4P5RA

Structure of oxidized w45y mutant of amicyanin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTYINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title The sole tryptophan of amicyanin enhances its thermal stability but does not influence the electronic properties of the type 1 copper site.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4p5rA00
1ASOA 4DPBX 4DP1X 3WKQA 3X1NA 5I6MA 2JFCA 4KOCA 5F7AA 2X88A 1AACA 1BXUA 2UXFA 4HIPA 1AANA 4WTQA 1PAZA 3T6VA 2Q9OA 1WA0X 3UACA 4DP0X 4RH4A 1NIEA 3HEIB 2BP8B 2TSBA 1W8EA 2XVBA 2ZXWB 1M9WA 1JZFA 3T9WA 5AKRA 5AFAA 1SFDA 3FYEB 3FSWA 1PZCA 4WKXA 4E9XA 1M57B 3ABKB 5B1AB 4BXVA 1NIFA 1ZDSA 2GIMA 1PNDA 3OMNB 4UAHA 1BYOA 2PPEA 5B3SB 1V54B 2FT6A 4BWUA 1IKOP 3T6ZA 1CC3A 1CYWA 1AZCA 1PF3A 3NJFA 1NTDA 2VW7A 1OCOB 2FTAA 3CG8A 2FT8A 3NSFA 1JOIA 2DYSB 1L9PA 3ZDWA 4NERA 4DP8X 1SHWA 1OV8A 2FQDA 1SNRA 1E67A 3H56A 3EH5B 3EH4B 2EINB 3JT2A 3WI9A 4FA7B 2EIKB 2Y1AA 1ADWA 2I7OA 2AVFA 2FWLB 4AX3A 1KYAA 3S8FB 4GY4A 3ABMB 1B3IA 1ZIBA 2AANA 3FPYA 2HX9A 1E5ZA 1TEGA 4YSTA 2YXVA 2UX6A 2Y69B 1IUZA 3D12B 3T6XA 2R7EA 3PAZA 4M4RB 1OCRB 4A2FA 1TEFA 5I5JA 2BZ7A 4W9ZA 4YSSA 2GB2A 3OQRA 3QJSB 4HZ1A 3KW7A 4KO9A 5D4HA 2CCWA 1SHXA 4KNTA 3UABA 4HAKA 4QKTA 4DP6X 3S3DB 1PLAA 3QPKA 2OCCB 4DP4X 5B1JA 7PAZA 4AKOA 2XX0A 9PCYA 2UX7A 2J57A 3QQXA 3NJGA 2ZONA 4YL4A 1OE1A 2CAKA 1YLBB 3NSDA 3CVBA 3UAAA 2DYRB 2B3IA 3SBRA 1CUOA 1NIDA 1WS8A 2HX7A 2HLEB 1GSKA 1A3ZA 2BP0A 4G72B 4N4YB 1AR1B 2CUAA 4A2HA 5B7FA 1F56A 3WNIA 4HCIA 4DP5X 1ZDQA 2YARA 4YVNA 1XMEB 4BK5C 2NRDA 2VSMB 2IDTA 3FQYA 3OD3A 1GS8A 2OJ1A 4M3HA 2DWSA 2XUWA 3CZUB 1NPNA 1PCSA 2JXMA 2X87A 4KNSA 3V9EA 3WG7B 1KV7A 2GI0A 4GYBA 4PCYA 2PLTA 2FT7A 3BQVA 2WO3B 3CDZA 4KOBA 1DYZA 3GYRA 2YAPA 1AIZA 3EF4A 1SDDA 4F2EA 1HAUA 2QT6A 4BXSV 3NP3A 2DWTA 1L9TA 1ASPA 1J9SA 3AG2B 1BQ5A 2PPCA 3IEAA 1ET5A 2IDFA 3OMAB 3X1GA 5I6NA 3KW8A 3RYMA 4HCGA 5FC9A 2YXWA 5I28A 1AS6A 2DY2A 5B7EA 4YSQA 3DTUB 1KBWA 3ZX1A 2IWFA 1GS6X 2QDVA 1N68A 3X2QB 4DP2X 1J9TA 3FQ1A 2BW5A 1PZAA 4YVUA 2AZAA 2B08A 1GY2A 3H4HA 4HALA 3FS9A 2UXGA 5I6PA 1EHKB 2XLLA 4G71B 1MZZA 3G5WA 5B1JC 1ID2A 2DV6A 2BHFA 2Q5BA 4E9YA 3N55A 1A4AA 1AG0A 3FU8A 1R1CA 4E9SA 2GSMB 2LLNA 4CSPA 3QJUB 4A2EA 3H4FA 1J9QA 1RZQA 4AKPA 3ABLB 1J9RA 2YAQA 4KNUA 4G70B 3NJJA 4KO7A 1XB8A 4JKNA 2VN3A 3PCYA 1J5DA 4G7SB 4X4KA 2XV3A 2VMJA 1FA4A 5A7EA 4NAJA 2H47C 2ZOOA 1TU2A 1N70A 3SBPA 5I6LA 3L45A 3AY2A 1RZPA 2WSDA 4YSDA 1AZBA 3FPXA 4DP9X 2AFNA 1KCBA 4E9VA 1JZIA 5LDUA 1GR7A 2VSKB 5TK2A 2QDWA 3ASOB 2GBAA 3ASNB 1ZPUA 1AG6A 2EIMB 1KBVA 4A2DA 2PP7A 1E65A 4PAZA 4JHVA 2HRHA 1PNCA 2R7EB 1OF0A 3IN2A 3TA4D 2FQFA 4UANA 3GDCA 5PAZA 4DPCX 4BWTA 2J5WA 3SQRA 2IWEA 4W1TA 3X1EA 1L9OA 1BAWA 1E30A 1NINA 3ABGA 3BVDB 1BQRA 1ETJA 3CVDA 1QHQA 2VM4A 3MBWB 1OE2A 3ZIYA 1BQKA 3S3BB 3CVCA 3IBOA 1A65A 1SF3A 3AZUA 2BP0B 3DIVA 4JHUA 1AAJA 1PMYA 4KO6A 3FYIB 2HXAA 1BYPA 1AOZA 2YQBA 4AZUA 1A4BA 1BEXA 5I6OA 6PCYA 2XU9A 2PCYA 1JXDA 4HHWA 1SJMA 2QPDB 3OM3B 4UF7C 1A8ZA 1UATA 1T5KA 1MDAA 2CALA 1BXVA 5I26A 2I85A 2YAEA 2XV2A 3QJTB 1JZGA 2PCFA 3CDZB 1JERA 5AZUA 3NSYA 1KGYE 1L9QA 1SDDB 1WAEA 2GHZA 1XB6A 4E9TA 1ZV2A 3HB3B 4DP7X 2VW6A 1M56B 1I53A 2PPFA 5I5IA 5D4IA 3FQ2A 2JKWA 3S8GB 3TBCA 4BWWA 2QPEB 2YAOA 1GW0A 1MZYA 1AS7A 3FSZA 3FU7A 3QJVB 3UGEA 4GP4B 2MTAA 2W88A 2E86A 2OV0A 1ET7A 2YAHA 1W6LA 3FU7B 1TKWA 2PP8A 1AZRA 4P5SA 1V10A 3NJHA 1KDIA 4YSCA 1GY1A 1SFHA 3S3CB 2HZHA 4GP5B 4AKQA 1AZUA 6PAZA 3PPSA 4L0PB 3UADA 2IDUA 4ZK8A 3TBBA 2BO0A 1IBZA 2XXGA 3NSCA 2BP8A 4Q8BA 8PAZA 1HAWA 1IBYA 1ET8A 4FAAB 3GXUB 5B1KA 3T6WA 1WS7A 3X1BA 1BXAA 3DKHA 2J55A 3NT0A 5B1BB 1NIAA 2YAMA 1OOWA 2MRYA 1WA1X 1NWPA 1JXGA 3AG3B 3N2JA 3T71A 4G7QB 1V55B 2PPAA 1A4CA 3NYKA 3OMIB 2IDSA 1NZRA 3NP4A 3X1FA 4QLWA 2EIJB 3NJNA 1SF5A 2GC7C 3PAUA 1GYCA 3ERXA 3IN0A 1FFTB 4YSEA 5EHFA 2BWIA 3PXLA 3WIAA 2AZUA 2W8CA 4A68A 3EHBB 4F2FA 2P80A 2UXVA 3FU9A 1X9RA 2CJ3A 2RACA 2H3XC 1JZJA 7PCYA 2WO2B 2BW4A 3AG1B 1NWOA 5I6KA 4YSUA 5D4JA 1GS7A 4HHGA 4F7KA 3JTBA 5B7MA 4Q89A 4K9JA 3QJRB 1PY0A 3WNJA 3NJLA 4A2GA 3PLYA 1ILSA 2XWZA 3FT0A 1PLCA 4A66A 4BDVA 3NJKA 3AW5A 1RCYA 1JXFA 2IH9A 1XB3A 3TU6A 4BDVB 1KCWA 2TSAA 4GP8B 4E9WA 1AS8A 3NJIA 4NB7A 3WKPA 1PLBA 3U25A 4EF3A 1NDTA 1WA2X 1ASQA 1DZ0A 4ENZA 4DPAX 2IAAC 3AG4B 2FQEA 2IDQA 2I7SA 1JVLA 2IWKA 4TXVB 2EILB 2IH8A 3NJMA 1QLEB 2XYBA 4YSPA 1PZBA 1X9UA 2FNWA 2P80D 1L9SA 2YAFA 1NIBA 1HFUA 5PCYA 3SBQA 4YSOA 3IE9A 1MG2C 1AQ8A 2H5UA 3FSAA 4E9QA 4HCFA 4A67A 1JZEA 4G7RB 4MFHA 3UAEA 2J56A 1E5YA 4AI7A 1JVOA 2GC4C 1W6WA 2N0MA 4CSZA 3TASA 2ZWNA 5E9NA 5F7BA 1OCCB 2UXTA 1J5CA 2HX8A 5ANHA 3EH3B 1AZNA 2PPDA 1RKRA 4KO5A 1NICA 1CURA 2A3TA 2HRGA 3MX0B 4N8UA 4P5RA 5I5MA 1MG3C 1OCZB 3FSVA 2VW4A 2FJSA 1FWXA 1ILUA 2BWDA 4E9RA 4YSRA 2CBPA 1ZIAA 3QJQB 3PAVA 2BZCA 2XX1A 1KDJA 3V9CA 1OE3A 1QNIA 3ZBMA 5IY5B 1NPJA 1JZHA 1L9RA 2XV0A 2XXFA 4GXFA 1CYXA 3C75A 5TK4A 2VM3A 1URIA 2FQGA 2PP9A 4YSAA 1EZLA 1IC0A 1VLXA
chains in the Genus database with same CATH superfamily
4DGVL 3BKCH 2BIQA 2IQAB 4BA0A 4PJ7E 3IXTA 3MFFA 2HP4A 4H20H 2R56H 1KTLB 3T6VA 3DV4B 5LWYH 2X4RB 4PJAF 3G6JB 5CILL 4MNGE 3WJLC 1W8EA 2IV8A 3AM8C 1KPRA 2XVBA 4XOEA 5DWUH 4KRMB 4NLHA 3QEUB 3FL7A 4JG0L 2V17H 2PYFA 1IAIH 3O3EA 1V7ML 1H19A 1XZWA 3VNYA 4HOZA 1USZA 2JKLA 3M17A 4R97C 3N0AA 3T2NL 3KVDD 1P0SE 3F64A 4B60A 5AYTA 3VFRA 1BYOA 5CIPA 1T4KA 2AK1H 4Y88A 4L3CB 2VGLM 4IKLA 4HF5H 4LSSL 4APQD 4CDGC 5KZCD 3MKGA 4K23H 2K0RA 3TVMC 1IAMA 1C9SA 5KYXA 1USQA 2X4NA 4FQXB 5CMAB 3ZL1A 5BV7H 5DSCA 3V6OC 1BMWA 1U8KB 4R96A 5AKTA 2NY6D 3LHAA 1EXHA 4N3UA 5DVPA 4LHJB 2XOTA 4NERA 3MV8D 4JPSA 5DD1H 2VDNB 5INCB 2NXYC 4P2OC 4D3CL 3V0JA 1SJHB 4XBGB 2LW3A 2G2RB 3SE8L 2KH2B 3IDGB 4XVJH 1DCEA 1LTXA 1F1GA 1MH5A 1ML0A 5GGUB 3R8BB 2VXQH 1P84K 1U3HD 3CVIL 4J6RH 4D0BA 2IOMA 4EPSA 1H5BB 3ZKSD 2QR0B 4MDIA 3FT4B 1HHHB 5SWSD 2X89D 4D0DB 1QBLL 5G4OA 1I82A 4FFVD 4NP4H 3REWA 4KDVA 2IGFL 4WRLA 3D8MA 3CLWA 3QZLA 4YHIB 3L54A 5AW8B 4L4TD 5GS0L 2JCCF 3GSNH 1ZTMA 1R0AL 2HJLB 2OCCB 3DSNA 3RFRA 2K70A 1KF9B 3O3BA 3DX2A 3PABB 1DQQA 4FYTA 3AROA 4WFGD 5JPNA 1HL8A 4AMWA 1K5NB 2B7DT 2DYRB 4DGIH 2CR3A 3TFBA 2BP0A 3R18A 3S2CA 1UM5L 3WHE1 5J8OA 3D18A 4XRCB 1MFMA 2FYYA 3RZCD 2VDRH 3GB7B 1RZ7L 5F3BB 4YH6A 5C9JB 1ZDQA 3QG6B 2P45B 3SY0B 3UDWA 1MJ8L 5DJ2A 3KG5A 1XH3A 4A63A 5DJ6A 3PHAA 4POYA 1P7QA 2OJ1A 1AY1L 5F2FA 5C0GB 1IEBA 2GHWB 1PCSA 4JGNA 5I1LB 3BH4A 4N2BA 4NWUL 1TJHH 3OAYK 2GI0A 4QHNB 1BLNB 1C1EH 2O30A 4ELME 3BQVA 2IH3A 4G6FB 2BCMA 4KOBA 4PRID 1DYZA 3CAFA 1W91A 4L8BA 4RRPA 3L13A 1ZLSH 4L29B 4QRRB 1OF2B 4WUUA 2DLTA 4P2CG 3ZXAC 1L9TA 1T1YB 5FGBC 1FFRA 4TKWA 3RPBA 4ZFOL 2Q8BH 5IP4A 2IALA 2FJHA 3CHXA 2OMTA 3RYMA 3LZPA 1TFHA 3Q8EA 1G7HA 3MOBL 2A6KB 4TRPH 5D2LB 4ZSOA 5T5NG 4GSDH 4AWJC 1CR9L 2UZYB 5ALBH 4P2RB 3EOTL 4JY6B 3BVVA 3VFWB 4WJ5B 2XIIA 3UBXA 3ABZA 4IYKA 4MX7B 5BO1H 1LO3L 2FBJL 2V2XB 3B8YA 2BY2A 3DK0A 3T0WA 1GS6X 2QDVA 2WQWA 3X2QB 3ZKXC 3M1BA 1B2WH 2QGBA 2ZKXA 5H94A 2JB5L 3P0YH 4F57L 4ODXA 3KPNA 2VDKB 4HWBL 5LNDA 3U4BL 4OCXH 1FVCB 3L2LA 5BS0D 4POZD 5FO2A 5MERA 3UYRH 43C9B 5CR8A 3SQBA 5EIIG 1DVUA 3QQDB 4E9YA 4OGAD 1EH9A 1M3IA 4ADIA 4YK4B 4E9SA 1NCDH 5LAXB 1QFWI 2OW6A 4JN2B 2ZXGA 4Z7AA 4JO4H 3F00A 2QPUA 4LIQH 1HU8A 4GQPH 4E5XB 5DVMA 5I17B 3Q5TA 4ICXA 2APXA 4ZTPH 2N59A 3C5ZC 1A6UL 2VN3A 3PCYA 1CF8H 3MROB 4KPHH 4LLDB 1SVZA 4G7SB 1KOAA 1XR8B 2CKBA 2ZCKH 3SOBL 1FA4A 4EI5A 1UURA 5A7EA 3F7VB 4RSVA 4TOYH 2PW1B 4WI5A 4XC1H 2DM7A 2HWZL 3H9HB 2P5WB 1HOCB 4G6AD 3NFNB 1OP9A 4N2LA 3EYUL 1U33A 2BY3A 4JN1H 3B5TA 5TK2A 4M7JL 1LJMA 3IGAA 3RJOA 3MBXL 4P04A 4N5EC 2VISA 3U9PL 1CQYA 2MCAA 5E4AA 5FGCE 4EMZA 4A2DA 2BDNL 2K9FB 2PYED 2HKFH 4TQPA 3UTZA 1YMME 5EZIL 4KI5C 4HUXB 4XI5C 2AQPA 2ZOWA 5F3HA 2OI9C 2DQGH 2NX5B 3ZR5A 3SZKC 1YUHA 1MHCA 4BWTA 1UASA 1T1ZA 5B22A 3DI3B 1E30A 2Y22A 3RGVD 3RIFK 4E9LA 3ABGA 3K0WA 4Z5RB 4Q6IC 1L4IA 4JFUA 5TE7L 4LMQE 1BQRA 4K9EL 5C08E 3KJ4B 1L0XA 5I75C 2DQCH 1UCBH 2YD6A 4HPOL 3S3BB 5D7JB 3UTSD 2C9PA 5DZJA 5JTWA 2B9BA 2GUOA 3ZHLA 4YHPB 1GTNA 2GK0B 2JKNA 5CO1A 1TR7A 1AAJA 4DUXA 2CBMA 1RUAL 4KO6A 4JVUA 4M5YH 4NNXA 1FNHA 4PP1C 3ULUH 3BKCL 1CI3M 3SJVD 5ISZD 1EDQA 3DETD 4EI6A 1A3QA 3K5RA 4LE8A 4QXVA 4TVPH 5AVXB 5KVGH 4H20L 1NM9A 4PRPD 2R56L 3EDFA 2DWDB 4D0CA 1RSYA 1V7NH 2E74C 1OT4A 3DVIA 1RZKL 1AI1H 3UZVA 1DLFH 5AW5B 4AQEA 4WENB 5FKAB 5ESQA 4PRBB 3FU6A 3I3DA 5TDOB 4GAAA 4IIQC 4XCFL 2JB6B 3F83A 5DC4B 5F7DB 1IAIL 1GTFA 3QUHA 4S1RH 1LO5A 1FUNA 4OF3A 2OYPA 2VUKA 5IB2B 5JHLA 3GWJA 5KJRH 2F54A 3BX7C 1LP9F 3O3UN 4JRYA 5TQ2H 2C3GA 2V8LA 3BAIA 4AENA 1HZLA 4G7VL 2ZF8A 25C8L 3DX6B 3ZL4H 3I85A 3OAZK 1UVQB 4FA6A 4HSQA 3ZGHA 4PLKC 2HVKB 4QJ5B 4GRLD 3VG0H 2R4SL 4P2QA 2Z8VC 3LH2L 5CCKH 1A7NL 2AXWA 1G1KA 5GGVH 1QI3A 3L5IA 4BH8A 1NGPH 5IJCC 5DK2A 4KHXL 3B2UD 4G8IA 2VB5A 5CSZA 3WKML 1XGYL 3S3CB 1KB5L 3Q1SL 4O2CA 4OZ4B 3FFCD 2UWEB 3G5YA 5DD1L 5LAPA 4OGYH 2EEBA 3GMLA 2OMXA 3E1F1 3D51A 2K4WA 3FH5A 3HE6B 1JUFA 3HZVA 4JFDA 4MZ2A 4FLSA 2AABL 4WTZA 2W9LA 4YE4L 4AZ8B 2J8HA 4IOIA 3QEQB 1HAWA 1DN0B 3B3IB 3SYQA 4OF8A 3CXHK 1RZKC 1MCWM 3VW3L 4X7DC 2F53B 4X6DB 5DS2A 4OIIH 3PHQB 4JR9H 4F2MB 1S3KL 3HNSL 3INUH 3R19A 2AJ3B 2Y7NA 4LU5L 1U8QA 3P9MB 3VTTA 3QAZB 3WE1A 4P4KD 4CN6A 4PJHB 5F1SA 4JVWA 1I1RA 3PE9A 4AVJA 4FQLL 3CNKA 4G3YH 4LVOB 2JQMA 1XCQB 3B9KB 4R4FH 1BVKB 4JHWH 4TYUA 1IO4C 4J39A 1FFTB 4W9CC 2VYRE 3KLAB 1PW3A 1OSPL 4GKZA 4LNVA 2GW5A 5DI8B 2UXVA 2YD8A 3WTYA 4NHCL 4NXSA 4IS6B 3OR7A 5AW0B 3WELA 3NDYE 5KVFH 1LDPL 3L3KA 5AW2B 1F02I 5KSUA 5DZOA 2NT1A 2GBVA 3UMNA 1HEHC 2DI9A 1J18A 4AEIL 2VDLB 1CBJA 4UWQB 1B0WA 3RKPA 5IEKA 1UWGL 2AJUL 4RMWA 1FYHB 4F7KA 1G6RB 1O7VA 5DMGD 5EFIB 3V4PL 5K9OB 1IGJA 2EH7L 4IJ3C 3BZEB 1T2JA 1QTSA 3NRPA 1PY0A 1DBBH 1X5LA 3O3DB 1ORSB 4LK4A 1L0YA 3JUYA 1MJJA 2XWZA 2YZ8A 4BDVA 5CLWA 3JWOC 5EU7E 5TH2B 5KS9E 1JXFA 1Q0YL 3P4NB 4EN3A 2X4TB 3TU6A 4ZSOE 2XETA 1ZLSL 2EYSB 5E8EA 5HGBB 2TSAA 5F0PB 3QRGH 4G6JL 4F7MA 2VDNL 1QBMH 3EJQA 3GQFA 1E8YA 3MLYL 3BPOC 1RZFL 1ASQA 2KLTA 1WZ1L 1RL1A 5EUKA 4ONHB 3DOIA 3KNBA 1U8IA 1K4CB 2XQBH 4IDJL 1R5WA 3HLAA 3IFNH 3D09A 4UV4H 2OL3H 4Q52A 2ITDA 3GMNA 1QLEB 4TRPL 3VXRA 1TVDA 3MBEC 3GEFA 3VM7A 4J2QA 5HHOE 2YAFA 1TTCA 4XN2A 4MWFA 2EYTB 2J8UA 5IB1A 3BCFA 3IDIB 5FYJU 4ZXBA 3ARWA 5BO1L 3KE0A 4JZJB 5AWNH 1KCRH 3H7BA 3MSPA 1QOKA 2WLHA 3KVQA 4EIZC 5ES4B 2QLVB 1QVOA 3QFJA 1H6EA 4LLUA 4KXAA 4Y2LA 3NTCL 1DHKA 3PF2A 4UTBA 4XPAL 3E9UA 3BZFA 5ANHA 2YEQA 4OCXL 2PPDA 5D8JH 1QHOA 3QYMA 2AK4E 3LKRA 2H1LM 2K6ZA 3RTQD 3S36H 2ZSVA 1HCFX 1PQZB 2YK1L 3G5VA 3VI4A 1GYVA 5DC9B 4PVLA 3OR6B 3VXTB 1AE6H 3IWUA 2DWEA 4FQXC 1QEWB 4FC3E 4CKVX 3D0VB 1S7VB 4JZOA 1U8HB 4HJEA 2HLAB 4MNQB 2VDPH 1DDHA 3LNHA 4ZFQA 4IHOB 3VFOB 1N3NB 3EUUA 4KPHL 1PX8A 3HBPA 5FYJL 2HJFB 3HI6H 4UCFA 2FIKB 2XXFA 1AQDA 1U3YA 4S11A 4PS7A 4N8VB 3QUKB 1LE9A 2JJSA 3CSYA 4RDQF 2ADJA 4HWBA 4MMYB 5HDQH 1IC0A 1G43A 3RU8H 2G2PA 5D4QA 3P4MA 1U42A 4IMKA 2ITFA 5IOPA 2XY1A 2YSTA 4QOKB 3V6FA 3KM2A 3WMPA 3MCG1 5HPMA 2CWRA 2DYPA 5TDNB 2DQDH 3LH9A 5IVNA 3UACA 3QIUB 4KGLA 5DQ9B 3DOHA 1Z9MA 1E4XL 4KDTA 3RURA 3CSBA 3MOQA 5C0AA 2ZXWB 1M9WA 4AOFA 1L7IH 1NLBL 4FQCL 3C8DA 4YR6B 1MVFA 3BVNA 4A7VA 3TF7C 1LWHA 1M57B 1YECL 4Q56A 3N41B 1JF1A 4ZMYA 2QKIA 1ZS2A 5E7FA 1MFNA 3K72A 4EUPA 5F7FA 3NG5A 1ZDSA 4EDWH 1YYLH 1LO2L 1PNDA 32C2A 2XVLA 4F33A 1JWMA 5HD8D 3TA3A 5IB5B 4E0RA 3RTLA 4I3GA 2C26A 1FDLL 4PJ9A 2VDKL 1BFSA 4QUOA 1R5VA 3T6ZA 1HHJA 1A25A 4KVCH 4Y9FA 3A67L 3ZK0A 2VL5A 2RFXB 2HUEA 4JO2H 1X5FA 2VQ4A 1NMAL 4N0CD 5GZNC 4XWOC 3T4YA 1GZPA 4DZBA 1ZWIA 2NOYA 3NFSL 3LRHA 5EN3A 4E41D 4S1QL 2Q3AA 3ZDWA 5BQ7B 4PN6A 3WEMA 2OSWA 4AGOA 1ETA1 1RZGB 1F4AA 2EKJA 2VQTA 1FYTA 1ZLUK 4R0LA 5IIEA 4UIMA 4YNYB 2E59A 1SXZA 4X6EB 4H25A 1S7TB 5KSBA 1DJIA 4FNTA 4QTFA 1E5ZA 5CLXA 4UT7L 3BRFA 3FDWA 2BP5M 4ZNCD 4PS3A 3P3UA 1CL7H 1IMHC 2H0JA 4JAMB 1T4WA 3P9LA 1INQA 4H7VA 3BQUD 3I9GL 2R23A 5D6DC 2Q3XA 3MV7D 5FO9B 2QHRH 3MDJA 4QKTA 3S3DB 1C16A 1RJYB 1HXMB 2G4EA 5L7XH 5EZJA 3S35X 3G9AB 1XTMA 3QCVH 3EYOB 3O2VH 2V9TA 2WLLB 5BUGA 1IFHH 3ROLB 4BE5A 1H6FA 4MKMA 4JFDE 1CUOA 5HDOA 1JV2B 3A4AA 3V4UH 3QXAB 1KBGH 1NGPL 5I19L 2X05A 4N1CA 4OCMC 4LKXB 3E80A 2E75C 3UO1L 1KGCE 3F84A 2IDTA 4YK4C 4GIOA 4XZ4A 2W07A 4OB5H 4OUUA 4NQXA 1HHKA 3DDFA 5CCHE 4GYBA 2PLTA 2FT7A 2H1PH 1R17A 2P48B 3V5DB 4NO2B 5IFAH 3CH1B 2EDHA 1WHPA 1I9JL 3OKEA 2ICEA 3AS3A 1ES0B 2B0SH 5J6SA 1RK1A 2B1HL 2CUHA 1A02N 2WKOF 1ASPA 2IANE 2VLKD 2O6FA 3IEAA 4FQPA 3D39D 3DPDA 2E5EA 5KSAD 1AO7A 4G1EB 2GJRA 5IZ7A 4AGLA 3GS0A 3PJSA 1HYSD 2CMRL 4WV1B 1JK9A 4JJ5B 4HPHA 4NFCA 4UT9H 2Y07H 4WFHE 2VT0A 3DMMD 1KG0A 4XP5L 2WSPA 4K15A 5IF0A 3W9DA 3QULA 2KZBA 1ETB1 2BM3A 5E4IA 5KVFL 1DQML 1K2DB 1U58B 3MLUL 4WEUD 1J1PL 4K3JL 2VXQA 4K8RH 1QSEA 4KXZI 1G7MB 2ZPKH 3ZJAA 4JRXA 1VACA 1UM6L 3O2WH 4B50A 4JO1H 5LN4A 4PJIE 3QORA 4OJAA 2A4ZA 3UTQB 4J3OC 3VRJB 5B1JC 3BVTA 1ID2A 3GSNA 4MA3A 2R2HB 3QIWB 1J0IA 1F58H 3KJ4C 5HHQA 4RIRA 2ZCHL 5D7JC 2E6QA 4H5SB 2WJ7A 4PJDF 5FUCC 1UQSB 5D1QD 5L4IA 4AL8H 2OW7A 3ARUA 2D7NA 2W0KA 5E8NA 3VA2C 5EN2B 2J8UE 4NQVB 4A2EA 1QBML 5IM7A 3Q2WA 4QDGA 5IJKC 4JKMA 4TNWK 2OJEA 3UBXG 3OX8B 3D0AA 2GVYA 4M5ZH 4WI2A 3QFJE 1VFBA 3C8KA 3NEOA 4UV4L 2AEOA 1OHQA 3JTSB 5TPWL 2XNAA 3HAEB 4RQQA 4NAJA 5A7BA 4NUQA 1TU2A 1B4RA 3B2VH 3LEYL 1MHPH 3FK3A 4OZHA 1PSKL 5C3TA 5C0EB 1E0OB 1SM3L 4L05A 1HOEA 4JY5H 5E2VL 3ARYA 3BZ4A 1ZJAA 4W4OC 3QDAA 4O2FB 4J7RA 5DR5L 3MRPB 3TCLB 3ASNB 4JDZA 2DQFB 4JFYB 5FGSA 1D5ZB 2PO6A 2MQ3A 4FADA 1NUNB 4JDEA 3TPUA 5IWLC 5D8JL 5EA0H 4A6YB 4OCWH 2O5YL 3UROR 1RIUL 4ZT1A 3QUYB 1PZSA 4X9GA 4ES8A 2NY5C 3SQRA 3KD4A 4N5UA 1T7XA 2C9QA 4DAGH 3DRQB 5IQ7L 2MHAA 5DS8A 2P8MB 5DFWH 2B4CH 3DMMA 5FECB 2ISDA 3K6SA 3HI6L 5DJXB 3QDJA 3WFHA 5E2TH 4PB0L 3TOPA 3LS5L 3QWOA 4HQQL 2VDOL 3PPEA 2C4XA 2UY7B 1IEAA 2YA1A 5C0AE 3MXWH 4OZFH 5C2BL 2ADIA 1W15A 5D6CB 3KXFA 4YXKL 3KS0H 2VOTA 2WXQA 3VGDA 4AZUA 5E6ZA 4BZ1L 1BMGA 1LXMA 5I82A 1HWHB 2GBUA 1GC1L 3CPUA 5CUSL 2I9LB 2ZX6A 1JZ8A 4HHWA 4GQ9L 1FV1B 1EFXD 3TTSA 5JNYA 4N22A 5C1MB 1CGWA 3QAZC 4MAZA 1DVFB 1KFAH 3O6FB 4K7PX 1GZQB 4G9FB 1FNSH 3WTXA 3FF7A 5FUZL 4HIHB 1KN4L 4LDEB 4PY8I 3APMA 2CR0A 4CVZA 2APWA 3QJHA 4QHMB 3B9KC 1MRDH 2F7IA 1GAFH 4FXTA 4OFIA 4DP7X 4YBHA 2WNWA 2VW6A 3LZLA 2HH0L 3IVKB 1BAFH 4PR5B 2X5PA 4BWWA 3KLHC 4PJEA 4B97A 1Z9LA 2F74A 4Y4HB 5I1KH 2CIKA 4NOFA 2YMXL 1FYTE 1VCAA 4XBPA 2KLSA 4XNUL 2BCKB 4GB9A 4LOEA 1WGVA 4IGBD 2NXZD 2PP8A 3QPQD 4JO2L 4HFUH 3SYCA 3GPEA 3WFDH 2ZXAA 3IJSB 3PP3H 1N7ML 1FAIL 2PW2A 3D25B 3KPPA 4HJTA 1CFTB 3GSUA 5EBGA 1XGUB 2O6CA 4PJ8B 3C08H 2F8VA 2OMZA 3IDXH 4JQIL 5M7QA 1QTPA 2GITB 2H3KA 1PZ5A 4AKQA 3PPSA 2W65A 3GGWB 3HC4H 2AQQA 4BBWA 2IDUA 3ZMRA 2V3FA 3CN3A 3MLZL 4WW2F 1JNHB 1RJLB 2FWOA 3UC2A 1GXEA 3PWVB 2BP8A 4PSPA 3U2IA 3L6FA 3L3HB 2FO4A 2FX9H 2WTRA 8PAZA 4Y16D 5BZXA 4LLMA 1WO2A 2E7LC 2BFVL 3X1BA 2OSLB 4ZAKD 4F3FB 1CL7L 3P4OB 1U9KA 3PV7A 1JCKA 3W11C 3P30H 3OF6A 1O7DC 4Z7VA 5C0FB 2IFFL 5IMMB 2VLRD 4ZPTB 3T09A 3FUDA 3ZTJG 2Q76A 2K6WA 4JZJC 1TZIB 3A47A 4L4JA 1MVYA 4MQXD 3CV5A 1A6AA 1LEGA 3BYTA 3O2VL 4YBQD 2D73A 1IM9A 1DDTA 3G5ZB 3SD5A 1T20A 4XCNB 1HKFA 3C6SB 2Q7YB 5HHVH 4Y5VB 5FO8B 1BV8A 2ATPB 1G0DA 2ZE0A 1MFEH 2ARJA 2HLFC 4ORGB 3VFPA 1PLGL 3DUSA 2BW4A 3KLKA 4G8FB 4WNQA 4ZS6C 1OP5K 4B5ZA 1DLHA 2EDOA 2ZKYA 5HHME 2P49B 4Q89A 1OB0A 4K9JA 4AQAB 3QJRB 5D1XE 3H3KA 2J6EH 1JYNA 4V1DB 5EC1A 3V4VH 1AO7E 1S7WA 1ZA6A 2NY3D 1IT9L 5B39A 4NDMB 2V2TA 2YGPA 5JOEA 2WQRA 4Q9CA 5KTEL 2AP2A 2DMGA 3KPQB 1XB3A 3RDTB 5I23A 4U05A 1EAPA 4NO0D 4QCIA 4KQ4L 4HJGA 5CINL 3H55A 2IQ9L 1UB5A 8FABA 4OCLC 3T2LA 2NY2D 2ITCA 1FZKB 3FQXA 3I6KA 4UDUB 4X5LA 1DZ0A 3H8NA 5JHBA 4OFPA 1MELA 3BGAA 4JRXE 1JVLA 4OTXH 3BUYB 4F7EB 2RH0A 3ULVC 2BSRB 1CLYH 4K2UL 1VFAA 1J86A 2P80D 5INDA 1YQVL 3TZVA 5EU3B 4GAJH 4GKSB 2VC2H 4YSOA 3PWPD 1CLOL 5EOCH 5F1IB 3HBZA 1T3FA 3RA7L 4HWZA 1ODUA 1WEJH 1A21A 1S7UB 4XX1E 4UYQA 1AYRA 4HS8L 4JO1L 3CZFA 3FT1A 3OQ3B 3HRZB 3TO4D 3W9EA 2D0HA 5HHNA 3S37H 3VJ6B 2XWTA 3MRGA 4NBZB 3IMWA 2CHWA 2VN4A 5HDBF 1YNTA 3BVWA 4KV5F 5CJBA 3V52L 3QDGB 4AL8L 3F6IA 4Q9BA 2OMUA 2E7CA 1UOWA 4OZHE 3VSUA 3RVXD 3V2AR 4PJ7F 1T89C 4J2XA 5DJDB 1JZHA 5GGRY 4NRYB 4U1NA 1F11A 2OCFD 3O9WB 1KGWA 1CYXA 5D2NA 1MHPL 1FBIL 3IETA 4WI8A 3TYGH 4LNRA 5ID0A 4M1DH 4DPBX 3QSKB 4YHKL 3S5YA 1S78D 2GG1A 4JY5L 4LCCA 1Q94B 1NAML 2BHYA 4KZEH 4DH2A 2EUZA 4X0KB 1KCVL 1WHOA 2B14A 1YEIH 2KKQA 5SX5K 4NQDD 5IB3B 4FLRA 4HMDA 5A2LH 1C08B 1R3LB 1HL4A 4JY4A 3FYEB 4KMLB 2X70A 3W3BA 3NABH 4MNHB 2OQJA 4YGVA 4UILL 3KPMA 1G9NC 1KBPA 3L7EB 3JVGC 2OL3A 4R2GB 3KS0J 1IAOA 2C7FA 5I8OL 5CZRA 3KXFE 5AB2A 4BFFA 5D9SB 1KCUH 3ARBB 3H85A 2OBGA 4BFIB 3SE9H 4J3UA 2XN1A 4BUGA 4AMKH 3DO3A 1JL8A 4IRJC 4HD9A 5LJYH 4FYSA 3M46A 1MY7A 4LVHB 3W5NA 4KRNA 4LIQE 4QY8B 4KXCA 4MJIA 3QIBB 4NKMA 4HWEH 1XGTB 1H8NA 5AW7B 5DJ8B 3JYBA 2CO6B 1KGIA 3H56A 3NIFE 1FL6A 2FATH 2W80C 1U4FA 1DN2A 5GJSH 4FA7B 2YSSA 3GXNA 3RWDA 4XGZA 1I3GL 4RBPH 4I0PA 1LWRA 2NW2A 1FNSL 3DHUA 2K8QA 3ABMB 3HB3C 4HCRH 3EO9L 3U4EB 4PS4L 4YSTA 5FK9B 1FL3A 2UX6A 3V10A 4ZTOH 4HIJB 4W6XB 2R7EA 2GEEA 1EJ6A 4WV1C 4HOMA 1FJ1B 3G08B 3VGEA 3QE5A 4PGCB 4G83A 1W8NA 1O9ZA 3KW7A 5C09B 1J5OH 3QI9D 4HWNA 4DCQB 3X12B 1OW0A 4AGNA 4FFYL 1T1XB 3GLAA 4Y2DB 5L88L 1TJGH 3QPKA 3CUPA 1X4ZA 2J71A 2VMDA 3KWWB 2UX7A 2CJSA 3ARFB 5KWYC 4LCWD 3L4ZA 2FR4A 1UOKA 1P4UA 4MTMA 1CGUA 1YEKL 1C8PA 3VWJD 3CCHA 2Y7QB 3DX8A 1U91B 3IDXL 4RDQG 3SYAA 1OGAE 2NRDA 3BLKA 1IRAY 4N0UA 4XOBA 1F6AB 3E2HB 4KAQH 4QXGH 1OD7A 3K1DA 3O6ML 1HKLH 4OV6F 4FFWC 4JRWA 4TN9A 1MI5B 2J73A 3OJDB 3CDGA 5ID1B 2FJFB 3VXOA 2ZG3A 1TITA 1MQKH 2IAMD 3MRCA 4PCYA 3RVTC 3ULUE 3S6CA 4U1SA 2WO3B 5I2IA 1N64H 2YAPA 4TVPE 2M2DA 3AU0A 3EF4A 4BQ9A 1D7FA 1IGCH 2NYKA 1QHPA 4NQEB 3RILA 4WI3A 2OMWB 1JGVH 3PDOA 2VXUL 3VB9A 4NI6A 4FG6D 4YDJA 2CE6A 1VJSA 1HHGB 1BQ5A 1BZ9A 2UYLA 1A1MB 5L2JB 3KH4A 2EDNA 2K7QA 5JORA 3CN4A 3X1GA 5F8RC 4NX0A 1F00I 1IIIA 3ZT6A 1YJDH 2OMVB 4MXQD 3MYJA 4HH9A 2J1KA 3D3VB 4QHUB 4IJTA 3QYNA 1WFOA 5E5MB 1LD9A 5E4EB 3SYOA 4YSQA 2I60L 2X6VA 1A7PL 2VXTH 2IWFA 1XZ0A 2W0FB 4DEUA 1OCWH 3JV4B 3EJCA 3FQ1A 5EH1A 3HMXH 4LSPL 1F6LL 4P5KA 2NY1B 3QUYC 3FH8A 2WUCL 4X4XB 1JNNL 2HFFB 1TSHA 2UXGA 4PBXA 4FEIA 4IOFD 4YPGA 3DO7B 4YQXH 4BEIA 2CO2A 1UD8A 4IOSA 4MD5B 4TUKL 3N55A 1IB5A 2AC0A 1T5WA 2GAZA 4Z95L 1DJGA 1Y6MR 3HJ0A 4MB4A 2WCGA 4I0CC 4Y1AB 5EMYA 4PV9A 1K6QL 5CEZH 3VI3A 2GTZA 2G60L 4P99A 3BAEH 4KNUA 5SWZB 3IMBA 2Y5EA 5JA8B 4LLWA 3LB6C 3RX7A 1U8PA 1KCSH 4FE9A 4UOZA 4WWKA 2IPKB 2WBJD 4CRPA 2VMJA 2CK0L 5EO9A 2JKXA 4FN0A 5C6TH 3GI8H 5CEYA 3TYFB 5C08D 1DVFC 1BBDH 1F4XH 4ZODA 4Z3FA 3S34H 3MRHA 2WSDA 1S9XB 3O6FC 5I6LA 4LDCA 4RLDA 5EOCL 3R1GH 4WI7A 5C0JB 4URKA 2J20A 3SEPA 4IRSD 3FQRA 1RVFL 5E95B 3M86A 5IREA 1SQMA 2MPAL 4LCUA 1FE8L 1NCUA 1YY8B 4R83A 4AYBA 4F37K 3T0EB 3KPSE 3IDUA 2Y2WA 3A22A 3TJHD 3H6JA 4Z7QF 1E27A 3QXDB 3US1A 3KGRA 5E1AB 5KVFE 2WOYA 3VXUD 3FT3B 1MCNA 2HJKB 4NKDA 1HHIB 4F8PA 4Y4HC 1J7VR 1HINH 1Z3GL 1EEYB 5GGTH 5AB0A 4KHTH 1OF0A 4B9YA 3U0WL 3WKNA 3MRFB 1IC4L 2GJ6A 5D2NE 5AW9B 4UT9A 4GH7B 1TCRB 5IR1B 4NJ9L 2IWEA 3T4AA 4ZPVA 4EZLA 5DRXA 3FN0L 1QEXA 3NACH 3F12B 2F5AL 4G42A 4PJ8C 1QHQA 3B6SA 3ZYOA 1ZHKB 2J88H 5IHBA 2AEQL 3UERA 4PREB 5FV2A 4DGYL 4QRQA 4PV1C 1SDAB 4W9LC 4N28A 5JXED 4JFOB 4N6RA 2V7NA 3SDDB 4ODSL 2FK9A 5HJGA 4JCMA 4M1DL 3BIKB 3BH8B 4LSTL 1A4JB 2FJGA 2EE6A 3S4SA 3GBDA 3ELAT 1BEXA 2J8OA 1G0XA 1CFSB 4XPBH 5IQNA 4KZEL 2O5ZH 1CLCA 3WDIA 2K45A 1YEIL 2G9HA 1KGUA 1YEHH 3P3YA 3DHPA 1D5IH 1S9VA 3J7HA 3DDGA 4TQEL 4WIQA 1A6ZA 2ADGB 4KX8A 5CZVH 1KENH 2C3VB 2WN3A 3UAJA 3BUQA 2YLHA 5BRPA 2G75B 3TEWA 3KLSA 4GXVL 5D4IA 2CRZA 1MIEL 2YWZA 1UACL 1BJ8A 4PG9A 2DH3A 4H4NA 4MA7H 4QLRA 3S96A 4QRPD 1CXKA 5I74B 4WK0B 4R4BB 5DK0B 5EEVA 3SE9L 4HJJL 4CMMA 4FS0A 4H1LH 5DYOB 1F4WL 2D4FA 2EACA 4FYRA 3CDFA 4FMKA 3HZKB 4QT5A 4EKJA 4M6OH 5EBWA 3TWCH 5I1DA 2B59A 4F7CB 2HZHA 3VFGL 4Q97A 4GP5B 2ZUYA 1A7QH 3E1ZA 4C56A 1SJXA 1AZUA 2NYYC 5GJSL 2IO5A 4LGRB 3SDAD 5K9KB 5KN5A 1JNLL 2G5BB 1RZ8A 2XXGA 3HUJA 4IBWA 1UG9A 5FUOL 4I3RH 1WBZA 2YJLA 4OIBA 2OA9A 1LMKA 1BYNA 1BQHB 3LPGA 3FH7A 2WVVA 3T0AA 4FQQA 1MHHA 3MUGA 3GSRA 3QISA 2JE8A 3AG3B 5ABZA 4OI8A 4WNSA 1MCPL 1QYGL 3DIDA 2R59A 1S3RA 1NCAH 3FQWB 1G7LA 3QUGA 4OZFA 4JGUA 1I1AC 2FL5B 2DQJL 2EIJB 1E5UI 3BAWA 3X14A 2VXSL 3BHBB 2B5IC 4IBSA 1IM3A 3FOLB 3PP4H 4EQ3A 3MRKA 1EPFA 4Z7WE 5DMJB 1DQDL 4FTVD 4YUEH 3JWOH 5FOBA 5T1KB 4FQIL 4Z8FH 3HRZC 3NESA 3W1ZA 4ZMVA 7PCYA 2IXQA 5KS9F 3GMRA 2A9BA 4OLYL 4JFFA 4BINA 4K7PL 3AJ7A 5HHOD 2EEDA 3OHMB 5F1NA 3WE6B 3EKCA 2FHBA 2XFXA 4OFVA 1DVQA 1P7KB 5HDWA 3VFTA 3Q6FB 4BFGA 3MRIA 5FHAH 2CO7A 5F89B 1KXQE 2GK2A 4TNGA 4X5QA 3BKJL 5FW6A 1ZV9A 3NJLA 2QSCL 4PYGA 4C57C 4U6XA 5CP7B 2XPGA 2W60B 4PRHD 4UQ3B 5CF3A 1PG7W 4PTTA 1Q9WB 2XTJB 3FB8B 3AWGA 1I4FB 1YAZA 3BKYH 1YEFH 3O9WC 4QAWA 1UA6H 3MJ7B 1IGCL 2HRLA 1JGVL 1KFGA 1QPKA 2AK4D 3T2OA 3BH9A 2YQ3A 4OFYA 5CJOH 2VLJA 3CBJB 5CD5D 3DJZA 4C4KO 2DJ4A 5DD3H 4ZFFB 4UQ2B 3KYOA 2R4RL 1A22B 5F44A 3NJMA 4AYEC 3C6LA 3RIAF 5CBAA 1P6FA 1S8DA 2EDWA 1CICA 5I30H 2F19H 4HPYL 1ZA3B 1N0XH 3CK0H 3UTTE 3VACA 2VXTL 3S98A 4PJBF 4J4PC 4RAUB 3V8CA 5AOLA 3DPBA 5B39G 4YAQA 5CBEB 1ETZA 3IFOA 5D1ZB 4GG6A 1CJYA 5BOPA 5HY9B 4UMGA 1KJMB 3VI3E 3JBG7 2AXJA 1J8KA 1T2QL 3EH3B 1AZNA 4I18A 4A37A 2X6AA 1A7RL 2ZP8A 3ET9F 1RUML 4P2YA 3ARBC 5IROC 4MMXC 3MV9A 4N8UA 3UP6A 4A7TA 4IU3B 4G9DB 5BNXD 5LXGL 1ESOA 2ICWB 4NIKB 4KNQA 2DD8L 4HDIA 4TUJB 3U1SH 5CEZL 2W0LA 4LVHC 3X11B 2FD6H 4ANVA 5DC2A 3QIBC 4RNRA 3I2CL 5K9QG 5JIDA 2Z92B 3B1UA 4LOVA 1I8KA 5HYSG 4LLAA 2O6EA 3OKOA 4FXGA 4LFHG 5C6TL 2BRQA 3DX9A 4X6BB 5A2KH 3L3OB 3OXRA 3O8XD 5GSVB 1XIWC 3RWGA 1VLXA 1DEEA 3RVWC 4LPUA 2J6EA 3V4VA 4QAMB 3PNWB 1CPUA 2JFCA 1DVTA 3T8XA 3M45A 4AM0Q 1FGNH 1A2YB 4UQCA 2GJ6E 4OKVB 1SVCP 1CF1A 2X4SA 2Z8RA 3MV8B 3WUWB 3BKMH 2VDMH 2FX8H 2DAVA 4XMZA 3PFUA 4Y2DC 2QSQA 5HDRA 4NPYA 5IJVA 1L0PA 1ZT1B 1SFDA 2WKLA 1OAYL 3KPRD 4CADB 4OF7A 1DQVA 4ZUUB 1EUTA 4E9XA 2Q8AH 3U0PA 3BI9X 4KKNA 4OZIF 2NXYD 5K9QI 1XMWA 1A64A 3L7FB 4DTGL 3ARFC 4PJBA 1LE5B 2OYKA 5C07A 3D05A 4ETQA 1BW8A 3H9SA 4UT6H 2CGRH 3CFBA 2PPEA 3DTXB 4ODTL 1JJUA 4BKLB 2P5ED 2IPTH 4BRJA 3BEVB 5I16A 4YZWA 4BSVA 2B3RA 1U8JB 3ASWA 2I5YH 1CN4A 3PGDA 4X6CA 3WIFB 1CK0H 3MGTA 4L4TB 1D7CA 4YHLH 3L16A 3MLRL 4JLRB 3E2HC 4PVNA 1P69B 1JWSB 5EEXA 5GJTL 1KPVB 2AAVA 1R24A 4QKXB 3EXLA 4JDVB 2FT8A 4K94L 1EDHA 1HK6A 2UVFA 2E6JA 2H0PA 2APSA 3NSFA 4FHJA 1RPQA 4O02H 4F7PA 3CFJA 1S5HA 1ZOXA 3P77A 1OV8A 3UPRA 3IJ8A 1E67A 1PCXA 4IKNA 4O5LH 1CU4H 2JJTA 5TQ0H 4ZUVB 5JO5A 3TJPA 1F3JA 1KGCD 1O7SA 4QYOB 3BSGA 1AGBA 4XPFL 2F58L 3ECQA 2D31B 3CSTA 3K0YA 1S7RA 1TZHA 1RUQL 3WJLA 1TEFA 1QRNE 3MA7A 4W9ZA 4LEOA 3OQRA 5T1LB 5CGBA 2MTPA 5I66A 1F3DH 2CCWA 1MUJA 4AK1A 3U7YH 5E4EC 2P24B 3PREA 5D96B 4L2LA 4HAKA 3BAKA 2J2ZB 4MSWB 3I02B 4V2CB 2X12A 3MTRA 1NMCB 1PD1A 3T3MF 3OZ9H 4C56E 1ZT7B 5HHXH 3T2PA 3C60B 4DHLA 2B1AL 2IAND 3HS0B 2CAKA 1JPGA 1SRDA 4W9GC 2NY1C 4X4ME 2FO8A 1UA7A 1U41A 1NFDA 1K8IA 2DJUA 4LPWA 4Q4IA 1VFMA 4ZW7A 1OAUH 3VE0A 3QO0B 2ATKA 4WNJA 5FAAA 1U6AH 3GINA 4L37B 4A7UA 1JFQH 1P7HL 4JFQB 1D5XA 3MCKA 3TVMA 4W81A 4WFHD 3WNIA 4AQ1B 2H2SC 1ORQB 1CZ8H 2VDQL 1XMEB 3O41A 3BDYL 1ZGLA 2GYSA 3V6OA 1R6VA 1OP3H 2YQGA 3CZUB 5GS0D 2P26A 3DGCR 2WZAA 4ZD3L 3U9UB 3ME0A 5F6IB 5JW4M 3JWNH 3DURA 2KZ1B 5FV1L 3TXAA 2R2BB 3B9AA 5FWRA 2F7QA 4P2OA 4WKZA 1A5FL 2XY2A 1OALA 1FH5L 3PWLB 2EXWC 2JXMB 1INDL 5JUEL 3GYRA 3TCXA 4IEFA 5BS0B 2WOBA 4WHTA 1NFIA 1N19A 3E6HA 5JHMA 1IGYA 4UB0H 3RPIA 1BD2A 3NMEA 1EEZA 3SCMB 3UL4A 4NRXB 4XTRD 1YN6B 2JQAA 4JFFE 1OGPA 5C0CE 4L8CB 2GJZA 4G6KH 4TLTA 3QA3B 1J8HA 4PJIF 5DJ0B 5C7XH 3CHSA 3OMZA 3T0EC 3AADB 3HZYB 4FTDA 2NTSP 3EYFB 2VN6A 2CBOA 4NJAH 5E70A 4U1MB 1X3DA 1N12A 4HCRA 3WTTA 2R51A 2NQ3A 5T1MB 3TBYB 4FNLL 3TS8A 1EAOA 1L5GB 1P5UB 1PJWA 2JWYA 3U1QA 2V5RA 1Q0XL 4UAOC 2WC7A 3D4GA 2Z0UA 5ICUA 4L4VA 2FRGP 3IDYB 5I6PA 1X7QA 1X9QA 2HSIA 2XLLA 4HXAL 2LLLA 4M7ZB 1YYML 4XPTH 4D7PA 3GDBA 1RLBA 2MNJB 5BO0D 1BM3L 2ZUUA 4AW4A 3L95B 1M4KA 1HNYA 3J8F7 4S1SH 2A77H 4RFEB 4KRLB 3GMQA 4HS6A 2DQUL 1OVZA 1THCA 1OXYA 4N5ED 4O4YL 5CJOL 4B7LA 1PDKA 4OSUL 2YO3A 5AZ2L 4GI9A 5TF1H 1DVYA 1TETH 2OP4L 3U6XS 2X4UA 1GOFA 3LDBB 1XL6A 5FGBA 4GG6E 1Y1UA 5DDHB 3MO1B 2XDHA 2BVPB 3MRJA 5T3XH 1N70A 2DIJA 2XZQL 1BFOA 2XIDA 4Z7UB 2QQNH 5HYJB 2VABB 1T0NB 3FPXA 5IB4B 4MDJB 1EBPA 5EO0A 3MRMB 1D9KA 2IH1A 3EFOA 1BQLH 3MV9E 4RDBA 4O51A 4NN5B 2MQGA 3L5HA 3T3PF 2WBKA 4G80A 2DLEA 3ARQA 4BKTC 4IBQA 1DQJA 1OSEA 5JIQA 3PL6C 2NR6C 2PCXA 4PRPB 1LP9B 3RY5A 1UJTA 2BVQA 2LU3A 4XMXA 1UWFA 2X2IA 2ZKHL 4MB5A 3CZKA 4RX4A 4LSRL 4UOW1 3HVDA 3BD3A 4X6FB 1JYVA 4P5TC 1CDJA 2J5WA 5ICZB 1JRHH 3MNWB 2WWKO 1H9DA 5CZXC 4NM8L 4NYLB 1FVDB 3SBWC 2N1KA 3GK8L 4WGVB 1FIEA 4HVBA 5TE6L 3MA9H 3FFDA 4CVXA 1FFOB 1UXSA 3HMXA 3MLWL 1XXDC 3CVCA 5IVXA 1S2EA 2BC4A 4DEWA 1TEYA 1JGDB 3O6KH 7TAAA 4ICWA 3VWKD 1DBAH 4JFZH 3DVFA 1KN2H 3C5ZA 4GRLB 5F6HJ 4DN3H 2EAEA 3PGFH 4BK4A 1CQKA 3CVHL 2AAAA 3FB5A 3MOAL 2Z35A 4P46C 3TV3L 3IDNB 4RGMB 4UTCA 1AGEA 4NUPA 6PCYA 2XU9A 4I1PA 1PX3A 3V0DA 3FXIC 1SJMA 3M8OH 1MFUA 3K2UL 3K46A 2Q6WA 1Q1PA 5I26A 1TO5A 4E36A 2YAEA 3PWNB 1R33A 1G6RH 1Q9LA 2KT6A 5ELIA 4M1CD 4X6CE 1DUZA 3AU1A 2E0PA 5D70L 3RLSA 3RWEB 1E5CA 5K9JH 1XF2B 3EDJA 1NBZA 3LPOA 4KK9C 5GZOC 2XN2A 3L5WA 1KIUA 4KTGA 3LQMA 1E4KC 5AVRB 2V3DA 5DTFB 1DL7L 1YY9C 4PS8A 1IZJA 1IBFA 4V11A 3LKNA 3MC0A 3V55A 3ZDXE 2V5TA 5ICXA 1Z9SB 3RNKA 4XXWC 4WI4A 3F7YB 4CGUB 1JN6A 5L2KE 3QDHA 5D71H 4Q6IA 2CLZB 1KZQA 2Z3FA 3ZE2F 3LPWA 1I3UA 4ACTA 1V10A 1BGXL 4XMLL 1M9SA 2HFEA 1KTJA 1QLEH 4F7TB 2LGNA 1F3DJ 2BSSA 1TPXB 3EO0B 3RFZC 3ZGIA 3OBAA 1H3GA 1U95B 3A6OA 2VJXA 5DMKA 5GGTA 2FSEA 5HJDA 4L0PB 3O45B 3LHPH 1G7QB 1PS3A 4H44C 5TJWK 4WO4A 3QUZC 3ARPA 5TD4A 4CBPA 1XVSA 2W9EH 3GXUB 1B88A 5ECGA 4MAYD 1KLFB 1J10A 1BXAA 5HI3D 4Q0XL 3VFUA 3GXMA 4OCSH 3QDME 1OAXL 5HGAB 5D1XD 2X6CA 1NFDE 3TJEH 4GLRH 1YNKL 3KWUA 4JPIA 4IIQA 2F2HA 3TO2B 4UU9A 3SE4A 4U3SA 5JXAH 1C5BH 3NP4A 1U8MA 3BN3B 3OKKB 4A7SA 4YZFE 4WW1A 5HGDA 4HEMA 3DX3A 3GM0A 3FNKA 1BWMA 3BP7B 2ADFH 2OX5B 3REVA 2XKUA 5D1ZC 1MWAB 2D3LA 3PNRB 1BMZA 4ZO8A 1QQDB 3QWRD 3GRWH 1M71B 4C4BA 3CDCA 3E7JA 4R5VA 3CFEA 3L1EA 2A4EA 4AEHH 1OAUL 4MJ5A 2XZAH 1U6AL 3CXFA 1PFCA 4MCYA 4O58L 3A6CH 1WD9A 4GAGH 4H26B 3V0FA 4DFIA 2ATAA 1LQBC 1TLKA 3ZDYB 5F72S 5MEPA 4OLVL 4UQ9A 5IEHA 4NZUH 1BD2E 4B53A 1INEH 4AXWA 5JLZA 2YKKA 4PJGF 3T65A 5B7MA 2YFNA 1S9YB 1WIPA 4HEPA 2Y5TA 1BFVL 5AOIA 3ULVH 1MIML 4HIIA 3X3GH 5IQ9B 3SPGA 3V7AG 1AIFB 1J8HE 3FRPA 4S2SB 1E40A 4H1LA 4L3EA 4MBOA 3L3OC 5C0IA 3MLSH 3ZHFA 4OD3H 3T77B 2XN0A 3FTGA 3G6JF 3N1QC 5FYKU 5GRZA 1YHPA 4LQFL 4X5WB 3FUIA 2NY6C 3L3IB 4XNZB 4GG8A 2D9CA 1EWHA 2CK2A 4NHUA 3LJ3A 5GHWL 2XRAH 1X9UA 5C7XL 3ECBB 2RTTA 1ZVNA 4DKAA 2NZ9C 4XX5A 2DJMA 4GMSH 5D93B 3MRRA 1XCXA 4U1KA 1X4XA 1RZJC 4E9QA 1TZAA 4U1LA 2OK0L 5KW9L 3BMVA 4AI7A 2ZCLL 3LN4B 3U4KA 3IJ7A 5ANMB 4NM4L 3EJTA 1E4WL 2XKSA 2V9RA 3IJEA 4YIQB 4UM8A 1IKNC 3QQ4B 3H3PL 1B6DA 1ZRUA 3U36A 1TJIH 4PBWD 4RSYA 5KBDA 4XPTL 3QRFM 2YN5A 1TQUA 1CVRA 3QXVA 4KO5A 4PP2B 5IW6A 4JL1A 4S1SL 1UB6B 4AEFA 5FYKL 1MG3C 2DS4A 3B2DC 4HETA 4AE1A 5EZPA 1LNUB 2CBPA 1FFNA 2Y72A 3HPLA 2EEFA 2WXKA 1QLFB 1OE3A 4XNYL 3VB8A 4N0YH 5J6GA 2W59A 3OL2A 3T1FB 2ODIA 3BDBA 2OMBA 3A4EA 3OB8A 2OTWB 3FT2B 4Y19E 1P2CB 1CFMA 3RZCC 3ZHDA 5CJQH 1J87A 4LCVA 1DZBA 3KPLB 4B0MB 4JG1L 3TPKA 1URIA 2ZX7A 4W9JC 3ECVA 2IQAA 5LGYA 3CTTA 1H8SA 3ZKMD 2ZAGA 3D52A 4X8XA 3BE1H 1L9MA 5F70A 4PJFB 1KTLA 4Z1PA 2CLVA 3PHOA 3MBEA 3J07A 2VNCA 3DV4A 1V3KA 5EZOL 1N5YL 4E41B 4TNVK 3JUZA 5DEZA 1FRGH 3ZMEA 4Z7OE 3UH8A 3QEUA 1JPSH 2NNAB 5I1CH 3CFDB 1QI5A 5E2UL 5FYJD 5D96C 1VKXB 4XWOD 1P4IH 4XO5A 2AQ1A 3HR5B 3SPVB 4WI0A 2EVJA 4G6FD 3BIAX 3MR9A 3C60C 1KT2B 2G3XA 5IVXE 2O72A 3HS0C 3IDJB 3K8KA 4OFQA 3IKKA 3VXSB 4QRRD 1YCSA 3NN8A 4L3CA 1KTDB 1W8OA 3N43B 3N50A 1U0QA 1A9BB 3Q43A 4PJCB 2FT6A 1X5KA 3STLB 3VSQA 2RAMA 3KCPA 3NIFF 3G6AB 4NCC1 1FLTX 3EJUA 3SDXE 3SPHA 3MA9L 4EOWL 3CHOA 1ROCA 2CGYA 3LRSA 5JR1H 4NZRL 4FQXA 5CMAA 1KJ2B 1NBYB 2WUBH 2VW7A 4RFOL 3D06A 3WEOA 5JMOC 1VSCA 4JO3H 1DQLH 4K5PA 3OPUA 4Y2NA 5F6IC 4OT1L 5AYUL 3CG8A 1BLIA 1CE1L 2HT3C 5CEZE 5JW5A 4P2RD 2CLRB 4YXHL 3C5JA 1ED3A 1A66A 1W0VB 3AITA 5DUPH 3ZSTA 3ZRFC 4A38A 3RY4A 3WFEH 1JI2A 5FO7B 4XBEL 4ZS7H 4FI6A 1AXSA 2DM2A 4ODWA 5GGUA 4OGAC 3Q3GB 5AW4B 5D2LF 3A24A 4FJZA 5F1OB 4M43L 4A2MA 3GMOB 5T5FL 4D0DA 1NC2B 2C7UB 5DFTA 3MRBA 4JHAL 5F7WC 3T6XA 1OCRB 4FD0A 4JRLA 3F58H 1PKQB 2YFOA 5BJTB 5JOPD 1RU9L 4RAVA 3PABA 2YGQA 3GRGA 2FWSA 2VLKB 3K4DA 2SODB 3BUBA 3QUMB 2Q86B 1P5UC 4FKHA 2BOBB 3O0LA 3U79A 1YLBB 3EH1A 2N0KA 2VITA 4TUOB 3MRLB 5F3BA 4F15B 3PY9A 4IRZH 5AVVB 1DFBH 2NCEA 4M7ZC 4WHDA 3HAEH 2P5WD 1EZVX 4NUJA 5C0GA 4YVNA 1ZANL 5DD6B 1MCJA 1KLGB 1QACA 2WWOA 3KYNA 3GO1L 2ZXEB 2AQSA 4JDTH 2QVFB 4L1SA 5CZKA 5GZNA 3FAXA 5LHDA 2JELH 4QHNA 4L1BA 3GKWL 4PJDB 1NCHA 1SMOA 2E6PA 4Q2ZB 3RHWK 2CJTA 3OZKA 2C1OB 2BXZA 4MS8C 2GIYA 1J5HA 1HILB 4UT6A 4XNXL 5E5UB 2FUQA 1I7TA 2F18A 4OZGA 2P7TB 4L29A 4HEME 1PZDA 4ODHL 4QRRA 1IFRA 3LDBC 1ZLVH 4ANWA 4XP9H 1A3RL 3TJEL 3PDGA 4M6NL 4X99A 3UJIH 4DW2L 5IQOA 1DBKH 2DWTA 4KX7A 4PW9A 3DVGB 3MRQA 4GQQA 1EJOH 5E6IB 4A6YH 1ND0B 2PXYA 1BIIA 3QCTH 4J3OD 2WYIA 3QAQA 1CBVH 1N6QH 2A6KA 4O02A 5D6DA 3G6DL 2CSPA 3F6LA 4NN5C 4HCGA 4JY6A 2J5LC 2E7HA 5D7JD 1NGZA 3GRWL 1M7UA 3V79C 4UBDD 3AGWA 4AEHL 1JK8B 3QNZA 2FLMA 5D7IA 3PXHA 1ACXA 3A3YB 1MAJA 3F3HA 4J3OF 5F9JA 2XXMB 4BQ6A 1SYVB 1T03L 1YDPB 3QARA 3BP6B 3CFMA 4PIRF 3ARGB 1TTBA 1JWUB 1E9PB 1RZIB 3JQOB 1FVCA 4QPEA 4K7FB 1OY3B 2BHUA 4AM0B 3W37A 1ONQA 1SBBA 4FQHA 2WZ5A 1GVIA 4TSAH 3LZNA 3GMPB 4ZRGA 3NA9H 4PWHA 2Q5BA 2P8PA 3M7FB 3KPSD 1A4AA 3QO1B 4JBSA 1U3JA 3L2NA 4NUGL 2XA3A 3FU8A 3BSZH 4AH2B 4ANKA 4KFZC 5ITFB 4E5XA 5I17A 1ID5I 1IKFH 1G94A 3Q8CA 4NZ8A 3ZKND 3MLSL 4GRLC 4BHUA 2BSBA 4B9IA 1MLBB 1XB8A 3MGOA 3F7VA 1YMHA 2QELA 4GKLA 4RGMC 2HTLC 5EBLA 1WVZA 4BQBA 3EO1A 4WTWA 2PW1A 3B2UC 4L3FA 3FCTB 4GW1B 1IZKA 1WCBA 2GIXA 3MCLL 2XRAL 3H9HA 2BVYA 5CJXC 1HOCA 4XMKL 3NFNA 4PTUA 2GJPA 2XPZA 4GMSL 4YHNA 5DS1A 5BVJA 2IWGA 4GW5B 4CJ0A 1YC7A 4ZYKB 3U2SB 3LSOA 3MREB 5ILTH 5EZLB 3HPJB 2DDQH 2EYRB 3KEDA 3QEGL 4EXPX 3GTTA 1F1DA 2R8SL 2X3CA 3CLFH 2LU5A 2QTVA 1TQCB 4QD2E 2V9QA 4KMTH 3HE6D 4JZNA 4YN3A 1AKPA 3DHJA 3CXDH 4P4KC 2NX5A 4L1LA 4N9GB 1XBRA 3I6GB 2BNRE 2A38A 3LNDA 3TIDA 3NCWA 4YDKH 3IN2A 4NWTL 4Z5RA 1UJ3B 2FQFA 2F53D 4ZDHB 5A40E 3LKOB 4DN4L 3P9WB 3K3QA 1CG9B 1J0JA 4D2NA 2A99A 5DD0H 2Z7ZA 5A6MA 1PG7H 1SOQA 1FIGL 4U2YA 4YJZL 4JPVL 5D7JA 5IBTL 3ESUF 1XF4B 4KGJA 3P11H 3K80A 4HC1H 2OSYA 2W1NA 5CJQL 4HULB 5FA4A 3V0WH 5IJKA 1JHLH 5C9KA 1OTTD 4LHUD 4X6DF 1TTGA 1AQKH 3UCQA 2MNUA 1G7IB 4WW2B 4AYMC 2K8MA 4ZFGH 4JFEB 2BVTA 4XB7A 2H2PD 4PJHF 2QLYA 2YD7A 1KEML 3E6FB 2EDQA 3LEVH 4U6VL 3TEXA 4MYWB 3OC8A 4M6AA 4Q9RL 4FABL 4LOFA 5JIKA 1WFJA 4AYID 5I1CL 1ACCA 1J11A 1YEDB 2ZSWA 4W4OA 3DBXA 3O4LB 4Y4KD 2DL2A 5IB2A 5IT2L 3KLDA 1BVNP 3OKLB 5GSRB 3QXTA 1VIWA 3BAXA 3W39B 5ERWB 3QR0A 2GTWB 2O6PA 2ZF9A 2RB8A 4NT6B 4ZBJA 5IWLA 4MKTA 4MQ7B 3DX6A 2FCBA 4AGPA 5AVQB 5EUOE 1GW0A 1VFOA 3A21A 2ORBH 4HUUA 4AV0A 3N3EA 1H3WM 5BOZG 3S9DB 1OB1A 3FU7B 1Z9NA 4JO3L 5BMFH 5IMKB 1KZYA 3FOMA 4OM0L 1R75A 3EOYG 2EABA 3HNTH 4GAYB 4HAFA 2UWEA 3C9NA 5KVDH 1LO0H 4HUWA 4Y5YB 4DF9A 1P5VA 2UZIL 3CMOL 4AZ8A 1FF5A 2ETWA 4DK5A 3RTQC 3QEQA 3PP3K 2I24N 4R84A 2BO0A 1FZOA 2XTJE 2IEPA 1A8JH 2H32B 3ENEA 1NGQL 3NGBB 1WWAX 2HLFD 1H3UA 3NCYS 1M2OA 3L1OL 3DKHA 1OQXA 4Z7NE 4NSKA 3ULSB 2G0LA 4YO0B 3WIHH 4Z7WF 4XNZC 2GABA 3HG5A 1LYQA 1QFWH 5H35A 2YKLH 3QQ3B 3PQYA 1QSZA 2ZWKA 3SKNA 1XCQA 3B9KA 4M1GH 2IDSA 3H1ZA 4JM0A 2VJ0A 1MFCH 4C55A 3K1KC 2CA4A 4MJ2A 4X2UA 1YEEH 4JREB 1UD6A 4WZ9A 5IFJA 1OAKH 2NNXA 4XNAA 5DHXB 5DT1H 4D9QE 5KYUB 3HHRB 2V33A 4TSCH 4HKBA 1ACZA 3EGDA 1E5BA 1W72L 4L9DA 5DHVH 4OZGE 1CFNB 3QCUH 3D07A 1G6RA 1WP6A 2D7TL 2EO7A 2D2CC 2WO2B 1BHGA 3BN9D 1Z9PA 3AG1B 4U7MA 2IBZY 4QOKD 1YG9A 1JGLL 3BZEA 4Y1TA 5IOKA 2F7PA 3UTTD 3O3DA 15C8H 4QHLB 4XXCA 3QIUD 2EIZA 4NGHH 4KTYA 5I0WA 5TH2A 1KJ2L 3P4NA 1D6VH 2X4TA 5GRYA 3VD0A 4MAUH 5HGBA 4UM9B 4H2CA 4M4RA 2XWBA 4XCCL 1NCTA 1QWHA 3VGAB 3QUXB 1DBKL 2L0DA 4MNGB 3UMTA 1K4CA 4GW4B 3IU4L 1NDTA 2QFPA 5D7IE 5E94A 3QCTL 1N6QL 2WBWB 2FQEA 3D1MC 1NQBA 4Z23A 2AEPL 3RIAK 1XL4A 2IH8A 4GXUN 1FI8C 1WFTA 3KR3L 5FYLL 1UA3A 1GKOA 4F91B 2WLIA 4H8PA 3NEXA 4HBCL 4YEEA 5IHWA 2WNKA 3TEYA 2H6PA 1XWVA 4MMZC 1AQ8A 1MG2C 2H5UA 1O5PA 3ECWA 4ABQA 1JZEA 3UAEA 1IGFH 2AJSH 1KELL 5JW3H 1FL5B 4YE0A 4HK0B 2FWUA 2N0MA 4J6IA 3GZOA 1BZQK 5EORL 1A3LL 1RIVH 3GLEA 5ACMA 4AJ0A 3FRPG 3KH3A 1WICA 1AC6A 4JB9L 4OJDH 5E8PA 2P8LA 4H1LG 4PY7B 3BQUC 2YPKB 3CC5B 4N0RA 5CN1A 1J05A 3NA9L 4PCSA 3OR6A 2Y36H 5ECJE 3W82A 1UXWB 3NCMA 1M7DA 1QEWA 1IL1A 1S7VA 1U8HA 4MNQA 3GRWA 1IKFL 3JWNE 2R0KH 1A7BA 3QJQB 4XNMB 4PVMA 3VFOA 2ZOLB 4JO5A 4M02A 4GMTL 4XAKD 2BZCA 4JNXA 3JSSA 3MRDB 4W70A 5T1DH 3RPKA 3VTAA 1ZT4B 2IOOA 4B96A 2WTPA 2YUVA 4N8VA 1BVOA 2WGXA 3ESVF 4GSRA 3HRPA 5ETUA 2BSEA 1OAZL 5AZEL 1MRCH 2P47B 2VSDA 3TT1L 1EZLA 1ZHLA 2WLJA 2YR3A 2EXYD 1YYCA 2QQKH 5AW3B 5DVOA 5I6MA 2CXGA 1A14L 1WFIA 1SGKA 2FBOJ 4KTEH 3WS3A 4ZX6A 3WSQH 2DDQL 1NGXB 1QA9A 1X5HA 1RD6A 1JHKL 1LO4L 2VR4A 3SKJH 4HU8A 4PHXA 3BUTA 2X3AA 1R47A 3KYMA 3HZMB 3NIDE 1NCJA 2QJDA 1I8UA 4G8EB 1MHEB 3EDKA 2F15A 3ABKB 2AJVL 2YUWA 4I13B 5DHYA 5B38B 3MFGB 4MA8H 5KSAC 1HXYA 2HVJB 3W5MA 3Q01A 1NIFA 5JDSB 5CP3H 5LBVA 2J3SA 3OMNB 1MCIA 3OXSB 4F15C 3LQAL 5AAPA 4QGTA 4N90D 5B3SB 1GIGL 4PRNA 4ELMB 1QRND 2WANA 1NL0L 4BWUA 4UIKL 2GEQA 2A9NH 4KTDH 3P11L 5T3ZH 1WTLA 4OGXL 2GUYA 2YRPA 3NJFA 3L4CA 5EEUA 5TE4L 4WSKA 2MCPL 1T89A 1N4XL 2XZZA 1UOVA 4P57B 1AQKL 5CU5A 2ZX5A 3BWAA 1RZGA 1JOIA 1RULH 1SHWA 3VWJB 4KKZA 1WBYA 3TT3L 1S7XB 5B4MD 5EF0A 2QTEA 4NNYB 1RPUA 4R6UA 5E6IC 2YEVB 3BSHA 4QF1B 3UOAB 4EEEA 3L8QA 1FFQA 5D1QC 3BO8B 4GEIA 4JAMA 4WY7L 4B6ZA 3F7QA 3QIWD 1XXFC 2I69A 5D5ME 4BFEA 2CO1A 1RHHB 3FQUB 1KJVA 5DRZB 2BZ7A 4RBPK 1ZTXH 2ZUQB 1UWXH 1QWUA 2E9JA 4FFWD 1RJYA 1HXKA 5SV3A 1VB9A 4KNTA 1BQSA 5EO1B 3UFIA 2WLLA 1A4KB 2YBGA 4HV8A 3RVTD 3JVGA 5IMLA 2J44A 1JGUH 3OKMB 2ORBL 2G5RA 4XT1C 1I9RH 2AI0H 4XCEB 3NOIA 3QQXA 1NJ9B 2ZONA 3MTXA 2LAAA 3IKCB 4GSUA 1M1XB 3ARGC 3UAFA 5DJAA 4LKXA 2CDGB 2WXRA 4HUVA 3II3A 4K0OA 5F7EH 1GGBL 2CUAA 1AXIB 2GBTA 1UHVA 3N44B 2WP3O 4IRJA 4P9MH 4PW4A 2NUTB 3J27A 4BK5C 4EBQL 3S5ZA 2DTSA 4OI7A 3C5SB 4GUOA 1NPNA 3PQYE 1D7BA 3ILPA 4U3CA 2X87A 2WB7A 1UD3A 5JZ7D 3ESOA 1F13A 4JFHE 3VD3A 3H42H 5E08L 1BG1A 3VCLB 5J9PB 3N40P 3E9TA 3WIHL 4MZIA 2B2XL 1UEMA 4PRAB 1A9EB 3QUYD 4L2YA 3NP3A 3NFPA 5JDJA 5FGCB 2PCPA 3DI2B 5KYWA 3HZ3A 1TENA 3QBTB 2BIMA 1UT1A 2QQLL 2YC1B 2YUXA 3L2MA 3N1PC 4WV1A 5I8EB 1JZ2A 4C83B 1KCKA 1YMMB 4X9YA 4ZUTA 2BJMH 2DBJA 4Q14A 1ZJBA 4DOHE 5AW6B 1U58A 3QHZL 2I07A 1TQCC 4M56A 1GZHC 2X4QB 2VMCA 4R7DB 1HSBB 1G7MA 2WBJB 3GBNL 1FNGA 5B7EA 4EE2A 1F4YH 1MQ8A 5L4FA 3SDCA 3CSPA 5C08B 3QT2A 4LSQH 3ZX1A 3HVNA 3DIFA 4ERSL 3ESMA 3IXTB 3MFFB 3BCDA 1M7IA 1R4XA 2F1AA 2B08A 3IDMB 3O6LH 1UJ3C 1I7RB 3UTQA 1EK3A 5I1JH 3VRJA 2BK8A 4IRSB 3Q6GH 4EIUA 1DVFD 3O6FD 1EHKB 3MNVA 4G9FD 1IX2A 2W9DH 5DHEA 3TC9A 2NMSA 2PYFB 3QPXH 4MAUL 4ANXA 3MNZA 1QO3B 1S9KC 3ARDA 4JKPL 3VFRB 4X9HA 5CIPB 5JIHA 1T4KB 4WW2C 4IRZA 5J11B 5FDWB 2X53A 4K71B 4IGBC 3QPQC 1QKZH 3JTSA 3NJJA 3HAEA 4FFZL 4Y4HD 4CBZA 5FXCH 4W9FC 1XGQA 4IU2B 4D9LL 1DE4B 1LEIA 3GD1C 1VZHA 4WAFA 4NP9A 2BNQA 3QZWA 5KYXB 1FO0L 4FL4B 2X4NB 3BP4A 5DSCB 1KGJA 4R96B 4K5OA 2YPVH 3EG9B 4TPRL 2EDDA 4O2FA 5I1HH 4G6MH 2O6DA 4PJ8D 1KCBA 4E9VA 4NQCA 2VAJA 3AWEA 1JZIA 1E4XI 1D5ZA 2XG4A 5KYYB 1RIVL 3CU7A 1MCSA 4KY1H 3TH4T 5KBLA 1MH5B 2QV2A 1LILA 1J1OL 3KGUA 5E56A 4E5XG 4A6YA 3FHAA 1FCGA 2HKHH 3QUYA 1OTSD 1CXIA 1MW2A 2Y36L 1MJ7L 1NUGA 1MPAL 4N2NA 5LCVH 5TDPB 3REWB 4DVBA 2FX7L 4J3WA 3VA6A 1TYJA 3GSVA 3FTSA 2VQ1B 3EGXA 1L9OA 1FNLA 3FQNB 5FECA 3NRQA 1ZGLP 4CGTA 3EAKA 5DJXA 3QQNA 3Q2NA 4Y5YC 1QPXA 5C0DA 3ULVE 3RI5F 1DQQB 3LMJH 4FI8A 2AJYL 4N8CL 1UYWL 5JPNB 2DLGA 3WNOA 1NAKH 2AQRA 4QJ4B 2KPWA 1MJUL 4FLHA 2BP0B 2C3WA 4OD1L 2UZXA 3K6OA 3D18B 4LBEB 1AQHA 2QQKL 2Z7YA 3ETSA 4CW1B 3NGBC 2I9LA 5L2KD 3FU0A 3LOWA 4KQ3L 3NBNA 5DJ2B 4KTEL 2X28A 3RBSA 5DJ6B 1BOYA 3L3DA 4X7CC 2G2NA 1DBMH 5BRZA 3BSZA 2FZ3A 3OM3B 4M7KL 1UATA 1H6UA 1MN4A 4J3OG 1IC5L 4QHMA 4P0DA 3MNMA 2ZJSH 5IHHA 1UH2A 2IH3B 4CU6A 5C7ZA 3TN0B 3F8UB 4GSXA 1S5IL 1BEYH 2NY2C 3HC2A 4G43B 4JREC 5ALCL 1T0OA 3LEXA 3MX0A 2NYZA 3RDTD 1X4YA 4PR5A 1PEWA 4M62H 2LR4A 2NYYD 4B27A 1TMQA 4PJXE 5I5IA 1W0WA 4PQXA 3UG5A 2C3HA 3QDMD 2IALB 2FJHB 2OMTB 2EO9A 2BCKA 1MDTA 5KS9B 4L5FH 4NKIH 3NPSB 1JPFA 4M6ML 4XNBA 1F3RB 4ZSOB 5EF3A 3BMWA 1CFTA 1CO1A 3NQKA 4JKKA 3ZDYE 1FGVH 4RMQA 3CPLB 2IPUK 1ZKAA 3KAAA 4KXZH 3L81A 1QI4A 2F61A 4BH7B 2OSXA 3TO4C 5FFGA 5H94B 4JRFA 6PAZA 4ODXB 3KPNB 3VXNA 3L3HA 2P42B 4AYFA 3TBBA 1QFOA 2FUTA 3VGAC 5LQBH 2MQCA 1WISA 1VAHA 2DF3A 4YZFF 4X8JB 5JHAA 1IBYA 5H2BA 2PMZA 1CLZH 5I9QB 3SQBB 3QZPA 4Z3GA 2R2EA 1MF2H 3MXVH 4AV5A 3RVXC 1ECZA 1TZGH 2NUPA 1NIAA 3TP4A 5IMMA 4HC1A 1A0QL 1HH6A 4XN1A 3WNKA 1EXUA 3RL2B 1NZRA 2NTFA 4EIBA 2YLKA 4DO4A 2AK4B 3MJ9L 2LE9A 4OCRH 4UQAA 2JIXA 5DEFA 1G9ML 4I9WE 5CU9A 2W95A 2CKBB 2Q7YA 1PX4A 1WBXA 3B8SA 3ILDA 2ARJQ 4EI5B 2EDLA 3VXQB 3O9WD 1AZVA 1E2WA 1NCBH 4ORGA 4F2FA 2JNZA 4X4ZA 4GOSA 4I2XA 3AQXA 1SBSH 1XT5A 2W81C 4DGUA 4E42A 4HXBH 1S7SB 5AVTB 3HN8A 2O5XH 1WIUA 1YEJL 2Y9RT 2OJZL 4MXWL 4QMEA 3VGGA 2Z31A 4DQOL 4HK3J 1DVXA 1G4RA 3ZU8A 1GS7A 4AQAA 2LHAA 3MRNA 4V1DA 3P2TA 2OMYB 1ZXKA 1HEJC 4TNFA 5DUMH 3UTZB 4WUKH 3V4LA 2AXGA 3AW5A 1MFAH 3KWTA 5GRWA 1YUHB 1MHCB 4UDUA 4S0HA 1RZJH 3OG4B 3O3AA 1T1ZB 4I3SH 2J4WL 3P54A 2EIDA 4R2GD 1XF3A 3RX9A 4H8WL 4J5VA 5AAMA 4ENZA 3IPBA 4DPAX 3QS2A 3IGKA 1ZVYA 2VN7A 2PWGA 1O6SA 3EHBD 4FDWA 3ARBD 2OCJA 5E7BA 5IROD 5EU3A 2GUOB 3MU3A 3GS4A 4YWGH 1I1AA 1G9MC 3HFML 3GSXA 3T2QA 4PV8B 1SXAA 4LP5A 5K59F 4NNXB 4Y19D 5E1QA 3LZFL 1CDUA 3FSAA 2DEWX 3O8XB 3QIBD 4JFTA 1Q1JH 3A4FA 3BPNB 3Q13A 4LEXL 2QMJA 4NNPL 4D0CB 3WIHA 2YPLA 2BY1A 3LV3A 4DIXA 5E9NA 2MOGA 3UZVB 5EBMA 3VJ6A 4AQEB 1TYEB 3HI1A 1P4BH 1A47A 4GRWE 1M2VB 1KSRA 4WK2B 1T83C 4TSBH 5GRXG 3RVWD 5ADOH 2LVEA 1AFVL 4HJIA 3QDGA 1NCGA 3N85H 1LO5B 3G3LA 3HFFA 4PJ5A 4ADJA 4FZ8H 3VXME 2BNQE 4XWGL 1ITBB 3KYKH 5C09D 2QFRA 3V9CA 2PTVA 5DHVA 4N25A 1G5AA 2IG2L 1TQSA 3VWJC 3QJXA 3AREA 1L7TH 1V3JA 3MJ6A 4P2QB 1QFPA 1SEQL 3AUWB 3HE7A 4U6YB 3UC0L 4AQ8C 4K55A 4XVUC 2FQGA 3F7LA 3MUZ1 3IFLL 5GGQH 4A7GF 4BH8B 2XWEA 2YPVL 1OARH 4LESA 5DK2B 3CSFA 1FZJA 2WMPA 4ZMNA 4G8IB 4O2CB 3G5YB 3KPTA 4AV4A 5F7AA 2VE6B 1IC1A 4MXVE 2OMXB 2UXFA 4XO8A 5DXWA 2ZUQC 4LSUH 4NQUA 2R0WH 1QLRA 1C08A 1JUFB 1G1CA 3LXBA 4JFDB 5CXPA 5FYLE 1LEKB 3UYOD 5MEND 1NFKA 2FAUA 1VEMA 4CVUA 4BE6A 4XPHL 4J4PA 1K9TA 3K2IA 4JKWA 4HGMA 5FWQA 4LXFA 3B83A 3HA0A 4KH2A 3SDXF 1AJ7L 3FSWA 4OQTH 1J88A 1UGKA 2XA8H 3JVFC 4FG6C 4PIBA 2BLFA 5D7SL 3MJGX 2OYMA 2WAQA 5IGXH 1DSWA 1DFXA 1U8QB 2YD2A 4N8VG 4WDIB 5E03A 4A1RA 4PSRA 4NQED 1FNEB 1Z0MA 2OR8A 3FTXA 4MXQC 4FQ2L 4KZDH 4BFIA 1MCBA 4MMXA 1MNUH 3HR6A 3TEZA 3X3FH 4GLRI 2ZG1A 5HPOA 1RJCA 2AKRB 2XCMC 3D2UA 3LMJL 4UNIA 5I1EH 3LIUA 5BRZE 3MPCA 3EBHA 3L5XH 4GKZB 1IE4A 3L1FA 3UCRA 5MHSE 1CDYA 3D3VD 2IANB 2HG5B 4UDTA 3ZTDC 4JMXA 1XGTA 2H0FA 3L3KB 5KSUB 1RK0A 3V0HA 2PWDA 4L8DB 2DQTL 2DQMA 1FAKT 4MRCA 4J3SA 5ACLA 1T2XA 1XIWA 4Y89A 2EINB 1I3VA 3RL1A 1IGJB 4OLXL 4JJOA 5IW1B 1MCWW 1F90H 5B3JE 4HIJA 5I71C 5KBKA 1MJJB 4QXUL 4XVSH 4HJ0D 4EN3B 1QFUH 2CNYA 3X12A 5T33H 1H3PH 3ILEA 4CN4A 2GB2A 4Y2DA 1T1XA 4TNEA 5DQJB 4JANA 1GPOH 1H15B 2FGWL 1GA2A 2XQYA 3ZSSA 2P4AB 2WBJC 3KWWA 1SOSA 4Y1AD 3SHSA 2CPUA 3UABA 2P9RA 3T04D 1U8IB 4DO5A 1HL9A 2V9UA 5SWZD 3ARFA 2WN2A 4AUYA 2EXWD 3HLAB 2B1OA 1YO4A 3EYVB 2ITDB 3GMNB 3VXRB 4GI6A 4XAWL 3ZR6A 3KL5A 1WITA 1F0LA 3OLEA 2BSTB 4G59C 4AYDC 4IRSC 1NIDA 4NC2B 4HYTB 2APBA 2HLEB 2J8UB 4MWFB 4CNIA 4YFEA 2XBDA 5IB1B 1U91A 4ZXBB 2YBRA 2ZWSA 3H7BB 3GSWA 4LARH 5GRUL 4EZMA 5B8CA 3APNA 3EFDL 3VD9A 2DLFL 2MEJB 4URTB 4ZNEA 4M03A 1MI5A 4ABVA 1QVOB 1PD0A 3QFJB 4LLUB 4KK8C 1HT6A 2OR9H 3GTNA 5ID1A 3ML8A 3OD3A 2ICWJ 3PWJB 4NAMA 2NLJA 4LCIL 1Z3RA 4P07A 4Y4FA 5CP3A 5LQBL 3T0ED 2GT9B 3BZFB 4OU3A 1BM7A 4I77H 4HKZA 5J11C 4K71C 3H3BC 3TTYA 1RAMA 1AD9A 4GJTB 3MXVL 4LHQB 1OP3K 2OMWA 4FKEA 3ZO9A 5EU6A 1TLMA 1HHGA 3OPZH 3DRTA 5DD5H 1QSFE 3GEWB 4FL4C 2DWEB 3MLXH 5DJCB 4N9OB 4R26L 3HG1A 4I2XE 2KC0A 2F6AA 3WYRA 4JZOB 1ZVSA 2PF6A 1DDHB 1OT2A 3BZDA 5JXEC 5FM5M 2HRPL 5C0BA 5I8KH 1T5XB 5GS1C 3Q05A 2F5BH 1AQDB 1FLRL 1WH0A 2L7JA 5E5MA 2PR4L 2NY0B 5FHBL 3RWCB 2HPOA 3LZOA 1LE9B 3CSYB 3W0WA 1FHGA 2ADJB 1NCBL 3VGFA 3MYZA 3U9WA 1KGXA 2Y1ZA 3JV4A 1WWWX 4HIXH 4KK6D 3P4MB 4QRFA 3SDDD 3ILQD 4XP6H 5IOPB 2O5XL 4FGMA 1U21A 2PTUA 4HUCA 1SYSA 3H6AA 3V6FB 3I50H 1U4EA 3CLEH 1HZHL 5HPMB 2DYPB 4R7XA 2HFFA 3WNMA 1SXCA 3BP5B 3EJYC 2ZUWA 4H0HB 2NCMA 5SWQA 4B0MM 5F7YC 4MZ3A 4YDIH 4ALAL 5C0AB 4XC3H 1BZ7A 1AGCA 4XP4L 3SDYL 4LP4A 3BVNB