4P5SA

Structure of reduced w45y mutant of amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTYINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The sole tryptophan of amicyanin enhances its thermal stability but does not influence the electronic properties of the type 1 copper site.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4p5sA00
3ZBMA 3FSVA 3BQVA 2UXFA 2CCWA 3NSYA 2GB2A 1KBVA 2FQGA 7PCYA 5I5IA 1SF5A 3ABLB 4G7RB 3WI9A 4E9VA 2J5WA 1JXGA 2LLNA 4DP9X 2TSAA 1XB3A 2QPEB 2QT6A 3T9WA 1L9PA 2XV3A 3QPKA 1ADWA 2BP0A 4A2HA 1WA0X 1OE1A 2AZUA 2IDUA 3AG3B 3IN2A 2BP0B 1AZBA 4KOBA 5B1JC 3WKPA 4BK5C 2MRYA 3T6WA 3NSDA 3KW8A 4G71B 3RYMA 1SHWA 2XV2A 1TKWA 2I85A 2QPDB 5EHFA 4BXSV 4YSTA 4Q89A 3ZX1A 3MBWB 4G70B 5I5MA 2ZWNA 3FU9A 4P5SA 2RACA 4E9YA 5B3SB 2UX6A 4KO6A 4N8UA 4BDVB 1PNCA 1GSKA 2WO2B 1AS8A 3AY2A 1HFUA 1SDDB 1X9UA 2WO3B 2OV0A 4QKTA 5I6OA 4JHVA 2XX1A 1PZBA 3WKQA 1GY1A 3AZUA 2GHZA 2XUWA 2FT7A 3NJKA 2HRHA 2GIMA 1ET7A 1OE2A 3EH3B 4KO5A 2IDSA 2HXAA 1KV7A 4YSDA 3WIAA 1CYWA 1M57B 3KW7A 3IN0A 3V9EA 1V55B 2JKWA 3OM3B 1MG2C 2XXGA 3ASNB 4F2FA 1NIDA 1A4BA 4A67A 3X1BA 4FA7B 6PCYA 1SF3A 3CVBA 5I6KA 3FS9A 2GC4C 1DYZA 1OCRB 2IH8A 3GXUB 2IWKA 2IDQA 4YVUA 1JXFA 4YL4A 2YAQA 4ENZA 4YSCA 2VW4A 3NSFA 4HZ1A 3ABKB 2QDVA 1MZZA 1BQKA 3QQXA 1ILUA 1PLAA 3UABA 1BXAA 4E9WA 1NIEA 3S3DB 5D4JA 3WG7B 1ZPUA 3EF4A 4RH4A 3ZIYA 3HB3B 3QJRB 2YAPA 4A68A 1ASPA 3FPXA 1BXUA 2GSMB 2PPDA 2P80D 3OMAB 2FQDA 1J9TA 4E9RA 3FYIB 1JVLA 2BHFA 3NJLA 3PAZA 4X4KA 3S3CB 1KDJA 1CURA 2DYSB 2CJ3A 3ZDWA 2XLLA 1ZIAA 4BWTA 1E5ZA 4L0PB 1PLBA 2BW4A 4E9XA 1OCOB 1F56A 2H5UA 3AW5A 2PP9A 2EILB 2FQEA 1DZ0A 2VSKB 3FSZA 4E9TA 4HHGA 4F2EA 2GBAA 1W6LA 3ASOB 4AKOA 4A66A 3TU6A 2VMJA 1J9RA 2PPAA 1GS7A 1BQ5A 3OMIB 3FYEB 1FFTB 2FT8A 5B1JA 3ABMB 4UANA 1BXVA 1V54B 2FT6A 1AACA 1T5KA 3SQRA 2PPFA 1WAEA 1UATA 5I6PA 5TK4A 4AKPA 3CDZA 1WS7A 8PAZA 2EIMB 2PP8A 3HEIB 4YSOA 2WSDA 5AKRA 3SBQA 1XB6A 1ZIBA 1PLCA 1A65A 2ZXWB 4KNTA 1NPJA 2AANA 1AG6A 4G7SB 1L9TA 3DKHA 3T71A 4K9JA 2YAOA 1ILSA 4PCYA 3NYKA 1SDDA 3TA4D 3CVDA 1KDIA 1BYOA 2YXWA 3SBRA 2UXVA 1I53A 4YSEA 2YAMA 4A2FA 1BYPA 1BQRA 2E86A 3CZUB 3SBPA 3UAAA 1IBYA 2DWSA 2HLEB 1NWOA 3JTBA 3H4FA 3PPSA 6PAZA 2J57A 4W9ZA 3EH4B 1YLBB 4P5RA 5TK2A 2HRGA 1AANA 3X2QB 1NWPA 2W8CA 1FA4A 1CC3A 1BEXA 2BO0A 1XB8A 4WKXA 1W8EA 4HALA 2QDWA 1HAWA 2CUAA 2XV0A 3T6XA 3PLYA 3U25A 3FSAA 3G5WA 1ET8A 3WNJA 4E9QA 3PXLA 3EHBB 1A3ZA 3WNIA 3MX0B 3GYRA 3ABGA 2N0MA 1KCWA 1IKOP 1RZQA 2IWEA 1W6WA 1E65A 1EZLA 4GP4B 3CVCA 2VW6A 1L9RA 2HZHA 1JZHA 3PAVA 3EH5B 4GXFA 2EINB 5LDUA 1E67A 1M56B 1URIA 1JZGA 1HAUA 2EIKB 4DP0X 1PZAA 2BZ7A 4GY4A 2X88A 1L9OA 1NDTA 4AX3A 2IH9A 1MG3C 4HHWA 1CUOA 1RCYA 2X87A 3JT2A 1FWXA 3C75A 2PPCA 2TSBA 3DTUB 1TEGA 4PAZA 5F7BA 2JFCA 4FAAB 5I6LA 1A8ZA 4DPBX 1V10A 1PF3A 1B3IA 2J55A 1QHQA 1SHXA 3FQ2A 1AIZA 3IBOA 2DWTA 4KOCA 4NERA 1QNIA 3UAEA 2W88A 2BW5A 1GYCA 3UACA 4DP4X 4DP8X 3X1EA 3NJIA 1NINA 3H56A 1BAWA 1ZDQA 1AZNA 1AS7A 1N68A 2BP8B 1GR7A 5I28A 4YVNA 2YAEA 4YSPA 3D12B 1NZRA 4DP5X 1PZCA 4YSRA 4GP8B 3X1NA 2BP8A 2OCCB 4YSUA 3FQYA 4M3HA 2PPEA 4TXVB 4KNSA 4KNUA 2J56A 2DY2A 1NIBA 2PP7A 2NRDA 4Q8BA 2H3XC 3AG2B 5I26A 1NTDA 1GW0A 2IDFA 1JZFA 1WA2X 4F7KA 3FU7A 3FT0A 4HCIA 1OOWA 2BZCA 2B08A 2XU9A 3AG1B 3V9CA 4GYBA 4A2GA 3TBBA 4BWWA 2VSMB 2Q5BA 3BVDB 3IE9A 5PAZA 2FWLB 2VM3A 1AOZA 5B1BB 1SFHA 2GI0A 3NP4A 3NJGA 4CSPA 5B7FA 3S8FB 4DPAX 2P80A 1GS8A 3X1GA 5AFAA 2AZAA 3QJQB 5IY5B 1E30A 3QJTB 4UAHA 1RZPA 4E9SA 1JVOA 4G7QB 1CYXA 1AZUA 1AZRA 1E5YA 3TBCA 2UXGA 5D4HA 1JZEA 1SNRA 1L9SA 3NJJA 3T6VA 3NJMA 3PCYA 3PAUA 2R7EA 2XX0A 2CALA 1GS6X 3NT0A 1WS8A 1M9WA 2Y1AA 3FU7B 1OE3A 2XVBA 5B1KA 1J5CA 1TEFA 4N4YB 3GDCA 3S8GB 2YARA 1IC0A 3NP3A 2YAFA 1PAZA 2CBPA 4MFHA 4NAJA 3N55A 2UX7A 4WTQA 4DP6X 2XXFA 1EHKB 4HCGA 3L45A 1AR1B 1J5DA 2EIJB 3ERXA 2YXVA 1PY0A 2FNWA 2A3TA 3CG8A 2JXMA 1NICA 1ZV2A 4QLWA 5B1AB 4UF7C 1AS6A 1ASOA 1JXDA 1AQ8A 4CSZA 4HAKA 4YSQA 1J9QA 2H47C 2VM4A 3QJSB 4BDVA 2YAHA 1PCSA 1N70A 2I7SA 2PCFA 3N2JA 2AFNA 2Q9OA 1KCBA 1NIAA 3NJFA 3UGEA 1AZCA 1OV8A 5I6MA 5FC9A 1IUZA 1PMYA 4JHUA 4GP5B 4W1TA 2GC7C 4DP2X 1JZIA 2OJ1A 1KBWA 2HX9A 2XYBA 4HIPA 1A4AA 3UADA 3T6ZA 1KGYE 5PCYA 4YSAA 3AG4B 4AI7A 2BWDA 2B3IA 1KYAA 4DP1X 1NIFA 1GY2A 4KO9A 1MZYA 1ZDSA 5I5JA 1TU2A 1IBZA 3QJVB 3OD3A 2UXTA 2MTAA 5E9NA 3NJHA 7PAZA 4HCFA 1OCZB 4EF3A 2IWFA 2ZONA 2I7OA 1WA1X 1JOIA 2DYRB 3CDZB 4G72B 4JKNA 3IEAA 2BWIA 1NPNA 2IDTA 1VLXA 1OF0A 2HX7A 1ET5A 1JZJA 1OCCB 4BWUA 1JERA 2HX8A 2XWZA 4BXVA 3FQ1A 1J9SA 2FTAA 2Y69B 1SJMA 5D4IA 2ZOOA 3OMNB 3OQRA 4AZUA 3X1FA 1XMEB 1R1CA 1RKRA 4ZK8A 1AAJA 2DV6A 3FSWA 3NJNA 2PCYA 2PLTA 3TASA 1ETJA 3H4HA 1ASQA 1L9QA 1SFDA 1ID2A 1X9RA 3FU8A 5ANHA 1MDAA 3QJUB 2YQBA 4AKQA 2R7EB 2IAAC 1PNDA 1AG0A 2AVFA 2VW7A 1QLEB 4M4RB 5F7AA 4KO7A 4A2DA 3FPYA 5A7EA 3NSCA 4YSSA 2VN3A 5I6NA 5B7EA 4A2EA 4DP7X 3S3BB 4NB7A 1A4CA 2FQFA 5AZUA 2CAKA 5B7MA 9PCYA 3DIVA 2FJSA 4DPCX
chains in the Genus database with same CATH superfamily
4JFTA 3SE4A 5CEXA 2PTUA 4FNRA 4FNUA 4MQXD 4WGKA 3CX2A 3UGUA 3KLQA 5AL8A 4PJAB 1RHHB 3TH3T 5EUOA 1JXGA 5JR1H 2FCBA 1NC4D 3IU4H 3REVA 3DURB 3WAJA 2H8PB 2IF7A 4F7TA 2CO2A 4TOYH 3F7YA 3QPKA 3ECBA 3M7OA 1FNLA 1G7PA 1S9WB 4BKLB 1ADWA 4M6ML 1KFAH 2RIKA 3Q06A 1HKFA 3MUGB 3HAEG 4RGNC 5AVRB 5IFJA 3L08A 1AP2B 3IN2A 2CO3A 4J6RH 3HE6D 4PW3A 3LIZH 2HG5B 3UTSA 1CD1A 3V0IA 2XN2A 1YECH 2NY5C 4YHNA 5T5NG 4JDZB 2BVPB 1ZS8A 5EU3A 2DB8A 3JZ7A 5BOZG 4QOKB 8CGTA 3MJ8B 5J12C 3LS4L 1BZ9B 4RFNB 4O02L 4MMZB 1JRHL 1T4KB 1XHHA 3K4ZA 5DVLA 2HKAA 2R0WH 5K9JH 3AM8C 2VDNL 5IR1B 3ARDD 1I7RA 1NCHA 1ZLSL 4R5VA 1E9PA 1MEXL 1MIEH 3OB0K 3SE9H 3O8XB 3FQTB 4N8VG 3DO3A 4MD5B 1LILA 4TUKL 1NUFA 5FUOH 5HGDA 4XCFL 2Z8WC 1OP9A 5J1AA 2EXWD 4PV8B 1FORH 1MJ7H 2X4UB 4ZZFA 3VYOA 3JV4B 1U4EA 2J6EA 4RRPM 5ES4B 1FO0H 5M7QA 3DDGA 4H8PA 2D31A 2XY2A 3SBWC 2HXAA 3GFUA 3FT1A 3TN0A 1GGTA 4XCCL 1F11B 1VFBA 3LKRA 3MLVL 1A7PH 3HI5L 1KCUH 2AGJH 1RSYA 4OLZL 2OS7A 4Z7NF 1IZJA 1KJ3L 4Q2ZB 1K85A 1GKOA 3HUJB 3PWNA 4DKFH 4MNGB 4WFGE 1YMHB 2Z92B 4FLSA 4PJFA 4O58H 4D9QE 1QNZH 3NH7L 3P3TA 4N0FA 2GAZA 4XBGB 2KPNA 2NW3B 1D5BB 5TD4A 2HVJA 4E5XA 5EZIH 3GXUB 5FK9B 3LIUA 3GO1H 1MCHA 2ZUUA 1IGJA 4UTBL 2QLYA 3CMOL 2IEPA 5LCVA 3S37L 7CGTA 5MENB 4NS0A 4HZ1A 2JIXA 3BW9B 1QHOA 3GXFA 1KN4L 2WO4A 3MRKB 4L9LB 4G82A 1YNTB 2ADIB 3B2PA 3QO0A 5DT1H 5DHDA 2NDGA 5DJCA 1NIEA 4KXBA 4M8QB 4ZFQA 1SOXA 3QJRB 4YDKL 5C9JA 1BPLB 2J1WA 4HIIA 2F5AH 4EO5A 3ARBA 4JFDB 4HUUB 3L3GB 3ARGA 3QJFA 4WUKH 3PL6A 5JOFA 5ALCH 4TQEL 4XP6L 4NXSA 4F9PA 3K8KA 4L0YA 2BVEA 2Y7OA 4FQHB 4ALAH 4D9LH 4QRPD 1ZHKA 5EUKA 2AHIA 1OW0C 3SPCA 5I16B 1E43A 1FNEB 3CPUA 5ECJE 1BREA 35C8L 5D1XA 2EEDA 5FGRA 3L5IA 4I9WD 1QUPA 2X6AA 4FYRA 5TE7H 4O5LL 2WNGA 2XPYA 1O75A 3BAKA 3Q6GL 1TG8A 5DJ6A 2PXYC 2GTWB 4ELMA 5IMLA 1ZRUA 3EGXB 3WKML 2WINA 4F2EA 1MFNA 2UVFA 1RK7A 1W6LA 3QUXD 4HHAA 1JWSB 1A4KA 3C6SB 1H0DA 1QFWL 4NQEB 3FF7A 5KG9A 1KPUB 4PJHE 5C9JB 4P57A 5LDSA 2F53E 4NOFA 4XHJD 5TDOA 3F6LA 3CDZA 1IGIL 1WS7A 1IEBB 1S9XA 5I1KL 1D9KA 2K9UA 5B3JE 4BFBD 1MEXH 3S37X 1KGIA 5CGYC 4PB0L 3INOA 4XNUH 2R29L 5B1CA 3SKOA 5K9JL 1SJHA 1Q9WA 1B4TA 3QNXA 3MROB 3C08H 4F9PC 1REIA 4G7SB 4MVBC 5TQ0H 4AL8H 4ZUSA 2ZF8A 3NYKA 4KH9A 3VU1A 4A55A 1HCZA 3FOMB 2H6OA 5J6GA 4Y2OB 4YO0B 5DD6B 2QGBA 5A3IC 2X4TB 3WHXB 1M1SA 4NQEA 2QSCL 3FN9A 5DD5H 5KW9H 3FH8A 3NFPB 5CLZA 2P24A 4IHOA 4FABH 2F1AA 2YC1B 3WUWB 1ZWIA 3MLWL 5D2LB 2R9HD 5KSBA 3HVNA 4RAUB 4KI5C 4K4KA 4XB3A 4P46C 4E41E 2E75C 3SQBB 3QEHB 3R06B 3L48A 4HUCA 4FABL 5BQ7B 4P2YA 1MWAA 2OMYA 4ELMF 4F9LA 3NCJL 4PGBB 3A3YB 1D9KC 2N59A 2X9YA 3H9HA 3IGKA 2WLHA 5E9DA 5D1ZI 2C4XA 2WUCL 1KIRB 2CKBA 5EO1A 4GFXA 2Y7QA 1EO7A 3QHFL 2NSQA 5AW6B 4ANUA 4I0PB 1UM5H 5KANG 2X0UA 1TO5A 2N0MA 2CKBL 3ROOB 1YZZA 4JPWL 2FDBP 4R4ND 1ZXQA 1E65A 1OP3H 1KJ2A 3CBKB 3IRCA 3V4VB 3BKML 3Q1SL 2NY7H 4K7FA 1F2XK 2YRZA 4U05A 2NZIA 1E3XA 5EFIB 2EC9T 5E8PA 1TKWB 4WO4A 3MFFB 3DHJA 3SDAD 1M56B 1VCAA 1RJCA 2WBJC 5D6DC 2BZ7A 2CHXA 4S1QL 5EN2A 1DCEA 3QZOA 1IQDB 5CR8A 2X88A 1J0HA 2WJ7A 4MQ7A 3N43F 1GC1L 3GNML 1OANA 1P9MC 4KXDA 4XVOA 2PPCA 2Z35B 2X40A 3DTUB 1BIIB 1JI2A 2ICWI 3ARFC 3O41A 3TIDB 4KBPA 1MCOL 3RL2B 3RY6C 1Q0YL 3FQ2A 3IBOA 3LPOA 3MJ9A 5DHEA 3O6FB 5AOIA 4PWHA 5BW7A 2E7CA 4PJ5D 1F5WA 4I0CC 1U8LA 4BZ2L 1V3KA 3EYQD 3AY4A 4I87A 2NXYC 4G59C 2ITFA 4HSQA 4ANXA 4PP1C 4GSDL 5SX5H 2PYEE 2C26A 43C9A 2QVMA 4P4KA 5HDBF 3MGAA 3WAKA 1K5WA 4I89A 1GL4B 1IBGL 4HJSA 5E56A 4DPRA 4MJ4A 4FE9A 4Y4HD 2VZOA 4JQVC 4EIBA 2BLFA 2RA1A 2FJGA 3E9UA 5F1KC 2QMJA 1PKQA 3L1EA 3O4OC 4GIPD 2EDQA 4L29A 2IANE 3BZEA 4HJJH 4OZGA 2OR9L 1F00I 3HC4L 4JRLA 5DI8A 3HZYA 3UC2A 1MFEL 3VXUB 1Y1UA 1A1NB 2IALB 4NO0D 4L3EB 3WO4C 5GGQH 3JUZA 4LCVA 5D7HA 1N19A 4TULH 4JGUA 4LP8A 1JZFA 3F12B 4R83A 4FFYH 1SM3L 3ZLQC 2YD5A 4M5TA 4JQXC 4GYBA 2X4OA 1V5JA 4L8BB 2VSMB 4JY5L 3V7AG 4DN3H 1A47A 4ONFL 2VLMD 3BVDB 4OFDA 1KN2H 5H2BB 3UYRH 5IJVA 5B1BB 1Q1JL 2MQ0A 4H1LH 5KVEH 2CCVA 2Z31B 4D2NA 4HZAA 3GXPA 3HCVB 1UZ6F 4K3DH 1ZLUK 4GG6A 1OY3B 4E9SA 2NUPA 1T20B 3T0AA 4X6EA 3TO4B 5I15L 5GZOD 3MLRL 5KS9F 3EFDL 3DMMA 1EZUA 1YMHA 1ITCA 2IFFL 2Z92A 4LPYA 5T1KA 2IV9A 2NW2A 4H8WL 3X3GH 1QI4A 2F53D 1J8HB 2K7PA 1WS8A 5T33L 2JJVA 3BPNC 3DXAD 1WC7B 3FT4A 3KS0J 5I71B 3DBSA 3GDCA 3CFKA 1XCXA 1E4HA 3VI3B 5IJBC 4TULL 1MCWM 2GJ6A 4JQIA 2F61A 3GSOB 3CCHA 3BW9A 4Z77B 3HFML 4EDWH 3CVIL 2GIYA 4DGVL 3ARGC 1AR1B 1J5DA 4HKXA 4FQIH 1R5VA 4QOKE 3TN0C 4NQVB 2XQYG 3ZE1F 3EJZD 3UP6A 1V7NH 2FYYA 1JK8B 1FP5A 4X9GA 5B4MC 4HPOH 2FWOB 1AQ8A 1MHPH 1XSIA 3EFFB 4H0LC 4P5MA 3L3GA 4X7SL 4AC4A 1J18A 1H3PH 5LQBL 1MNUL 2Y3NA 5DD0L 3ZHFA 3RDTD 1GOFA 4TV3A 2BSCA 4UZGA 5DK0A 2JF1A 3UGEA 2Y0SA 2B0SH 4W1TA 2F7QA 3DV6A 5DQJB 1SXSA 2JNZA 5DGRA 3MUUA 5EA0L 1UCBH 1ZLWH 1T1WB 4B95C 2HX9A 2I26N 3WNNA 4OJFH 4ZQTA 2BOCA 5L8KB 4OGXL 2O61B 2IGLA 1BBJB 2EE2A 4FNLH 4GIOA 2BSTA 2WQVA 5LNEA 4Z3EA 4XMXA 4J4PA 1FAIH 2OTWA 4MA1B 3QIBD 4EF3A 3BH9A 4W9FC 2QGDA 1TENA 4RVBA 3CFJB 9CGTA 3ZZ1A 2C4FT 1OT1A 3IEAA 4YPGA 4CC4A 4P5TD 5DJ8A 4HUVB 3TURA 4QT5B 3F85A 4Q52A 2IDTA 2YPVL 1PEWA 1PPIA 4MJ6A 3ZU8A 1PSKL 4ODWB 3QFJE 3HBGA 2BMKA 4F20A 2AJZB 2HX8A 5ISZE 4GUQA 3EJPA 1SJMA 3O6KH 4JX0A 2IGTA 4WNQA 4R8WL 3F7QA 4Z7UF 1R1CA 3ABZA 4AIXA 4DFHA 2CJUH 1AAJA 5HHPB 3V0GA 1DLHA 4AYFA 1LM8V 4P4RB 5GRWA 2VDPB 4ILDA 2MNWA 1J1OH 3W39A 5KN5A 2PLTA 5D2LA 1ZJBA 1RP8A 4RGNB 1P84K 1CF8L 3R4DA 3TJEH 4PSPA 2CGRH 2WBXA 3QZPA 4OKVB 4AVJA 4ZAKC 4ZMXA 3HAEA 5T1DH 4FXGA 1S9KC 4EVNB 5FDWA 1ETB1 1RK1A 5D70H 2HTKC 2JKIS 2D7QA 3CLEH 3K6DA 3QH3A 4N0UE 2FRGP 4NQDA 4WUUE 4ZOBA 3T04D 3T2NL 5A7EA 3NSCA 4JFFA 1I7UA 1K6QL 2EDJA 2I32A 2OKMA 3POHA 4D8PA 2XIBA 5D1XC 4AOFA 2AABH 2XC8A 3G5ZB 1P1ZB 1Q94A 5IFJB 5HHXH 1ZA6A 5CINL 2FQFA 5AZUA 2QMKA 3DIVA 3FH5A 3Q9PA 1NSNH 1CFSA 1MCSA 1T80A 2JJUA 2ADFL 4HWEL 3ZBMA 1F1GA 2DI9A 3LNIA 4ZOCA 1GZPA 1AQDA 1FYTB 3HPLB 5GS2D 5KTEH 2EO1A 2P8LB 4XOBA 3DURA 1I8KA 3ARXA 1NGXA 3JYCA 3M45A 1B2WL 4HIIB 4WI7A 3MCKA 3LXBA 5CCKL 2ADYA 4NO2B 4TS6A 5LGHL 4HWBL 3DIFB 3Q3GA 3PGFL 4M29A 4AXWA 1L9NA 5D1ZB 3VU2A 4BFRA 5EUOF 3OWEA 3I9PA 2ZYRA 4WJ5B 1S9VA 5DWPA 3X11B 5I8OH 5JA9A 2BP0B 4YDJA 1NGQL 3PWPE 2GW5A 4JM2C 4A37A 1JZ6A 2WXKA 5B1JC 4X5WB 1MSPA 1I3RA 1UFGA 2AMUA 1K4CB 2NY4C 2ADGA 3JBG7 3SJVD 4P23C 1A9VA 2Q86B 2MKLC 1D9KD 1I82A 2A1WL 4X6FA 2QPDB 3P2TA 1CLCA 4O00A 1I7RB 4YSTA 3NSJA 4Q89A 3NDYE 1J8KA 5F7HA 3FU9A 3DVNB 3SDYH 3F7KA 3RTQD 3VFGH 5JZ7D 1CPUA 4PRPA 4M3KB 4R4NC 3BT2L 1SDDB 2D2CC 2JKJA 4YDKH 1BQHA 3MRRB 4PGEA 1FFOA 4FC3E 4DVBA 4RQQB 5ERWB 1UACH 1IGJB 3F00A 1SXBA 5E5LA 4ISVA 3WKQA 3U46B 2XVGA 2HFEB 4L1DA 3FN0L 4JFQA 1QRNA 5C0FB 4JO3L 4OZHA 5TQ2H 3ZZSA 2PW2A 1T1ZA 4EZKA 3RZCC 4JDTL 3C87A 3GTTA 4DVRL 1V55B 2QPUA 2VWEC 1E3ZA 4M7LT 5IB4A 4OZHF 4D0DA 4HBCH 2OMUB 3ZGIA 1KY7A 1H3PL 4JUTA 5DA4A 4H88H 3W56A 1B0GB 3GLDA 4UMGA 1OVZA 3DXAB 5MEQB 3OKLA 2VH5L 4AQEB 2MOGA 3F5WB 3MXWH 3IMWA 1ZSDB 1HHGB 3CFEA 4JMXA 4JB9H 4PYGA 1C12B 3TF7C 3QUHA 4HT1L 3ZY7A 3OJMB 4M8RA 3KDMB 4JKWA 1DTUA 3IFLL 3L3HA 3JV6A 2OW7A 3GMMA 3VRIB 2BHYA 4HG4K 5GS1A 1SDYA 2Z31D 3VGAB 4RH4A 3ZIYA 3V7MA 3RVTC 4M9PA 4L8CB 1XQ4A 3OMAB 1E2WA 5DMYA 3LRSB 3SE4C 3K6SA 4HKZA 2J88L 4U6XA 3R4RA 5D5MF 5F1NB 3WNMA 2DYSB 5I0VA 3KHQA 3MV8A 2CJ3A 3ZDZF 1KACB 3ZDWA 3DPBB 5IFHH 4QHUB 5SWZD 2J8UB 3NGBB 4BZ2A 1QYGH 1PCXA 1AGFB 4WEMB 1UACL 3QXAA 2R0KL 2EEAA 3BPOC 4G6JH 5IHUL 2BY2A 1R3IL 3AU1A 4W9CC 4A66A 4FQJL 4IW4C 1J9RA 1BDYA 1MVUB 1JMXA 3TU6A 2BFVL 1G7HA 3JVGC 2H6PB 3V0HA 5DR5H 5GGQL 3WDIA 3ULVC 2FT6A 1DBAH 3P02A 3SQRA 4HS6A 4N2CA 3MR9B 3OKDA 3PUCA 4K5LA 2WXLA 5EEUA 5GS0C 1ZAGA 5IMKA 1BCIA 3UBXA 4YPJA 1T2QL 1ZIBA 43C9B 1JGLH 5FM8A 3QEQB 1NEZG 3QFDA 3MREB 4G8GB 1NPJA 2UZIL 1L9TA 4L2LA 4U1GC 4JDEA 3FQNA 1D5XB 2YEZB 3HS8A 3GSWA 3VMOA 4Y19A 1MY7A 2YC1A 4JGMA 3VGFA 4MJ6B 1E6OL 1P5UB 1IGCH 3GKWH 2WB1A 1CB4A 3B5TA 3SYPA 3H4FA 5JIKA 3SEPA 2QQNH 4KQ0A 2Q7YB 5DRZB 3LYRA 3O2DL 4XVJL 4CW1B 3ZKQD 1UZ8A 5I1AB 4YK4B 4NKOA 4DVRH 4MAYA 2EDKA 4DTGH 1NC2A 4UQEA 5KBLA 4WKXA 4KWUA 3AITA 4N8PA 1HAWA 1IEAA 3GSXA 5LAXA 1IBFA 2DWDB 1EA9C 3WNJA 2Q76B 5IGXH 3LZPA 2VMEA 1JWUA 2Y36H 4GBXB 4M4PA 2IPTH 1IGFH 4OV6F 4JRXA 3TNMA 1RK1B 4GOSA 2HMID 1Q1PA 2DKMA 3QI9C 2ZCKL 5T1KB 2LW3A 1RZQA 2NW2B 2C1OA 4PS4L 3O2VL 4QHNB 5EO9A 2BP3A 3VVWA 2Z4TA 3EH5B 1SEBA 4PW9A 4W68A 3B34A 3US1A 1C08B 4RMWA 4KZ0A 2EIKB 4KUZH 3T8VA 3HC3L 2QADC 2ZQKA 3FFOA 4KJWD 5E1HB 2CIKB 3WE6A 4X4ME 3FCGA 1AH1A 4AV0A 3LQAL 4MJ5A 3BUBA 5EU6E 1UWGL 2XZQL 2CHWA 5F7UA 3G7TA 4DW2L 3GI9H 3GUTB 4C57C 1IFRA 1HDMA 4X7FC 2JFCA 2DQUL 3P9MB 2CKNA 4L8SC 1AHKA 4WW1A 3WJJC 4GBXD 1H9VA 3MJGX 1YHPA 2X38A 4JJHA 3PGFH 5JLZA 4NERA 3QVAA 2DWTA 4U0RB 2X3CA 3PQYA 4P23A 1YMMD 4RFOL 1MAMH 3B2XA 4ZYKB 1A7NL 5IEHB 2APVA 3TGXA 2E8ZA 1J1XL 1UD2A 1FVCA 3WELA 3H56A 1T0MA 1RJZA 1HZHH 1AXIB 4LNRA 4NQCD 3FU6A 1CXFA 3FZUC 1WH0A 2HTLC 1E9QB 1VEPA 2QKIA 4GP8B 4NKIL 3DUUB 5ESAB 2PPEA 4N0FB 2VZSA 4FTVD 5ACZB 1WTGT 5DJYA 4DSYA 4ZD3H 1A6ZB 2XETA 1Y07A 1TJMA 3FHQA 3AG2B 1TQWA 3GSNA 1GH7A 3VD7A 3FUNA 5KVFE 5KBPA 2JTYA 4JM4H 3SO5A 5ID1B 2HKHH 5D6DA 2XWJB 4MDJA 1NMBL 3Q5OA 1W91A 4Z7QF 4Z78B 2I69A 4KC3B 2XU9A 1KNOB 3A0OA 1MCQA 3MRKA 4L9LA 1DBKL 3GF8A 5L0QC 1IC5L 1ZGLB 4Q58C 3W57A 2FWLB 4KXCA 1YA5A 2R4SH 1CIDA 1LGVA 3CVHB 3OSVA 4JFDD 5IHZA 1KGUA 3G04A 1VF5C 4FLHA 2R2HB 1CGSL 3GC3A 4CSPA 1RUPH 4K7PX 3S5ZA 3U7AA 4DPAX 1IC4L 4OFVA 3W82A 5IF0A 1KIQB 2ZTBA 3O3BB 3QJTB 5IKCB 5AW0B 1K2DA 3DBXB 3O8XA 4JFZH 5C0EB 3BVUA 4ZZKA 4V11A 1OB1A 1SNRA 5KVMC 1AJ7L 3SKNA 1RIHH 3P9WB 3O6ML 3F7PC 3CZSA 1T03L 4B9KC 2XWJA 4MDJB 4MA1C 3I85A 2WKOF 1TF4A 2NY1C 4RGMB 3L2LA 4UQ2A 2NY3D 3U4EA 2IPTL 5KZCD 4ICXA 3VX1A 2H2PC 5C0AB 4NYLA 2YAFA 4MB3A 1MFMA 3N55A 1A6AB 4EI0A 5E99L 3DVIA 1J0YA 4NZDA 4KRNA 4E42B 1P5VA 2KZWA 3IJ9A 4J6IA 4M3JA 1FAIL 4PW4A 1KSRA 3LHAA 3DYPA 4MQTB 5H8DA 1SPDA 4JRYA 2ROYA 2GJ6D 4TUUA 3WEMA 4AYID 4G8GE 3D18B 2GAZB 2BCKA 4UOQA 3RVVD 1J9QA 4O58L 4XZUB 1PCSA 5D5MA 1SUJA 3C09C 3VFSA 1T6WA 4HKZB 3IDGB 5I0YA 1U4FA 4X5QA 4PJXB 4DN4L 4JJ5B 3W0WB 2BY3A 5GZOA 3O2WH 3SKUD 2PO6C 1EJOH 3ARYA 4L3CB 4QYOB 3O4LD 4C4BA 3ETBJ 1WTLA 3PWPB 3N40F 1GPOH 2XZQH 1HILB 3O6FC 3UADA 4G9FB 1IZKA 1NLDL 3FXIC 5EU5B 3ZYZA 3T2PA 4E42A 1NIFA 1P4LB 4N85A 4N9OB 1DQLL 3FB7A 4WDIB 3DGCR 5F6HJ 5KSBB 2LR4A 4ZUTB 2DM2A 2XTJD 1GGYA 1LO0L 1OSEA 1OARH 1RZFH 2MNJB 3B9VA 4FXKA 1A6TB 3N3EA 4HS6B 3HE6B 1GTFA 3FT3B 5F9WB 1SZNA 5LAPA 1BP3B 3UEZA 5FWRA 2DQFA 4AT6A 3V8CA 3GHPA 4Z76A 5FW6A 4KI1A 1AVAA 2Z91A 1OCCB 1PJWA 5HHXL 2WINB 5JW4M 3LSOA 2J12B 2ZOOA 2BY0A 5L7XH 2AQNA 3HG5A 1U8KA 4KDTA 1TFHA 1AD9A 2QHRL 3RVXC 1WBXB 2NYKA 4PMFA 2WTRA 1MCEA 4LT7A 1XR9B 2CUMA 1U3HD 5FECA 1GZHC 2YWYA 1D9KB 2WZ5A 2VAAB 3ISRA 4FXGB 3FTSA 2KQMA 1X9RA 2HLFD 1MJJA 2Q7YA 3N1GC 4IRZA 8FABA 5F6IB 5F3HA 3BUTA 1RZIB 1QASA 3WGVB 5D9SB 4P2QA 1BLNB 4P46B 1G6RB 1TJGH 5FYKU 5FOBB 1MFCL 4WUUD 2BC4A 4OZ4A 4Y5YB 4YSSA 4JHAL 4YDVB 3S98A 3VG9C 1JWUB 3EH1A 3QDMD 4FF9A 4HGKC 1KB5L 4M1DL 4IRJB 1OTSD 4XWOD 2CAKA 4YL9A 3BLBA 4MLIA 3KJ4C 4OCXH 5JW5A 1NANH 2FJSA 1A66A 3C6LB 4H1LA 5E9DE 4LCWB 1XV8A 3UTTD 2IBZX 1EFXB 4RMVA 2AK4B 4HMEA 2VRKA 4L4TB 3VFTA 3ZR6A 4GSDH 1S3KH 3HUJA 3PWNB 4NBZB 4RMRA 5D6CB 4ZBJA 1I1AD 4UNIA 5AYUL 5H35A 3EYOB 4XNZB 2EC9U 2K4AA 1RZIA 3DARA 4BM7A 3V5DA 1KCKA 2ENQA 1L7IL 5ICYB 1JNJA 2VDPH 4HEPA 1MHHB 3U1SL 3PABB 2H0PA 4ZFZB 1EV2E 4PV1C 2LQRA 4IBZA 2WWKT 3DX7B 2ED6A 4L3AA 4HUXB 4LSPH 4X5WA 2AZUA 3DPBA 4PJDB 4ISVB 3UTOA 3QGVA 3U46A 3GS7A 3T0WA 5BRZB 3KWWA 3P4NA 5D7JA 5J57B 3KZ8A 2XJKA 3V4UL 1YNKH 2E8YA 3HIZA 3T6WA 5CP3H 5I8EA 4G42B 2PW1B 3BD3A 3G6JF 1G9NH 3BKYH 4IU3B 1MWAL 4P4KD 5CSZA 5DZ9A 4MS6A 1MHPL 4R2GB 3LV3B 3FCTB 2O93L 1WZMA 3IJSB 2A4EA 3QUYA 4FG6D 1BVKA 4HWBA 2UYLA 4G6AC 3GHEH 1H6UA 2YUVA 4AVKA 2DJSA 4XPTH 1HFUA 4JPIA 1M1XB 5I6OA 2V33A 4JHVA 1GCYA 4P2AA 4MD4B 4N87A 1XBRA 2P43B 1YEJL 4JAMB 4PWFA 3L4VA 5K93A 3BKCH 4ZTOH 1CFVL 4WTZA 2E4FA 4DEPC 2DMKA 3RILA 3HZMA 2W07B 2VC2H 4RIRB 3QUYC 3T65B 3QNYB 4Y4KC 5LGHH 2VIRA 1KLUA 5DRXA 4WWPA 1I31A 4Q0XL 5ESQB 4KROD 3R7QA 5I75C 1FYTE 4JM0A 3WFEL 5ICUA 2ZXDA 3SDAA 2OMWA 4RZCB 1JHTB 4GQPH 4PGDB 5CP7B 4OB5H 5C0AD 4PIBA 4HGMA 2R2BA 4DETA 4FZ8L 5E99H 5J13C 2ITCB 4PJEA 1OAYL 5E0FA 1KBBA 3CFEB 4JFVA 2MOVA 2YOCA 4MYPA 4TVUA 5C0IB 1C12A 2AEOA 1EAJA 3U4BH 3BUDA 3Q2CA 5F7KC 3GWJA 5GS0L 4BZ1L 2DQTH 1N5AB 5AQ0A 5IESH 4S11A 3ZE0E 2XFXB 5HGHB 2EVHA 1N0XL 2XBZA 5BRZD 1K8DB 5KSAA 4DT2A 2R29H 1YJDH 3II2A 4RAHA 1NCDH 1NEZB 5DUML 4K5NA 3EF4A 3L2NA 3TS8A 3FB8A 5BXFA 2P7TA 3ZKXC 2MH4A 4ONHB 4PJFE 5DURB 1DLFL 2PPDA 4F80A 4RLDA 3M8OH 1AR1D 2VOTA 3AT0A 4PJDF 1CGSH 1T20A 4PFEA 3NABH 3JWDC 3MLUH 1RZ8A 4QAMB 1H5BB 5DRNA 2QSTA 4NT6A 5C0IA 1FFQA 4E9LA 1SBSL 2VL5A 1HXMB 1ZE3C 2C9UA 1OK8A 3LXAA 3LZFL 2VDLB 4J12A 1EFXD 2K1MA 1KBKA 3KYNA 1AO7D 2Q6WA 4ODWA 1E4XI 3ECBB 4LLWB 3MV01 3OJVC 1NC2D 4TVSa 1TUPA 4D8OA 3CFTA 3T8XA 3WSQH 1W72H 5HYIA 2CGZA 3LRMA 5BCAA 4B9FA 1EMTL 5C7XH 2Q10A 4TYUA 1ECYA 4JFHD 4LRIA 5ENWB 4Z5RA 1E5UI 2HJKA 4V33A 1AHWB 3MV9E 4IDJL 4LVHB 1RZJL 4KRMB 1E8YA 4ONGH 4XNMB 5DJZA 5ESVA 3VH8G 2NY6C 2Y2WA 5G4OA 1KGWA 3JWOL 2M1KA 1EAPB 2NY5L 3GMQB 1JGUH 3FHAA 2W65A 4IOFD 5FV2A 4Q74A 3UROR 1P7BA 4MSWA 1MFDL 1T1WA 3V6BR 5JHMA 4L37A 3ORJA 4J3VA 3TYGH 4BCZA 1G4MA 2MIZA 4A2FA 2DMHA 3K3QA 4U1JB 4OZGF 3QFJB 1A6UL 2WXNA 1FC1A 2WIIB 3DSFH 3ARZA 3LDBB 1G7IB 2J57A 4KDWA 3VA6A 5AB9A 3RU8H 3HC3H 3GSNL 3FONA 1BEXA 5F93C 3K72B 1L7IH 4LSDA 3QUMB 3FJTA 3DX2A 4G43A 3NA9L 5KVDH 5AYUH 3WMSA 3GKZA 3D3VE 4S10A 1ET8A 4EIZC 1BD2A 1P4BH 5IQ7L 3MLWH 4ORGA 2HT3C 3AREB 1M3JA 1PLGL 3V5KB 1DJIA 1KCRH 3S35H 5FOBA 3NZHL 5EBLA 4WU5B 3FN0H 3KCWA 1PYWB 4WGWB 3P11H 4R0LB 2R0ZL 2J4WH 1K5NA 4W9IC 3ETSA 5HHVH 3ATBA 2DWXA 4BD4A 2GJZB 2A9NL 4K8RC 4QXGH 4R7DA 4XAKD 1WF5A 2R0LL 2EINB 2XHNA 5HJ3B 2VXTL 2XQYK 3RWGB 4EN2A 4PTUB 5AOZA 2HPTA 4MJ5B 1XEUA 4FLOA 3TCXA 2X9ZA 3UO1H 3VXQA 3H8NA 4LLUB 4EBQH 3EW3B 2XWTB 3MNWA 4HIJB 3ILQC 3BUQA 2GITA 5ICXA 1A6WH 3OC8A 2X1XR 2HFFB 4A04A 2R2EA 5DVMA 1BZQK 1CFBA 4KJQD 3T5WA 1GRWA 5ECGA 2NQ3A 2VXSL 4OCNC 5FX3A 5KAQG 5I6LA 1FVDB 1PF3A 3QEQD 5AW8B 2CH8A 1SHXA 1HWGB 2XXMB 5DFVD 2AXFA 1TYRA 4BH7B 3M88A 2CR6A 4JO4L 4F58L 1GYCA 4NKQB 5A16B 3UACA 4ETYA 3HI6L 2VR4A 3V10A 2BERA 4ZG1A 4NEHB 3C5ZA 1FYTA 1AQDB 4C4KO 3LMJL 1J11A 3IF1B 1BF2A 4V1DB 3E1ZA 5DC2A 5EU7E 3REWA 5IB3A 3S88L 4H25A 4ANWA 3UBGA 4F33B 4LPTA 1MELA 2BP8B 1GR7A 3G04B 1I8LA 3K8LA 1QW8A 4YVNA 1F0LA 1E3FA 2JQAA 3PWUB 3OZKA 2HVKA 1JNHA 4LEXH 4FULA 4U1IA 4M3HA 1T66D 1FDLH 3U7YH 4IDLA 3UZQB 4IOSD 4TRPH 5C08E 4OW6A 4TUOA 4NFCA 3TT1L 1ADQH 3TA3B 2J25A 2A4ZA 1JF5A 2C34A 4OD2B 4MKTA 1XF4B 1GW0A 4KI5D 4OIIL 2WLLB 3BWAA 4F7KA 3NCBB 2P5WE 1DJHA 2ZUQC 3FT0A 4ERSH 2ZX5A 4R2GC 1OOWA 1TPXC 2ZICA 3H9SB 2W9EH 4W9GC 3UXFA 4A2GA 1YNTA 4LSRL 2AEQH 2YJQA 3D0VB 3DRTB 4F2MA 4M5SA 4NFBA 1X5JA 4QO1A 1AOZA 3GBMH 2J88H 3D1MC 2O26U 4XPGH 2AJXH 1WBXA 2I5YH 4WFFE 2UZYB 2Z3FA 3UTPD 3T1WA 3AMKA 3WFBL 4U3XA 2X4SB 1ZHNB 4FYSA 1RUAL 2XKNA 4P5TA 4X0NA 3KPQB 5JOFB 1DFBH 4JY5H 3MI6A 4OJYA 1AZUA 3LNFA 1XGUA 1GAFL 4GRMB 5E2WL 1PZSA 2AQ1A 4QT5A 4UM9B 2XRAH 3V4PA 3IDGA 3UPAA 4LGRB 4OD2A 4EI5C 1OAUH 5HJGA 1TVHA 4N1CA 4U2ZA 3SDAC 4JG9A 1UB6B 4P2OA 4Y4FC 3QRGL 2YARA 3QXAB 1UOWA 5CIPB 3SY0B 4FNTA 1PAZA 3EADA 4WW2F 3PXHA 3RWIA 3Q7JA 1OLLA 1QA9B 3VQMA 4F8OA 3HI1A 3IDXL 4UIMA 1RSFA 1S7WA 1ZT7B 2DDQL 3FT2B 5EOQL 4YXKL 4AIZA 1S9XB 1B0GA 5FYLE 2VM4A 5L8JB 4HKBB 4BFGA 5BUAA 4QRUA 1GGUA 4PG2A 5AYQA 4MJHA 1JNLL 1U8CA 2OQJB 4M5ZH 5IROD 1IUZA 4G7VL 3PV6A 2OJ1A 3CFDA 4GW1B 5IT2L 5IIEB 3AT8A 4FXGC 2X6VA 2M83A 1A7RH 2YEZA 3WE1A 2H1PH 3TT3H 3EJUA 5CEZD 4FTVA 2EDFA 4WENB 2X9WA 3STZA 3UYOD 1U8KB 2OMVA 5D2NB 3F8UB 4ZODA 3CIQA 1P2CA 1Y6NR 1U8LB 4Z7NB 5LQBH 2LOEA 2VXQH 3PWJA 3F2LA 4RAUA 3IU4L 4C4UA 4FA6A 5FGSA 1JOIA 3BYYA 3OKKB 5E6ID 4Z5RB 4IRSC 3S3SA 4N5ED 2VLRA 1E90A 2LE9A 5HYEA 3QPXL 4JRWA 2D7TL 5DMKA 5T8IA 3GMPB 5E6UB 1V7MH 3MRDA 2OMXA 3ATAA 2K7QA 2VLJB 1P7QA 5FFOA 1NCTA 4MXWH 5E2UH 4RFOH 2FTAA 2Y69B 2QR0B 5IW3A 3GPSA 2YS4A 5I5RA 1D5RA 1LO2L 3X1FA 2G5RA 3ARDB 2E9WA 5F9OH 5HDRA 3ZE0F 5FKPB 3A23A 3O45A 5H37G 2L0DA 1FYTD 2CCLA 5D4QA 5BQ7A 1IM3D 1N3NA 4P06A 4TSAL 4X9FA 3OKDB 3SGKC 4DO4A 2PETA 4ELDA 2PCYA 3H54A 2P8MA 2NXZD 1ASQA 2WWOA 2XWRA 1U8PA 4HIHB 2LFEA 1J1PL 4YDMA 1RMFH 3KBHE 3QJUB 5I1IL 5E1QA 1WFMA 3GSNH 4PLJC 4XPHH 2MQ3A 2AVFA 1CR9H 1QLEB 4KUZL 3L4YA 5F1SA 5HHOA 1KT2A 4JN1H 3ILPA 1HDMB 1CGTA 5IB5B 4QRRD 1N4XL 1T83C 4JFFE 4QF1B 3T2NH 4Z7OB 1TQTA 4P04A 1S5HA 4PJGE 4MCYB 1YEWA 5I74B 2C9PA 4YHIB 5L2KD 3FSVA 4M7LH 4H44C 3AS2A 3BUYA 3IDYB 1QFPA 1T0MB 5IFAH 1EJ6A 1UD3A 4TNGA 5T1LA 4QIRA 5INDB 1ZLVK 1XAUA 4Y2DC 4AVHA 3D39E 3RL1B 4HLZH 3X3FH 3PP3H 5BJTA 5FR3A 2Z4QA 4CMHC 4MXVF 2KH2B 1DQML 3QT2A 5DHYB 3TOPA 4P8QA 2P46B 4MCZB 5E08H 1BD2D 2EYTB 3IMSA 4CJ0A 4L5FH 4ODBD 3BIAX 2X7LA 2F7OA 2W0FA 1S7VB 1P7KA 3AWFA 3P3UA 3QDGA 3RWDA 3AXHA 1JYNA 5CCKH 4NKDB 4HCRL 4ANVA 3QWOB 3RJDA 4KX7A 1AFVL 2FECL 2MHAB 4OJAA 3VI4B 4YQXL 1F45A 5CD5C 3ZE2E 3QQ4A 1HVXA 4N9GB 1VERA 3KBEA 2V5SA 3MRMA 4Y1SA 1P6AB 4JL1A 4JR9L 1ZMYA 1B4LA 2OMZA 3NBNA 2E7BA 4XPTL 5AVTB 1E28B 3GJFA 5CO1A 5JO5A 4QHMA 1UT9A 4OZFB 4RMBA 4FQ1H 4LLMB 4B5EA 2J8UA 3C12A 3HVDA 4R9HA 4KI5E 3WTUA 2YN5A 2C7UB 1AP2A 3FUKA 3MJ7A 3ULUH 3H3PH 3HB3D 1PZ5B 2XUWA 1TJIH 3NJKA 4PRNA 2A83A 2HRHA 4M43H 5F7WC 3WN5A 4NQSB 2BMKB 4KO5A 1KGXA 3CZNA 7FABL 1NGPL 1I3GH 3HG1B 1R5WB 2VLME 2O5ZL 1T89A 4YHKL 4U1JA 3WNLA 4LVOC 4AGNA 2Z9TA 2A0LC 4A67A 4ZFFB 6PCYA 4FA7B 4NRYA 4P4RA 3S36H 1DDHB 1KIPA 3T1FA 1R3JA 2EDHA 2HCZX 2ZUQB 3O6KL 4O2CA 1MLCB 4DGYL 1I75A 2ZOTA 1J8HD 2F53B 3LQZB 3QUMA 2R0ZH 3ZR5A 5EDSA 1N5AA 2JCCE 3ETBF 4F8NA 1N5YL 1SVBA 3RDTA 3WLWC 1FH5H 1JWMB 1AGBA 4LQFH 1I7ZA 3WL9A 1HJCA 2QV2A 2A73A 1T0NA 4X4MA 5LWYH 5EZOH 4FOMA 1P1VA 4ZS6C 3IDUA 3UABA 4LCWE 3WLBB 5H37H 1QR1A 1A3RL 1JPEA 1M05B 1VACB 3KPRB 4GAGL 4AMKL 2XG5B 3Q13A 4A68A 1UXWA 1LP9A 3GHEL 1I7TB 4JPQA 1ZT4B 4PB0H 5KSAD 5C97A 3L7FA 5E6IA 3NJLA 4Z3TA 4XOAA 2AEWA 1WBYA 2BH0A 3BOVA 1NH6A 4JM2D 2DWDA 3LH8A 2DIAA 1NCWH 2XWTA 3MNWB 1UCBL 2N1TE 2UY7A 3ZE1E 2FBJL 4L0PB 2CRYA 2HT2C 4MS8D 4Q4EA 3WHE0 3BSZH 4NUJA 5KVFH 5EOTB 3AW5A 5DLLA 3CWGA 4AXWB 3TWYA 1UC6A 5IOPB 1A9BB 1XMWA 2QQKL 3LTVA 1GGBH 1U8IA 3RPIB 3VMPA 3MRCB 5TE7L 4XNDA 4I1PA 1IM9B 2AKRB 4HPOL 2WBJD 1PKQE 2DICA 2NX5D 2R69A 5DU7A 2BIPA 1DLHB 1UWFA 5FECB 2ADGB 2X0VA 3W39B 2QADD 2CNYA 5AKSA 1NC4A 1OWRM 2DDQH 1KLGA 4PS4H 5DK3A 1Z3GL 3IRZA 4ZW8A 3ARFD 1IC1A 2GI7A 2N4IA 4OBSA 5HI3D 1K3ZA 2NYZA 1YRKA 3T71A 2ARWA 4PCYA 5DK2A 3RKDD 1BQHB 3MRRA 4KVNH 4PGEB 4YDIH 3L7EA 3UTTB 5DMIL 2Y6SD 4NENB 3I84A 2VJ8A 2XN0A 3GMPA 2OYMA 4FQXC 5CP3A 3SGDH 3DRQB 3TA3C 3C8DA 3EYQC 4G6ML 3MO1A 1QI3A 5ITBL 5KYYB 3T4YA 1RLWA 2C5DC 3KPSB 2IGFH 3AQZA 5G5DA 3UEQA 3ZUNC 1TNNA 5DD3H 1BLIA 5C0RH 3CZGA 4PJBB 5IROC 4FTVE 3MRLB 3V6OA 2FSEA 3HE7B 3K81A 2P8PA 5C07D 4M7LL 1KMGA 4WI4A 1UUNA 3U25A 4F92B 3G5WA 2AGJL 4JFFB 4ENED 1N59A 3BPLB 2YEVB 4IS6A 2COQA 1PG7W 1A3ZA 4ZFZA 1R34A 3HZKB 5EBGA 3PJNA 3ABGA 1PIGA 5A7BA 1HEZB 3ULVL 4YHPB 4B50A 2H1LM 3MBXL 2WLYA 3EJJX 1B6UA 3EO0A 15C8H 1A7QH 3EF7A 4LVHC 4UWQB 5IMMB 3EDJA 2G5BB 4RDBA 2QSVA 3L4XA 4Y16B 1CTNA 4G42A 2ZX8A 1FVEB 2BIMA 1QUNB 2DQHL 3B6SB 3KPMA 4RWHA 4TTDC 3U6XS 3NIFF 4E41A 2VO5A 4PS7A 2L7UA 4PGBA 1UB5B 1D5ZA 4HD9A 1VFOA 4WWKB 3BVVA 4C56D 1EHAA 1W2KT 4TNVK 1NLBL 5CIPH 5HHQB 3OAUH 4NUGH 5G2NA 1RZ7L 1VADB 4PBXA 4KPHH 1QQDB 2EAEA 5F7BA 1CICC 1YUHA 2AXWA 5MP6H 3TJHC 3UC0L 1CFVH 1U8CB 3VFMB 1KPVA 3AXIA 4K7PH 1FV1B 2RAMA 4YXLL 2NXZC 1J0KA 3L6FB 2W07A 4F7PA 1T83A 1HYRC 4NZRH 1L0YA 3NJIA 4NP4H 2CR0A 2EYRA 1WYJA 4UZUA 4FA8A 4YS4A 3QUZD 3TO2B 1CLOH 2OMVB 5D2NA 4GFTB 5EN2B 2BIHA 1FRGL 4FXLA 5DGQA 4D0CB 3VXNB 3MNDA 1UJ3A 3JWOH 2NZ1A 5AAWC 5HYSG 3V6OE 5T5FL 4PJ5E 5JO5B 1SQMA 2P5EB 5D2LF 3C5JB 2AJUL 1TVHB 5DS2A 1X7QB 4NQXA 4KX9A 4KTEH 1KULA 1ESOA 4X0KA 2IXQB 1IU1A 2XY1A 2Y72A 2BZCA 3QJZA 1IFGA 3FFDA 2ICWA 1PBYA 3GMRB 1T1XB 3AB0B 4NOBA 4DCQB 1PZ5A 1ORSB 3GM8A 2AVGA 3IE9A 1X4ZA 4GSXA 3A4EA 4XXCC 4QRPE 4TL5A 2OSLA 5GGVY 1SFHA 3NJGA 3UTQB 2D9QB 1BMZA 4OUUB 1UA6L 2OLDA 3BHBA 3X1GA 1TTCA 2WXHA 3K4AA 4Z6AT 1E5BA 2F5AL 4BQ6A 4EZJA 2XPGA 4B27A 5I8CB 2KPWA 5IMOA 2GVYA 4X8XA 3ATDA 2K0RA 3QDJB 2PWHA 4WV1B 3TBCA 3U2SB 2UXGA 1D7FA 3OF6D 1ZVYA 1LEGA 5L88L 2BVQA 3N50A 3D33A 1ED3B 2O5XH 2J5LC 1WT5C 5J6GB 2P3YA 4LOEA 2NR6C 1CXLA 2FB4H 1Q38A 2D73A 4NJ9H 4YUEH 4TF4A 1XH0A 4F27A 5CEZL 4F7MA 4OLWL 5HYSB 1WLHA 4JG5A 3PHAA 4WI9A 5EB9A 2YQ2A 1EHKB 4XMLH 3BQUD 4ZD3L 1CE6B 3DVFA 2FNWA 2JKTM 4G5ZL 3BMVA 2CNZA 3FTVA 2NY5H 5HHNB 2UWEF 1AS6A 4JREC 4A7VA 2IPKA 1ASOA 1SEBB 1ZT1B 4M1CD 5CZKA 3FO9A 3BP4A 4YSQA 3OKOB 4N2GA 5HHMD 1CDYA 5BZWB 1BFVH 4OSUL 3L5WA 4LOUD 5EIQA 2Q8BH 3BZFB 2XPZA 4CVXA 1OGTB 2QQQA 2W9EL 1EZSA 3KGRA 4WWNA 1KELH 5AZEL 1J8HA 3UC0H 4A2LA 4HCRH 3LRHA 3BIKB 4HLEA 5HPOA 4JHUA 3THML 5MP6L 1HHKA 2GC7C 3AU1B 1VFUA 2EDWA 3D2UB 5LGJA 2EE9A 1U6AL 1A64A 1MI5A 4PREA 1UYWL 4OGYH 5HJDA 5TGBB 5IQ9B 2VDRL 3T6ZA 4LCWA 3MNMA 5CEZE 1PD0A 2NR6A 2HN7A 1JTPA 4NJAH 3EYVB 1NDGB 2IAMB 3ME0A 4YHLL 3II1A 1VHPA 1TU2A 3VWJC 3OD3A 3GRGA 2F08A 3UBXB 2IOMA 2XTJE 2C3WA 5E7BA 5BZZA 4PJ8A 1F4XH 4BEIA 5J89A 1IJNA 4E0RA 1H5BC 4IRJC 4J3XA 5E4EC 4FMVA 5FA3A 4ELKA 1XF2A 4PVMA 3I02A 4Y5XA 5F7YC 4XCNB 3MRDB 1NOFA 1EQWA 3NOIA 1WK0A 3D06A 2ATPA 2JKNA 4P3CL 3LRLA 3O41B 2B8OT 2NCMA 5DD6A 1L9MA 4WWKC 1OF0A 3FRUB 2IH3A 4TLTA 4G8EA 4XVUC 5IWLA 5J1SC 4FLRA 3A67H 3BE1L 1RURH 4TKWA 5BS0A 5IESL 1TTAA 2B5IC 4JKPH 2W9DH 1B2YA 3TNNB 4UIKL 3CVHL 3GDBA 1MCRA 3EYVA 1FNSH 3ME0B 5IVZB 1QWHA 2DZEA 1B90A 3SQBA 1B0WA 1EJ8A 2OMBA 4GLRI 1LP9F 3RFRA 1ZGLA 3IJEB 4G11A 2OR8A 4HPYL 3OR6B 3FSWA 4XNMA 4TVPE 5ESVB 2Y07L 2E76C 3NESA 2VDKL 4JQIL 3RTQC 2GTZA 4XE5B 5K9OA 3DTXB 4H2AA 1WQVT 4XXDA 5EEYA 2XZCH 3NQKA 5E9AA 1UD6A 4XCNA 3VFRA 1EX0A 2NXYD 4NHCL 4EUPH 2ESVA 2JKLA 4AK2A 4G6AD 1AG0A 5HD8D 4LCCB 4XMKL 5KJ7E 3DBXA 2IALA 2R2EB 3KGUA 3GUTA 1ONQA 2G30A 1OT2A 5I6NA 2DJUA 1PZUB 1I9JL 2DQJH 1QO3A 1QI5A 3H7BB 4O9HH 4MQXC 3U82B 2WXQA 3TNNA 3K71A 4AEIL 4NO3A 1PTZA 2WPGA 1F13A 4Q4IA 3WO3B 1BIHA 1WCQA 4QCIA 4YJZL 5HDOA 4J1UA 1RJYB 5JHDD 2IJ0C 1SF5A 2DD8L 3ABLB 1FZOA 3KPOB 2Z4QB 4B97A 1GC1C 1FL3A 3E3QC 5GSRB 2GQHA 2WM0A 3LMJH 3FUHA 3OHXC 4R7NB 2CA3A 5FGBC 2ESVB 2Z35A 3NA4A 4M1GL 1UXLA 4CGTA 5K39B 2DYPA 1KUMA 3C6LC 2BCKB 1XIWD 1VPOH 3WIIL 2AF2A 3V5KA 4UTAA 2I07A 1WA0X 3H3PL 4MGXA 3S34L 5HHQA 4I13B 5DVOA 1GIGH 1M42A 2EIBA 5DJ2A 3S6CA 2X4UA 2ZOWA 4PRHB 4X50A 5I8KL 5JHLA 1WEJH 2Z6FA 32C2B 1IVTA 5LHDA 3EH2A 4L3CA 4QYOA 2AITA 3RYMA 4LK4A 1SYSA 4ZOAA 4F2MB 1T04A 1NAKH 1FNGB 2H32A 2J71A 1OGAB 3T09A 4XCYA 1HSAA 5KG9B 3D0LB 1E9PB 4ONGL 2RMNA 2DQGL 4OJEH 5I5MA 5JW4N 2G3ZA 5ACZA 5FHAH 4E41D 2F1EA 1TXKA 4HK3N 3WEXB 5C0EA 3WFDH 4PV8A 3AGVA 5FGBA 3C60C 1ID5I 4NNPL 4BZ1H 4QUOA 3S5LA 4R4FL 4L05A 5ABDE 3AROA 1S9VB 1A22B 1RL1A 3M1OA 1RP9A 2VLRD 1CU4L 4XNBA 1BQUA 1DP0A 1KCLA 3CVHA 3ZTJG 3GS4A 1FH2A 4CNIA 3QNFA 1QVOB 1ZXKA 4PRBB 1YPZF 3IRPX 5LXVA 3WIAA 1CYWA 1BJ1H 4LF3A 4XBPB 3BQUB 4H8WC 3CC1A 4XRCB 4CMMA 2HUEA 2XG5A 5DZJA 5SX4H 4POYA 2A38A 2A74A 2WXIA 35C8H 4LRNL 5TE4H 1TZ8A 5C07A 3WIHA 4HH8A 4Q9BA 3TJHD 5F6IC 5LBSH 3U0PB 5M95B 1ANUA 1CK0H 3FMGL 4DQAA 2IQAA 4M7ZB 1OM3H 1M9SA 2ZXAA 2G2RB 3ZE0B 3H3BC 4DVBB 1DN2A 2YAQA 1T7VA 4LSRH 3AABA 4YXHL 2OJEB 4AW4A 4MCNA 3PF2A 4YFLF 4ERSL 5ALBL 3DETC 1PLAA 2ISDA 4LLDA 3MRIA 5HGAB 2NTSP 1UOLA 1JZ4A 1MIML 4E9WA 1H0DB 4XAWL 3EJSA 2AEIT 4XN9A 3UGXA 1NAMA 5I82A 1MFBL 5IB4B 2QVTA 4Q9QL 4D0DB 5TDPB 1AJ7H 4GAFB 1URLA 1OO2A 4I5BB 4O51A 1P9MA 1HHJB 1JDCA 5E4AA 3I9AA 4QY8B 4BHUA 4D0BA 3WFCL 4YBLC 5I1HH 1J5HA 5ISZD 5FUCE 1CFMA 1YEFH 1PDKA 3VA2C 5BV7B 3QZMA 1HJBC 4ORGB 4P9ML 2K6ZA 2WBJA 1HHGA 1UJ3C 3CQPA 1VZHA 3RU8L 4ZNCD 5J9PB 3QNZA 5MI0C 1I8LC 3FSZA 2VSKB 2GABA 3OKNB 3UTPE 3VFUB 1SUHA 1RJLB 2J1ZA 4Y5VA 3ES6B 1GC1H 3GNMH 1HHKB 1MREL 3UZEC 3D25B 2XA8H 2WQSA 2VMJA 4AUJA 1XGPB 2A6KA 3FYEB 2ITEA 3ARWA 4PG9A 4BK5A 4PCTA 5AOMA 2ZWKA 4R7LA 4HZLA 2DLTA 5GGSA 5KVGE 3O3EB 5D1XD 3I3EA 1AACA 5GS0D 1WAEA 4FRWA 1NGXB 2A4CA 4TLSA 3ZL2A 3H2QA 5GRXG 2WZPD 3BFOA 4EN3A 3CXFA 3HEIB 3HHRB 3EJYD 1I1YB 3RZCA 1TTUA 4MA8L 1QTYT 4YDLB 3DMMD 4NKIH 4XMZA 1RI8A 2VXTH 4NHUB 1RZJH 4JPWH 5GGUB 5ACMA 1A3RH 2A9NH 3OHMB 4HGWB 4QXGL 4AMKH 3DKHA 5C07E 3LSOB 4K9JA 4NNXB 5J56B 5GJTL 2YMXH 2ZWLT 2UXVA 1I53A 1IO4C 3LIZL 1MVUA 3DXAE 4LSSL 2A6KB 4RX4A 2XIDA 3CFBA 4JVUA 2E9JA 1P7HL 3INUL 1IBYA 4HZLB 3SPHA 2DLGA 3CZFB 5CKAA 3JTBA 1WZ1H 3QPQC 2Y23A 4MHHG 3VFVA 4KNQA 1KJMA 2P5WA 3K6OA 1R17A 1DZBA 2HRGA 3GJFH 4DESA 2JXMB 1AZVA 2APFA 3STLA 2BS71 1UWGH 2BO0A 2G3MA 4PWGA 5C08A 4AQAB 1MCJA 4HALA 2QDWA 3G6AB 3QFDB 2VC2L 4X5PA 5E2JA 1RZKC 3RWFA 4AW7A 3MBEA 2DD8H 5ERWA 2ROXA 3EHBB 3HE6C 2ITCA 4PJEB 2J2ZB 2V8LA 4KK8C 4HX1A 4FMKA 2F8VA 3QUZA 2DQ6A 4UV4L 2D8KA 2JK5A 3L3KB 4M43L 4XVTL 2QELA 4YFLI 1P5UA 4LDCA 3CFBB 3CN1A 4O2EA 4HH9A 3VQLA 4GP4B 5E5UB 3VFTB 3CVCA 2CK0H 3QWOA 4AV5A 1K8DA 5DZLA 5AAPA 4KJWC 4Y4KA 2YD3A 3AXLA 2CK2A 4U1GB 4XNXL 1HAUA 4F7CA 4WWKA 3ISWA 4GY4A 5C08B 4AQAA 2CO1A 3AAZB 1U8OB 4DK3A 4KZCA 2Y6TE 4JDTH 4PRDB 2D7NA 1N8OE 3QCUH 2X87A 2X4RB 4N2AA 3JT2A 4ZI8A 5C6TH 1XXFC 5IHWA 4NQDD 1H5BA 1TEGA 4LLMA 3QIBB 4PAZA 2CLVB 3LEXA 4OJFL 4PLKD 3BVWA 4G7VH 1JNNH 3QUML 1XSOA 5FYLL 1I85C 4YHMH 5HYQA 1UT2A 1CZ8L 2J44A 4N2EA 1ES0A 4HH9B 3VI3F 4GI8A 4XX1G 3CDGB 5IB1A 1TVBA 4ZW6A 4KQ4H 5HXMA 1EGJH 1AS7A 1LO0H 5A6LA 2UZIH 1DQMH 5KJ4A 4JPSA 2OR9H 5F7LB 4JN2A 5DUPH 4EDXA 4GSRA 1N7ML 2FR4A 1CTMA 3FQWA 4JFDE 2A7BA 1R3JB 3EAKA 1T5XB 3HI6H 6TAAA 5J06A 3BSZA 2PP7A 4HAFA 1NTDA 2DL2A 2K8QA 3B2VL 1EAOA 2K78A 3F58H 5JPNB 1WA2X 3V4UH 4M7JL 3V9CA 2H0EA 1KLFB 4F1ZA 1CG9A 2Q5BA 1ZVNA 5KSAB 1M7IB 1YVLA 1RIVL 2GJRA 1WFIA 1P2CB 4U6TA 4KVCL 4U31A 2B5IB 1WIUA 3NP4A 1VEOA 5CGBA 1R5VB 2VN6A 4NQVA 2H3NB 1ZTXL 5IVXB 1NFDF 3MLVH 5AFAA 1E30A 3PQYE 4S0SD 3DX3A 3MA9H 3K2KA 4HWEH 4HS8H 1TQCB 1AQKL 2X3BA 4YK4C 4PJCF 1A02N 5L6YH 4GKLA 5IZ7A 1ZHBA 1WC7A 1SY6A 3SE3A 2OMXB 4HU2A 1G9MH 2XX0A 1EAQA 1KYOJ 3NT0A 4ZSOE 4AH2A 5CWSA 3ZDXB 5FUOL 1I8IB 1MHEA 4Y19D 4R90H 1J0JA 4NRZB 4OZIE 1G7MB 5EUOE 3E8UH 2ZXCA 3G5ZA 4Z7UB 5KVDL 3CH8A 2BOCB 4KKPA 1Z5HA 4HCGA 3WJJA 2O61A 1SBBA 3NEEA 4OLXH 1QFUH 4JFUA 3HG1D 5HDBB 2V7NA 1I1RA 1LQBC 5DRNB 3RLSA 3I9GH 3LD8C 3OGCB 2G4EA 4I88A 1SJEB 3IXAA 4YHKH 4JFPB 2H47C 3JV0A 4O2CB 4JFEB 3MODL 3TEYA 4JO4H 4F58H 4OAWA 1B0RB 3IGFA 3PJSA 1HCVA 2CRMA 2R15A 1XD1A 3K74B 2VDRB 3C2AL 3MCKB 3GMNA 5DQJA 3DUSA 1N26A 3QG7L 3BWUC 5E7FA 2ZX9A 3QAZC 4PJAF 2PCFB 4M6MH 4WSJA 5CLTA 3ZQXA 5AVQB 1HOEA 4U6YB 4P05A 1BX2A 4NRXA 2VDOL 4S0TD 4G1MA 5I24A 1KB5B 4QTIL 3NAAL 1IARB 3KAAA 4ODXA 2R83A 4AI7A 5C2BH 5JYMA 4HETA 2EH8H 1P5VB 3ZL4H 1A5FH 3ZT6A 1JGEB 3WXVL 3KLSA 2V4LA 5E9NA 4LXFA 1EERB 1LLAA 3T08A 3FTXA 2AS5M 3EZJB 12E8H 2VJXA 5CN3A 3IF1A 4HK0A 3CQFA 3S96A 3RWHB 4BK8A 4PBVC 4N26A 2B4CL 2X89A 2EDMA 5D7EA 1MQKH 5D1QC 1J1XH 3QZBA 4PJEE 5SWQB 5I1KH 2EE3A 2ICES 2WWMC 4RISL 3V55A 4A63A 1I1FB 5GZNC 4NWTH 4BA0A 4I3RH 1AO7A 1JRHI 3HBQA 2W0FB 4RSYA 4BWUA 3O3AB 1TQUA 3NN8B 4YXLH 2GHWB 3DI2B 3GI9L 1ZA6B 4F1SA 4NO3B 3R0NA 1WAAA 5DD0H 3WV0A 3CLWA 1RJZB 1IFHL 1KG0A 1R75A 2FJFB 4LQ1A 4XX5A 4ZK8A 3TBTA 1GOGA 2XRAL 4MAYB 1KTCA 4PRIE 4RSVA 4X7SH 3TVMC 1F90H 1H3VA 4R3SB 3CTTA 4AGQA 3KPNB 4OD1L 2E74C 3IDJA 5D7LD 4XVSL 1LE5B 2FYVA 5EU4B 3QBTB 3T77B 3ZDXF 4XBPA 1BMWA 1U92B 3MBEC 1IKNA 5SWQA 1KV3A 2FLMA 3MXVH 5FFGA 3FAWA 3SDDB 3MGOB 1NDMA 3GSNB 2K9FB 2XKNB 4KO7A 5KBKA 2VR7A 1BAFL 2ICCA 3PIQA 5ETUA 2C7FA 4A7UA 2Q7NA 3EYUL 4MTMA 1X5MA 2OL3A 2BSBA 4LSTH 4XAWH 4HOXA 2XWBB 1TYJA 3MV8E 5D71H 1U91A 3JV4A 1PFCA 5D93C 3KBPA 1T6BX 1BOGA 1HT6A 2WB7A 5KOMC 1C08A 3JTSB 3IMBA 2FUQA 5C0JB 3DO7A 1VFAB 3BD5A 3O6MH 1N64H 5DZOA 3P4MB 3WN5C 1F1AA 5CGTA 3BPOB 4H25B 1XL4A 5JHDB 5F0PB 3IFPA 1HSAB 1HZHL 3K2UH 2DYPB 1MRDL 2DRUA 2LLNA 5C7ZA 3UBXI 3ZXAC 3AS0A 3KLDA 2BM3A 5E94A 1R24A 4JCMA 2VDQH 4I0KA 1CBVL 3E7JA 5EF0A 2JJTA 4J2XA 1PD1A 4Y7MA 4U49A 3NDZE 5LBVA 3QE5A 3EBAA 5E9DD 4HP5A 5IBLC 2UWEB 5D1XB 2NDFA 4QHUA 1J87A 4G7YH 3D2TA 2IDUA 1OD7A 5DSCB 3QEQE 4JFSA 3HRPA 1UQSB 4LNRB 4BK5C 1IJ9A 4UDTA 1DVSA 4DHLA 1O7SA 1IIKA 1K8IB 5I1CH 4XNQA 1T2QH 4QRRA 4OT1L 5BOPA 3QDHA 4AV4A 4NZUH 3V52L 2IOOA 4XPBH 2HJLB 4P2QE 1PNCA 2OULB 2XPGB 5D5MB 3TA3A 3KPQA 5DHVA 5HI5C 5JW4Q 4HJUA 3GZPA 5C0DB 2I24N 1FSKC 2V5MA 1UVQB 2DQTL 2L04A 3VX0A 4K71B 3WXWL 5EIIA 3PL6C 1UGKA 3GXNA 1CD0A 5JXAL 1BG1A 1Q9WB 3QNXB 5IEKA 4BCYA 1AKJA 4O2FB 5CLWA 3GSUB 4LSVH 2SODB 1MUJA 4ZMYA 3JTTB 4X99A 4G9FA 1XO8A 2QZQA 3GTVA 1OE2A 3CMOH 3L8QA 4RZKA 4KKCC 4OB5L 1RIHL 4N2FA 4PR5B 4C54A 2CBMA 3GO1L 3A6CL 1IAIL 4G6KH 5TDOB 5JW3L 3RFZA 2Z0BA 1U8NB 2PO6D 4XX1E 2JKWA 2EVIA 5F9JB 1CK0L 4I3SL 1Q9OA 5DYFA 1ZWIB 3KYOA 1QTSA 3RDTC 4WFGD 4WNSA 5DUBA 4FQXD 1BJMA 2X2IA 3MROA 3OAWA 4EQ2A 4ZUUA 1EBPA 2IDQA 2JIXB 2Y06H 3WO4B 5C86A 3MJWA 4YDZA 2QZ5A 3QRGH 3U6RA 3EZ8A 1JXFA 1XGYL 1OAJA 4YSCA 2W1NA 5K1NA 1AGEA 4Y2DD 1D5MA 5G55A 5AKTA 3ILPB 2LABA 2AV1B 4YHZH 1NEPA 1ZD6A 4IHOB 2V2TA 2BJMH 3ROOA 2FZ3A 5D7IF 4LDOB 2MNUA 3P0YL 2C1OB 4Z0XB 5FCUL 1UH3A 4BKSC 1N5YH 4FG4A 1IGYA 4F37F 2EYSA 4YGAB 4HPHA 4PJAE 3WFHA 4XZUA 3UG4A 1H8LA 1J9TA 4DEPB 1DL7L 4PHZA 3MV11 5F7NC 4TLUA 3LXCA 4Z3IA 2BVOA 3CXDL 1UENA 5IV2A 4XC1H 2R0KH 4ICWA 3MREA 4G8GA 3WEOA 4KXAA 4YLBA 4ZOEA 2Y4SA 3I75A 4GXVH 1E42A 2O5ZH 4L4VA 1MQ8A 3G6JB 3P4LA 3SE3C 4AEHH 4YHYC 3RB5A 5HPMA 3I6LD 2KZBA 1MI5D 4E9TA 1S9WA 5F9WC 3VSQA 1BW8A 1HHIB 3K8MA 3OAYK 2VSCA 5IMMA 4GINA 1FDLL 2Y24A 4JANA 1UOVA 3U7YL 3QA3A 1DVXA 3OKKA 3X17A 3KL3A 4JDZA 2PPFA 3LN9A 4O4YH 4V1DD 4PRAB 4AKPA 1SQ2N 3GMOB 3OKOA 3KEDA 3QXUA 3I9GL 3SBQA 1F4WH 2N7AA 3MKKA 3WDJA 5DWUL 5C2UB 1ZPLA 2IMNA 1UXSB 3CSBA 5D7LB 3P4OB 4ADIA 1MREH 2IADB 4IGBD 2CSPA 5E8NA 4PP2B 1A4JA 3BVNB 3ZYJA 3BH4A 2QGCA 1ONQB 3MRBB 4LMQI 3CFUA 2BNRB 5JHLH 1U2HA 1SVCP 1MFCH 5LBGA 1BYOA 1M6OB 4XNZC 3T8XB 1UYWH 4OGYL 1J5OH 4AM0Q 5JPNA 5D7KE 1NGYB 2WZAA 4PJ9D 2UY6B 4W9ZA 4HS8L 3D39B 3E2HB 1AANA 3BXNA 3H0TA 1G6RL 4F5CE 3K1DA 1F11A 2LTQC 3JUYA 1RIUH 1BBDH 2L4OA 2BS8A 2RGSA 3SKMA 3WMQA 1L7TL 1L3NA 1YEDA 1U8OA 5E5MA 5D7SH 1JV2A 5DMGC 5DMIH 1HWWA 4P4KC 3RZWA 3SQOH 4BQBA 3GQFA 4ZXBA 4OIIH 2AK1H 2EICA 3CVHH 1DN0B 3RNQA 5BS0E 2VWEE 3IDNA 4UU9B 4B6ZA 1CXKA 5JPMC 1TCRB 5AEAA 1THCA 3MV9D 4Z7QB 2ZWZA 1PW3A 5I6XB 5JHLL 5IQ7H 2ERJC 3KJ4B 3DVGA 2WIIA 4YC2B 3VFNB 4UOW0 2X1QA 2MMXA 1RAMA 3QDGE 2VW6A 1Y7VA 2FX8H 4E5XG 3GSRA 4BH8A 1JDAA 4NQQA 4QOKA 1JDDA 5C0GB 2H9GA 3WLBA 1QR1B 1BZ9A 1VRSA 2XIIA 4I1NB 5LBSA 1P4UA 3KE0A 1JZGA 2MTPA 1QWNA 2W60B 3QUYD 5GS1C 2YKKA 2AQPA 3E0GA 3BIBX 1H3WM 2A9AA 2MWCA 5I1CL 1WUZA 3RPBA 4P2CG 5L0QB 4D3CH 4K9EL 4GBXC 4B9ZA 4X4ZA 3B3IA 5E1AA 2DKSA 5EOCJ 3UZVA 4IBTA 4FAAB 1ES0B 4HEME 1ZLUH 2JSFA 3ROLA 3INUH 1S78C 1B3IA 2J55A 1QHQA 3FCSB 4MXVE 4GG6E 4B9YA 2D9CA 2B2XL 3MCLH 1NEZA 2GFBA 4LSVL 2FX7L 1XZWA 4HWNA 2O5YL 4NXKA 1DVFC 4XPAL 3O81A 5DEGA 3U0WL 1JGDA 5LNGA 4EDXB 5KOVC 3L4CA 4PHXA 1HI6B 3EBHA 4WI0B 5HHME 2RFXB 1N64L 4LLUA 2YLKA 3D12B 3I6SA 1NZRA 5JIHA 1IE4A 3BAIA 4DKEL 3BCFA 3OX8B 4WSKA 2QVKA 3FNKA 4P9HC 4MD4A 3V95A 1F6AB 1JF1B 3G9VA 1AXSB 2BSEA 1NIBA 1VKXA 2BOBB 2NRDA 4M4RA 3LNGA 3NACH 4G9DB 1CFTA 4PGJA 3SYCA 1SMDA 2F19H 3AFLA 3T3PE 5DJ8B 5F96L 1HS6A 1L0PA 3IGUA 3PWLA 4G8FB 4OV5B 2CDFA 4FHBD 4FQCL 1IX2A 3EOBA 2VXVH 1JI1A 1CCZA 2AW2A 1QSED 5DK2B 5LUMA 3ZKNC 3ARDC 4NENA 2V5YA 4Y19E 1B88A 2GI0A 2X28A 4FQLL 3GMLA 2BSRB 1W0VA 2VDML 2NX5B 2WTRB 3MUZ1 1IAOA 1M2VB 2WMPB 5T1MB 5CJXA 3TZVC 2QFPA 2GSGB 3UIZA 3B7TA 3W81A 4FQIL 1N6QH 3L7FB 1NCBH 1SOQA 4WEBH 4APQD 3AS1A 2FL5B 1AMXA 5D4HA 4F7TB 3MRGB 4PJIF 1OAZH 3LJ3A 1HX0A 3SIKA 1AI1H 4G9FE 1NGWB 4TTDD 4W6XB 3SPGA 3L9RB 4PG2C 3MPCA 4U1NB 1HYSC 3QZWB 3V0DA 1LD9B 1E4XL 2VC2B 4KJYB 3ULVD 4BSVB 4I1RA 4X8GA 2GEQA 3PRZA 1GYAA 4YHNB 4PJ5A 4KH2A 3VGAC 3RVVC 1WFTA 12E8L 1NCCH 1PY0A 1W0VB 3B9AA 1ZV2A 1WBYB 4AIEA 1TQSA 3U0WH 2BHUA 2DMGA 5ITFA 4J3OD 4EN3B 1MPAH 2XN9E 2EYSB 3G6JE 1JK9B 4NN5B 4BINA 1NIAA 4ONFH 2C9RA 4F3FA 4H1LG 1OV8A 4NBYB 4NP4L 4QD2E 4ZT1A 5IOPA 3MRPB 4GRWB 3HG0A 3G6DL 2BSSA 3EKCA 4J3UA 4ANKA 1ERNA 5HYJE 3OTTA 1BYNA 3Q2NA 3ARPA 1P4LA 2BSED 2J21A 3UG5A 2YBRA 2BSTB 2PXYB 1XIWC 3IJYA 3KWVA 3KWWB 3MU3A 5FO8B 2YPVH 2AQ2A 3GLAA 3G5VB 2IQ9H 2P5WB 2ZZUT 7PAZA 1EEYA 3QO1A 4UB0H 4JKLA 4X4YB 4RISH 4MJIE 4I0PC 3FUIA 3FQXA 4OCMC 4NQEE 4WNJA 3WKYA 2K70A 1DBAL 3FN3A 4WUKL 4HWUA 2VB5A 2VDNH 1XZ0B 5LG1A 5AOLA 4J28A 1GGIL 3VD0A 3SB3A 1G7QA 4CVZA 4Z7WF 4N0CD 4HXBL 4IKJA 1BJ1J 2VR9A 5D8JL 4FNLL 5KBDA 5D1QB 4X5RA 3ZL4L 1NCAL 4LSUH 1ET5A 1OB0A 1E4WL 2JKRM 1U8JA 1J0ZA 3QK0A 3GRWA 1DJGA 1WWAX 5GSVB 1WJ3A 4QYAA 3CFCL 3WIFA 1UKSA 5JW5B 1BFVL 1DQJB 3DK2A 5DEFB 3UDWA 4WHTA 3VXOB 2AK4D 2CA4A 5I1GH 5TDNA 4KKZA 2NYYD 1ZOXA 4KUCF 4LCWD 3ET9F 1N6QL 4XCEA 1OIOA 3KVQA 4P2QB 1SFDA 1ID2A 1U8NA 3QORC 4DKFL 4MBOA 1ZHLA 2AQTA 5FDYA 1OAKH 1BZ7A 3WDHA 5DMKB 1DBJL 1UT1A 4NZ8A 4JDVA 2IG2L 3B3BA 4WW2B 4MA7L 4ZAKA 1M7DB 2E7LA 1KPRA 1R3HA 3H3KA 4M1DH 3C60D 3QORB 3CMGA 3IKCB 5C0BB 4GAGH 4R8WH 4G6MH 2OX5A 2RD0A 3E6FB 4ZO7A 1KB3A 4RNRB 2X2HA 4R90L 4I9WE 5DSCA 4N25A 4B0MB 1KJVB 1NFIB 1PU0A 1ZTXE 4LOUC 4G6FD 4MDRA 1A6VH 5CJ8A 5DMJB 2HTLD 5H4YA 2VZTA 2J1XA 3CCHB 2YO3A 3KPPB 3FQUB 4HG4J 5JW4R 3Q43A 2VCOA 3HNVH 4IGBB 4Z0XA 1M4KA 1S7QB 4KQ4L 4CN1A 4HD5A 1AD0B 4K3EL 3PHQB 5AWNH 4O02H 1SXNA 5T5NF 3SD2A 2QQLL 4GAJL 5DI8B 1L9PA 4N2IA 4MMZC 1PY4A 4V2BA 3P4NB 1UQSA 1WHOA 4X8CA 3HG3A 4QF1A 3WY3A 2GTQA 4NWUL 3D5OF 4RNRA 3SY0A 2JQZA 2L7EA 3GIZH 5AW5B 3WBDA 4XH2B 3RWIB 1OGSA 2B0SL 2PR4H 2NQDA 3L81A 4N24A 5HTSA 1FO0A 3RWCA 2WGNB 3WUWA 4NPYB 4R0LC 4Z7WB 2O6DA 5A1AA 4O51B 2DBLH 4CKVX 3WGUB 2ZUXA 1O5DT 1S7QA 2H6PA 5FF6B 3ZX1A 4HJJL 1JTOA 4W9HC 2NY4B 4LFHD 4NQDE 3S4SG 4FHJA 4G9FD 4E9YA 2EDXA 1TQVA 4TUOB 2FNBA 4JO1L 3UTZA 2BJML 4F91B 4OCXL 4JM2B 1MFAH 3QIUD 4OF5A 4OCRH 2AQRA 5CLXA 5DD1H 4E0RB 4XMWA 1HEJC 1YSOA 3BDYL 3GSUA 3IAQA 1EUTA 3QNZB 1MUJB 4M03A 4PGZA 4JG1L 5L2KE 3MRFB 4U1MB 5FYJH 2WYIA 5KJRL 4WW2C 3VB9A 1EXUB 3OSKA 2CO7B 5IVOA 1VJSA 2XWDA 2Y1YA 3I50H 1E5CA 3D0VA 3DRTA 5K5YA 4MD0A 4ZSOA 2HFGH 3OL2A 3IETB 4UYPA 3D3VB 1ZLVH 4QO1B 5A43C 2GJ6B 3DOIA 2C9SA 3MLYL 3VFWB 1XTLA 3US0A 1JBJA 1Q9OB 3SQOL 1KV7A 2DJMA 1G1KA 2UZXB 3QFJA 4H8QA 4PQXA 5JUEL 4DNLA 4XP5H 2XXGA 3ASNB 4Y2LA 4WFED 2OP4H 1OAXH 3L5XH 4JFOB 1R6VA 4KKAD 1XGUB 3BAJA 2IPKB 3N1PC 3ARRA 2BVQB 3OR6A 1KXVC 1R3LB 3GRBA 5DO8A 3BP4B 1SJHB 4UI2A 1NSNL 3B8YA 2YR3A 4HS3B 3RY6A 4NCDA 3VXTB 3CSYB 4KX8A 3KPSE 3G08B 3QB7C 1H3TA 4HMCA 3FB5B 3BH8A 4RX4D 3QS3A 2VLKB 1I4FB 3GZKA 4N5EC 4OLWH 2QR0A 3AJ7A 1OAZL 4RFNC 3V4PL 4ZX4A 3ESMA 3CZKA 3O6FA 3W2DL 5DTFB 5DVNA 3S3DB 1R46A 4GRLD 4X42A 4JO2H 2W81C 2WXPA 2VDKB 4JANB 4HBQA 5DWUH 1MF2L 3DUHA 1XXDC 2XQBL 3UMNA 2HPOA 1I8MB 4JMNA 2BHFA 2WXGA 3GSXB 1A7PL 1ND0B 4W9EC 4J3OG 3GB7A 3OKEB 3QQ9C 3GSVA 3I75B 2FE0A 3KYNB 4L4VB 3BPCB 2NTFA 4X9BA 5DJXB 3WE6B 3VI4F 2ZOKB 5CCGE 1AFVH 1U93B 2RALA 4PREB 3ARGD 1NUDA 5IQ9A 5TGBA 4FTVB 5IW1A 1I8IA 1MHEB 2IH3B 3F7YB 3LNEA 3D87B 4HHGA 4N90E 1KJ2B 4EN3C 3O11A 1ZV9A 2BPBA 5E2UL 4K7FB 1NKRA 1M2OA 1MIEL 3IWVA 1UWXK 3PQYB 2FEDD 4P23B 2I9TA 3S5LG 2HLFC 1RHHA 3D69A 4QHLA 1UM6L 4KHXH 4KKBC 4ELKB 3RFZC 3IXAB 1HXYA 3T2QA 1J8SA 5KVGH 3E1F1 4JFPA 1N8ZA 6CGTA 3PXJA 2W65B 2WK2A 5HDQH 2IBZY 5ALBH 5HI3C 2ZOKA 2YD9A 3PG2A 2V2XB 4MX7A 4HUNB 1CICD 4NO0A 4Y8DC 3FU3A 3ALWA 3J8F7 2YAOA 4JJOA 4ESKA 2Y6SC 4ZO9A 3KYKH 4CDHA 4HFWA 3O0LA 4L4JA 3LVEA 3TA4D 3UPRA 3HJEA 2HWZH 4U6VH 3QG7H 4XBEL 5MERB 3GUFA 5IEHA 1G7IA 3LZOA 3ILEA 4KK5C 5HHOE 1DBML 3H55A 2JCCB 4YC2C 4JN1L 2DWSA 1PG7X 1NWOA 1W8OA 1KJ2H 3VYPA 2UZPA 1KYUA 1RUPL 4J1UB 3TN0B 2RH0A 2W8CA 2IH1B 4JN2B 1U0QA 3I74A 4U1LB 2JI1A 2VTFA 4IYKA 4AQ8A 4LKCA 1JZ2A 5IUCA 2E7LC 4YR6B 1ZS2A 4WLCA 5H94A 4QPEA 4KITB 3AQXA 4PY7B 5GRVL 3VACA 4U0QB 3PGCB 3Q2LA 4LASH 4TLKA 1FIEA 4OF6A 3TX4A 2Z93