4P5SA

Structure of reduced w45y mutant of amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTYINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title The sole tryptophan of amicyanin enhances its thermal stability but does not influence the electronic properties of the type 1 copper site.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4p5sA00
1L9OA 5D4JA 5FC9A 2FT7A 3WNIA 1WA1X 2QPDB 5B1BB 2IDTA 5B1KA 4ENZA 3CVBA 2IDUA 2YAPA 1RZPA 1V10A 2PCFA 1AIZA 4UAHA 2W88A 3V9EA 1BQKA 3FYEB 2P80A 3PAVA 5TK2A 4G7SB 1QNIA 5EHFA 5I6OA 3NP3A 1A8ZA 1HAWA 3NJJA 3SBQA 4GY4A 4BXSV 4YSRA 1BQ5A 2PP9A 4CSZA 4DPBX 4DP0X 4GP4B 5I5JA 3CDZB 2DWTA 1XMEB 1SHXA 2MTAA 4BK5C 4W9ZA 1ET5A 4GYBA 2VW7A 3EH5B 4DP9X 1V55B 4G71B 3ABGA 1KGYE 1GY2A 1ASQA 2Y1AA 4UANA 3SBRA 1L9SA 4A68A 3FPYA 2BW5A 1HAUA 1SDDB 2OV0A 4KNTA 2BWDA 3OMNB 2JFCA 1KV7A 2DYRB 1AS6A 1TEFA 1SF5A 1KCWA 2XUWA 5I5IA 1E5ZA 2B08A 1KCBA 2XYBA 2OCCB 1ILUA 4FAAB 1ZV2A 3PCYA 2XV3A 1J5DA 4N8UA 2GIMA 1ID2A 1PCSA 1M57B 2FWLB 2H5UA 3EH3B 2FQGA 5AZUA 2DV6A 4G7QB 2PP7A 4A67A 3QJUB 3UAAA 4DPAX 1NPNA 4BWWA 7PCYA 4A2EA 1OE2A 1MZZA 3L45A 4MFHA 3WIAA 3GDCA 3HB3B 2YXWA 1ZPUA 3FU7A 3WI9A 3CVCA 4G7RB 3BQVA 3UACA 1RKRA 1AR1B 1PF3A 2LLNA 1AZNA 4PAZA 2YAMA 4KO5A 1SFDA 1ASPA 2XXFA 1SNRA 4W1TA 2P80D 2UXTA 3AG1B 3FSZA 4YVNA 4DP8X 4X4KA 1CURA 3DIVA 5AKRA 1AZBA 3OMAB 2J5WA 2XLLA 1KYAA 2CALA 1IUZA 2VW6A 5PAZA 4HHWA 3UADA 5B1AB 1BXAA 4YSQA 2FNWA 3N55A 4HCIA 4EF3A 2GSMB 3AG3B 1J5CA 4RH4A 1ET8A 3WKQA 4E9QA 1OCCB 1JZIA 2UXFA 2PP8A 3NJMA 1OE3A 3NJHA 1TU2A 3NSFA 1AQ8A 1GSKA 1RCYA 4JHVA 2PCYA 1R1CA 3QJSB 4GP8B 2PLTA 1A4CA 3OMIB 1KDJA 3GYRA 3S8GB 2ZONA 1ASOA 1W6WA 3PXLA 4ZK8A 1E30A 3T9WA 4E9RA 3AZUA 1MZYA 4AKPA 3AW5A 1WS8A 2IH8A 1WA2X 2PPFA 3CDZA 3PAZA 5I6MA 4GP5B 3FU9A 2BP0B 1QHQA 4KO6A 5B1JC 3H56A 3ASOB 3CZUB 4N4YB 6PAZA 2XX0A 1N68A 3FSVA 3UGEA 5E9NA 1EHKB 3OM3B 3MBWB 4L0PB 1ILSA 1ZIAA 1SDDA 3IN2A 1AACA 3NJLA 2VM4A 4YSPA 2VM3A 2HXAA 2IWEA 3FQ2A 4A66A 5B7EA 1SF3A 4A2HA 1A4BA 1CC3A 2WSDA 2IDFA 5AFAA 1HFUA 3TBBA 2BWIA 2IH9A 2J57A 4KO9A 1PNDA 4HZ1A 2GBAA 4E9WA 1NZRA 1ZDQA 2GB2A 5A7EA 2MRYA 4E9XA 1GYCA 2TSAA 1NIFA 3X1FA 3ZX1A 4AKQA 2I85A 4YSSA 3OD3A 1AG0A 1BQRA 2OJ1A 2VMJA 5I28A 2H3XC 3UABA 4E9TA 3NJFA 5D4IA 2WO2B 3IEAA 4WKXA 3WG7B 5B7MA 3QJVB 1JXFA 3S3DB 2DY2A 1IBZA 2HZHA 1DYZA 1NIDA 3ABMB 2VSMB 1KDIA 2NRDA 4G70B 1A4AA 1OF0A 2VN3A 1PZCA 5I6PA 1NIAA 1PZBA 4JKNA 2GHZA 3NJIA 1GW0A 2IDSA 2GC4C 1JVLA 2HX9A 3ZBMA 1NINA 1GS6X 4F2EA 4AI7A 3PLYA 3U25A 3NSYA 1FA4A 1V54B 2EINB 1XB3A 1B3IA 3FSAA 3T6WA 1GY1A 4A2FA 1J9RA 4AZUA 2FQDA 3S3BB 1OOWA 1AZCA 2AFNA 2AANA 5PCYA 1URIA 5I6LA 1TKWA 2Y69B 4KO7A 1YLBB 1IBYA 4AX3A 4G72B 1I53A 1UATA 2PPDA 4YSAA 2HRGA 3ERXA 2X88A 1PZAA 1ET7A 1NIBA 3H4HA 4KOCA 1AANA 2FT6A 4E9VA 3X1GA 3HEIB 3NSCA 3V9CA 4YSCA 2BP0A 1A3ZA 1PLBA 4BWTA 3FT0A 1XB6A 1BAWA 1SHWA 1E67A 2ZWNA 3NYKA 1L9PA 2IDQA 1X9UA 3JT2A 5F7AA 2PPCA 6PCYA 2XU9A 1BYPA 2H47C 1FFTB 4DP4X 2YAQA 1AAJA 2IWFA 3D12B 3H4FA 2UX6A 2CUAA 3JTBA 2Q9OA 2UXGA 4DP5X 1GR7A 3CG8A 3EH4B 2YAHA 5I6KA 1JZHA 1IKOP 1WS7A 1AS8A 3FPXA 4BXVA 3S8FB 1J9SA 2BO0A 4QKTA 4YSUA 2I7OA 4JHUA 1NTDA 4AKOA 2PPAA 2BW4A 4HALA 2FTAA 4DP2X 1AZRA 1RZQA 1JZFA 3FQ1A 1JXDA 4WTQA 2BP8B 2R7EB 1SJMA 3DKHA 1ADWA 3FU8A 3FYIB 2I7SA 1JOIA 2EILB 1CYXA 4M4RB 3TASA 4Q8BA 4A2GA 2DYSB 2FQFA 3QPKA 2AZAA 2QT6A 1FWXA 1WAEA 2HX7A 4YL4A 2XX1A 4NAJA 1GS8A 3GXUB 4M3HA 3NJNA 3PAUA 3QQXA 2YAOA 1BXUA 4YSOA 1EZLA 2YAFA 3TA4D 1A65A 2TSBA 1PAZA 1OCZB 1M56B 1JZEA 1KBWA 3FQYA 3ABLB 3KW7A 4A2DA 2WO3B 2CBPA 2N0MA 1M9WA 1N70A 4BWUA 1PLAA 2UXVA 1SFHA 1BYOA 2CJ3A 1PLCA 1NPJA 5LDUA 2QDWA 3MX0B 2ZOOA 3TU6A 5TK4A 1E5YA 3T71A 2J56A 2CAKA 1PNCA 4K9JA 3IBOA 4P5SA 3T6ZA 3X1EA 2BZCA 9PCYA 2QPEB 4E9SA 2QDVA 1J9TA 4CSPA 1JXGA 3NT0A 2DWSA 1XB8A 2EIJB 2J55A 4UF7C 2UX7A 1MG2C 3NSDA 3ASNB 3N2JA 2B3IA 2VSKB 2X87A 3AY2A 7PAZA 5I6NA 1ZDSA 1BEXA 8PAZA 1AG6A 4HCGA 2PPEA 4BDVB 3ZDWA 4KNUA 3T6VA 1CUOA 3SBPA 3T6XA 4KOBA 4DP6X 2JXMA 1ETJA 1AS7A 3CVDA 2FT8A 2IWKA 1BXVA 4YSEA 1NIEA 3SQRA 3IE9A 1ZIBA 4QLWA 4HCFA 3ZIYA 1OV8A 3EF4A 4HAKA 1CYWA 2GI0A 2HRHA 3KW8A 1W8EA 2ZXWB 2YARA 1L9TA 3C75A 4HHGA 1NWPA 4DP7X 3TBCA 3QJRB 3PPSA 1F56A 4NERA 4YSTA 2HLEB 4P5RA 1JERA 2BP8A 2R7EA 3FSWA 1QLEB 2VW4A 3QJQB 4F7KA 2BHFA 3X1NA 1L9RA 2FQEA 3NJKA 2AZUA 2EIKB 5I26A 3UAEA 4F2FA 2XV0A 5B1JA 4YVUA 2W8CA 4E9YA 1NICA 1VLXA 1MDAA 1MG3C 3FS9A 3RYMA 1L9QA 3WKPA 2E86A 1GS7A 2EIMB 5ANHA 5B3SB 1J9QA 1W6LA 3QJTB 2XV2A 4Q89A 1JVOA 3AG2B 2BZ7A 3G5WA 3NP4A 4YSDA 2YQBA 4DP1X 5I5MA 1OE1A 3IN0A 3X1BA 1DZ0A 3EHBB 2XVBA 4GXFA 3ABKB 2AVFA 2FJSA 1JZGA 3NJGA 2YAEA 1NDTA 1IC0A 1T5KA 2JKWA 1PY0A 2IAAC 3WNJA 5B7FA 2Q5BA 3FU7B 4HIPA 1KBVA 2YXVA 1X9RA 1PMYA 4DPCX 4FA7B 4PCYA 2XXGA 1AOZA 1JZJA 4TXVB 2XWZA 1E65A 4NB7A 1OCRB 1WA0X 3DTUB 1OCOB 2A3TA 3S3CB 2HX8A 5D4HA 4KNSA 3BVDB 1TEGA 1NWOA 2RACA 2GC7C 3X2QB 1AZUA 4BDVA 2CCWA 5IY5B 5F7BA 3AG4B 3OQRA
chains in the Genus database with same CATH superfamily
3PGDA 3VFNA 2VXUL 3EDKA 4K5PA 4QRRE 3VXOA 1UWEH 5CN3A 1J0HA 4L37A 2OZNA 1UWFA 1CFSB 2Z1PA 2HSIA 4XPHL 4HYTB 1NCHA 1W0VA 2VE6A 1IT9L 2HH0H 1G1CA 2CKBL 2X3BA 1OQXA 3S4SA 4UDUB 1CU4H 3NFSL 5EHFA 3MUUA 1CR9H 5KSUA 5CFAA 1ED3A 4TOYL 3D85D 1EAPA 1NEZG 2FJGA 1ZE3C 3R06A 2GI7A 4NQCD 3AGWA 3CIAA 3G6DH 2EABA 5FUCE 5B39G 4JMNA 4WI7A 4GRWB 1NANH 2X09A 4S10A 1UJTA 1CLYH 2IBZX 3CXDH 5FO8B 1VZGA 1MVUA 1V55B 2H6PB 4PEEA 1L9SA 1GSMA 1MCBA 1NAML 3EJSA 5AUMA 2FNBA 3MCKB 4UQ2A 2YGPA 1ZTXL 1JZ7A 1U95A 1O5DT 4IBWA 3LQAL 1PD1A 3WFDH 5JNYB 3WUWA 3GSVB 3PF2A 1SF5A 3KVDD 5D1QC 1E5ZA 3L16A 2FEEI 5D7IB 2WP3O 1FRGL 3AU1B 3MJ6A 5T1JA 4A04A 2BSRA 2FWLB 4RWHA 5IJVA 3HS0A 2VISB 1NCBH 3RDTB 5IIEB 3IMWA 2W07A 1ZHBA 1MLBA 3L81A 1TTRA 2ZOUA 5D5MB 4PJBB 1RUMH 2N01B 4TVPE 3KJ4B 3BGMA 3ZYZA 2XNAB 2VITA 5ICUA 4D9LL 3I75B 4C8XA 4L3AA 1RUPH 3ULVF 1HL4A 3O2VH 3VI4F 1AR1B 1NGZA 1N0XL 1UASA 1RJCA 4IMKA 5E2TL 2OSLB 4LARL 2VABB 5DMKB 5I8CA 2PR4H 1RZ8B 3BZEB 3GSWB 1AR2A 4YDJA 3PUCA 3AY4C 3AS2A 5EU7C 4HAGA 2HT2C 4G9FE 4PUBL 2FZ3B 4PJAE 1AFVH 4OZGE 5JOFA 5FW8A 4X6FB 4Z7AA 2W92A 4KKRA 2CALA 2VLME 1K5NB 2VMDA 2ZJSL 1D6EB 4HEPA 4QHUB 5B1AB 1J0KA 3ZRFC 4WDIA 4FRWA 1IARB 4JDEA 3UBXI 1WFTA 5LAPA 1MN4A 4NHUB 4MJIB 5E8PA 4GFTB 3A3YB 4QTHA 1QVOA 3II2A 1YG9A 3QZBA 4HDIA 4TSBL 3TN0C 4ZW7A 1RULH 3QDMB 4RMSA 3P77A 4WW2B 2FJFB 3GI8L 2YO3A 1EWHA 3O6KL 1GPOL 2KERA 4U7SA 5HHPA 2JLLA 4AYDC 5KVDE 3IAQA 3VXPB 1OD7A 1FDLL 4N2LA 2B1HL 5JPMA 1TZ8A 1TQUA 1I1AD 3TURA 3AZUA 3VGHA 1DLHB 2ORBL 2EDXA 5D7KE 4LIQL 2A74B 1MQKH 4YHLH 3PP4L 2VIRA 4AGQA 4Z7VF 2AXJA 4F9PA 1MKFA 4I2XE 5FFLA 1MJUL 5IHHA 3S88L 3IDJB 3NVQA 1H3TA 2X10A 4Z95H 3MZGB 3TBTA 2ZF8A 2C3HA 1ILSA 1F3DJ 1RU9L 5EZJA 2BHZA 4L9LC 2WXLA 3ME0A 1DDHB 1OIOA 5GGRA 5DD1H 3CBKB 3DHPA 3QS3A 5LGJB 4QKXB 2PWGA 3PV6B 1PSKH 1SVCP 4ODXA 3L1OH 2ZUVA 3QQDB 2MNUA 3O11A 1UXMA 5L0QC 3QO0A 4HZ1A 1JP5A 3HRZA 5TQ0H 4E9WA 4U1NB 4G1EB 1ZLUK 2R0KH 1MDTA 3VXSB 4ZPTA 2AEQH 1KCUH 4EZJA 4OF5A 3L4TA 2WM0A 4XT1C 3ZE1B 1LTXA 4FGMA 2FR4A 1HKLH 1IBBA 1Q9WA 1LM8V 4AKQA 4XN4A 2MPAH 3JWNC 3VFPA 1OWWA 5ACZB 1JI2A 4HETA 4Y16D 3S36H 4UU9B 5IB4A 3CVHL 4EO5A 5IB5A 3LXAA 4DIXA 1BF8A 1IBZA 5DEGB 3WXVL 5E1GA 1ZLWH 2CHZA 3V5DA 4FKKA 1AQKL 2CIKA 3G5XB 2ZCLL 3HE6A 4KXZH 5DJDB 5EPMA 4UTBL 1MREH 1RIUH 1ZRUA 3GBEA 3PHOB 4OB5L 1IM3A 4O2EA 4BQ9A 1I8KA 1DE4B 5IESH 1U8QA 2DBLL 3Q9PA 3SBWC 1ZT4A 3EXJA 4WUKH 3GRWH 3BRDA 1VEOA 1KJMA 4YC2C 1B0RA 3CN0A 5D72H 2G5BB 3BAYA 3GM0A 1RLBA 2Z35A 4Z76A 4E42B 1MFVA 4FQIL 1KWGA 2WQRA 4A1RA 3LN9A 4HH8A 1OOWA 5C07A 4AITA 5EEYA 1BLNB 3CHQA 3V4UH 2ZCKL 3RZWA 2PCXA 3QGVA 2GJ6A 3RE0A 5ES4B 4PGCA 3UC0H 3ROOB 3N5AA 4CL7A 4YSAA 1PEWA 2DN7A 4HXAH 3K74B 4Y1AA 5T33H 5D96B 4N2BA 3W3BA 4J7RA 5DQJA 1E5AA 2ICES 1VFOA 1UOVA 3C5JA 3O3EB 2JQMA 4LLUA 5K39A 4BQ6A 5E56A 2AJXH 5KSAC 4RGNE 4UOZA 1NLDH 5F7KC 2UY7A 3B7SA 1ZLSL 1J8SA 2XG4A 3LSOA 1L0QA 1SLWA 3FAXA 5KAQF 3GD1C 4DZ8B 5FECB 3W2DH 4XMPL 3RZCA 3MZTA 5SWZD 5A2IH 3KPRA 3QHFH 1C16A 1A3RH 2JXMB 4MSWA 4AIOA 1R5VB 4POZC 1C5BL 3SDCD 1AQDA 1WICA 2VXTH 2DQDL 2X4UA 3D08A 4M1DH 4M6NL 1TQWA 1DUYA 2VN5A 3CG8A 1VFBA 3GK8H 3SGJC 4XMLH 1OAYL 4XVJL 2G9HA 1IC5L 3DI3B 1YEIL 4ZMQA 4RDQG 4PRPA 4ZFQA 4ZMPA 5HYQB 5INCA 2VDOH 4CMMA 4XHJD 1O6TA 2GJJA 2Y4SA 1B0IA 1KXTB 5IM7B 4TVPH 3DSNB 2NNCA 6FABL 2A4ZA 4G1MA 3UZEA 1IBFA 1LDPL 4JVUA 2D73A 1DTUA 3D69B 4GJTB 1EERB 4YPJA 4WTQA 3O2DH 1I3RA 1PTZA 4Q6IC 5EZPA 3RAJL 2C5DC 3VRJA 2I7SA 1G9EA 4ELMB 3I6GA 3PXJA 5C0NC 4Q8BA 4C57C 5FUOL 3AB0B 1NGYA 2ZX5A 3OVUB 1TZOA 2LGNA 1PDKB 5DI8B 3SPIA 2NNRA 1ZAGA 3DO7A 3PAUA 3QE5A 5BUGA 3RVVC 3DX1A 4K0OA 3TA4D 2E7BA 2Y72A 4R97C 4LCIL 4PY8J 1JTPA 2YEQA 1SGKA 1X5LA 5GGRY 1E6JL 2A5UA 4L29A 3SE4A 3IKCA 5DGQA 3KW7A 5BMFL 1NLBH 1V3JA 1N70A 1SVBA 4HIJB 4IIZA 5IWLA 3WE1A 1W9XA 1BYOA 5JXEA 1O7DC 2AQPA 3IPBA 5DR5H 3V0GA 5C0DA 1UD3A 1DJXA 2OYPA 4MXWH 3H6JA 3MXWH 4WI0A 4L18A 1HNYA 4WI3A 4F8QA 3IJEA 2VH5H 1MI5A 5T3ZL 2BRRH 5F1SA 3UEZA 1Q0XL 2BFGA 4KRPD 4NQEE 5JQ6L 3PIQA 3GMQA 1B0GB 4UT7H 4PMEA 1DSFH 2E7LC 2IALA 5TFSL 3O0LA 2UX7A 3NSDA 4KTEH 5EO9B 3KH4A 2ZAIA 3H9SA 4LAJH 3ZYIA 4BUHA 3LPPA 3GHEL 1ZLVH 2YRLA 3C12A 3W9EB 2XT1B 4M5YL 4TUOA 3L3DA 3Q6GL 1KLUB 4UOW1 4QIRA 2GVYA 1IBGH 2QV2A 3F58L 1OW0A 2Q86A 5SX4I 1JS4A 4KVNL 2XFGB 5H94B 3L8QA 2GBVA 1WFNA 2XWJA 3FT2B 5I8EB 1J10A 2PYEB 3CFCL 4HWNA 4UM9D 4DUWA 2CBTA 4K7FA 3VYNA 3QORC 4HCFA 1IKNA 1EIBA 3VA6A 2EKSB 3WY2A 1KBGL 4RFNC 3HC0B 1EXUB 1N3NA 1LEIB 3HZYA 3GS7A 5MI0C 1ZANH 2ZX9A 2VGLM 5D1ZA 1OT4A 2OMZB 1CVSC 3ISWA 4P23A 5C0RH 1QFUH 1CD1A 1SBSH 4G80B 1MCEA 4M5ZH 4YMPA 1Q0YL 3GEFA 5D4QA 1AGEA 1LILA 1MPAH 1WF5A 2EKJA 4WI8A 3WTUA 2R1XB 2WKGA 3MBED 1ZHLA 2JKIS 4NPKA 1SN0A 3MLWH 4OBSA 2VLRB 4KGJA 1I3UA 2ESVD 4F3FA 4UILL 2DWXA 3KGUA 3II1A 2YK1H 3B37A 3BISA 4KK9D 4MCZB 4NAMA 3RVWC 5CBAA 4GSUA 2D0FA 4BD4A 4L4VE 2DQFA 3LRLA 2JJUA 3FS9A 3JUZA 5IB3A 4F7EA 1P4LB 4H25A 3P0VL 5CXPA 1FL5B 1UM5L 1KCVL 2X70A 1A7PH 1WE5A 3SDAC 4N8VB 2V2TA 3QJTB 2EVJA 1LD9A 5I75B 3CMGA 2OX5B 1UFGA 5DMIL 5E8NB 2YQBA 1AJ7L 5LNEA 5EBWB 1A9BA 3RNQB 3EIFA 1CXLA 1KGUA 5FYKH 1TJXA 2G75B 2FBOJ 2VLKD 2FIKA 5DK3A 4ERSH 4DFHA 2WLIB 2VQTA 2Z8WC 5DEZA 3TBVB 5B7FA 4KH9A 3LDBB 1EHXA 3G5YA 2ITCB 4E5XB 1KCSL 2ZCHH 1NSNH 4XOEA 3X11B 3S5LA 4JHAL 3OZKA 1PY4A 1NDMB 1ACXA 4WFGD 2GABA 3DTUB 2V8MA 3FO9A 3IDYB 1K4CB 3KYKL 3ZKSD 2A9NL 3VACA 4D0CA 2WLLA 3BVDB 3IDUA 5C0BD 2YRBA 1MUJB 3KBFA 1AZUA 3N44F 2CD0A 3S96A 1SOSA 5G4OA 5HJ3A 3SJVB 3MJGX 1KTRL 3QXWA 5IBTH 1U3HC 3QISA 4AGOA 1WA1X 3Q48A 1AC6A 5B1KA 4ENZA 1TJGH 2H32B 15C8H 4GXVH 1RZPA 2P8LB 4DZBA 4L8CA 3KPSE 3T3ME 2J44A 4N9OB 3LKSA 1QSFD 1BQKA 3FYEB 3SDDC 1D5MA 1U30A 1N8ZB 5TK2A 5IW1B 3SE3C 4TUUA 4XB7A 4ZAKB 1A7RH 5I1LA 3N85H 2IMMA 1HAWA 1QX1A 1F1AA 4N2DA 5DJ2A 3NFNA 2RCSL 4PY7A 5T3XH 1R3LA 2XYCA 3D09A 1EBAA 1PU0A 4KJPD 4NNXB 1OO2A 4WO0A 4N0UA 5I5JA 4L3EE 2XTJE 2DWTA 5E5MB 3SO5A 1M3IA 2MTAA 2OMXB 1N6VA 4H1LH 2AQRA 5JIHA 4BUQA 2QMJA 4BGDA 2FUQA 2CQVA 2NR6C 4XN1A 3ABGA 3RWJA 2AXFA 4XXWA 1MJ7L 3V4VA 2XI9A 4H8WC 3VQ1C 1EJFA 4K94H 2IBZY 3C87A 3IF1B 3WJJC 3UTTB 1KV7A 2EXYD 2I9TA 3R8QA 1BFVL 4A38A 1DVYA 3C6LD 1XX9C 1JFQH 1UM4H 1BMWA 1QFWM 1KCBA 3VUAA 5GRWA 3U0TB 2XV3A 3MJ7B 1FLRH 4EIZC 2R0LH 3DHJA 3ILPA 1XHHA 2A83B 1DBML 2D03L 3QIUD 1A3LL 1LEGB 1OZTG 2G2NA 3ZPDA 4WUUD 1TQCC 3OZ9L 4BWWA 4RX4D 4A2EA 5FS5A 3M1BA 4LSQH 4JRXD 4MNQD 1U8KA 4OF7A 2XZQL 3I9GH 5TPWH 1KT2B 4FI8A 1JWMB 4NZUL 5IKCA 1TJHL 5CLXA 1SXNA 1XVSA 4GT7A 2Q2LA 5LCVA 1INEL 4EUPA 3CZNA 3MMEA 2VDRB 3B2MA 3QUZC 2Z31D 3B9KA 5J9PA 4Q9BA 5IG7B 5F1NA 4W1TA 5A2BA 2UXTA 1GGCL 1W8NA 4N2AA 4NIKB 2X0UA 4KMLB 1CURA 3QUKA 3PRZA 1ML0A 3O6FD 4NRZA 4KFZC 3RWFA 1SN5A 3VFRA 4JFHD 1OB0A 5H2BB 1MCLA 4HW6A 2ITFA 4JO3L 3QI9B 4KUCF 2DD8H 3BH8A 3JWNG 1DJZA 1BQLL 2FH6A 1Z9NA 2IV8A 3HG2A 3VFUA 4FZ8L 4JPIB 5I0WA 1BIIA 2O6PA 5E1QA 5I30L 3FB5A 3BKCL 2BVYA 4GUPA 4H5SA 1AE6H 3PQYD 4E9QA 4Y5XA 3ULVC 2O5ZH 3EYUL 4KKBC 4Y19E 5D1XD 5BXFA 3ULSB 2EXSA 1RY7B 3BUTA 3KYMA 3NSFA 3DUUB 1R1CA 3C5ZB 3QR2A 4O00A 1TKWB 1YPZE 4D9RD 1TFHA 3GXIA 4G8EB 4JFZL 5E99L 3B9DA 2EH8H 3EO1B 4OUOA 3U6RA 4NZ8A 4ADGA 4N0RA 2L7UA 1XD1A 2CCVA 4YZFE 4WFHD 2YXFA 1SUJA 4NCC2 5FGRA 1M7DA 2IH8A 4FHBD 4GRMA 1U8NB 2FO8A 4GP5B 2NY2B 3MV9D 4P2AA 2X4NB 3GT6A 1N68A 1NUFA 1XCQB 5E2JA 4DO5A 3V0DA 4ES8A 3WKYA 1V27A 5BRPA 2RGSA 2W0KA 4GXUN 1KJ3H 4TM9A 1ONQB 2DPKA 3QR1A 1JPTH 3MV8E 3RJDA 32C2B 2IQ9L 3NPSC 3WHE0 3SGDH 3MI6A 5GJSH 3V4VL 4HGMA 3F64A 5KJRH 4KZEH 3QZWA 4NFDA 4NN6C 3C2AH 3GKWL 1LO5B 3PWPD 3TL5A 5C70A 3K6FA 5I8KH 4Y4HC 1GYCA 4I85A 4F7TA 2DDQH 3T0ED 1CDYA 1KCRH 2H1XA 4MNGB 3G6AA 4OM0L 1HWWA 5HVWA 4M62L 1QTYT 3BEWB 4B9JA 4QWWC 3BEVA 1USZA 4NENA 2CK0H 1WBXA 1G9NL 1QPPA 2H0PA 3A5VA 4LVOB 4Z7VB 3MV7E 4O51A 1GTFA 4HGKC 4JFPB 4PGEB 3BKYH 4UMSA 2E47A 1NFDA 2A73B 2VLJD 4XNXH 1DEEB 4PLKC 5F9WB 3V55A 4F2ME 2HFGH 1EBPA 5JXAL 5IUCA 1NIAA 2EACA 5LCVL 2OSYA 2YMXL 4NUGL 5EZOH 3QEGL 3VDAA 4XAKD 3A24A 5KYYB 4N8PA 2HX9A 3VI3E 3WFBH 4BFRA 1ZTMA 1K2DA 3OKYA 4JFDD 2NY5C 1KGIA 3OKEA 4TPRL 3U25A 3NCEB 1BJ1J 3IE4A 3SGKC 1V54B 1WBYA 4OR1A 5FUZH 5FYJU 3QEQA 5HJDA 3W11C 1YEGH 4DGWC 5KS9A 1RJYB 2Y7MA 3W39A 1TZGH 2HMID 3D0VB 4ONHB 1XT5A 4V1DB 5EH1A 2OMUA 3OHXC 4JJ5A 1AZCA 3REVA 3QP3A 4P9MH 2YA0A 2HT3D 3ZXAC 2CM6A 3STLB 3LH9A 1AD0A 4Y0GA 5KVFL 3ARGC 4QHLA 4IRJA 3LV3A 1ET7A 1BLIA 1DUZB 4PCSA 2WLMA 4PP1D 5K1VA 3DX6A 2OCFD 2H0FA 1INQB 2H9GA 4U4IA 1SHWA 2OW6A 1WHPA 4P5TD 3U4BL 1P1ZB 3DGGB 3GSXB 4X6DB 3QNXB 1UA3A 3PWLB 2CKNA 3B7YA 3BQUA 1DLFH 4NNPH 4QHKJ 5GZOA 3FFCA 2VKXA 4MAYB 4XBMA 3I9PA 4ZMVA 1GZQB 3VMNA 2OK0L 3VU2A 4CDHA 3HG5A 3MACL 3EH4B 1IGFH 3AQXA 3IAPA 1W2KT 3ETBJ 3IK2A 2IXQB 3T0XA 1KIRA 2AJZB 4FQJH 1LMIA 4IHOA 2KZKA 3O4OB 2CO7B 4LNRB 1KCLA 5DLML 1S7XB 4X7EC 4LU5H 4P2OA 3QFJB 3O0RH 5L8LB 1XTMA 1G7HA 5KBNC 3IFLL 4QXTB 4IDJH 5HGBB 1MFDH 1DQDH 2LTQC 3H1ZA 2XPGB 4ZUUB 3ZR6A 4YHZL 3EDJA 1JFHA 3HMWH 1GZPA 3VXRB 2BNRA 4EQ3A 1JG9A 1GZHC 2FQFA 3LZFL 3MCLH 4JKPL 4HWBA 4R26H 5IVZA 3SKOA 4L23A 2CLZA 5BCAA 3ZHKA 1SYVB 5D7LA 2N1TE 1GIGH 4PJ5E 5MHSE 3APMA 1MW0A 1Y18A 1S78D 2AMGA 2XTLA 3AADB 5GRJH 4I4WB 2W80C 3VH8A 2W9DL 4Y1SA 2C1PA 1O7VA 4QRPE 1EHLL 4R2GC 1M56B 3HW7A 3B7TA 3C60A 3MU3A 3FO2B 1TETL 3FQRB 4UB0L 5L4IA 1CMOA 2AAAA 3ZLQC 4G5AA 3RY5A 5B3JE 1M3JA 1THCA 1ZSDA 2CJ3A 4YHKL 5F21B 5IT2L 2YQ2A 4AJVA 1DL7L 2ZYRA 3L5XH 1T0MB 2Y6SC 1KENL 1VACA 3D3VE 5TK4A 4KRMB 2YSTA 2FBJL 1WWWX 3QRLA 4Y2DA 3X3GH 3L3JA 1UEMA 4N8VG 3NGBB 4FLSA 4ZMXA 2B59A 3FQTB 4BM7A 2G4GA 4E9SA 5SX5K 5BUAA 1R5WA 2EECA 4P5MA 3HR5A 2OTWB 3OG6B 1R34A 1WRFA 3MRDB 1FG9C 1IAOA 1J1OL 3CSTA 4AJ0A 1KG0B 5HDBE 1QFOA 1WIPA 2GJRA 2O30A 3FHAA 4UV7H 4QXVA 1AGDA 3RJQB 3R4RA 3N2JA 2VSKB 2UY6A 4ETQA 4YDMA 3DK0A 4J3TA 5IHBA 5HD8C 1DDTA 5CILL 3RL1B 3L6FB 3UBFA 2GT9A 5E5UB 4XVOA 2APXA 1BZ9B 3CHRA 3T6VA 5SV3A 4E5XG 3QSKB 2VMFA 1NCAH 2YD0A 3ABZA 3PGDB 1PKQA 1I9RH 1DZBA 1ZT1A 3VFNB 3RKDC 3VXOB 1ETJA 4PJIE 4URKA 3V8CA 4V33A 2RJMA 4YDLB 1DBAL 4F8LA 4L37B 2V5RA 4K71C 3HMXH 1KYUA 4LCUA 1I1RA 1OALA 1G1YA 5C0CA 2VE6B 1UXSA 1W0VB 5T1DL 4Z7IA 5AW7B 2RB8A 3UJTL 2EC8A 4QNPE 3MRQA 4I3RH 2YARA 3MKGA 4PRHE 3S4SB 4GQ9H 3BWSA 1XH2A 2PXYC 5KSUB 3I2CH 3DPDA 1ED3B 5JR1L 1EAPB 1HU8A 2Q8BL 5JZ7D 2DIBA 2FJGB 2NXZC 4ODVL 4UYQA 3R06B 2X41A 5TTRA 2V7NA 3GXPA 2UVEA 5AZ2L 1UZ6E 5A3IC 5KVEH 2F19L 1JZ2A 5E94A 5IVXA 3TWCL 1MVUB 4F2FA 1EJ8A 3TYFB 2ENJA 5I6XB 4I0KA 1X4YA 3HHRB 3OC5A 2VWEC 4G8FA 4UQ2B 3SGEI 1BQHA 2DKUA 1MDAA 1U95B 2VR6A 4XC1L 5D55A 2NXYD 4HWBL 1DQMH 4AQEA 3WUWB 5DZLA 1MFCH 3HN5A 2H26A 4J6RL 1IC7H 3D07A 4Q89A 3CH1A 2BZ7A 5GISH 5I82A 5LGHL 4RLDA 2BSRB 1E4WH 3NZUA 5IJVB 3HS0B 2AABL 3UC2A 5F72S 2VJ0A 5AQ0A 2W07B 4H8UA 5TGBA 3KPPA 4C4KT 1ZHBB 1MLBB 2WC7A 4ONFL 4OSUL 2FJSA 1CQYA 3CCHA 2FCBA 2IAAC 3BGMB 4WK0B 2VITB 2ZKHH 4BKTC 2BSBA 3QQ9C 4PRIA 1NGZB 1YN7A 4GAAA 3F84A 3N9GL 3FO0H 2R2HA 4G6AC 3CV5A 4P05A 4Q14A 5I8CB 1ZEAL 4FZEH 2GQHA 4J12A 1MW2A 3ZKXB 3HHMA 3FCGA 1OCOB 1HQ4A 4S0TD 4YHOH 2KLSA 4YDJB 4QRFA 3SOTA 4HIHA 5EOCH 4BDVA 3HZ3A 4MHHI 2IAMD 4KHTL 5JOFB 3AG4B 2NX5D 4AVIA 1J1XH 4OZIE 2VR4A 1D2PA 2BS8A 2OI9C 2OLDA 2IG2L 1QZNA 4CJ1A 4WU7A 1KTDA 1YMME 4WDIB 1GHFL 2AV7A 5EUOA 2JB6A 3VGFA 5ENWB 5IVNA 2Q7YA 1EDHA 3O3DB 5E8PB 3HJEA 4QTHB 1QVOB 3CBRA 2Y7QB 1TQVA 3FK3A 4IBVA 2ZXDA 3RUGA 3PAVA 4AEHH 4JFVA 4IM8A 3TWYA 1J5OL 1CTOA 5HHPB 3POCA 4K7PH 4Y4KD 2EDFA 3E38A 2VJ8A 3M7OA 1D5RA 5JW4N 5JPMB 5DHDA 1OKEA 4GEIA 4N1CA 3ULUL 2R4RH 4BZYA 5B8CC 1WP6A 2VIRB 5EWIL 1A7OL 4YK4C 4GYBA 1YEDA 5KZCD 1CFNB 3TBTB 1GY2A 1I7ZA 4APQA 5EZJB 2MQ3A 4KJWC 3JWDH 2WUBH 2JFCA 3ME0B 2JJTA 3KXFA 5GGRB 2DYRB 1FV1A 5IROC 3HZMA 3K1KC 2NSMA 4CN1A 4NO2A 2LAAA 5MP6H 4FG6C 5TDOB 4ODXB 4GAJH 5C0AD 3O11B 3FUDA 2NZ1A 4WFED 5KWYC 1DVSA 3HRZB 4JW3A 4ZPVA 4MQXC 5KS9F 3ZTDC 1UXWA 4ZPTB 4F7CA 4MKTA 1ID2A 4KKCC 3EH3B 3CK0L 3UAAA 2FR4B 5IHWA 3ALWA 1Q9WB 1ZVYA 3SDXE 4M6OH 4JG0L 2J72A 3KWVA 4POYA 3VFPB 4K3HA 2XQYG 1XTLA 3L1EA 5ITBH 2WZ5A 3ROLB 1T7XA 2UZIH 5IB4B 5IB5B 4JL1A 3GC3A 4N2MA 3GUTA 5FLUA 3SCMD 5AYTA 4GRLC 4M7ZB 3DGDA 4KO5A 2CZNA 3V5DB 3TFBA 2CIKB 3HE6B 5EPMB 1YJDH 1RP8A 3KCPA 3OKOA 5HHQA 3FFOA 3F7YA 3BVNA 3TBYA 5AOMA 1IM3B 1A7BA 4NKMB 1I8KB 4O2EB 4Z7UE 5PAZA 1U8QB 5CEZD 2GIYA 1ZT4B 4LPYA 3VB9A 3UADA 4AQAA 5JIDA 4E41D 4ODTH 1KJMB 1B0RB 2YWZA 1Q94A 4QMEA 3ZR5A 4HIIA 5J3HC 3WFCL 5KVGH 1P7KA 1O9ZA 3QR0A 2Z35B 4X8JA 4Z76B 4BCYA 4K3EL 4GAFB 1FYTD 2BMKB 5AG8A 3WV0A 1UT9A 4NQVB 5IQNA 4I18C 3K72A 4K9EL 3IXTA 4ONGH 4HUNB 2GJ6B 5DHVA 5F0MB 5LNGA 2PLTA 4JGNA 1Q90A 3CFKA 4PGCB 3ZTCC 3BN3B 5DVKA 2ICWA 2O5YH 2ZP9A 3MO1A 1UWGH 4Y1AB 2MFNA 3T9WA 4QEGA 5DQJB 1JGVH 1LWJA 3C5JB 4LLUB 5I1KH 4AKPA 1JPFA 5K39B 3NACH 5K9QG 3IT8D 4YDKH 3N0AA 3WD5H 2UY7B 3V7AE 4GI9A 2XG4B 1A6TA 4MBRA 1KN2H 2P3YA 3SPGA 1M7IA 3V52H 1O5PA 4B7IA 5LO7A 1OSPH 3ATFA 4LHQB 3RZCB 3TO4D 3UOAB 1P84J 4JGUA 4MDIA 3TTSA 5CSBA 4BZ2A 3DHMA 2OL3L 1OAUH 1C16B 3KPRB 5KSBA 4MSWB 5I15H 3ARDD 3HOGA 1ZXQA 1C8QA 2IBBA 2AK1H 3EBHA 3KEHA 2W59A 1AQDB 2ZSWA 4UNUA 1DUYB 4L2YA 1DP0A 3P2BA 3BOVA 1VFBB 5DQDH 1OGSA 2F1AA 1FF5A 2G9HB 1WWCA 4ZG1A 3DSFH 4XE5B 2GB2A 5I5RA 4PRPB 3T8XA 1UWEL 2NY3B 3DXAE 4NWUH 5INCB 4CC1A 1SEQL 5DJ0A 2F7IA 2JJSA 3WDHA 3QIBA 3QCTL 2F5AH 1NIFA 4NI3A 4G1MB 2I85A 3UCRA 4M4PA 1GVIA 4WWID 1XGUA 1I3RB 5EU6D 2L0DA 2H3XC 2HH0L 4OF6A 1M7UA 1E27A 3VRJB 1JDDA 3A6OA 4C4UA 2WO2B 1L6ZA 4LSPH 2K3TA 1CU4L 1IAIH 3I6GB 3GI9H 4FE9A 4IKNA 4ORGA 1KY7A 4N1EA 4RDBA 1NGYB 3W9DA 5CINH 4X6CE 1DN0B 4G70B 1A4AA 1ZLDA 3SE4C 4PS3A 3DO7B 4XODA 3G6DL 1Z9SA 2QQKL 4HJ0D 4KTDH 4L29B 4AI7A 2OMNA 4HISA 3TCLA 5JMOC 5KAQG 3K2KA 3VVVA 1ORSB 3NMEA 4F7MA 1KV3A 4I7ZC 5HI4C 1QZ1A 3D33A 3ILEA 2LT9A 2VN6A 4XCCH 1BOYA 1OQOA 3D8MA 2AV1A 1OSYA 3O81A 4JRYD 2JKTM 5C0DB 3ULUF 4FC3E 4WI0B 1S7WA 4G9DA 5D6DA 2WBJC 2J1YA 1E3FA 3PP3H 2LU5A 3IJEB 4K15A 1MI5B 5DZJA 4QJ4B 4KXDA 1NCBL 3GMLA 3PIQB 3V0FA 3GMQB 3WTXA 4PJ9C 2IALB 3A22A 3HEIB 3U36A 4R7VA 1KTCA 4EIGB 5T5NF 1FJ1A 1RUML 2PNDA 5TD4A 2KLTA 3QUXA 5HHOD 3X3FL 2CA3A 3H9SB 5IVXF 5JHLH 3FT0A 3HHSA 3IGFA 1S3KL 1WZLA 3ES6A 2YBRA 4TUOB 1BDYA 1AGFA 3OB0H 3WNNA 1Z0NA 2A6JA 5F7AA 6PCYA 4H88H 2H47C 1FFTB 5BRZE 3UO1H 2Q86B 3KPTA 4QRRA 2YAQA 4EN2A 4WY7L 4JFOA 1WC7A 4CBZA 1X5AA 5JHBA 4N9GA 2CUAA 3UPAA 3T0DA 1L3WA 1AR1D 3AUWB 4FXKA 4BZ2L 5I2IA 5IW6B 1ROCA 4AE1A 4K7FB 2ED9A 4D9QD 2HJFA 1LP9E 1ADQA 3MRHB 1P6WA 4MQ7A 1U8PA 1N3NB 3PDGA 3AREA 3DOHA 2BO0A 1EZVX 2G30A 3HZYB 2MTPA 2QTEA 5D1ZB 4MJIE 4GI6A 1TNNA 3ILDA 4P23B 3UBGA 3MRRA 1CD1B 5I9QC 2YD7A 1OPGL 3KBPA 1RULL 3BKJL 2UZPA 2WCPA 5DVPA 5AVZB 1AGEB 1M1XA 2HT2D 4LSRH 5F7NC 2EILB 3RTQA 2P45B 3S4SG 5CLYA 3TASA 1MAML 2DLHA 4HT1H 1ZV5A 3KYOA 4Z7OF 4F3FB 2XKNA 5CBAB 4XN8A 4C58B 2D7QA 2DQFB 4C59B 5HHMB 5JPNC 2ZAHA 5IB3B 1ZVNA 1MQKL 3LN4A 4F7EB 2P42B 3ETBF 1YQ2A 4TQ8A 3INUH 4OLUH 2X70B 1JZEA 2V2TB 4Z95L 4JO8A 1LD9B 3BH4A 4Z7QE 3WN6A 2E8YA 5EUOF 3PHQA 4LSVL 3QWRA 1ECZA 1BP3B 1BZDA 2C7FA 4OZFH 1IIIA 5DD1L 2OULB 1A9BB 1BAGA 1FC1A 2VDNH 4NKIH 3RUGF 3TU6A 4Y5VC 3SPVA 1PSKL 3MRFA 1E9QA 2FIKB 3L1OL 3WUWG 5EMYA 1AO7D 1CT8A 2K45A 2Z65C 4X80H 4HHAA 1YQVL 1YY9C 3G5YB 4K9JA 1M53A 2R0KL 5EF1A 4FNRA 2BOCB 5DJAA 1SJXA 1P4UA 1IRAY 2X4RA 2BX5A 3NT0A 4RCAA 3S5LB 5E6UB 4YH6A 1HKLL 3KD4A 1MNNA 1GC1H 1Q9LA 2WZAA 2MPAL 3ZGHA 2V5MA 2RAMA 2IWGA 3B5HA 3TTYA 2Q6WA 4ZOCA 3GB7A 4ODUA 3QZMA 4D0CB 2WLLB 3S36L 3N41F 4G9FA 2R1WA 2Q10A 1KIUA 3C8HA 3NIFF 2DQTL 4PJAA 3S96B 4OZGA 3T6XA 3BVWA 3LOWA 4OUUA 4QGTA 2N59A 3D2UA 2YGOA 2J8HA 4DVBA 3IETB 2PTVA 4KPHH 1NIEA 1RIUL 2FX8H 3AGVA 1MQ8A 3N1PC 4DZBB 4L8CB 2WKLA 1A6PA 2OMTA 3LKSB 1PZ3A 4LMQI 5IESL 4ONOA 1D5MB 2NY1C 1B0WA 4NC1C 4WUKL 5I1LB 4HEPG 3IFNH 5DJ2B 5D72L 3HB3C 2BINA 3BDBA 3BFOA 3NFNB 5CN2A 2L8AA 4PY7B 1ADQL 1QTSA 2NZ9D 3EYSH 3MLRH 1F2XK 3T0WA 4YAQA 2YLKA 4DGYH 2R7EA 3DDGA 5A7BA 4N0UB 4L3FA 1JZ5A 1BAFL 3TO2A 4MMZC 4H26A 5DK0A 4I2XA 2AK4D 1U8LA 2Y06L 3UC0L 2MOQA 3NJKA 2AZUA 2WXOA 4TRPH 1ZVSA 2OAAA 4S1QH 2AXFB 2N7BA 4HXAL 5T33L 3V4VB 5DZ9A 1GMEA 3QAZB 4E9YA 3EDEA 3OBAA 4GRWH 5CCJA 1MG3C 3GSOB 2CO4A 2E86A 2I9TB 1NLDL 3LH2H 2NW3A 3O6LH 4HJTA 4DEPC 4JDTH 2YR3A 2D3VA 1W6LA 1Z5LB 3FUHA 5MEND 3G5WA 1VGEL 3AG2B 3WN5C 2KS0A 5DHVH 3QHFL 3ILPB 4AH2A 3IN0A 4WKZA 3KHOA 2VXTL 5BS0B 3ZL4H 1IBHA 1SYSA 2AQ1A 2YAEA 5KSAD 3DNKA 3ZZLA 3M1BB 4XMLL 1U8KB 1RK7A 4H13C 1OP9A 3Q8BA 4B9YA 4AQ1A 1VFAA 3O9WC 4AMXA 5T1LD 1PW3A 5IKCB 5AVTB 1NFIA 4JFED 3CZEA 4NQTA 2VDOL 1PMYA 2DQCH 3H2WA 4MD0A 4EUPB 1JZJA 3MMEB 4TVPL 2XWZA 3ETTA 1MHPL 2J5LC 4EN3A 1E9OA 3B9KB 5J9PB 5F1NB 3O2DL 1Q8MA 1KTJA 4D7PA 1NWOA 3QUKB 5GRXG 4FNPA 4NRZB 1PAMA 3RWFB 1OAXH 3VFRB 1I1YA 4RWYH 3BH8B 4EI5C 3VFUB 2QHRH 1BIIB 2NNAA 3WU1A 3FB5B 1FNAA 1K8IA 1KOAA 3C6EA 1XIWC 4GUPB 5CJQH 4YHNA 3CVBA 2EDBA 5LXVA 3PWJA 3ZQ9A 4Y5XB 2PO6C 4BE5A 2G60L 5BXFB 2ADFL 4CU6A 3KYMB 2H0JA 5FEBA 5J5EA 2GAZA 1NLBL 4JQVC 2LW3A 3PNWA 2EEFA 4I48A 4TNEA 3U4KA 1UCTA 3LNIA 3GSRA 2R51A 3U6RB 25C8H 4OI8A 2YN3A 5LBSH 2X6UA 2Q7NA 1UKTA 1ZVHA 3NRQA 1C7TA 1M7DB 2DM3A 4YDNA 1P5UC 5DR5L 3RVVD 1EFXD 1N64H 4GRMB 4MXWL 5F6HJ 4YHIA 4W9ZA 1UD2A 5AYUH 1HL9A 3DGCR 2NY6B 1VRSA 1QFWL 4KTEL 3RIFF 2GTZA 3ZE2E 2Y7SA 1WAAF 4PLNC 2Z4QA 4GAGH 1BFOA 2XUWA 4XRCA 3VG9C 4ABQA 3S9DB 2C3VA 5FFGA 1N19A 1PD6A 1OGPA 4TQIA 5IGXH 1BGXH 3BVUA 1FNSH 2E9WA 3U83A 4JQIH 5IREA 4L4TE 4F7TB 1CIUA 5SWZE 4AE0A 3OAYH 3G6AB 3J2PA 4KI5F 1KN4H 3BEVB 4JCMA 3WIAA 5J11C 2WWKT 4JM4H 4NENB 1WBXB 3IWVA 2V3FA 3FU7A 3OAZH 4FD0A 4NZTL 4B9CA 3BESR 4BZ1A 4O51B 2VR7A 1Z5HA 1JHLH 1ZANL 1NFDB 3F04A 5C0RL 2XXFA 1DO5A 1QFUL 4DP8X 1SBSL 4M5ZL 1KLFB 1OM9A 1MPAL 2JJWA 3GBDA 4W9KC 3ZKQD 3ECVA 4HMDA 3QORD 1ZLEA 4OF0A 5DZPA 1K2DB 4AEFA 1TJIH 3OKEB 1J18A 2CUIA 3DJSA 4D7BA 4F15B 5FW7A 3E6FA 2IIJA 2BXYA 1WBYB 2Z4TA 4EF3A 4ESKA 5KS9B 3QEQB 1HYSC 4CVZA 2WIMA 2D7TL 3F65A 5JTWA 7CGTA 4OGYL 4XP1L 3CX5J 3W39B 2O5NA 4V2CB 1HSAA 2BVTA 3WELA 3GBNH 2OMUB 1A7PL 4JJ5B 3REVB 4LZKA 3VE0A 3CC5A 5F1OB 2BIMA 5EEXA 4Y9BA 5IMKA 1X7QA 3CZGA 1N5YL 3MRPA 4QHLB 3EDDA 3MRBA 4PREA 4NNYA 3S8GB 4IRJB 3LV3B 3K6SA 1E30A 5I17A 3RVWD 2BVOA 3QDGB 5BZXA 4NQEA 1THAA 3QEHA 1HE7A 1LLAA 5FYKL 4ERSL 2NSXA 5FGBA 3CFQA 1WA2X 1G9MC 4KO6A 3DX6B 1N8OE 2ROYA 4JN1H 5C8JA 4LPCA 2XX0A 4KAQH 3SDAD 3F7VA 3FSVA 3L9EA 1NSNL 3ZDXB 3F05A 4GSXA 4GUCA 4XI5C 1HNFA 1T6VN 4AXWA 5F71A 5K9KA 3BQUB 4CKQA 3FFCB 3O8XA 4LPVA 1CC3A 3CHPA 1RPQA 1WFJA 2WBWB 5JUEH 1FH5H 4NQDD 2C26A 4F8TA 3BP5A 1B4JH 1KIRB 1ZDQA 5IBTL 4IHOB 2ZXGA 3IKKA 1GMIA 5IQ7L 5F7EH 5GZNA 2MCPH 4ODHL 1K8DA 3NN8A 1TJGL 4P2OB 9CGTA 1F1DA 4N5UA 3SJVD 2Z92A 1G7HB 5J12B 5I28A 1XEDA 4GSDH 4PY8I 4AEIL 2XY1A 3QJVB 2IF7A 2JV6A 2EDHA 2HPOA 1GZPB 2BNRB 5FA3A 1G7MB 5IVZB 4TLUA 3SKOB 2BFVH 4F91B 2CLZB 3QJOA 1U3HD 3PJNA 2VQ4A 5T3XL 4UT6A 5D7LB 3GXTA 4L4VA 5GGQH 1Y18B 4UQIM 3U30C 3NJIA 4U1SA 2B2XH 3VH8B 1FZOA 2C1PB 5CD3A 3P11H 4OY9A 2BIQA 2X1OA 4M6ML 4YUEH 3C60B 3SDDD 3DJRA 3P0GB 2JTYA 3TEWA 2WBKA 1MCOH 4U6HA 1CLVA 4PN6A 3CFNA 4XMXA 2ESVE 4K8RC 1SQ2N 2X3AA 1ZSDB 3ZZSA 5A43C 4GO9A 4NZJA 2P5ED 3NEEA 5CHNA 2E7MA 1Z3GH 1VACB 4Y2DB 3I6SA 3S3BB 4ZX5A 3WMPA 1KBKA 1JFQL 4R7LA 1UM4L 3L3JB 4KROB 3U1SH 2FO1A 5PCYA 4XNZB 4FFVD 1DVQA 4XZ4A 1FLRL 2YRZA 3SYAA 2B59B 2NR6D 1RZJC 5C1MB 3AT8A 1KELH 3K91A 1R5WB 4P5MB 3HR5B 5DJCA 1SMOA 5A2LH 4NPJA 1IAOB 1T04A 2D8KA 2BDNL 3OR6A 3VTMA 1AGDB 1X5MA 2DLFH 3PWVA 4LSQL 4CJ0A 2UY6B 1OTUC 3IMSA 4K07A 4Z7NE 4TNVF 4ETQB 4M8UA 4EXKA 3I9GL 2VLKE 2R23A 3ARBC 2X4SA 2GT9B 4OGZA 1CL7I 3NYKA 2WN2A 4MA7L 2K3HA 5GRYA 2D9QB 5ABAA 1TQBC 1XCWA 1XL6A 3GJEA 1PKQB 4JX0A 2J7LA 4MAUH 7FABL 4MYPA 3NPZB 3CFTA 2NY4C 3H4FA 3LPGA 43CAA 4WFGE 1T7VA 3ULUC 1PFCA 3L9RA 4XPAL 5ICXA 5C0CB 1RPUA 3QNFA 1UXSB 3KPSA 1ZA6A 4DK3A 3T3PE 4N20A 1JZHA 1QNZL 5C0BE 3FTSA 4DN4H 3MRQB 2DD8L 4EIBA 1I85C 1RVFH 5I1CH 4FTVD 2WQSA 2XN9D 1NBVH 3BPLB 3B2XA 1JV5A 3QDJD 1H6UA 3KL0A 2XN2A 3Q8FA 1AE6L 3FU6A 3HG3A 3B2PA 4PJCF 1EZVY 5HGHA 4PVNA 5GGVH 4N85A 2AC0A 2A7BA 2V7NB 2O5ZL 4XE0A 4XB3A 4L3EA 4Z8FL 3CPUA 3OLDA 1T7YA 1AKJA 1AY1H 1KFGA 3VG0L 4YX2H 5E94B 4OVVA 3G9VA 4EXPX 4F20A 5IQLA 2XETA 1TPXB 4R8WH 4JO5A 2ZTBA 3HNSH 4YL4A 1ZMYA 4G8FB 1RZKH 1BQHB 3EZ8A 4BFGA 5EIIA 1BXUA 3SZKC 1AIFA 2X5PA 4AQEB 1HT6A 4UT6L 3ULVD 1CDIA 5HHNA 4KKBD 2H26B 4IIQA 4MMXC 3DOSA 5DRWA 1KJ3L 2WQUA 4Q0XH 5EOCJ 1T4WA 2QDWA 3V0JA 1IQDA 2BVQA 5TGBB 3KPPB 1T83A 2IPUK 5GJSL 2PCPA 1S3RA 4PJHE 3WKNA 1RQ5A 3CCHB 3J8F7 5KJRL 3C2AL 3TIEA 4ATWA 2IGFH 4P5SA 5CLZA 3X1EA 1CFVH 1IM9A 5I8KL 4PRIB 5F44A 2RQ8A 2NT1A 3HPLA 1YEHH 1YN7B 3ZK0A 1XBRA 2VAAA 4P2QB 2EDTA 2R2HB 4OIAA 1KCRL 2HVKA 4HULB 3SN6N 2O6EA 4LLYA 5I1HH 4Z7OB 1P7QD 1DBBL 2HTLC 2CMRH 4OLVH 1INDH 1XDTT 1HQ4B 4WUUE 2CK0L 1B4TA 2Y2TA 3EJRA 3RX9A 2PPEA 4HIHB 4JRXE 3E9TA 4BDVB 3MOAL 4K9EC 1RJLA 3BIAX 4WI9A 5EO1A 3OWEA 5I0ZA 5ISZD 4BQCA 4Y4HD 4JM2F 4HS3A 4WU7B 4XNXL 1KTDB 1J1PH 2Q76A 1EEYA 2HFGL 4U0RC 2AV7B 2NT0A 5EUOB 4PJGE 1HJBC 2XA8L 1V05A 1BX2A 2Q7YB 3DETC 1D5BA 1RIVL 3IE9A 4JLRA 5EZOL 2EAEA 3ZIYA 4WQOA 1A6WL 3RUGB 3WFBL 4Y19A 5F8RC 1QBMH 2M2DA 2H32H 2CU9A 1AHWC 4JFHE 4NO0A 1YPZA 2QPFA 2AXGB 5E8DH 5FUZL 5J7CC 5I1AA 1YEGL 4LL9A 1CCZA 1XFPA 2WQVA 3DIDA 5E9DD 1S7SA 2K4AA 2CO6A 2E56A 4PLKD 1W80A 4PBVC 1NOLA 3H55A 1QLEB 3PQYE 1O9VA 4P9ML 4A7VA 4ZFFA 1KYOJ 4ADIA 2XXCB 1YEDB 2X1PA 4YBLC 3AFLA 1I7ZB 2AJSH 4MD5A 4APQB 4D9RE 4V1DD 1T80A 3NIFB 1QPXA 3NH7H 3W11D 1B88A 1OHQA 4OCRH 3CVIH 4W6XB 1J12A 3MV8A 3KXFB 5L88L 3CFUA 2WVVA 2ZNWA 4LLDA 1FV1B 1GS7A 1X6NA 4WFHE 3NCBB 4NO2B 4W9HC 2Z8RA 3QUYC 4J3XA 2AS5M 1N18A 3MV9E 1J88A 1I1CA 4F24A 4U3SA 2ZXAA 1MVFA 4ZPVB 3HMXA 4UQ9A 2LABA 1UXWB 4F7CB 4MNHA 3JV5A 4NNPL 1H3GA 1N7MH 4PH8A 3P4OA 1CD0A 2LOEA 4X6BA 1IEAA 2JKWA 4I1NB 1IGFL 3QZWG 1TYRA 3Q8AA 2CLRA 1DQJA 2KT6A 3K4AA 4NN7B 2DWEB 5HYJD 3MV7A 3BRFA 3K0YA 1KXQE 4LU5L 3GUTB 1EMTL 3FQUB 2WPGA 3O0RL 3T0EE 1NGQL 3ZTNH 4F2MA 3B1UA 4ZOEA 1WCBA 3L4WA 1CDCA 1MNUH 3KCPB 5HHQB 1MFDL 3F7YB 4R96A 1DQDL 1MCQA 3BVNB 5HDWA 2RACA 2VDRH 3U2IA 2X28A 1MRFH 3LHPH 4FYTA 3VI3A 1WWAX 3HMWL 1NCCH 3QFJD 4R26L 3MCLL 4AW7A 1FFPA 5FC9A 4AQAB 3SEPA 3LQZA 1XZWA 3MRMA 4I9WD 4ZBJA 3VD5A 1GIGL 5E6IC 4XNMA 1Q94B 2KBGA 4HIIB 1XF3A 3LNGA 2VLJE 5GGUA 1MHHB 1M4KA 4XNDA 4X8JB 5GRJL 2JKXA 3WE6A 2Y2WA 4GSRA 4IRSA 3RVXC 3VXRD 1YEFH 3Q0HA 3LCYA 3IU3A 5ID0A 1NBZA 1QYGL 3K72B 4XAKE 3IXTB 4UNVA 2EEAA 3BWAA 5DHVB 8FABA 3CFKB 2ITEA 3L7FA 3H2PA 3QJHA 4W9JC 3ZL2A 2ICWB 3CU7A 5DHYA 3MO1B 5KYWA 2ADYA 1J5HA 4AC4A 3FB7A 1MCNA 3X3GL 4MGXA 4GP4B 3VFGH 3RB5A 1MFBH 3D51A 2XACC 2YN5A 5D7SL 4OJFH 1A6TB 2EYSA 2YUWA 4R2GD 3NA4A 4FHJA 3V7MA 3FH5A 4MDIB 4NQSB 1AGBB 5AOJA 3QXTA 1KYOK 5KSBB 1XMWA 2HB0A 2CJTA 4PFEA 5BRQA 1TLKA 3ECWA 2ZSWB 4J1UA 2Y6SD 3RA7H 3OWRA 1G7QA 2EC9U 5D93B 2JJSC 1ILUA 2EIDA 4ZFOB 3MNZA 4N8UA 2BVUA 5EV7A 1I9RL 2QQQA 3T8XB 4RMBA 4ABUA 5G2NA 5DJ0B 2AJYH 3MLUL 3QIBB 2NCMA 4DPAX 3HMXL 3HTLX 4EKXA 5LN4A 4K5LA 4DKTA 1SXBA 1XGUB 1A1OA 5JOEA 3ZRCC 5HD8D 1M2OA 1E27B 4GQ9L 1ESOA 3MLXH 3T2PA 1RKRA 3L3OC 4U49A 1HCZA 1DEDA 1HTYA 3FTUA 4B97A 2YJLA 5DJZA 3RKDD 3GXDA 1GKEA 5G4MA 4RZCA 3FHQA 4PJ5A 4XVSH 4KZ0A 2NTSP 5JIQA 3F7LA 4QCIA 4UINL 1RJZA 1Y1UA 3BPOB 5KVEL 4QRPA 3IU4H 1HXKA 3U7WH 1QFHA 2FDBP 4JR9H 3QQ4A 4YFLF 2PXYD 3TCLB 3IGLA 1Z9LA 4HCIA 3LXCA 5J1SC 2GJZA 1WDAA 4F7MB 4XBEH 5D2NE 5EBMA 2NXZD 4RMTA 1DQML 5D7EA 2AV1B 1F42A 1IBDA 1MFCL 3D3VA 2PP8A 2OZ4A 4EI6A 4EDWH 1E4XI 4HSAC 5A3ID 1S7WB 2XRAL 5GISL 1X5ZA 2OP4H 4G9DB 3D39D 1WO2A 2H4EA 4PRNA 1L6XA 2EH7L 1GJWA 3W56A 4PJ8C 4MJ2A 3GMLB 4YFEA 3DRQA 1CG9A 5I73C 3U36B 2PPFA 1FJ1B 3PWNA 3OL2A 3QUXB 5A2AA 2CG9X 2ZXQA 2HWZH 2ZKHL 3CZUB 3HHSB 3GDBA 5F89A 4MJ5A 3UTPD 3F8UB 1G7IA 2UZXA 4YLQT 3ES6B 2YBRB 3QFGA 4IKJA 3FO0L 1AGFB 4HWEH 1SDDA 3BGFC 4FZEL 4ZTPH 3CMOH 1BZEA 2ADJA 3KHQA 3MA7A 4PJIA 4QRRB 3NG5A 3QEUA 4JFOB 4P46A 2EYRA 1WC7B 2ATKA 1AYRA 4N9GB 2KZ1B 5AFAA 4FXKB 5I2IB 2IH9A 3QPQC 1DJHA 3EJJX 1IT9H 2QKIC 4YBQC 2HJFB 1J1XL 4MQ7B 4FMKA 1U8PB 4PRHA 3VGGA 2WJ7A 3ZSSA 3NFSH 4KK5C 5HBBA 3AREB 2VO5A 4NBZB 4N2HA 4PM1A 1KJVA 1URLA 3AS1A 2C9RA 5IFHH 1JAEA 1FAKT 1TZIA 2WLHA 3M6DA 3MRRB 5DFAA 2GY7B 4LP8A 1DQKA 3UABA 1M1XB 2EICA 1MXDA 4DJMA 3RTQB 4K7PL 1ZWIA 3AQDA 4HD9A 3KYOB 5D7JA 5AYQA 1KDIA 1S7VA 2CR0A 5F7HA 2VN3A 2Y3AA 2R4RL 1RHFA 4LPWA 4HGWA 3FCBA 2K0RA 4KHXH 5I6PA 4MB4A 3LN4B 3LQAH 4B9GA 4DKEH 3WEMA 4OLEA 3PP3K 1JVLA 5T5NG 4OJEH 3HCVA 2L7JA 1HINH 2UYLA 3NSYA 1FA4A 3PHQB 3K80A 1B3IA 5I1DA 1A21A 1GY1A 1VB9A 3CFEA 1MCWM 2F74A 4GFXA 3SPVB 5MP6L 3MRFB 4X7TA 2VXVH 4NGHH 1E9QB 5BZZA 5HVHB 5IHUH 1YPZF 1CT8B 4HHAB 2Y69B 1U8IA 2NY0B 5C08D 4M29A 5BQ7A 3LKNA 3A4FA 2ERJB 5G55A 2QPSA 5EEVA 2X88A 5E2TH 2OZ4L 2X4RB 3H7BA 1NIBA 3SE8H 1AANA 4YZFF 1JIBA 4MXVF 4KJWD 3BWUF 3NSCA 4A7SA 1NC4D 1NANI 1Q9LB 2FD6H 4M6OL 1QR1A 2FVNA 1BF2A 4XCYA 5C7XL 2M83A 2Q6WB 3GB7B 1YEWA 4BWTA 4G9FB 2R1WB 1KIUB 4ANXA 5LBGA 4PJAB 4J28A 4OZGB 1EZUA 1IGYA 4OUUB 1BYPA 3D2UB 4QPEA 4OZIA 3NDZE 2AKRA 3OSKA 2QFRA 2YD8A 3R1GL 4KKCD 3U79A 1YMMA 1WPCA 4HC1A 3D12B 1D5XA 1MJ8L 4GAYA 4G11A 2FYYA 4P99A 1HOEA 4HUWA 1IO4C 4IJ3C 3PYCA 4TSBH 1MIMH 2OMTB 1MEXH 2YAHA 1XSKA 3WEOA 4IK7A 3WMSA 3GI8H 3O6KH 2YPLD 1AS8A 2QVMA 3FPXA 3U7AA 2P28B 4FADA 2QZQA 3VM5A 4ODTL 4JHUA 4UOJA 1DSYA 1FDLH 5HPOA 2B8OT 4GRLD 5KVGL 4HALA 1UWXH 4I9XA 4YAQB 5KYNA 4LIQH 2R7EB 4FQ2L 4FDWA 3QJZA 3MCG1 3TO2B 4ONGL 1MJUH 3S88H 4H26B 5DK0B 4I2XB 4J39A 1U8LB 4HBCL 4L8DA 3S3PA 3TH3T 4BELD 1ZVSB 4HMCA 4WWKC 4ZW3A 2O5YL 2XWTA 4L8SC 4ZO8A 5K33A 5T3ZD 3UAJA 1S7RA 1UC6A 1JGVL 1ITCA 4TUJA 2FHCA 5C07D 5I1KL 3NACL 5KBDA 1H0DA 2QSQA 3MLZH 3I3EA 2DYPA 2ITDA 1UT2A 1WLHA 2NW3B 3WD5L 3VI3F 4OJDH 2J1KA 1KN2L 2FO4B 4D0DA 3QWQB 4LVNB 3VSVA 4BKLA 5ESAA 1SLXA 4X4ME 4Q6KA 4F57H 1SLVA 3GUFA 4AQOA 2ZPKL 4NUJB 4AH2B 3KZ8A 1B2YA 1NPJA 3CQQA 4WKZB 3TF4A 1WCQA 4ZXBA 1NCWH 2APTA 4WV1C 1SYSB 3ARRA 3SDXA 1S9WA 4PLOB 2CAKA 4DQAA 4YDIH 4KUCD 1JDAA 5C0AE 1VFAB 2P48B 3FH7A 3JV4A 4HUXB 1NM4A 3WAKA 4AQ1B 4B9IA 4FFTA 5DMGD 1J9TA 1F5WA 4NWUL 4CSPA 1KSRA 1E8YA 4PGZA 3BAEL 3WXVH 4QR7A 4EN3B 4IOSD 4UYPA 1E9OB 1AQKH 1G4MA 1FVDA 2ZCLH 3K2MC 3SSGA 3WENA 3WTVA 3OPZL 3MOBL 1CFMA 4FX5A 5T5FA 8PAZA 1QEWA 5FOBA 1BHGA 2QADB 4AUJA 4G6MH 3GI9L 1I1YB 4W93A 4Z7UA 2O72A 2VQ1A 4UUJA 2AF2A 2NNAB 2BSTA 3EJZC 4HUKB 3SQRA 4P2YA 4YHNB 2WANA 2HFTA 1JTTA 5DZAA 3F12A 3TCXA 3PWJB 4FQIH 2DH3A 4QLWA 3HKFA 1DSWA 1OV8A 3ZTJG 3KLDA 2N7SA 2X4TA 3N40P 4GMSH 4HC1L 4MBOA 5FCUH 2D7PA 2GAZB 1CICA 3I02A 1H19A 3PNWB 4I48B 1X7SA 3MRJA 3GSRB 4NOBA 3LRKA 1UXLA 4BQ8A 1JGEA 5EEUA 3E0GA 4RGMB 4E41E 4P5RA 2V7HA 4XCCL 2OFQA 1I3GH 1O6SB 3F6IA 4O5LL 4RGNB 1KGJA 1KY6A 2ARWA 2OA9A 4G8AC 1ZLSH 1AQHA 4YHIB 1DVFC 1FYTE 1YCSA 1OOAA 4N26A 4J4PC 4M4RA 3E3QC 1TO4A 3C08L 2EIKB 4B5EA 4JM2C 3BN9D 4KXZI 1T3FA 5IF0A 4XMPH 2R8SH 5C92A 3B7UX 5JXED 5ALCH 2Z7YA 5J06A 2RH0A 1N26A 3BD5A 4CN6A 1DQLH 4PG9A 1L9QA 3EZJB 5HI4D 2XCMC 1C5BH 1NA8A 4EI0A 2GTZB 3QXUA 3HI6H 1MCSA 4LVHB 5EBLB 5ANHA 1F6FB 2Z4QB 3AWEA 1BFOB 4XRCB 4I5BA 2G0LA 3S5ZA 2Y07H 3RWIA 3VWJC 2C3VB 2XV2A 1OAYH 2AXWA 4P3WA 5B3JF 4H88L 2V9QA 4C4KO 5I5MA 2E4FA 1OE1A 3H9SD 3DXAA 4P49A 1CGTA 4JRFA 4UQCA 3F6JA 5IHZA 1LDPH 1JZGA 5A6IA 3QXVA 1SLUA 4ISVA 3T4AC 4BKSC 1DCLA 1U93A 3RAJH 3FU7B 2PN5A 1KBVA 1OY3B 1SDYA 3S2CA 2B5IC 4GW5A 1NC2A 5HDBF 1E65A 4K94C 2EYTA 4JRWA 1A5FH 4X6CA 5DUML 2YUXA 2FK9A 4ACTA 2GC7C 1X5IA 4M1GL 4N2EA 1IL1A 5EU6E 1E7VA 3VXTA 5D1ZD 4LOVA 1E6JH 1KB5B 1J8HE 1T6WA 4HT1L 4AUUA 4LQFH 1B90A 2FT7A 5T5FL 2VERN 5BMFH 5FIEA 1FYHB 3E6FB 3V10A 5J6HA 2DIAA 7TAAA 1E4KC 1TF4A 1CE1H 1KCKA 2XY2A 4LSTL 4IQHA 3INUL 5C7ZA 1HSAB 2HA1A 4HK3J 4OLUL 4QNPF 3VE0B 3CC5B 1B4LA 4N24A 1M6UA 1X7QB 2X9YA 4FQXA 3MRPB 1ZOXA 1R5IA 2E74C 2YOCA 2CHXA 4HFUH 3MRBB 4PREB 4NNYB 2X4OA 5I17B 5JQ6H 4F37F 3QNYA 2BVOB 3K6SB 1BVKA 3D4YA 3QEHB 4NQEB 2DMCA 3NEOA 4CSZA 5DS2A 4DPBX 5D6CA 5C3LD 1U8JA 1KPVB 2VJXA 1UZ6F 2MCMA 2ZX8A 3T04D 3Q5OA 4W6WB 4JRYE 3RFZC 2Z8VC 3GHEH 4QHNA 3F7VB 3BCDA 3BUIA 3X13A 1CLOL 3FPYA 4XB8A 3F58H 3ZHFA 1P0SE 5K9KB 1GC1L 2MKWA 4XBGA 5BRZA 3RLSA 4WTZA 3BZEA 2QVIA 1FVEA 4R9HA 5BO1L 2EDRA 3O8XB 5DFTA 3F3HA 1KLGA 1KCWA 4WEEA 4C83A 2VRAA 3ZY7A 1SJHB 4HUCA 3CPLA 4UM8A 5HHOE 2CA4A 5A40E 5AD0A 3BP5B 1YY9D 1LP9A 2WLNA 5D1QE 4GO8A 4M93B 3RVUC 1JF6A 2WYTA 5C6TL 4QRAA 2O6DA 4FNSA 4N22A 5AZUA 3C5XA 1UD4A 1RZFL 3QIWA 2H8PA 2YKLL 3D05A 1K8DB 5CWSA 3NN8B 1TZHA 4MJIA 1ZHNA 2FX8L 1QRND 2JQAA 2ILLA 3CX2A 2Z92B 3V0AC 1AOHA 2D3NA 3ZJAA 3F85A 4U0QB 3VJ6B 3HUJE 3UACA 4X98A 5JQIB 2YZ1A 1CDHA 1PF3A 3G04B 1KB3A 2ZYIA 3IFNL 5FA3B 3VXPA 1VA9A 1ZCRA 4M3JA 4TNGA 1F1GA 5E51A 4AMKH 4NWTH 3MLRL 4LKXA 5BOPA 1SNRA 4L4VB 1QWUA 5ETUA 4DGYL 4OQ1A 1FFRA 1YECL 2E0PA 2XV6B 4U1SB 5GJTH 1FZOB 1UM5H 2KC0A 2WGNB 5CD3B 2V33A 1KCVH 3HLKA 3LAFA 1KYAA 4OZIF 3DTXA 2ENYA 5ADPH 3MCYA 2C9XA 4WK2B 2NY1D 4S1QL 4U6HB 1MFNA 1L3NA 5DMIH 3RGVC 1AJ7H 2GCYA 4WEUD 3WKMH 3GTTA 2JELL 2GSMB 3HB3D 3X17A 4H4NA 1J5CA 1KNOA 2ZZUT 4Y5YB 2YFOA 3OLIA 5CHNB 3BAKA 3LH2L 1FO0A 4JDTL 4LE8A 3EJTA 1F11A 5ANME 1F4XH 3QWNA 5E4EB 1FNLA 1LNUA 5F6IB 1MCIA 3RJOA 4Q7DA 5KSVA 2FSEA 1H3XA 5K9OA 1KDJA 3QRGH 4JHAH 5DJCB 3WFEH 2BP5M 4LOUC 5BS0E 3BRGC 4IOFC 4YHML 1T04B 1T7WA 3W1ZA 2G3XA 4F8NA 3QG6A 1QLFA 3P4MA 1EHNA 3PAZA 3PWVB 4LOEA 2A9NH 1TR7A 5E23A 2R23B 1E6OH 1HILA 3REWA 1CTNA 2X05A 2X4SB 1AO7E 1UUSA 2G4EA 4FQLH 2BHYA 2DQCL 4OD2A 2X44D 4GI8A 3GJEB 3L4XA 5CZVH 2Y1VA 2VM3A 1A3QA 5FDWA 2V6HA 3GTVA 2AMUA 43CAB 1HFUA 3LKPA 4QRTA 3PE9A 1HEJC 3F2LA 4TLSA 5HTSA 4XP6H 5ICXB 4FMVA 1MH5A 2YC1A 3KPSB 1ZA6B 3T3MB 4BA8A 3P73A 5BV7B 5CP3H 1E50A 3O9WD 5E00A 4OLYL 2QHRL 2QVTA 5I0DA 1H15A 3OGOE 1JV5B 1SDAB 4Y4FA 2RCSH 4IBZA 3KE0A 3SDXF 5CJQL 3L3GA 4F27A 3B7RL 3FAWA 1Q72L 3M17A 3WHE1 5HGHB 1TTGA 3IRPX 4OCYH 4L3EB 2XTJB 5CJBA 3GS0A 4H8PA 4PTTA 1EVTC 2VOTA 1AKJB 1CDJA 1JXFA 4QJ5B 1MFMA 1DYZA 4EI5D 1MJ7H 2A4EA 3OF6D 25C8L 2J12B 5ICYA 3DX2A 3H54A 4UT9A 1SXCA 3RY6C 1OF0A 3MC0A 1XIWD 2F8XC 5EIIB 1I1AA 1N64L 1BFVH 1AIFB 2YHGA 1R0AH 4CUCA 5I0XA 1T21A 5HHNB 4IIQB 3AT9A 2XBZA 2OMWA 2AK4E 2E4TA 2IV9A 3MFGB 5DRWB 4FXTA 3P9LA 3MUGA 3WEBA 2DLTA 2KZWA 3I6KA 4QRSA 1DBMH 5ADOH 1OAJA 4AJYV 1IQDB 1WT5A 2WVSA 5BNXD 2PCPB 1OGAE 4G82A 1JCVA 4DTGL 2LU7A 2XZQH 2LVEA 3TIEB 1GRWA 1JBJA 5IGXL 4R4FH 1FNSL 3K2UH 1IM9B 5FV2A 5MENE 1TJHH 2EDMA 3HPLB 1FO0L 2J8UF 3PGCA 1TFPA 1FIEA 1UJ3A 2VAAB 1INEH 2A6DA 2AI0H 2VMEA 5TH2A 5E2VL 2HVKB 3VNZA 3ARUA 3B2UC 1KN4L 4FABH 4HIQA 1UOLA 5D1XC 43C9A 2CWRA 2A9AA 3NCXA 5A2KH 4EQ2A 3M1CA 3SKNB 4JO3H 1NM9A 5DTFA 5EO1B 2ZWZA 1AC0A 1JHLL 1TTFA 3UL4A 4OVUA 4JFEE 4HS3B 3HR6A 2JKSA 2Q76B 1EEYB 3BKCH 4FTDA 3Q2CA 4KUZL 4NBYB 1BX2B 3FTXA 1M42A 1D5BB 1QFPA 2Q9OA 2WQ8A 4JLRB 3HZKA 3N0PB 3LY6A 5I6KA 1MW1A 2BNQD 2FJHA 4Y19B 4PV9A 2PETA 4X7SH 1Z3RA 4NO0B 3F00A 3OSVA 1YPZB 4QKTA 4JFZH 3BWUC 5FGCE 5CUSH 4EDXA 4A55A 5GS2H 5I1AB 4AM0A 3GSUA 1OTSD 2VDMB 1S7SB 2CO6B 3KM1A 5E03A 1IKFH 3GBNL 4NCC1 4ZFFB 5E1HB 2Q3ZA 3VGBA 4WLCA 1IGCL 3QA3A 3MRNA 3DV6A 4W4NA 5AZEH 4BK5A 1VFUA 1TG8A 2LVCA 3FBKA 2OJZH 3QDGE 4MD5B 2C9QA 4X6CF 3KWUA 4F7PA 1X44A 3ARTA 1CLZL 1HYSD 4P57A 3MV8B 2IQ9H 3GEWB 3QQXA 2WVVB 4LLDB 4BJLA 3V4VH 4JN1L 2APVA 4PS7A 4W9CC 4IRJD 4KAQL 2JNZA 1KBWA 1U36A 1NCDH 4U3SB 1KLUA 1NCNA 2QEJA 4KDWA 2J1XA 4GS7B 4MNHB 4FNTA 4L4TA 1U4EA 5SWZA 1T66C 3U6XA 2MCG1 4OM0H 3P4OB 4M62H 1MWAA 5KANI 1R9FA 1BFSA 3NTCH 4X6BB 3D5OF 4LLQA 5E95B 4WK4B 4PGJA 2YPKA 1O7DE 3LYRA 3SPJA 5CF3A 3T6ZA 1B4JL 5L2JA 4G6FB 1NCOA 2CLRB 1DQJB 1A4JA 3PHAA 1XH0A 3MV7B 5E4OA 5F7EL 4KXBA 1RV6X 2MCPL 1ULVA 5D5MF 4PJBF 5SWSD 4QHPA 4AG4H 1E3XA 1WCBB 5LCVH 1F97A 1OLZA 4R96B 5LGKA 4U1GC 4EUPH 3QEGH 2DIEA 2W81C 2D2OA 3H0TA 3VI3B 3D52A 3SGDI 2EE3A 1T1ZA 5FYLD 4R0LC 3RI5F 2W94A 1FFPB 2QLYA 2DQIH 4FG0A 4J3BA 2CDFA 3LQZB 3MRMB 5TE7H 3L9YA 4H1LG 2W91A 3VXUD 4XNMB 4PP1C 5GGQL 1YNKH 1XF3B 5GGUB 4EVNA 3SO3C 3WE6B 1FL5A 2B2XL 2GTQA 2DTSA 4IRSB 1LP9F 1GCYA 1VGKA 3P11L 3IU3B 2XC8A 4YUEL 4F93B 5ID0B 1NBZB 2G2PA 1MCOL 2IH1A 5F6HI 3BWAB 3D0AA 2OX5A 4DKAA 1R3IL 8FABB 5KVFH 3MTXA 3L7FB 3JSSA 3QJHB 4M56A 4JGMA 2DBJA 5DHYB 3ZQWA 1MWOA 3RBGA 5KYWB 5DEJA 3FT4A 3H9YA 1Z3GL 3FB7B 4WW2F 5DUPH 4B41A 2O6CA 1OAKL 5JHDE 4PP2A 2ARJA 1WGVA 3U1SL 1X9LA 4CC4A 2DTML 3S37X 3TZVA 2EYSB 2PKDA 3IFPA 1KELL 1A4KB 3U4BH 2Y5TA 1QABA 1G6VK 4XXCA 3L1FA 4NP9A 5LG1A 2A6KA 4JREC 3GLEA 1BWWA 2H45A 3QO1A 3MODH 4J1UB 3WBDA 2DWYA 1G7QB 4YHYB 2WIIA 3MVSA 1CGUA 4Z7QF 3LIZA 3MACH 1E28B 2Y3NA 1P1VA 2CGRH 1DHKA 4X0NA 3MNZB 3QG7L 3STBA 3TC9A 4MAUL 3PL6A 1KIQA 4WSGA 1EEUA 3MX0A 3ZRSA 3L17A 4ZMZA 4PRDA 3MYZA 2HTKC 4HJJL 1OTUD 3ALXA 3WNJA 1A1OB 3LVEA 4M8RA 4X99A 5C0JA 4OM1L 5E6SB 4AYGA 2Q87A 3ARBD 4DN4L 4N68A 1RVFL 3ZE1F 2X6CA 4YHZH 5I1CL 1NBVL 1P6FA 4JKPH 5EG6C 4MYWB 4XCEA 5EO0B 4B9PA 4ZTOH 3TNMA 1RFDH 2R56L 3JWDC 5DJZB 4EJ1C 1KGWA 2AEWA 2ZUQB 1J0ZA 1WA0X 4RZCB 2NY4D 2KPNA 3ZGIA 1T0PB 1QATA 3ULUD 3X2QB 1UGKA 4QCIB 4ZMYA 1RJZB 1EHLH 1HS6A 2ODIA 4ZD3H 3BX7C 4YX2L 4QRPB 1MY7A 5GS1C 1F4WH 1TETH 2YPVA 2CNYA 4UB0H 3R4DA 5D4JA 5FHAH 5TE4L 3QQ4B 3HNSL 2IOIA 2ESVA 1YA5A 2IDTA 2GJZB 3ZE0E 4LCYA 5IT2H 4BFIA 3IMRA 2IDUA 4MD4A 5EBMB 2DH2A 5IOPA 5AENA 3US9A 1F18A 4YXLH 3CQPA 2VLLA 4LLAA 4UAHA 1I9IL 3D3VB 3L2NA 4EI6B 1VERA 1NKGA 1TNMA 1PLGH 3PFQA 1QNIA 1YYML 5I6OA 4Q0XL 3AXLA 2OBGA 3FB8A 4LKCA 2BWQA 3QQ3A 4PRNB 2VUYA 3HE7A 4TTDC 3DRQB 3RILA 3EOBA 5HDBB 1YJDC 4NIYE 3WNPA 3PWNB 1VENA 3S48A 1KT2A 2VLKA 1NUDA 2G5RA 4KQ3L 3EH5B 1CFVL 4DP9X 4MJ5B 1G7IB 2UZXB 2XQYK 1HC1A 2YQ3A 4P2QE 2BW5A 1HAUA 1SDDB 2DI8A 5KG9A 3FUEA 4KNTA 1SY6A 4H44C 3MRLA 2ADJB 3MA7B 4PJIB 2CMRL 3MRGA 1INDL 3QEUB 4P46B 5GQBA 2ATKB 1W0WA 2ZSVA 4PRID 4NOFA 4XWGH 1XXFC 3MLTA 4XWOC 1ZV2A 5C0BA 1P53A 1FHGA 4PRHB 4LPTA 2Z7ZA 2R2EA 1J1PL 1OANA 3LIZL 3LRGA 1KJVB 2WWKO 1QBLH 2TAAA 1URZA 1TZIB 1MZZA 2HTLD 3L45A 3STZA 4MCYA 1FL6A 3LKOA 2DJ4A 4MKMA 3S8WA 1ZPUA 5AAMC 2B20A 2AGJH 2D7NA 4QT5A 1GGIL 1S7QB 4QLRA 5E8DL 3TWCH 4W4OA 3BP7A 5D7JB 3OV6A 4FTVE 2XN9E 3DYOA 3QDJE 1UACL 4RMQA 1OAZH 4HGWB 3FF7A 4JKMA 3DETD 4ELMF 4HWBH 4B53A 2PTTA 1XCQA 4Y8DC 3LS4L 1KEMH 3HCVB 5KW9L 3PS6A 2AJSL 3NUKA 1IILE 2RHEA 2UYLB 1I9EA 4YSQA 3FN0H 4OCRL 3CVIL 1H5BA 3KEDA 5I1DB 1HHHA 1Y1DA 3C9NA 3CFEB 4NBXB 2F74B 1D9KC 2IOMA 2UUDK 4NSKA 5KJ4A 3TCTA 5I1EL 4PJHA 1ZHKA 1G7PA 1FCGA 1GSKA 1L0PA 1HCYA 1LO5A 4I0PC 1QACA 3ULVE 3C6LA 3VI4E 4OGQC 2XIDA 1N12A 1TITA 3OMIB 3LKNB 5BQ7B 2PABA 1T89C 3T65A 3GGWA 3NCYP 4ZK8A 3FU3A 1N7ML 3H7BB 4TKWA 3V5KB 3GINA 1R4XA 1MZYA 2F53B 2H2PC 2WLJA 1EAOA 3QIUA 1QR1B 4N0FA 3BZ4A 3I6LE 4XCYB 4WUUA 3FU9A 1I7UA 4G43A 4RX4A 4BHUI 3QUYD 5AW2B 3SODB 2WMPA 3UGEA 4JRXA 4KHTH 4P4KC 1RMFH 3E80A 2F0CA 5AW9B 5I19H 1IGYB 1JF5A 5EULV 4OZIB 3B9AA 5EF2A 2AKRB 4KTYA 4HOWA 1U2CA 2A73A 3DJTA 2EVIA 4A66A 3ZE2F 1YMMB 4IDLA 3BUDA 1PX4A 1W72A 1MFAH 1MAJA 1D5XB 2X2IA 4GAYB 4LDLB 1MNUL 1Z1WA 4PJGA 2Z31A 2FYYB 3APDA 3WS3A 4HUWB 1N4XL 3CZFA 3E1ZA 5KYYA 1CPUA 1MRFL 2VAJA 4FF9A 2BRQA 2GBAA 3LHPL 4FI6A 4TQEL 4F8OA 1NCCL 2HYMA 3O6FA 1J5OH 4PJEE 2F7PA 3OLEA 3QHZH 5LGYA 1NUGA 1UUNA 1YYLH 1ZK9A 3CWGA 5ISZE 3P3RA 1N6UA 5K69A 4TTGA 5E2WH 3WO4B 1JD9A 1R17A 3CDFA 4AGLA 4J5VA 3HRPA 4AYBA 3RX7A 3PQYA 4HU2A 4LSSH 1A7OH 5HDLA 3OR7A 3DMMC 5DXWA 1TENA 4L8DB 2EUXA 4LCCC 3VQ2C 4U3XA 4HS6A 2QPUA 4FYSA 1SEBA 2XWTB 2ODHA 2WINA 1S7RB 2LLLA 3EJCA 3TBWA 5DS8A 4TUJB 4NN5C 4P48A 5E9DE 1QSED 3M86A 1H0DB 3BLKA 3LH8A 5DVOA 3EOAA 1PZBA 1QW9A 2DYPB 4JE0A 1MFBL 1GW0A 1MRDH 1U42A 4JG1L 5IMLA 3RVXD 2MSPA 1C7SA 4GBXB 3UDWC 4D0DB 1WAPA 1V8HA 2IANB 1IC1A 3MV9A 4C47A 4L1SA 3T08A 1GGBH 1JVKA 4BKLB 5ESAB 3QNXA 5F93C 2NYYD 1UH3A 2WP3T 4JRLA 3VFWA 3C8KB 4WJ5A 4BSWA 3KG5A 2YS4A 2AXHA 4ZXBB 1UA6L 5FYJH 3V6OC 1M7XA 3RA7L 2FQDA 1IEHA 5E1IA 4QRUA 4JG0H 3UEQA 3SDXB 1S9WB 4XX1G 2CDEA 5SV4A 2X2JA 3RX5A 3RWHA 3AITA 4LGSB 5JORA 5K5YA 3S34L 4UIKH 3TT1H 3CZLA 1HHJA 1RERA 3GMRA 2AJYL 4Q56A 1KXQA 2QSVA 3V2AR 4TYUA 1CXIA 1E42A 3DX4A 4OCLC 4DWHA 5CLWA 3WIHA 3T0EA 2Y1ZA 1FVDB 2X6VA 3PNRB 4PGDA