA 3KP6A 3FZVA 4YIFA 2VXZA 3ZN1A 2YU3A 4P55A 4A5MA 3RYRA 5E8IA 4EVIA 2WV0A 4MNUA 2WTEA 1IN5A 2IPQX 2Q2EA 3IHUA 3T5XA 1K7AA 2K02A 3GFIA 2A6HF 3ULQB 5FLXZ 1DP7P 1W7PB 5FD6A 1YLFA 3DKWA 3C1DA 4KIGA 1W5SA 3F6VA 3TO9A 4A2UA 1QO0D 3CO6C 3H3UA 2COMA 2IRFG 4O3MA 3KP7A 2UWMA 1UHWA 5H6QA 5L3BA 2K4JA 1KU3A 4P96A 3EDPA 4GXOA 2M87A 4AWXB 1IAWA 4LLNA 2HKOA 2RGVA 2M5WA 4CGZA 3F3XA 3HOTA 2QZ8A 4IF4A 4Q5SF 1U78A 1G4DA 4AVPA 3HRTA 5FO5A 4YFKF 2Z3YA 1ON1A 3IL2A 3CLOA 3GWZA 2X4HA 3VODA 4L0ZB 2DPUA 3L00A
chains in the Genus database with same CATH superfamily
1ZTRA 2M45A 3DLAA 4A3CJ 5EF6A 3ZQQA 1I3QJ 2HOEA 2ISYA 5KAIC 2OQGA 4D5FA 2D5VA 1TT5B 1X2NA 3DBHB 1WVRA 5ERIA 4FE7A 4JX5A 1S29A 4C2MJ 1A31A 2W57A 2CH0A 3BPVA 2JJ7A 1CF7B 4RGSA 1QRYA 1T8IA 2BE5F 1BC8C 1G3TA 1ZREA 4DYQA 1I1GA 2MC3A 5HS9A 3NWTA 3N97A 2GWRA 3HJEA 4N9HA 3CMEI 2VOPA 3ABUA 2GM4A 3BG3A 3FBIB 4N4NB 2OPTA 4OIPF 3CCVI 2VKHA 3U21A 5B1BH 3WGHA 4ZTFA 3BR3A 2HGCA 1FY7A 3KEYA 3KZYA 4KT6A 3HGGA 2R0QC 1B8IA 2HVRA 1HC8A 5CVUA 4A3GJ 1UG0A 1OYYA 2R4GA 4XRSA 2A69F 4OMYA 1MMSA 2FNPA 1MJBA 4XKVA 1SAXA 3ZCOA 4BJ6C 1OCTC 2DW4A 2V1XA 3O6BB 5CKTA 2VBZA 3GTLJ 2VQGA 3IH4A 1R1VA 3BJAA 2HWVA 2LVSA 3CCLI 2H6CA 4CXFA 2R7QA 2CV0A 3FDYA 4IL6C 2NYXA 3F8BA 4HSTA 4RM2A 3VYSB 3J80K 4G7OF 4NUBA 3SEQA 1VQ7I 2DT5A 4HF2A 4EATA 3OYGA 2O03A 4G9YA 5FFZA 4HNTA 2BEOA 4HRIA 5LBQA 1MH4A 5M3MJ 4M3DA 3OY9A 3HTSB 4AIHA 2IT0A 3L7WA 1ACIA 2ZXJA 3CP2A 3G71I 5KHDA 1IV6A 1W1WE 2JMWA 2H1LA 3R6SA 4RB3C 2XUBA 2JA2A 4EM0B 3HKZN 1JJ6C 3IKTA 3ML6A 3ZXSA 3RQ4A 1RPWA 1ZG3A 3BG7A 5HS8A 2JPCA 3GZNB 1I6XA 3QAHA 1ZR2A 3F23A 3TGNA 2UV1A 2O3FA 3JSPA 4PZJA 2MSYA 3V7SA 3LSPA 2M4KA 2E2IJ 3GTMJ 3H35A 3JR9A 2QLZA 1TL8A 5J6XA 1ZGWA 4IKFA 1ZLJA 1R6RA 1AOYA 3RZDJ 1EH8A 4QPQA 3HXLA 5J1RA 2QQAA 4CHUA 3DU6A 3GO5A 4U0WA 2AS5F 4YFNF 4DIQA 2HDWA 2IVMA 4IRHA 1ETOA 3CCMI 5BMZA 2HI3A 2JA7J 1IXRC 1D3YA 2BOLA 4F52A 4XLCA 4MHGA 1KQ0A 3FWEA 1HQCA 2ECCA 4F55A 2ZNZA 1VQ9I 1D1AA 1RRJA 1FPQA 3E6BA 3I53A 4A6EA 4BNCA 1X4PA 5EG0B 1KU2A 1R7JA 2YS9A 3WE3A 4CH7A 4MQ9F 5F1JA 1Y1VJ 2EV5A 3ZMSA 1XMAA 2NS8A 4EM2A 2MLKA 3FMQA 4Q4ZF 3G73A 1Y8RB 1LDKB 4NDLA 1QNTA 4L9JA 3QWLA 2X6YA 2L0KA 4KN7X 3ZP5A 1QZYA 3ZRGA 4L5IA 5CQGA 1TLHB 2XKPA 3RDIA 2EFPA 2HPMA 4JP0A 4HBLA 4QTRA 3M7GA 3CCEI 2K9LA 3F72A 4EJWA 4FISA 2UXNA 3M8JA 5FRNA 2L9RA 1XN7A 3HHGA 3HSEA 1YS6A 2PX9A 4BJ5C 3RIRA 2QGUA 5E1XA 3BCBA 5BPDA 1SMTA 3MD2A 1G6NA 4FE4A 2W1OA 1HXDA 2BV6A 2E34A 4JYKA 3D0SA 3U1DA 1H9GA 1XCVA 2WZKA 4YIRX 1MNDA 3ABKH 4RGUA 1LE8B 4PFOA 1I6HJ 3ZMZA 5DD4A 1YX5A 4RAYA 1FTTA 2JUCA 3SZTA 1JJ8C 4IHYA 3ZQ7A 4BEHB 4CYCB 3U1KA 3K4JA 5EZHA 1AU7A 1P7JA 2RV8A 3KLNA 1LKXA 2LP0A 4ENJA 1XX5A 3IWZA 3WTSC 1KQ8A 1X2MA 2DU9A 2KRHA 2L7KA 2XPVA 2K9MA 3BWGA 5F0HA 4RA2A 3W2AA 4GYGA 4PJJA 4M3FA 2PJRA 1W7PD 4LITA 1SFOJ 5TJJA 1WZ2A 1JI8A 2VKEA 2QKMB 5D6FA 2PMZA 4GYIA 1T08B 4XR6A 3DPLC 2Z5UA 1QZZA 1D5VA 2P5VA 1GLNA 2VL8A 2VE8A 3U2RA 3JRCA 1UHSA 1GT0C 2KJCA 1P6RA 1TNSA 1D8KA 3CCRI 3K1NA 2EFWA 4YFXF 1Z21A 4ESFA 3J81K 3TP0A 3TOBA 2QF7A 4ZH4F 4Y15A 4GRIA 3VFZA 2EQRA 1TNTA 4E7LA 3DKYA 1T2KA 4XQFA 4PFPA 1EF4A 3FKJA 1F36A 1YFHA 3GTGJ 2FUG2 3HOVJ 1ZARA 3C2BA 3RTRA 5EZGA 1XPXA 1YE9A 3HRMA 2MABA 5EEGA 1XGOA 4M71A 4DJAA 4LG3A 3JRDA 5FKMA 2VUMJ 4H4KC 2DQRA 4AIJA 1T39A 2KDOA 1FSHA 4F92B 3K7AJ 1H0MA 4I7HA 4EM1A 2F5FA 3E6CC 1H9TA 3K4MA 2CFXA 1SFUA 2IS4A 5JR3A 2LNBA 4L5JA 4FX0A 1ODDA 2R7VA 1OCRH 3MN2A 4BBRJ 3ONQA 3B73A 1XMXA 2DA2A 4BAYA 4D5CA 3HL2A 3HHHA 3S17J 3S3NA 2FQ4A 3DKXA 2E1MB 4NNJA 2BYVE 4E7SA 1K78B 1ZELA 2PQ8A 2ZBKA 4BS9A 1PP7U 2WB1N 2LF7A 1K6YA 3S1RJ 5FLXK 4A3JJ 4IQ4A 1IO2A 2GIZA 3I4NJ 3CP8A 3E5XA 4HF0A 4RAFA 1PP8F 2Z33A 4DZPA 1PJRA 1ORKA 4NUUA 2P6TA 5F3JA 2Y8DA 5L3EA 3BPXA 4AIDA 3JRGA 1MZBA 1X19A 1ONVA 2YU9J 3AFHA 3LSMA 3BR0A 4RB0A 1FEXA 2PFVA 3HRSA 1FMVA 4MQVA 4FT8A 4UHTA 1BN5A 1BW6A 3I4PA 2B1EA 5LGTA 2Z9OA 2LY9A 2UXXA 4XORA 4IEJA 4BBSJ 4A3LJ 4OIRF 1WH5A 3ABLH 3CJTB 2ZSIB 2F4MB 3AG3H 3SZGA 3H36A 4NHJA 3R0JA 5IP9J 1HF0A 3A0HC 2M0CA 3PFYA 3VB2A 3VSLA 5IOZA 2F5CA 2EZIA 1GXQA 1BIAA 2K3FA 4F3QA 2LKPA 2QQBA 1ZAOA 3ZQLA 5J1YA 3W6JB 2Z2SB 1ZGJA 4BYYA 3K10A 4PGGA 1HW1A 1LB2A 2H94A 2J5OA 2VQLA 4DGWB 4M9XA 2JRTA 1S5LC 2BVMA 2HYGD 3I54A 4I01A 4RGRA 1V4RA 4KYWA 4PJ0C 3WU1B 4ZZDA 3GXOA 1RETA 1X1DA 1YJNI 2IBDA 4WXCA 1SEUA 1ITYA 2XPUA 4OU0A 3H3ZA 3CF5F 4IHTA 2PN6A 3C7JA 2Q0OA 1J0RA 5HVQC 2ZJRF 3JTGA 1ZYRF 4A64A 1Q1HA 3TO6A 2LREA 4U7BA 4ESBA 4UUSA 2A07F 2H8RA 1WJAA 3OYDA 2CS3A 4CCJA 4WCGA 1Z6RA 4FTHA 4X0GA 2D1VA 2ZXHA 4IX7A 2O8KA 4ENNA 4Y17A 1LFPA 3F8MA 3HDDA 5JFRA 2KLOA 4DQ2A 4OWRB 3K1MA 4YRVA 3GFJA 3KPHA 1XGMA 1MBJA 3EPZA 3FMRA 4RAGA 4XBFA 1B9MA 5D4RA 2CRGA 3GEZA 4LIVA 3LFKA 2HOSA 1IJWC 5HDGA 1W36C 1VFCA 3K2AA 4TV7A 3L2UA 1WPKA 3K69A 1Y8QB 2X85A 3BTLA 2MYSA 1FP2A 4LB5A 1IZ1A 2DXIA 1RI7A 3ESWB 1ZLKA 3KZZA 2W25A 4IHXA 2HXIA 4UV8A 2LFBA 3RQIA 3SZPA 1RESA 3EQLF 4A93J 3K70D 1YW8A 4CCKA 2FBIA 2HFHA 1T98A 4CSWA 1Z05A 5D5VB 2R5ZB 3WE2A 1ZG1A 4HPQA 1MW7A 4QLCU 4KMFA 3FXRA 4PCQA 1JHFA 4XKWA 3BT9A 3IAM2 4LFUA 2LLKA 3GLLA 4BQNA 1NK2P 1WJBA 3OSGA 4Q48A 1E3OC 2HS5A 4C9YA 3DP7A 4N9F3 1WCMJ 5FROA 3QPLA 1YG2A 2KMUA 3EYIA 5IY5H 2DLLA 1VQMI 4JX4A 3BZCA 4S0HB 2VI6A 5EDNA 4MEYF 3WHCA 4R8HA 3WTWC 3BQIA 5BOXA 2CW8A 1J09A 1F9NA 1U9NA 2LRDA 1ZQ3P 3E6DA 4BE2A 3QU6A 2GLOA 3HIFA 2IA2A 3MVPA 1TTYA 1B72B 4N4OB 1MJAA 3M8FA 5DM7F 2L9NA 1K6OA 4J00A 2DTRA 3SQNA 2RKHA 2FOWA 4P1WA 1G59A 1K79A 2EIMH 1IV8A 3HZJA 4NC7A 4C30A 3GW2A 1E17A 5IOYA 1FWZA 3FF5A 4ENKA 2CGPA 1OISA 4FHTA 3A03A 3T8TA 2JA8J 2LMDA 4HLXA 1BI0A 1YRNB 1QU3A 5FKOA 3VYTB 3B6AA 1WI9A 1BIBA 1XTAA 3QPHA 3L1PA 2A68F 4D7NA 1YW7A 1RUNA 3FXQA 3FM3A 1S6LA 4KA4A 3FX3A 1NK3P 4W1UA 3H9GA 2IGMA 3K0LA 2H8WA 3HYIA 2LBFB 2R7TA 2QYOA 3ZPLA 1F43A 3X2QH 4IZZA 2VKDA 4M6XA 1UHMA 1U3EM 3KCCA 3O2PE 3S32A 2FMLA 3OYLA 4A12A 1IF1A 2GXBA 4DNCA 3QP5A 5LHHA 1FYLA 3DF8A 3L9FA 4GO1A 3WTYC 2QENA 5HS7A 4MIMA 4BY7J 1FSEA 1QGPA 4DYRA 4NUVA 3E7LA 1WJ5A 5LRSA 1AKHB 1DDNA 2D1HA 2O5RA 4CDGA 3WG7H 4AM3A 4BE1A 1GHCA 4EJVA 2XAJA 4LG0A 2HEOA 2LC2A 2VJ5A 5BS6A 3RPUD 1YHQI 2HDCA 2W7NA 5F08A 1R1TA 3CC4I 1GVDA 3L2CA 1QBJA 2VOOA 1SD4A 3ELKA 3HG9A 3OYEA 4IHSA 3JRFA 1R71A 1S7EA 4B43A 1X1BA 5FFXA 2E2JJ 5HDNA 5DCMA 3TW6A 1JE8A 4Y52J 1SFKA 1OFCX 3W6VA 1B6AA 1PUFA 3G4SI 1LVAA 2BW3A 2OQRA 4CYDA 1N77A 3IH3A 1OKRA 4KIBA 1FIPA 1FOWA 2K3PA 3QODA 2ZKZA 3KETA 2L7MP 3HUGB 2OZUA 1U5TB 5J3LA 4GGGA 2X1CA 5EGOB 5E17F 2LK2A 4UVCA 3WG9A 2CV2A 2VPRA 2ZB9A 4U88A 1GVJA 5JLXA 2P7VB 5CPRB 3LAPA 2OCCH 3I59A 5GADJ 2NVXJ 2DPDA 3G1MA 4UB8C 1O7LA 3I9V2 3LSJA 3BTCA 4KMUX 3AL0B 1BW5A 1WFXA 3OIQA 1FT9A 4A3KJ 1IGNA 3OMYA 5K7HA 1VNDA 3R60A 5CVRA 1QPIA 3CJQB 4CA0A 1IRFA 3PNYA 3DBRB 2KRFA 3Q0WA 4OIOF 4GDFA 1W0TA 2Z16A 1TWGJ 2P7CB 1JKRC 3H9QA 4AD9A 1BR2A 1MJ9A 4G6QA 3IKVA 1T33A 4NC8A 4I0BA 3S3OA 2PBIA 4ZYDA 2ISZA 4KISA 4A0ZA 3PIPF 4LJZF 3SHFA 3WTTC 3GMEA 5FGMA 4AVZA 5FKKA 4JBAA 2ESHA 5D5XB 1D0ZA 5J40A 2DAOA 4ZDOA 1RUOA 4GCVA 2G9WA 4PDKA 2KJBA 4ZTJA 3QU3A 3KFWX 2RC4A 3TDZC 2FEZA 3GTJJ 1V5FA 3IWFA 1S3JA 3PL8A 3HPHA 4JOMA 3VEPA 4CCLA 3C3WA 2QQ9A 3K6GA 1EA3A 4BL0B 4R79A 4XLPF 3TW7A 4IRIA 4MTEA 5AIQA 1NH3A 1OMIA 5ICFA 2JPBA 1E0EA 1YITI 3MFKA 2J5PA 2VODA 2JQ7A 2XAUA 2L7FP 5F6FA 5B1AH 1P4XA 5E3NA 1YX3A 1H89C 2P5LC 4M74A 3HM5A 1I3AA 3F6OA 1ERDA 1CGPA 2DYRH 3OYBA 3W3CA 3HOUJ 4M6VA 2EFQA 1T0FA 3BZ6A 1R9TJ 2VBWA 4BXUA 2DMQA 1OCCH 1VQOI 1FOXA 1T56A 3BTIA 3WTVC 2ZXIA 3EUKL 1FZPB 5IYCJ 2VN2A 2R3SA 3QYBA 1SFXA 1LDJA 1OJLA 1Z77A 1EH7A 1FC3A 4B48A 2LY1A 2PJPA 2F6CA 2MH9A 5HLGA 1FBSA 2Y48A 4UB6C 1YS7A 3LNQA 5TRDA 3RYPA 2VJJA 3ABTA 4M9SA 4XOPA 2CQKA 2DCEA 5F0FA 2Y9YA 2E7XA 1UFMA 1ETKA 4HG2A 2HQRA 4BGDA 2IEKA 4B3AA 2Y75A 3PUFA 1MSEC 2WAQN 2ZMEB 2DTZA 1MMDA 3MZYA 4S04A 1Q1VA 2L4AA 4ZYHA 2WA0A 2X6WA 4HDVA 3DPTA 3D1NI 3QOEA 3LWFA 2YUSA 3MQ0A 2DN0A 1BBYA 4RAZA 3O8GA 5TISC 4MFEA 2GA1A 2WY7Q 3QP6A 4KDPA 2ZO4A 1ZRCA 1DGWY 1BM9A 4I0AA 3QQAA 1XCBA 2P6SA 2QQ8A 5LRRA 1D0XA 1P7IA 2V1NA 1HSJA 2A05A 3HTUA 5LEJA 5E18F 5H6RA 3TQNA 3GBGA 2XGDA 6PAXA 1M1EB 2KZGA 3E0JB 1O57A 1FIAA 1Y0NA 3FXLA 5D4SA 1W7PA 1WWXA 2R5YB 1J75A 2DMUA 1VQPI 4FQGA 4BJTA 2HOAA 2WAEA 4IHVA 3A01B 2JTVA 2XDVA 3CUQB 2BXYA 2QWWA 3MKWB 4K2EA 2XGEA 4XNFA 1MMAA 3E6MA 1PVEA 4BHCA 4G6TB 4HYEA 4B47A 3HSFA 3RJPA 1F5TA 2CQXA 4A6DA 1TBXA 3SDBA 1FYKA 2G7HA 1EKEA 4YEJA 3FXOA 4CCOA 3CMMA 3HOXJ 4HW0A 4X6AJ 3JRBA 4F7ZA 4IQJA 3KEQA 2M8GX 3SXYA 1TWAJ 4BU2A 1BR4A 2PMZN 5GPCA 1ETQA 4LLGF 1YJWI 4L0YB 4CZCA 2WAQA 5GTIC 5A2QZ 2BVLA 3FBNB 3TDUC 1ZHFA 3PSIA 4ZZLA 2QKLB 1G8XA 2ELKA 3L2VA 2ELJA 3G3ZA 2OZ6A 2NOGA 2XGXA 2JWTA 2CYYA 2WBMA 1LEBA 3I3LA 2FRHA 2JT1A 5C4XJ 3OIPA 1TQMA 1Y56A 1HCRA 2LTPA 3JAMZ 3COAC 4HQMA 3S1NJ 4FASD 4I02A 1G3SA 3FK7A 1A35A 4N0BA 3CLQA 3OS0A 5C4JJ 1RR8C 2HVQA 1WRJA 2V9VA 3IH2A 2E60A 1QA6A 1T6SA 1K83J 4EV0A 2PG4A 2YR2A 3P9KA 4EOZB 2VQHA 1ENHA 3MZ8A 4ITVA 3BQKA 3EYYA 4E7HA 2QVOA 2IS6A 5CLSA 3K70C 3MKZA 1HW5A 2L02A 2O6GE 1CF7A 1WKMA 4XLNF 2F5DA 3CMAI 2O9LA 4ZDPA 1TQIA 2FX0A 2RAEA 1X4OA 2VE9A 4I2OA 2M0MA 1BA5A 1MNEA 3BDDA 3H5AA 5ILSA 4RB2C 2H1KA 4X1EA 3Q0VA 5AIPA 1ZG5A 1O7FA 2ESNA 1PDNC 3F8CA 4J01A 2CUZA 3TMOA 2JVGA 4OAZA 2VIXA 1R22A 2W24A 2IW5A 2H09A 2HZDA 5K5RA 2GOMA 2VT3A 4M3EA 1I39A 3LSIA 1MKMA 3Q9SA 4MEXF 4XONA 3VOEA 2HQNA 1V54H 1XDSA 3ZMTA 5HNHA 5LHGA 4BDZA 3JRAA 4M6YA 1XB4A 3S14J 4PUSA 2M1BA 2QBYB 2BHYA 1LQ1A 1T38A 1L3LA 1DPRA 1ETYA 2XAFA 2VC0A 3CPZA 1RKTA 1XG1A 2GQQA 2N8GA 1V3FA 3GFMA 2R7SA 3BG5A 4M73A 2JRMA 2XVCA 2VBYA 2CSOA 4G12A 1BL0A 3G1OA 2LKSA 2A6EF 3R61A 4HNUA 4ZJZA 1RR7A 2AO9A 5D8KB 3M1EA 3RKYA 3H5NA 3DBLB 2O0YA 3K9TA 5DD8A 1ZH5A 2F4OB 5IYBJ 1A6IA 2OAZA 4G7HF 4AUXA 4NQWB 5C44J 5LFAA 1OCOH 3H1CA 2XGCA 1IUFA 3P7NA 1J59A 2DA6A 4NBQA 1JGSA 2G0EA 1MBFA 3ZOBA 4EEFG 2R92J 4WXDA 4A3BJ 2XV4S 2W48A 2MGQA 1XGSA 1OCZH 2JK3A 4UUVA 2MA3A 2XSJC 4E4HA 3CMLA 3EETA 3OYHA 1U9OA 4Y7NJ 4LOCA 4MFDA 2L2OA 2XF6A 2K85A 4M72A 2HU9A 3NRVA 4P5OA 4HLYA 2P8TA 5IT9Z 2BY1A 1ON2A 3SFIA 3A0BC 3L09A 1IC8A 1W5TA 2XAHA 4I09A 3GFLA 4DBRA 5H2FC 4QPOA 5EG0A 1OQYA 2V9KA 2R7ZJ 2A61A 3JRHA 4RS8A 5GAEJ 2QSFX 4NB5A 3V7CA 4BQQA 3HRUA 2CG4A 2ZXWH 1QZEA 3LMMA 2CW7A 3BCAA 5DUIA 1Z1DA 1K4SA 4GFBA 1LDKA 4XRSG 5B66C 1T95A 2ETHA 1MDMB 3ABMH 3U9GA 5K5OA 1LNWA 2Y9ZA 1IN6A 1QHHD 3MZHA 1A36A 5ICCA 5AONA 1D1BA 3FISA 3L2QA 3P9CA 3V8LA 3AG1H 4CICA 2E1MC 2XSDC 1SVOA 2K27A 2ZJQF 2HPIA 1R5HA 2QUFA 2L9SA 2R7FA 1L0OC 4BACA 4CO8A 3QYEA 1XSDA 2I8DA 3BROA 4M9ZA 4ZDLA 2FA5A 3W2WA 4ZYEA 2EH3A 1KGSA 1N75A 3E5UA 5FD5A 1LE8A 2E2HJ 1SFEA 1LVKA 2EZHA 5DYMA 1Z7LA 2XPWA 1S8NA 2BXZA 3S2WA 2EV0A 4BEHA 2CU7A 4CYCA 2EIJH 4RLQA 3CZ6A 1VZ0A 2DA4A 1B4AA 3PSFA 2R7RA 2DK8A 2DOFA 3W2VA 3VWBA 4LGWA 3WHBA 2NNYA 2IJLA 2TRTA 3J80Z 5E20A 1R5GA 1TT0A 3GZ6A 1BI3A 4ZYAA 3AG4H 4CUGA 3DU5A 4L9NA 3M8EA 4LD5A 5D5WB 2GBYA 4RDUA 2V4JC 5FB2A 2EV6A 1WGXA 2UZKA 5J4VA 4U0YA 2BBYA 2P4WA 2MC4A 3GX4X 4UV9A 2QSGX 4B8XA 4G94A 4B09A 4XSZF 3M9AA 2IAIA 3EUAA 4QWQA 1H8AC 4HX8A 4AYBN 1BI1A 2OUMA 3OYFA 1UZCA 2EINH 4HQEA 3RKQA 3M1CA 1AHDP 4HV5A 1NG7A 1TWCJ 2E36A 1TZLA 1JKOC 2JA6J 3GTQJ 2R7XA 3GTOJ 3KEOA 3SFZA 4HSRA 2RNJA 4KNYA 1JT6A 2PMHA 5ED4A 1OCPA 1MGTA 4QIWN 5E3LA 2EK5A 1A5JA 2EA2A 2HKXA 3KYLA 2V1UA 1OPCA 1OYIA 3DTEA 3OL4A 3VPRA 2FU4A 3RPUA 2Y69H 3DTKA 2Q2EB 3DEWA 3F9KA 2CFOA 2KRCA 2O61A 5HLHA 1HA8A 1FJLA 1WH7A 1OR7C 3LSTA 2GXAA 2L5QA 4XOTA 3ZMDA 3I4MJ 3I0TA 2EILH 3OR1C 1HKSA 3OWTA 2ME6A 5JVTA 1WJCA 1IUYA 5JHFA 3K1PA 3OV8A 1P92A 2GIVA 4PJLA 5KK1A 1Y0UA 3BJOA 2WY8Q 2E5NA 3ERMA 3J7AO 1SD7A 4HZFA 3L2RA 1N25A 4EJUA 2LSOA 4IJAA 4KFCA 1WSUA 1KQ9A 5KAFC 4C3HJ 4BDYA 1MBGA 3CDHA 2COBA 2NVYJ 1AWCA 3MAJA 4F93B 1K78A 3F22A 5KVRA 1TWHJ 2OBPA 1VI0A 4O6JA 1G2HA 3IAS2 4HF1A 3S15J 2JN6A 3BP8A 2MH2A 4R1HA 3L2WA 2P0WA 1O3QA 1UG2A 4AYBA 4EQQA 3V4GA 3ZQFA 2PLYA 2RQQA 3J7AY 1LFBA 4OAYA 3LAJA 1KA8A 2LOOA 2STTA 1QHGA 1NHAA 5DEQA 3RI4A 2E1CA 3RRCA 1EJ9A 1GDTA 1JHHA 1FOKA 2E1NA 3BG9A 4WQOD 2ZFWA 3GYHX 2DDAA 2FMYA 2Q8KA 5HLTA 1VF9A 1BOAA 1Y6IA 2M9HA 3WTUC 3JREA 5TGTA 2X48A 2IS2A 2IGOA 3T0YA 5A2QK 2A5YB 4WK8F 3H0DA 4U0VA 1IDYA 3P5JA 3H3VK 2M8EA 2VKVA 2LF8A 3QRFF 3T1BA 5CYVA 5LEKA 2XASA 2MD5A 4XLEA 5CQEA 3O3KA 3V42A 2XAGA 4CZZA 3VYUB 3JAMK 5E79C 3NWSA 2FE3A 5BPIA 1PUEE 3GUDA 3ECHA 1QVTA 3QOPA 1T0FC 2WC2A 5FLMJ 1QVUA 2XC7A 3F8NA 2DI3A 3S2DJ 2BY3A 2TCTA 4HX7A 4E6KG 3PFIA 3H9JA 2WAFA 4XN0A 3VDXA 2FNAA 3M07A 1JT0A 1MD0A 2BGCA 3CF2A 4HNVA 2E1OA 2I10A 2Y30A 3IRRA 3TO7A 3BJ6A 5DV5A 5M5WJ 3OOUA 2DFIA 4MO7A 2DFEA 2C6YA 2E71A 1FMWA 2ECBA 1XD7A 4KIFA 2WADA 1B8IB 3AG2H 1U2WA 3BR2A 3ROUA 3IRQA 1YJ9I 2DT7B 3GLXA 3LOCA 3MKLA 1OR7A 1ZN2A 5D6EA 4Z2YA 2QEXI 3N4MA 3F8FA 3LSKA 4XM3A 1FBQA 2K7LA 2RNGA 3FM5A 3LA3A 1Y1WJ 5EJCA 1VQLI 2NAZA 3OYAA 3QPSA 1W5CC 3V8JA 3CESA 3IP4B 3OS1A 4D9JA 2KIUA 2XU0A 4EJOA 1GV2A 1NTCA 1XDUA 1WHUA 2L01A 2FXAA 1F1ZA 1P2FA 1D0YA 3OOPA 2EBIA 1BC7C 3CJRB 3HOZJ 5CVJA 1UCRA 3LA2A 2R5ZA 3H92A 2MBFA 2YPRA 1IRXA 3R4KA 3I64A 1Z6TA 1D5YA 1U5TC 4UNOA 2DK5A 4B3XA 4E7IA 2DJNA 3CJNA 4BHBA 1Z9CA 1VQ4I 2E19A 2K5CA 3V7RA 3NARA 1PYVA 1VTNC 3C2HA 3JW4A 4MTDA 2XB0X 2VC1A 3AL0C 1IN7A 4Z6YA 4H0EA 2ADUA 2ELHA 4PSXA 4UUTA 1MSFC 1C0WA 3E5QA 3J7ZI 4M3GA 5J8FA 1HLVA 1J2XA 5C3EJ 1Z3XA 2R7WA 2MD0A 2X0LA 5BQTA 3FXKA 1RZ4A 2L4MA 3G2BA 3BR5A 1B72A 1HSTA 4O5VA 3DTIA 1R00A 5EYRA 4KN4X 3PIOF 2EZKA 2QCOA 3PUBA 1ZK8A 3B02A 2BZTA 2FBKA 4JX6A 5IP7J 2F48A 3FXUA 4JQFA 5LGUA 4YG2F 1DU0A 2X51A 1YRNA 3WODF 5HODA 2F4IA 2KQRA 3N05A 1MBHA 2YX7A 1J9IA 1DUXC 1XSVA 3PQKA 2DOEA 3K4CA 1LDDA 4YFSA 2EIKH 2A3SA 1RC9A 5K7ZA 5B5EC 2F5EA 4B4CA 3M4OJ 2CW0F 4HXIB 4RMNA 1X1PA 1TW3A 1GUUA 5IP6A 2R7OA 2LBFA 3OYNA 1YIOA 2YX4A 5IT9K 4AC0A 3JTHA 4DBQA 5IYDJ 1Z7UA 1LEAA 3FKIJ 4EJTA 2D2WA 1W36D 3DEUA 2NOJB 5DDGA 1IXSB 2KISA 2IGKA 1R4NB 2PEXA 1JGGA 5F04A 4A5NA 5DUKA 1X3ZB 2DOAA 3PJRA 3CTAA 2OA4A 3KP4A 3SYTA 2FQ3A 1YO5C 3K4NA 4ON0A 1FX7A 1SAUA 2HTJA 3LSHA 4BXXJ 1AKHA 2VJIA 2LD5A 3A1YA 3FXJA 5L3DA 2KHMA 1BJZA 2LYCA 3G1LA 5DCFA 2P5KA 1KYWA 5GAHJ 4IO9F 2CO5A 2DA3A 4C2TA 4RBOA 3ECOA 1QPMA 3S3MA 5FLVA 3W6KB 2D45A 1DQUA 2OU2A 3CDIA 2FJ1A 4OIQF 3LL7A 4KUMA 2KP6A 1X3WB 3OSFA 2O8XA 1J5YA 4IVNA 2PFBA 5JVGF 2PJRB 3HOSA 1G3WA 2VLAA 1XS9A 4A3DJ 4V2FA 4A3FJ 2CMPA 2JVHA 3ASOH 2EFOA 2HDDA 4FX4A 3JRIA 1HKQA 4XL9A 3HUGA 4CCMA 4DOZA 2DYSH 1U5TA 2DA1A 4RLFA 5EGOA 4PGHA 4I76A 3GVAA 2ZMEC 4BQAA 3WGGA 1I1SA 5J47A 1K4TA 2RN7A 3FK6A 4BXFA 1HKTA 1FBUA 1W4MA 3LQQA 3WTZA 4IHWA 4I98B 3ZN0A 2ICWG 2YSRA 2ZSHB 1X1CA 1U8BA 3KP2A 1LPQA 2XRNA 3UKGA 2HZTA 1G3YA 1USTA 2IXSA 1EH6A 3BY6A 1LFUP 4ASNA 3AAFA 2L3DA 5HDKA 2L9VA 3KIOA 3K4LA 1DU6A 4LLLA 3FHZA 4JGHD 5LLQA 4PJNA 4WF2A 1MBEA 2DO7A 3S93A 2XRLA 2IP2A 2NS7A 3OYMA 1RKWA 2JA5J 4EMSA 3ZMVA 1POGA 2KZVA 2DMPA 4E7ZA 2DODA 3J7YJ 1UJ8A 2NRAC 2V6EA 3OL3A 5JI6A 4MGRA 4XLHA 3GZ5A 1FTZA 4W97A 3HGYA 3IC7A 5KNLA 4QSHA 4ESJA 5FKNA 2ZJPF 4E7KA 3CUQC 2LH9A 3BC8A 1CQTA 1Y39A 5EEHA 5M3FJ 3KYDB 3TKYA 2B7EA 2DJIA 1OLTA 2M30A 3RSNA 5M5YJ 3O8HA 2X1DA 3OYKA 2HYFA 2KT0A 4V2GA 3HB9A 1TQPA 1UB9A 2GAUA 1VQ5I 2NS0A 2VQCA 1SVMA 2Z1DA 4IXAA 4G6DA 2ZJ2A 2KPMA 2CUFA 2BY2A 2IA1A 5J1UA 5LHIA 1X3UA 5DS9A 4UY8I 5GAGJ 3HOWJ 2GXGA 2O7OA 1N78A 5FRMA 2K40A 1AA7A 3E97A 3HSRA 4IRGA 3BR6A 2ZFUA 1IN8A 4XKBA 4AP2B 1Z3YA 5E1WA 1WI3A 3ZR8X 2X6XA 1FOYA 2R7DA 4B44A 2EZLA 2STWA 3Q9VA 1U0JA 4A0XA 1WJEA 3KP3A 1XMKA 3DEEA 3DXJF 4II3A 3HKZA 1BR1A 2HYJA 2Z99A 1U8RA 4S05A 3M3YJ 1IRGA 1ULYA 4BE0A 1FYMA 3RZOJ 1FP1D 2DT6A 2M2EA 2EPFA 1STZA 3PNTA 2HR3A 3I55I 2LKXA 1HW2A 4L5EA 2XIGA 2DA5A 1O3TA 4BKXA 4XRFA 3T8RA 2RREA 1BJAA 2L54A 3D5SC 3Q3SA 2ZMEA 4LIUA 5HOOA 4RB1A 2XROA 5JHUA 1Z0XA 1UMQA 3FMSA 3I5UA 3RKXA 3SJMA 3K4BA 1R5ID 1DP3A 3LFUA 1S9HA 4XN3A 3MCZA 5ILUA 5FJ8J 4HAMA 4ANJA 2ZCWA 3S8PA 2IS1A 3ASNH 4AIKA 2OV7A 4LB6B 1IN4A 2W85A 3IUOA 4KJZA 3C18A 2W4SA 2JSCA 4UUSB 5IT3A 1MBKA 3CCSI 4ABZA 1USSA 1TW2A 4C3IJ 1O3RA 2X1EA 4FCYA 3LA7A 4WX9A 2VASA 1D1CA 1DGRM 3GF2A 4DW6A 1IDZA 4A3IJ 4DZJA 3ZQGA 3VSKA 2Y0SN 4L9TA 1XC5A 5ILVA 4XICA 3CO7C 3BOQA 3P9IA 5H20A 3A4CA 1ZRFA 2PMUA 4RGXA 1V5GA 2UUZA 3DCFA 2R5YA 3TP3A 3CC2I 4MLOA 2PI0A 4PK4A 5B3SH 2OD5A 3A01A 2A5WA 3CUQA 3BQZA 3MKYB 3LSGA 1JTXA 4KICA 4APFB 4C2UA 1JUPA 2NXNB 3BG6A 3EUHC 4YELA 5GPAA 3I56I 2HTSA 1ZGAA 1S7OA 4IPAA 2G7UA 3BTJA 4UVAA 4HA8A 3NQOA 3LQRA 5E1ZB 5HLIA 2ME0A 3PQJA 1SD6A 2DMTA 4P9FA 2FD5A 1MMNA 4CCNA 2RDPA 3DV8A 1W0UA 3REOA 3CUOA 3MEXA 4U87A 2B0LA 3H5RA 4E7JA 3RKWA 2A6TA 1GV5A 3HPGA 3NEUA 4OMZA 1A04A 2M7BA 4Y4RA 1VQKI 2H27A 2Y0MA 3KP5A 1HBXG 2K86A 2M7AA 1H88C 4BHPA 1REPC 4AU7A 5J4YA 5F64A 5KCMA 4N9IA 1BOBA 2RVCA 1E3PA 3ZMUA 5LD2C 1APLC 3CDLA 4IOCF 1JKPC 3WU2C 5ICGA 1NG6A 3OYIA 2KIMA 1B9NA 1R1UA 2KDZA 1Z91A 5CVIA 2MFZA 4XMYA 2LR8A 3V8KA 1B59A 2FOKA 2KL4A 2V7FA 2XKOA 4G7ZF 2GA2A 5J8CA 1YW9A 2Y0SA 4D7MA 3JSOA 3OIOA 3MWMA 2F5VA 1YIJI 1ZKGA 2OTJI 2W84A 4P9UA 1JXSA 4YIIA 5F0CA 2EWNA 3KLOA 3SDGA 3LSRA 2JSPA 2ZC2A 5L3GA 4ETSA 2VBXA 5HNFA 5K5QA 2F2EA 2FBHA 2JUGA 1KONA 2W82A 2CUEA 2OC6A 3UR3C 2DDBA 2RQPA 4A0YA 1KYZA 2R7UA 5IPAA 3BQYA 5M5XJ 2WV1A 3R0AA 4EGYA 3SEZA 1A6QA 2MG4A 4HOBA 1RIOH 2OTLI 1ZRDA 4HV6A 2FF4A 1Z67A 4ZC3A 1QQIA 3ZQCA 2V1DA 4LG0B 4LMYA 4UVBA 3F21A 1I27A 2AXLA 4XLFA 2M3AA 4JK1X 4F91B 3OYCA 4IOAF 2VJ4A 4B1RA 2KKOA 3TEDA 1ETXA 3K4KA 1XGNA 2V9PA 2MW8A 5EEAA 5FKLA 2QBYA 3CC7I 2XF5A 2GZWA 3A02A 1XSXA 2L7ZA 3HEFA 5F27A 4ENMA 2HOTA 2MLGA 5LGNA 4HX4A 1E2XA 1OYWA 3F0CA 5DCMB 1KU7A 2HQAA 2HNHA 3KX2A 1R36A 3HC7A 5DM6F 5D5UB 1VQ8I 1JTYA 4XIDA 1PUFB 4LK1F 2CQ7A 2M34A 3EUHA 2WAUA 2BW3B 2WB1A 1YYVA 1LJ9A 1YQAA 3MMYB 1WQ2A 3CMYA 5ICEA 1R23A 3BLYA 2NVUB 1UAAA 4WXHA 1JUMA 2V26A 4Q47A 3OS2A 2V79A 1KU9A 1ETWA 2QSHX 5L3FA 2KFDA 4WWCA 2K9NA 4NQWA 3C2GA 2ID6A 2QM3A 1MMGA 2DA7A 3BR1A 3I59B 2Y31A 3KE2A 2CWEA 2ZNYA 2ID3A 2VPLA 1TC3C 2DBBA 4OOIA 2Y2ZA 4U7DA 2CQQA 3PO3J 5F1RA 2BY0A 5D8LB 3S2HJ 4HDUA 3D5LA 3WGIA 1HOMA 3E3VA 4PSWA 1SANA 1O3SA 4HEA2 1FNNA 2VONA 1MH3A 1IW7F 2X9DA 4M3BA 1SMYF 3Q0UA 4C3JJ 1BI2A 1U6GA 1S7AA 3VYRB 1LUJB 3I71A 3G6EI 3D5RC 3WU0A 3QYFA 3PM1A 4E70A 5CVVA 3DQVC 4I6ZA 2XAQA 2JZYA 1YTYA 2NVTJ 3FHNA 4L9VA 1I50J 1P4AA 2GOXB 3ISPA 1X58A 1I5ZA 4XSXF 3BQLA 2HQ5A 2EJRA 2OF7A 2V6CA 1MIJA 3RPQA 1GXPA 4J19A 2KIFA 4XLAA 2DQLA 4D1QA 5JLWA 1EV7A 2CJJA 3B6CA 3KYCB 1MDMA 4ZYGA 1SVLA 2EA4A 1IXCA 2R93J 4XK4A 2TDXA 3A2KA 2K9SA 3HOYJ 3BZKA 5DTDA 5K7FA 1HDPA 2LDUA 3DPUA 4UXNA 3DWLE 3IV5A 5L3CA 3CCJI 1J7KA 2M4GA 2WWYA 2NVQJ 2FSWA 1B1BA 5K1YA 4V19K 2DFHA 3WTXC 2IGNA 3I58A 2H6BA 4NC6A 1FLIA 2QA4I 5E8GA 3ERED 2OJED 3GCMA 2K4BA 2E35A 2XF7A 1D8JA 3GTPJ 3DFGA 2P81A 5GP9A 4Y13A 4G8XA 2AXTC 4II2A 3ZGKA 4L18B 3OR2C 4KT5C 4I99C 3CQZJ 1R58A 2EB7A 1VQ6I 1SD5A 4OINF 3OYJA 3K2ZA 3QPTA 1DPUA 5CJ9A 4BQOA 3Q5FA 1O4XA 2AHQA 3J81Z 2ACJA 2E7WA 4D0PA 1V55H 2XHKA 4BH9A 2IA0A 1F4KA 5E3MA 2LG4A 3CCYA 4BY1J 3ZQIA 3S1QJ 5GTHC 3TL4X 3JCUC 4XRMA 3TOAA 3CCQI 2NNNA 1WJDA 1K61A 1IRZA 1RNLA 4LK0F 4PJMA 1TP4A 2LY2A 1P4WA 1YOVB 2VT2A 4EGZA 2X6OA 1VQNI 2EFNA 4Y3OA 3KP6A 5BNGA 4BUPA 3FZVA 3CD6I 1P9QC 4YIFA 3ZQHA 3UNGC 2VXZA 2BHZA 3ZN1A 1X1AA 2YU3A 4P55A 4A5MA 3RYRA 1S72I 5E8IA 2DFFA 4EVIA 2WV0A 4MNUA 2CV1A 2WTEA 2Q1ZB 2E5ZA 1IN5A 2IPQX 2Q2EA 3PNVA 2HXOA 3E1SA 3IHUA 3T5XA 4DYCA 9ANTA 2W00A 2VXDA 2B63J 1K7AA 2K02A 1SC7A 5E3OA 3GFIA 2A6HF 3S1MJ 3ULQB 2CUJA 1MNMC 1R49A 4A3MJ 4A69C 1TWFJ 5FLXZ 1DP7P 1W7PB 3KZIC 2KIQA 2B9SA 5FD6A 1JKQC 1YLFA 3NAUA 3S16J 2I5UA 3DKWA 3C1DA 4KIGA 2K9QA 1W5SA 3F6VA 3TO9A 1ZR4A 4A2UA 2CQNA 2VB6A 4Y33A 1QO0D 1ETVA 3CO6C 3H3UA 2COMA 2IRFG 4O3MA 3KP7A 2UWMA 1UHWA 1UELB 4XKCA 3FIWA 5H6QA 3DLLF 5L3BA 1HDDC 2K4JA 1KU3A 4P96A 4A3EJ 3EDPA 4GXOA 1V5EA 2AQEA 2M87A 4AWXB 3PO2J 2OCEA 1IAWA 4LLNA 2HKOA 2XB5A 1YI2I 2RGVA 2M5WA 2HVSA 1E3HA 4CGZA 3FXMA 3AKZA 3GTKJ 3F3XA 3HOTA 2QZ8A 3CCUI 2DMNA 1R4MB 4KITB 2AQFA 1KZHA 3RCOA 4IF4A 4Q5SF 1U78A 1WJFA 4FETA 1JUSA 4RM3A 4AVPA 3HRTA 5FO5A 4YFKF 1G4DA 2Z3YA 1ON1A 3HBLA 3IL2A 3CLOA 1IG7A 3GWZA 2X4HA 3VODA 4L0ZB 3TBIA 2DPUA 3L00A 3H0GJ
chains in the Genus database with same CATH topology
2M45A 3DLAA 3ZQQA 2HOEA 2ISYA 2OQGA 5ERIA 1S29A 2W57A 2CH0A 3BPVA 1CF7B 4RGSA 2BE5F 1BC8C 1G3TA 1ZREA 1I1GA 2MC3A 5HS9A 3NWTA 3N97A 2GWRA 4N9HA 2VOPA 3ABUA 3FBIB 4N4NB 4OIPF 2VKHA 3U21A 3WGHA 4ZTFA 3KEYA 2HGCA 1FY7A 3KZYA 4KT6A 2HVRA 5CVUA 1UG0A 1OYYA 2R4GA 2A69F 4OMYA 2FNPA 1MJBA 1SAXA 4XKVA 3ZCOA 4BJ6C 2DW4A 2V1XA 3O6BB 5CKTA 2VBZA 2VQGA 1R1VA 3BJAA 2HWVA 2H6CA 4CXFA 2R7QA 2CV0A 3FDYA 2NYXA 3F8BA 3J80K 4HSTA 4RM2A 3VYSB 4G7OF 4NUBA 3SEQA 4HF2A 2DT5A 4EATA 3OYGA 2O03A 4G9YA 5FFZA 4HNTA 2BEOA 4HRIA 5LBQA 3OY9A 3HTSB 4AIHA 2IT0A 3L7WA 2ZXJA 3CP2A 5KHDA 3R6SA 4RB3C 2XUBA 2JA2A 4EM0B 3IKTA 3ML6A 3ZXSA 3RQ4A 1ZG3A 3BG7A 5HS8A 2JPCA 3QAHA 1I6XA 3F23A 3TGNA 2UV1A 2O3FA 3JSPA 4PZJA 3V7SA 2M4KA 3H35A 2QLZA 5J6XA 4IKFA 1ZLJA 1AOYA 1R6RA 1EH8A 4QPQA 3HXLA 2QQAA 4CHUA 3GO5A 4U0WA 2AS5F 3DU6A 4YFNF 4DIQA 2HDWA 2IVMA 4IRHA 5BMZA 1IXRC 1D3YA 2BOLA 4F52A 4XLCA 4MHGA 1KQ0A 3FWEA 1HQCA 4F55A 2ZNZA 1D1AA 1FPQA 3E6BA 3I53A 4A6EA 4BNCA 1X4PA 1KU2A 1R7JA 3WE3A 4CH7A 4MQ9F 2EV5A 3ZMSA 1XMAA 4EM2A 2MLKA 3FMQA 4Q4ZF 3G73A 1LDKB 1QNTA 4L9JA 4KN7X 2X6YA 3ZP5A 1QZYA 3ZRGA 4L5IA 3RDIA 1TLHB 2XKPA 5CQGA 2EFPA 2HPMA 4HBLA 3M7GA 2K9LA 3F72A 4EJWA 2UXNA 3M8JA 5FRNA 3HSEA 1XN7A 3HHGA 1YS6A 4BJ5C 3RIRA 5E1XA 3BCBA 5BPDA 1SMTA 3MD2A 1G6NA 2W1OA 1HXDA 2BV6A 3D0SA 3U1DA 1H9GA 1XCVA 2WZKA 1MNDA 4RGUA 4PFOA 3ZMZA 5DD4A 1YX5A 4RAYA 3SZTA 3ZQ7A 4BEHB 3K4JA 2RV8A 3KLNA 1LKXA 4ENJA 3IWZA 3WTSC 1KQ8A 2DU9A 2KRHA 2L7KA 2K9MA 3BWGA 3W2AA 4GYGA 4PJJA 2PJRA 1W7PD 4LITA 5TJJA 1JI8A 2QKMB 5D6FA 2PMZA 4GYIA 4XR6A 3DPLC 2Z5UA 1QZZA 1D5VA 2P5VA 1GLNA 2VL8A 2VE8A 3U2RA 2KJCA 1P6RA 1TNSA 1D8KA 3K1NA 2EFWA 4YFXF 1Z21A 4ESFA 3J81K 3TOBA 4ZH4F 4Y15A 4GRIA 3VFZA 4E7LA 1TNTA 3DKYA 1T2KA 4XQFA 4PFPA 3FKJA 1YFHA 2FUG2 1ZARA 3RTRA 1YE9A 3HRMA 5EEGA 2MABA 1XGOA 4M71A 4DJAA 4LG3A 4H4KC 2DQRA 4AIJA 1T39A 1FSHA 2KDOA 4F92B 1H0MA 4I7HA 4EM1A 2F5FA 3E6CC 1H9TA 3K4MA 2CFXA 1SFUA 2IS4A 5JR3A 2LNBA 4L5JA 4FX0A 1ODDA 2R7VA 3ONQA 3B73A 4BAYA 3HL2A 3HHHA 3S3NA 3DKXA 2E1MB 4NNJA 2BYVE 4E7SA 1K78B 1ZELA 2PQ8A 2ZBKA 4BS9A 1PP7U 2LF7A 5FLXK 1K6YA 4IQ4A 3CP8A 3E5XA 4HF0A 1PP8F 2Z33A 1PJRA 2P6TA 5L3EA 3BPXA 1MZBA 1X19A 1ONVA 3AFHA 3LSMA 4RB0A 3HRSA 1FMVA 4MQVA 4FT8A 4UHTA 1BN5A 3I4PA 5LGTA 2Z9OA 2UXXA 4XORA 4OIRF 2ZSIB 3SZGA 4NHJA 3R0JA 3PFYA 3VB2A 3VSLA 2F5CA 1GXQA 1BIAA 4F3QA 2LKPA 2QQBA 1ZAOA 3W6JB 2Z2SB 1ZGJA 4BYYA 3K10A 4PGGA 1HW1A 1LB2A 2H94A 2J5OA 2VQLA 4DGWB 4M9XA 2JRTA 2HYGD 3I54A 4I01A 4KYWA 4RGRA 2BVMA 1V4RA 3WU1B 4ZZDA 3GXOA 1X1DA 4WXCA 4OU0A 3H3ZA 4IHTA 2PN6A 3C7JA 2Q0OA 1J0RA 5HVQC 4A64A 3JTGA 1ZYRF 1Q1HA 3TO6A 4U7BA 2A07F 4ESBA 2LREA 1WJAA 3OYDA 4WCGA 2CS3A 4CCJA 1Z6RA 4X0GA 2D1VA 2ZXHA 4IX7A 4ENNA 4Y17A 3F8MA 1LFPA 5JFRA 4DQ2A 2KLOA 4OWRB 3K1MA 4YRVA 3GFJA 1XGMA 3EPZA 3FMRA 4XBFA 1B9MA 5D4RA 3GEZA 4LIVA 3LFKA 5HDGA 1W36C 4TV7A 3L2UA 3K69A 2X85A 2MYSA 1FP2A 4LB5A 1IZ1A 2DXIA 1RI7A 1ZLKA 3KZZA 2W25A 4UV8A 3SZPA 3EQLF 3K70D 1YW8A 4CCKA 2FBIA 2HFHA 1T98A 4CSWA 1Z05A 5D5VB 1ZG1A 3WE2A 4HPQA 1MW7A 4QLCU 4KMFA 3FXRA 4PCQA 1JHFA 4XKWA 3IAM2 4LFUA 4BQNA 1WJBA 4Q48A 2HS5A 4C9YA 3DP7A 4N9F3 5FROA 1YG2A 2KMUA 3EYIA 2DLLA 4MEYF 4R8HA 3WTWC 5BOXA 2CW8A 1J09A 1F9NA 2LRDA 3E6DA 4BE2A 3QU6A 3HIFA 2IA2A 1TTYA 4N4OB 1MJAA 3M8FA 2L9NA 1K6OA 4J00A 2DTRA 3SQNA 2RKHA 4P1WA 1G59A 1K79A 4NC7A 4C30A 3GW2A 1E17A 1FWZA 3FF5A 4ENKA 2CGPA 4FHTA 3T8TA 4HLXA 1BI0A 1QU3A 3VYTB 1WI9A 1BIBA 3QPHA 2A68F 1YW7A 1RUNA 3FXQA 3FM3A 1S6LA 4KA4A 3FX3A 3H9GA 3K0LA 2IGMA 3HYIA 2LBFB 2R7TA 2QYOA 3ZPLA 4IZZA 2VKDA 4M6XA 1UHMA 1U3EM 3KCCA 3O2PE 3S32A 2FMLA 3OYLA 4A12A 1IF1A 2GXBA 4DNCA 3QP5A 5LHHA 1FYLA 3DF8A 3L9FA 4GO1A 3WTYC 2QENA 5HS7A 1FSEA 1QGPA 5LRSA 1WJ5A 1DDNA 2D1HA 2O5RA 4CDGA 1GHCA 4BE1A 4EJVA 2XAJA 4LG0A 2HEOA 2LC2A 5BS6A 2VJ5A 3RPUD 2HDCA 2W7NA 1R1TA 3L2CA 1QBJA 2VOOA 1SD4A 3ELKA 3HG9A 3OYEA 4IHSA 4B43A 1X1BA 5FFXA 5HDNA 5DCMA 1JE8A 1SFKA 1B6AA 1LVAA 2BW3A 2OQRA 4CYDA 1N77A 1OKRA 4KIBA 3QODA 2K3PA 2ZKZA 3KETA 3HUGB 2OZUA 1U5TB 4GGGA 2X1CA 5E17F 4UVCA 3WG9A 2CV2A 4U88A 1GVJA 2P7VB 5CPRB 3LAPA 3I59A 2DPDA 1O7LA 3I9V2 4KMUX 3AL0B 1WFXA 3OIQA 1FT9A 3OMYA 3R60A 5CVRA 3CJQB 4CA0A 1IRFA 3PNYA 2KRFA 4OIOF 2Z16A 2P7CB 3H9QA 4AD9A 1BR2A 1MJ9A 4G6QA 3IKVA 4NC8A 4I0BA 2ISZA 2PBIA 4ZYDA 3S3OA 4KISA 4A0ZA 4LJZF 3SHFA 3WTTC 5FGMA 4AVZA 4JBAA 2ESHA 5D5XB 1D0ZA 2DAOA 4ZDOA 1RUOA 4GCVA 2G9WA 4PDKA 2KJBA 4ZTJA 3QU3A 3KFWX 2RC4A 3TDZC 2FEZA 1V5FA 3IWFA 1S3JA 3PL8A 3HPHA 3VEPA 4JOMA 4CCLA 3C3WA 2QQ9A 3K6GA 4R79A 4IRIA 1EA3A 4XLPF 4BL0B 4MTEA 5AIQA 1OMIA 5ICFA 2JPBA 1E0EA 3MFKA 2J5PA 2VODA 2XAUA 5F6FA 1P4XA 1YX3A 2P5LC 4M74A 3F6OA 1ERDA 1CGPA 3OYBA 3W3CA 2EFQA 1T0FA 3BZ6A 2VBWA 4BXUA 3WTVC 2ZXIA 3EUKL 1FZPB 2VN2A 2R3SA 3QYBA 1SFXA 1LDJA 1EH7A 1FC3A 4B48A 2LY1A 2PJPA 2F6CA 2MH9A 5HLGA 1FBSA 2Y48A 1YS7A 5TRDA 3RYPA 2VJJA 3ABTA 4M9SA 4XOPA 2CQKA 2DCEA 2E7XA 1UFMA 4HG2A 2HQRA 4BGDA 2Y75A 2ZMEB 3MZYA 1MMDA 4S04A 2L4AA 4ZYHA 2WA0A 4HDVA 2X6WA 3DPTA 3QOEA 3LWFA 3MQ0A 1BBYA 4RAZA 2GA1A 2WY7Q 3QP6A 4KDPA 2ZO4A 1ZRCA 1DGWY 1BM9A 4I0AA 1XCBA 2P6SA 5LRRA 1D0XA 2V1NA 1HSJA 3HTUA 5LEJA 5E18F 5H6RA 3TQNA 3GBGA 6PAXA 3E0JB 1O57A 5D4SA 1W7PA 1WWXA 1J75A 4BJTA 2WAEA 2JTVA 3CUQB 2XDVA 2QWWA 3MKWB 4K2EA 4XNFA 1MMAA 3E6MA 4BHCA 4G6TB 4HYEA 4B47A 3HSFA 3RJPA 1F5TA 4A6DA 1TBXA 3SDBA 1FYKA 2G7HA 4YEJA 4CCOA 3CMMA 4HW0A 4F7ZA 4IQJA 3KEQA 3SXYA 4BU2A 1BR4A 4LLGF 4L0YB 4CZCA 2WAQA 5A2QZ 2BVLA 3FBNB 3TDUC 1ZHFA 4ZZLA 3PSIA 2QKLB 1G8XA 3L2VA 3G3ZA 2ELJA 2OZ6A 2XGXA 2CYYA 2WBMA 1LEBA 3I3LA 2FRHA 2JT1A 3OIPA 1TQMA 1Y56A 3JAMZ 3COAC 4HQMA 4FASD 4I02A 1G3SA 4N0BA 3OS0A 2HVQA 1WRJA 2V9VA 2E60A 1T6SA 4EV0A 2PG4A 2YR2A 3P9KA 4EOZB 2VQHA 4ITVA 3EYYA 4E7HA 2QVOA 2IS6A 5CLSA 3K70C 3MKZA 1HW5A 2L02A 2O6GE 1CF7A 1WKMA 4XLNF 2F5DA 4ZDPA 1TQIA 2VE9A 1X4OA 4I2OA 2M0MA 1MNEA 3BDDA 3H5AA 5ILSA 4RB2C 5AIPA 1ZG5A 1O7FA 2ESNA 1PDNC 3F8CA 4J01A 2CUZA 3TMOA 2JVGA 4OAZA 2VIXA 1R22A 2W24A 2IW5A 2H09A 5K5RA 2HZDA 2GOMA 2VT3A 3LSIA 1MKMA 3Q9SA 4MEXF 4XONA 3VOEA 2HQNA 3ZMTA 1XDSA 5HNHA 5LHGA 4BDZA 4M6YA 1XB4A 4PUSA 2M1BA 2QBYB 1LQ1A 1T38A 1L3LA 1DPRA 2VC0A 2XAFA 2GQQA 1V3FA 3GFMA 2R7SA 4M73A 2XVCA 2VBYA 2CSOA 2A6EF 3R61A 4HNUA 4ZJZA 5D8KB 3M1EA 3RKYA 3H5NA 2O0YA 3K9TA 5DD8A 1ZH5A 2OAZA 4G7HF 4NQWB 5LFAA 3P7NA 1J59A 1JGSA 4WXDA 2XV4S 1XGSA 4UUVA 2MA3A 2XSJC 4E4HA 3EETA 3OYHA 2L2OA 2XF6A 4M72A 2HU9A 3NRVA 4P5OA 4HLYA 2P8TA 5IT9Z 1ON2A 3L09A 1W5TA 2XAHA 4I09A 3GFLA 4DBRA 4QPOA 2V9KA 2A61A 4RS8A 4NB5A 3V7CA 4BQQA 3HRUA 2CG4A 3LMMA 2CW7A 3BCAA 5DUIA 1Z1DA 1LDKA 1T95A 2ETHA 1MDMB 3U9GA 5K5OA 1LNWA 1IN6A 1QHHD 3MZHA 5ICCA 5AONA 1D1BA 3L2QA 3P9CA 3V8LA 4CICA 2E1MC 2K27A 2HPIA 1R5HA 2QUFA 2L9SA 2R7FA 1L0OC 4BACA 4CO8A 3QYEA 1XSDA 4M9ZA 3BROA 2I8DA 4ZDLA 2FA5A 3W2WA 4ZYEA 1KGSA 3E5UA 1N75A 5FD5A 1SFEA 1LVKA 5DYMA 1Z7LA 1S8NA 3S2WA 2EV0A 4BEHA 4RLQA 3CZ6A 1VZ0A 1B4AA 3PSFA 2R7RA 2DK8A 3W2VA 3VWBA 4LGWA 2NNYA 2IJLA 3J80Z 5E20A 1R5GA 1TT0A 3GZ6A 1BI3A 4ZYAA 4CUGA 4L9NA 3DU5A 3M8EA 4LD5A 5D5WB 2V4JC 5FB2A 2EV6A 2UZKA 4U0YA 2BBYA 2P4WA 2MC4A 3GX4X 4UV9A 4B8XA 4G94A 4B09A 4XSZF 3M9AA 4QWQA 3EUAA 4HX8A 1BI1A 2OUMA 3OYFA 4HQEA 3M1CA 4HV5A 1NG7A 1TZLA 2R7XA 3KEOA 3SFZA 4HSRA 2RNJA 4KNYA 2PMHA 5ED4A 1MGTA 2EK5A 2EA2A 2HKXA 3KYLA 2V1UA 1OPCA 1OYIA 3DTEA 3OL4A 2FU4A 3RPUA 3DTKA 2Q2EB 3F9KA 2CFOA 2O61A 2KRCA 5HLHA 1HA8A 1OR7C 3LSTA 2L5QA 4XOTA 3ZMDA 3I0TA 3OR1C 1HKSA 5JVTA 3OWTA 1WJCA 1IUYA 5JHFA 3K1PA 3OV8A 1P92A 2GIVA 4PJLA 5KK1A 1Y0UA 3BJOA 2WY8Q 2E5NA 3J7AO 1SD7A 4HZFA 3L2RA 4EJUA 2LSOA 4IJAA 4KFCA 1WSUA 1KQ9A 4BDYA 3CDHA 1AWCA 3MAJA 4F93B 1K78A 3F22A 5KVRA 2OBPA 4O6JA 3IAS2 4HF1A 3BP8A 2MH2A 4R1HA 3L2WA 1O3QA 2P0WA 4AYBA 4EQQA 3V4GA 2PLYA 2RQQA 3J7AY 4OAYA 3LAJA 1KA8A 2LOOA 2STTA 1QHGA 1NHAA 5DEQA 3RI4A 2E1CA 1JHHA 1FOKA 2E1NA 4WQOD 2ZFWA 3GYHX 2FMYA 2Q8KA 5HLTA 1BOAA 1Y6IA 3WTUC 5TGTA 2IS2A 2IGOA 4WK8F 3T0YA 2A5YB 5A2QK 3H0DA 4U0VA 2M8EA 2LF8A 3QRFF 3T1BA 5CYVA 5LEKA 2XASA 2MD5A 4XLEA 5CQEA 3O3KA 3V42A 2XAGA 4CZZA 3JAMK 3VYUB 3NWSA 2FE3A 5BPIA 1PUEE 3GUDA 3ECHA 3QOPA 1T0FC 2WC2A 2XC7A 3F8NA 2DI3A 4HX7A 4E6KG 3PFIA 3H9JA 2WAFA 4XN0A 3VDXA 2FNAA 1MD0A 2BGCA 3CF2A 3IRRA 3TO7A 3BJ6A 5DV5A 3OOUA 2DFIA 2C6YA 1FMWA 1XD7A 4KIFA 2WADA 1U2WA 3ROUA 3IRQA 3GLXA 2DT7B 1OR7A 1ZN2A 5D6EA 4Z2YA 3N4MA 3F8FA 3LSKA 4XM3A 1FBQA 2K7LA 2RNGA 3FM5A 3LA3A 2NAZA 3OYAA 3V8JA 3CESA 3IP4B 3OS1A 4D9JA 2KIUA 4EJOA 1XDUA 2L01A 2FXAA 1F1ZA 1P2FA 1D0YA 3OOPA 1BC7C 3CJRB 5CVJA 1UCRA 3LA2A 3H92A 2MBFA 2YPRA 1IRXA 3R4KA 3I64A 1Z6TA 1U5TC 4UNOA 2DK5A 4B3XA 4E7IA 3CJNA 4BHBA 1Z9CA 2K5CA 3V7RA 1PYVA 1VTNC 3C2HA 3JW4A 4MTDA 2VC1A 3AL0C 1IN7A 4H0EA 2ADUA 2ELHA 4PSXA 1C0WA 3E5QA 5J8FA 1J2XA 1Z3XA 2R7WA 2MD0A 2X0LA 5BQTA 1RZ4A 2L4MA 3G2BA 1HSTA 4O5VA 3DTIA 1R00A 4KN4X 3PUBA 3B02A 2FBKA 3FXUA 4JQFA 5LGUA 4YG2F 2X51A 3WODF 2F4IA 2KQRA 3N05A 1J9IA 2YX7A 1DUXC 1XSVA 3PQKA 3K4CA 1LDDA 2A3SA 2F5EA 2CW0F 4HXIB 4RMNA 1TW3A 2R7OA 2LBFA 3OYNA 1YIOA 2YX4A 5IT9K 3JTHA 4DBQA 1Z7UA 1LEAA 4EJTA 2D2WA 1W36D 3DEUA 2NOJB 5DDGA 1IXSB 2IGKA 2PEXA 4A5NA 5DUKA 2DOAA 3PJRA 3CTAA 2OA4A 3KP4A 3SYTA 2FQ3A 1YO5C 4ON0A 3K4NA 1FX7A 1SAUA 2HTJA 3LSHA 2VJIA 3A1YA 5L3DA 2KHMA 2LYCA 5DCFA 2P5KA 1KYWA 2CO5A 4C2TA 3ECOA 1QPMA 3S3MA 3W6KB 2D45A 1DQUA 2OU2A 4OIQF 3LL7A 4KUMA 2KP6A 2O8XA 1J5YA 4IVNA 2PFBA 2PJRB 3HOSA 1G3WA 2VLAA 2CMPA 2JVHA 2EFOA 4FX4A 1HKQA 4XL9A 3HUGA 4CCMA 4DOZA 1U5TA 4RLFA 4PGHA 3GVAA 4BQAA 3WGGA 1I1SA 2RN7A 1HKTA 4BXFA 1FBUA 1W4MA 3LQQA 3WTZA 4I98B 3ZN0A 2YSRA 2ZSHB 1X1CA 3KP2A 2XRNA 2HZTA 1G3YA 1USTA 2IXSA 1EH6A 3BY6A 4ASNA 3AAFA 2L3DA 5HDKA 3K4LA 4LLLA 3FHZA 4JGHD 5LLQA 4PJNA 4WF2A 2DO7A 3S93A 2IP2A 3OYMA 4EMSA 3ZMVA 2KZVA 4E7ZA 2NRAC 2V6EA 3OL3A 5JI6A 4MGRA 4XLHA 3GZ5A 3IC7A 5KNLA 4ESJA 4E7KA 3CUQC 2LH9A 3BC8A 5EEHA 3TKYA 2DJIA 2M30A 1OLTA 3RSNA 2X1DA 3OYKA 2HYFA 1TQPA 1UB9A 2GAUA 2NS0A 2VQCA 2Z1DA 4IXAA 4G6DA 2ZJ2A 2KPMA 5LHIA 2IA1A 1X3UA 2GXGA 1N78A 5FRMA 1AA7A 3E97A 3HSRA 4IRGA 2ZFUA 1IN8A 4XKBA 4AP2B 1Z3YA 5E1WA 3ZR8X 2X6XA 4B44A 2R7DA 2STWA 3Q9VA 1U0JA 4A0XA 1WJEA 3KP3A 1XMKA 3DEEA 3DXJF 4II3A 1U8RA 1BR1A 3HKZA 2Z99A 4S05A 1IRGA 1ULYA 4BE0A 1FYMA 1FP1D 2DT6A 1STZA 1HW2A 2HR3A 3PNTA 2XIGA 1O3TA 4XRFA 3T8RA 2RREA 1BJAA 2L54A 5HOOA 2XROA 2ZMEA 3D5SC 4LIUA 4RB1A 5JHUA 3I5UA 3FMSA 3RKXA 3K4BA 1DP3A 3LFUA 1S9HA 4XN3A 3MCZA 5ILUA 4HAMA 4ANJA 2ZCWA 3S8PA 2IS1A 4AIKA 4LB6B 2OV7A 1IN4A 2W85A 3IUOA 4KJZA 3C18A 2W4SA 2JSCA 5IT3A 1USSA 1TW2A 1O3RA 2X1EA 3LA7A 4WX9A 2VASA 1D1CA 3GF2A 1DGRM 3VSKA 4L9TA 5ILVA 3CO7C 3BOQA 3P9IA 5H20A 3A4CA 1ZRFA 2PMUA 4RGXA 1V5GA 2UUZA 4MLOA 2PI0A 4PK4A 2OD5A 3CUQA 2A5WA 3MKYB 3LSGA 4KICA 4APFB 4C2UA 3BG6A 3EUHC 4YELA 2HTSA 1ZGAA 1S7OA 4IPAA 2G7UA 4UVAA 4HA8A 3NQOA 3LQRA 5E1ZB 5HLIA 3PQJA 1SD6A 4P9FA 1MMNA 4CCNA 2RDPA 3DV8A 3REOA 3CUOA 3MEXA 4U87A 2B0LA 3H5RA 4E7JA 3RKWA 2A6TA 3HPGA 3NEUA 4OMZA 1A04A 2M7BA 4Y4RA 2H27A 2Y0MA 3KP5A 1HBXG 2K86A 2M7AA 4BHPA 1REPC 4AU7A 5F64A 5KCMA 4N9IA 1BOBA 2RVCA 3ZMUA 5LD2C 5ICGA 3OYIA 1NG6A 2KIMA 1B9NA 1R1UA 1Z91A 5CVIA 2MFZA 4XMYA 3V8KA 1B59A 2FOKA 2KL4A 2V7FA 2XKOA 4G7ZF 2GA2A 5J8CA 1YW9A 2Y0SA 3JSOA 3MWMA 2F5VA 2W84A 4P9UA 1JXSA 4YIIA 2EWNA 3KLOA 2JSPA 5L3GA 4ETSA 2VBXA 5HNFA 5K5QA 2F2EA 2FBHA 2JUGA 1KONA 2W82A 2OC6A 3UR3C 2RQPA 4A0YA 1KYZA 2R7UA 3R0AA 4EGYA 3SEZA 1RIOH 4HOBA 1ZRDA 4HV6A 2FF4A 4ZC3A 1QQIA 2V1DA 4LG0B 4LMYA 4UVBA 3F21A 1I27A 2AXLA 4XLFA 2M3AA 4JK1X 4F91B 3OYCA 2VJ4A 2KKOA 3K4KA 1XGNA 2QBYA 2XF5A 2GZWA 4ENMA 1XSXA 2MLGA 5LGNA 4HX4A 1E2XA 1OYWA 5DCMB 1KU7A 2HQAA 2HNHA 3KX2A 1R36A 3HC7A 5D5UB 4LK1F 3EUHA 2BW3B 2WB1A 1YYVA 1LJ9A 1YQAA 3MMYB 1WQ2A 5ICEA 1R23A 3BLYA 1UAAA 4WXHA 4Q47A 2V26A 3OS2A 2V79A 1KU9A 5L3FA 4WWCA 4NQWA 3C2GA 2QM3A 1MMGA 3I59B 3KE2A 2CWEA 2ZNYA 2VPLA 2DBBA 4OOIA 4U7DA 5F1RA 5D8LB 4HDUA 3D5LA 3WGIA 3E3VA 4PSWA 1O3SA 4HEA2 1FNNA 2VONA 1IW7F 1SMYF 1BI2A 1U6GA 1S7AA 3VYRB 3I71A 3D5RC 3WU0A 3QYFA 4E70A 5CVVA 3DQVC 2XAQA 2JZYA 1YTYA 3FHNA 4L9VA 1P4AA