4P5SA

Structure of reduced w45y mutant of amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTYINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The sole tryptophan of amicyanin enhances its thermal stability but does not influence the electronic properties of the type 1 copper site.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4p5sA00
2GHZA 2WO2B 1IC0A 1OOWA 4N8UA 2HZHA 3ABKB 1GW0A 3WG7B 3NJLA 1M9WA 1NIDA 1WS7A 1AZCA 2MRYA 3JTBA 2N0MA 4KNSA 1KCBA 1KGYE 4BDVB 1PLAA 5B1KA 2XWZA 3ERXA 3NT0A 4YL4A 3IEAA 1MG2C 1PLBA 1BYOA 1GY1A 3OD3A 2YAHA 1L9QA 1JZJA 4KOBA 2JFCA 2UXVA 1MZYA 2BWIA 1WA1X 4A66A 2DWTA 1PAZA 3ABLB 2EILB 2AANA 3S3DB 2PP9A 4A67A 1E5ZA 3QPKA 1ASOA 1M56B 4NAJA 2GBAA 2YARA 2OJ1A 4G7RB 2H3XC 3OMIB 3QQXA 1NIEA 1SJMA 1HAUA 5I26A 2BZCA 3PCYA 1GS7A 1NWPA 2XV0A 3WNJA 2OCCB 4A2GA 1OCCB 1URIA 4E9TA 3SBPA 2VSKB 4F2EA 5I6OA 2EIMB 3TBCA 1N68A 1AANA 7PAZA 4WTQA 3EH3B 3FU7A 4KO9A 3NJMA 1NWOA 2XX1A 2BW5A 1NIBA 2DYRB 2JKWA 4HCFA 1WA2X 1I53A 4YSTA 4AKQA 3H56A 1ZIBA 2B08A 4UF7C 1PCSA 3FQ2A 4E9XA 3X1FA 1J9RA 1NIFA 1XB3A 2XV2A 1IUZA 1NINA 4DP5X 2GI0A 3CG8A 1NZRA 4KO6A 1OCOB 2HX9A 4W9ZA 1GR7A 4YSQA 1RCYA 1ETJA 5I6NA 2YAQA 4GYBA 2FQDA 2EIJB 1SHXA 3CDZA 1NPJA 2R7EA 1ASPA 1AG0A 5EHFA 2W8CA 1SNRA 3PAZA 3T6VA 4PAZA 1YLBB 4YSAA 3ASOB 2X88A 2TSAA 3CVDA 3S3BB 1E5YA 1J9QA 6PAZA 4CSZA 1MDAA 1E30A 1AQ8A 2IH8A 2YAEA 3DTUB 4L0PB 2QPDB 3IN0A 1KDIA 1HAWA 1PNCA 3SQRA 1CUOA 3DIVA 3AZUA 3NP4A 3IBOA 1VLXA 1L9PA 3NJJA 3ABMB 1N70A 2PLTA 1XMEB 3OMNB 2VN3A 1ET7A 5PAZA 4DP4X 2FT6A 2BZ7A 3NJIA 2QPEB 2PPDA 1BQKA 1ZIAA 2IDFA 1NICA 1A4AA 1SFHA 1J9SA 3AG3B 4YSEA 1A65A 1AS7A 1AG6A 1PZBA 5AFAA 4AKOA 1ID2A 1ZPUA 2BHFA 4AI7A 4BWWA 1L9TA 1J5DA 1UATA 4AX3A 4HZ1A 3N2JA 1PLCA 1KBWA 1JZEA 8PAZA 3UADA 4YSCA 1J5CA 1AIZA 2BP8B 3NJHA 5I6PA 3QJRB 1TEGA 2BP0A 2CJ3A 5D4JA 3FQ1A 2VW6A 3S8FB 3PPSA 4TXVB 2A3TA 2AFNA 4YVUA 3BQVA 4E9SA 3NJNA 4E9YA 1EZLA 5B3SB 3CVBA 5I6LA 3NJKA 3PAUA 4K9JA 3AG2B 5F7AA 3FU8A 2YAPA 3H4HA 1OV8A 1AAJA 2QDWA 5ANHA 3V9EA 3FYEB 1E67A 4YSDA 5B1JC 1V55B 3SBRA 4DP2X 2XU9A 2ZOOA 4P5SA 4BWTA 2Q5BA 2FNWA 4F7KA 4X4KA 4HALA 2FQGA 4PCYA 3FU9A 5LDUA 1JVOA 1BXUA 4DP0X 1ASQA 2QDVA 2HRGA 4AZUA 5B1BB 2GIMA 3S3CB 2Y69B 4KNUA 4ZK8A 3ZIYA 1IBZA 1JVLA 3FPXA 2IWKA 2P80D 3KW7A 5FC9A 3NYKA 1X9UA 3FPYA 1PMYA 5D4HA 2IWEA 3OQRA 3FSZA 1ILSA 4QKTA 1OCRB 2IDSA 1TKWA 1ADWA 2AZUA 1L9SA 4CSPA 1GYCA 3EH5B 1EHKB 2DYSB 5I28A 4GP8B 1AS8A 1AR1B 5I6MA 2IAAC 2PCYA 3FSVA 4P5RA 3HEIB 4WKXA 1JZHA 3TU6A 2DY2A 3UGEA 2ZXWB 3X1BA 2PPFA 2ZWNA 1SDDB 4DP7X 3JT2A 5TK4A 4JHVA 1SFDA 3MX0B 3EHBB 3HB3B 2CUAA 4YSSA 5IY5B 3UAAA 5AZUA 2UX7A 4Q8BA 3WIAA 5A7EA 1BAWA 1OF0A 2XUWA 3AY2A 3L45A 1KV7A 4UAHA 3WI9A 1PY0A 4HHGA 3S8GB 3GDCA 2VM3A 4BK5C 2RACA 2YAMA 4GY4A 5D4IA 3FS9A 4A2EA 1AZUA 4A2HA 1WAEA 1SHWA 2Q9OA 2GC4C 4A2FA 2Y1AA 1FA4A 3SBQA 2YXVA 1SF3A 3CZUB 4HCIA 4DPCX 3GXUB 4KO5A 1A4CA 2FQEA 5B7EA 1M57B 2J5WA 4F2FA 2PP7A 1AACA 3MBWB 4HAKA 5PCYA 2PPAA 1JOIA 1BQ5A 1E65A 1OE1A 3ZBMA 1V54B 1CC3A 4GP4B 2XX0A 1QNIA 2BWDA 4G7QB 3C75A 1W6LA 4MFHA 4A2DA 1GSKA 1RKRA 4W1TA 2PP8A 3UACA 2VM4A 3PXLA 3IE9A 3NSFA 1PZCA 3T6WA 5B1JA 4N4YB 3EF4A 4YSUA 5I5JA 1PF3A 5B1AB 2IH9A 1CURA 2WO3B 4AKPA 3TASA 2OV0A 1ET5A 3NSYA 4KNTA 4GP5B 4BXVA 2J57A 1OE2A 3D12B 5I5MA 2R7EB 1OCZB 2YAFA 3FU7B 4E9VA 2BP8A 1BXAA 1GS6X 3CDZB 2PPCA 2YAOA 1HFUA 2NRDA 2YXWA 3OM3B 3QJVB 3X1EA 3X2QB 2QT6A 3PLYA 1BYPA 4DP9X 2FJSA 1JZIA 2GSMB 3NJGA 1DYZA 1DZ0A 2HXAA 1QHQA 4EF3A 2H5UA 1ZDQA 2H47C 4DPAX 5B7MA 1ZV2A 3UABA 1F56A 2XXGA 1T5KA 1W6WA 4M3HA 4G71B 1W8EA 2FWLB 2CALA 2LLNA 2HLEB 3FSAA 2FTAA 5B7FA 1BEXA 2MTAA 4G70B 5F7BA 1A4BA 2I7SA 2P80A 2W88A 1FWXA 2JXMA 2XYBA 3H4FA 3IN2A 4YVNA 1IBYA 2J56A 1AZBA 6PCYA 1V10A 2BO0A 2UXFA 2GC7C 2BP0B 4YSRA 4BXSV 3RYMA 1L9OA 1MZZA 4KO7A 2HX7A 3WKPA 3ZDWA 4JKNA 3FT0A 4BDVA 3NJFA 2IWFA 1JXFA 3QJQB 1GS8A 1JZGA 1KCWA 1JZFA 1NPNA 1NTDA 1XB8A 2VMJA 1TU2A 3ABGA 2XV3A 3FYIB 4NERA 3QJUB 4JHUA 1JXGA 2IDTA 3AG4B 2VW4A 2AVFA 1ILUA 2CBPA 4DP8X 7PCYA 2VW7A 1B3IA 4DP6X 1RZPA 1J9TA 2TSBA 3AG1B 3FQYA 2UXGA 1OE3A 1WS8A 1WA0X 3ASNB 2X87A 1A8ZA 3PAVA 3TBBA 1XB6A 3DKHA 4UANA 3WKQA 2CAKA 1AZNA 3G5WA 4FA7B 3T6XA 2YQBA 4ENZA 2EIKB 2AZAA 2XLLA 5I5IA 2HX8A 2IDQA 5TK2A 4GXFA 4YSOA 4M4RB 1ET8A 3U25A 4G7SB 2DWSA 1RZQA 4HIPA 1IKOP 2CCWA 2I85A 1AZRA 1JXDA 3X1GA 4BWUA 3FSWA 3CVCA 4DPBX 2VSMB 2WSDA 4KOCA 1NIAA 3T6ZA 1ZDSA 3BVDB 1PZAA 1SDDA 3V9CA 4E9RA 1FFTB 3X1NA 4E9WA 4QLWA 1KDJA 3EH4B 5AKRA 3T9WA 2BW4A 3NSDA 3OMAB 1R1CA 3GYRA 3ZX1A 4RH4A 2J55A 3TA4D 2HRHA 1GY2A 2PCFA 2GB2A 1KYAA 1AOZA 4Q89A 3KW8A 2B3IA 2FT8A 3NSCA 4A68A 2ZONA 4DP1X 1KBVA 2XVBA 1A3ZA 2FT7A 2I7OA 2DV6A 1CYWA 1X9RA 5I6KA 4HCGA 1PNDA 4HHWA 2IDUA 9PCYA 1CYXA 5E9NA 4YSPA 1QLEB 1NDTA 2PPEA 3WNIA 2UX6A 1AS6A 4G72B 1SF5A 2EINB 4FAAB 3NP3A 1JERA 2E86A 1BXVA 2FQFA 4E9QA 3AW5A 3QJSB 3T71A 1TEFA 2UXTA 1L9RA 3QJTB 3UAEA 3N55A 1MG3C 2XXFA 4NB7A 1BQRA
chains in the Genus database with same CATH superfamily
5DR5L 3GBLA 4P23D 3HUJE 1IC0A 3U2SB 3KCPB 3DETD 1J1OL 4GSXA 1T7XA 5LCVL 5IB3A 1QPKA 1CU4H 3GB7A 2JJSA 4IRZH 3IK2A 2F5BH 3JZYA 2R29L 2ZOTA 3GTTA 5AVXB 1NFAA 2WY3B 5IMLA 2KT6A 2A4EA 1NUGA 3X17A 4JPIA 1VCAA 2R2HB 3X3GH 1I3UA 4L4VE 1MFEH 1K8DB 5AVYB 3GMPB 1AHWC 4NI3A 1KGIA 4UV4L 4JY6B 3T0EE 2KYIA 3OXSA 4Z3TA 3NCFB 3EYOB 1F3RB 5AAWA 1W8OA 3KXFB 1C16B 3MV8D 3VRLE 3CQPA 1VPOL 1WC7A 3FCBA 4PV1C 1JK9A 4QO1A 3OX8A 4FTVD 4GW4A 3LNHA 1INQB 1SYVB 3ARGA 4JKMA 1UM5L 3HE6A 3BRFA 3BRDA 2XZZA 3V4PH 3GLAA 1HJBC 4NQXB 3ZTCC 3QARA 1JRHL 4PGJA 5C0EA 4LL4A 2X89D 3AS1A 2OMUA 2IPTL 3HI1A 4MDRA 2H8PA 3ESNA 4PGCA 1Y6NR 2A74A 4BH8B 3WGVB 4WAFA 4YIQB 3J8F7 1XCXA 2PW1B 2YMXH 5CINL 3C60D 4Y4KB 4RGMB 4IRSB 2DIEA 3RGVC 1PZ2A 5JXED 1I1CA 4AQEB 1JCKA 4HS8H 1OAZH 5ANMA 2P5WB 2XKUA 4K7PH 3RFZB 1NIBA 2XIBA 5CJOH 4PW3A 1I7RB 3EYFB 4U6YA 3ETSA 3WV0A 1G0XA 3H56A 2G9KA 2FYYA 1T4KA 5A6MA 1LDPH 2XCMC 1YEFH 3B3IA 1RIUH 5CZVH 4WK2B 1NLBL 1RZKH 1ZPLA 4RFOL 3AADB 4S0TD 1X6NA 3TCLB 4A39A 2PYED 5DZJA 3KHOA 4BFOA 2CR3A 2KMWA 3CDZA 4PQXA 1NCCL 3S35X 4XGZB 2R23A 4JDTL 1IGYB 1MLBB 3QAQA 2AEPL 4LAQH 3V52H 2VSCA 4HBQA 4PJIB 4CBPA 4JN1H 4RGNB 2P44B 3ARDD 4X6DF 5K39A 1JHLH 1D2OA 1FFOA 1Y0LB 3QNXA 2EDTA 4M6OH 4AMXA 3MLXH 3N44F 4Y16A 4LXFA 5HHNB 5HDOA 2NNAA 3NACL 4F5CE 2O5XH 3C09B 4M61B 2NCEA 3HC4L 3QJOA 5LBSL 1RURL 1OGSA 2Z91B 3TEZA 5EBWB 3F58H 4LFHD 1IAMA 2WBJD 2WUBH 1CICD 4G8FB 4IRJC 5FKAB 4MSWA 4Q9QH 1IGFH 2DM7A 3REVA 4YHIB 5HHOB 3RHWK 2X0WA 4ZQKA 1NCOA 2AJUH 1IC7L 3CSBA 4PRDA 1BZ9B 3US1A 1F41A 1NKOA 3B9KA 5F1SA 2PPDA 5CKGA 1KJ2B 3SYOA 1DVQA 3M1BA 4Y2LA 2K70A 5IWLA 2ZOLA 4J3BA 2VQ4A 5KVEH 2VB5A 2P43B 3IWVA 2BHFA 4N3TA 1L9TA 2Z8RA 3GHBL 4X6BB 2ORBL 1KJ3H 4UBDC 4LIQE 1TZHB 1UTDA 4PTUB 2X9YA 1KBWA 2WIIA 3EF7A 2F54B 1G7JA 4I1NB 1OSZA 4PJCE 4O00A 4OLXH 5JA8B 1RH8A 3OF6A 2IMNA 3QIUB 1E4XL 4IM8A 4UM8A 4E5XB 1SEBB 3C87A 3DJTA 1HL9A 2HFGH 3MOAH 1ITCA 1Q8MA 1KYOK 1SOQA 3BAJA 4GQPH 4MXQD 3I2CL 4YVUA 3CZGA 4WW1A 5KOVC 2WLJA 5FFLA 3NIGE 4Y5XC 5GXBB 5IW1A 1EZUA 2LLGA 4IK6A 1C9SA 5I0VA 2QELA 3AMKA 3VWJA 4Q2ZA 1OV8A 5A6LA 4OB5H 4GG8B 5I19L 4JFZH 1P53A 1OWRM 2DAVA 4QRQB 1FIGH 3BW9B 4F7MB 1NGWA 4X6EB 1KBBA 1UZ8A 3FUEA 3AT9A 1YG9A 2FGWL 3FU5A 1TQWA 4P2AA 1MIEH 5IBTL 5K69A 1JVOA 3L9RB 2PNDA 1ZHKA 1X7TA 3D69B 4K07A 2HG0A 2WVVB 2NNAB 1V3LA 1XCQB 2K9UA 2X9XA 3IS1X 4UM9A 3NFPB 3CFJB 2GEQA 1HE8A 3EJZC 4ZAKA 4PJ8C 5AKTA 1OD9A 4LL1A 2CIKB 5ESQA 3WN5A 2Q2LA 5BVPL 4F7MA 3WTWA 5DJZA 1MW1A 2OX5B 3PG2A 2NX5E 4MSWB 2W59A 1EQWA 4ODVL 3H53A 4G42A 2Z31A 4FABH 2XZAL 43CAA 4PRDB 1IQDA 2Z65C 3F3HA 2HSIA 1B6UA 1QR1A 2WLZA 5A3IC 3VFVA 1O6TA 1IGIL 1LDSA 2XACC 2VR5A 5E23A 2Y5TB 3RDTB 1LP9B 3HMWL 5IHUH 3FCTA 2X0VA 3AB0B 4H25B 1IT9L 5I30H 1LYQA 1SFDA 1DO6A 4NUPA 3JWOC 1JPTL 1AGFB 5CP3H 1A3RL 5IY5B 2DQ6A 4P23A 1K6QH 3DPBA 4MQ7B 5A7EA 2ED6A 5BUPA 3OLGA 3DURB 3WI9A 1G7JB 2EIEA 3BWAB 3IFNL 3O45A 3LNGA 2VM3A 4S1QL 4XOAA 1J5IA 2N01B 2YSTA 4MWFA 4ZXBC 4S0HA 2IOMA 3Q3GB 4LNVA 4Z7QB 4JW3A 1LP9A 1D3CA 4K0OA 1T3FB 4WI0A 1ACYH 4QYOA 2EXWD 2PP7A 2ICEB 2IH3A 4G6MH 4LVEA 3VFMA 3DPBB 1R5VA 4NM4H 1PAMA 4H0LC 1PQZA 4ZMXA 3JYCA 4JDZA 4AT6A 2CGRL 5E6SB 3ILPB 1KTKE 3C75A 4WFHD 1TJXA 4EVNB 4J4PA 3L1OL 3TFKD 3EFOA 3FQRA 2JKXA 3Q9PA 4HJTA 4N2IA 2AABL 4HJ0D 4G9DA 3EYUH 3WIIH 4S1DD 3NSFA 1QPPA 3L6FB 4NN5B 5B1JA 2E27H 4Y5VC 4XBPA 3Q8AA 3QDME 1FI8C 4HCRH 1Q90A 4PGEA 3OLIA 5E1IA 2HTKC 4GQ9L 4IDJH 4ZXBB 1I7ZB 4FQXB 4PU2A 5GIRA 1HSBA 4KMQA 2GIYA 4NKOA 5B4MC 3BEWA 4URKA 5AENA 3WAJA 2JTDA 2A0LD 3LSOB 4GIAA 2R7EB 2FIKA 2N1KA 3IJEA 4UT9L 5C0NC 5DEZA 4FQCH 1ZGLM 3L9BA 4JG0L 1R3HA 4YHOL 4NQDA 3FFCE 3KWTA 4AW4A 3IFLH 2CCLA 3SE4A 1AXTH 4KVPA 1KGCE 2NX5A 1NJ9A 4ZD3H 5JIPA 4M4PA 4OGAC 1HXYB 1KB5H 2E8ZA 3VE0A 2PCFB 4WKZA 5E4EB 1JBJA 4PJ5A 4KJQC 3T4AC 3BP5A 1W8EA 2E9WA 2VZTA 2AQQA 3VCLA 2DLFL 1IM3A 2IBGA 1FZOA 4HFWB 1AVAA 2VDLB 3GSNL 4R7DB 1AHMA 4LLYB 1JF1A 1YEFL 5DUPH 4WGWB 3QXWA 2V3FA 5C07B 1CLOL 4X6CE 2R2EB 4NO0D 2WXPA 3HNVH 3VMOA 3Q05A 1NUDA 1AIFA 1VAHA 3K3QA 3OAZH 4J3TA 5DJAA 4HQQH 2P8MA 3UH8A 3Q3GA 43C9B 3EUDA 4GRLB 3BCDA 3EAKA 1WHOA 3FCUB 3CVIH 1JV5A 5L9DH 1HOEA 3EFDH 1ZVSB 1MXGA 5F3BB 1U91A 4PHXA 1NPNA 5C0CB 5IG7A 3CDGA 4JQIL 1U8KB 4NQDE 3DV4A 4WI6A 3BAEH 2XPGA 4OF7A 4ODTL 5FUCE 3HZMA 1SXNA 4ZUWB 1RZPA 2F6AA 4P3DA 4BH7A 4CVXB 1WS8A 1FZMA 4AJWA 3GRBA 5LQBH 5CO1A 4NEHB 1X5YA 1ORQB 1Q1JH 4HIHA 4XNMA 3DKHA 2YPKB 4JFFA 5I75B 2ZE0A 3ULUF 1AZNA 1J18A 4JO3L 1FVEB 3GK8L 4WUKH 2QQNL 3UTQA 1TJIH 3OBAA 3UPRA 5KVDH 2HX8A 3NEEA 3ES6B 3BIKA 3O6FA 4FQPA 2GEEA 3TBTB 4KBPA 1E2VA 1RFDH 4RCAA 3GWJA 3QUYD 1WFTA 2ODIA 3L1FA 4GAAA 4HK3J 5E7FA 2BSCA 4Z3HA 3EJQA 1U92B 1XF1A 2P24B 2VLJA 3KBEA 1MFCL 2VN7A 4NSKA 1RLBA 4ORZC 1Z3GL 5TFSH 3X1GA 4UQ3B 2OTUA 1MHPH 1EHNA 4DPBX 1BZEA 4I8DA 3J2PA 1WIUA 5LCVH 4QHKI 4PJ5B 4QEGA 3HCVA 4OFYD 4OIAA 1TCMA 5KYUA 5LO7A 5I17A 3SBWA 4YWGL 3EH4B 4P99A 1WD8A 5B38A 4HFWA 1GJWA 4EI5B 3UBXA 1YEWA 3G6DH 5ICXA 2R0ZH 4NUJB 4P5MB 4A63A 2W9DH 5GGTL 5C9KA 2CWRA 2FO8A 1JF1B 4EUPB 1MW0A 3ARSA 3GUTB 4BFGA 3J07A 4FXKA 1KPUB 2GW5A 2YPLE 5FA4B 3MUGB 3AUVA 1AR2A 4NO3A 2VN6A 1UOLA 1NKRA 2WPGA 1R33A 4RGND 4G8GE 2WKLA 4DP1X 5DO8A 4JFQB 1NAML 3KE0A 2IANA 4NDMB 2FO4A 2WW8A 4HA1A 5AZEH 1JV5B 4O02H 4E42B 3ECBA 3QUYB 1KWKA 3AU1B 3D39D 1QBLL 4CMHB 2ZNXA 3ULVE 3BT2L 5FYLE 1QMUA 4FTVA 2WWMD 4OY9A 4D9LH 1OAQH 1QRNE 2PPEA 3L1EA 1OTUC 3FN3A 1PD1A 4LSDA 3RA7L 2K4AA 1XX9C 2BRRL 2DDQH 1B0IA 4ICWA 1D5IH 5MEOA 3ESUF 5IOPA 4TQHA 3AREA 5KS9B 4HV8A 4F8NA 2WQVA 5B8CB 5L8JB 4ESKA 5IJBC 3HZKB 1XH0A 4K7PL 5DT1H 3BE1L 5AWNH 5HHVH 5KYYB 2OMYB 2AITA 2CKBL 2I69A 4HJGA 4JDVA 1OF2B 3NCCB 1LO4H 4NQQA 2H1LM 5DD6B 3D85A 4ZTOH 2AK4D 4LDCA 4MQTB 5E7BA 2Y0SA 1AZZC 3CLEH 4N6QA 4G1EA 1FFPA 4IJTA 2K7PA 3NPZB 2YGVA 3KWVA 2OA9A 1J5OH 3WLWC 4JY5H 2QPSA 3K72B 2ZOKB 4RGNC 4JRLA 1RP9A 4FFZH 4QRRD 4KNSA 4BDVB 4D2NA 4W9KC 3IMRA 4WFED 3MBEC 3RZCC 4X7TB 2RB8A 4Z76B 2OTUB 4M7ZB 3AXHA 2BWIA 1WA1X 2OMZB 4TSAH 3BKCH 4MXQC 4IGBB 5CHNA 3QG7L 4YBLB 3ABLB 1WBYA 5D1XA 4A67A 2PP9A 3LXUX 4RETB 1E5ZA 4ELMB 5I17B 4O2FA 3EKCA 5D7LD 2OJ1A 2DMBA 4MMXB 4O58L 3VFNA 5CF3A 3GPEA 3V9FA 3VQMA 4HLEA 3C5JA 4N6RB 5HGBB 3M1CA 4OD3L 1RXLA 1ADQH 4GAYB 2CDEA 1QP1A 1AI1L 1H6UA 4QT5A 5DVMA 5FK9B 5FYKH 1YYMH 5B39A 1S7TA 4RGOL 4WTWA 2BMKB 4MCNA 1G7LB 3ATAA 1IAOA 1N67A 2DW5A 3RUGA 3WIIL 4CGUB 4E9TA 3F12A 4U1KB 2EE3A 5TDPA 3V5KA 3SDYL 3W0WA 4MNQA 3DX9A 3P02A 4KO9A 2NOYA 2Y7LA 4IOSA 5JR1L 3FT4B 3F5WA 2YMXL 4WK4B 4M5YL 3MJ7A 2B08A 5KN5A 2A9BA 5I1DB 1E4WL 1SXAA 4IKKA 3OAWA 4O4YL 1AO7D 5GRJL 5MEPA 1KN2H 3QUZA 4FQCL 5HDRA 2EDKA 1TDQA 1KCSL 2NXZD 2QJDA 5FX3A 5KS9A 5T5FA 2EIJB 4IKNA 3W2DL 1M7IB 4RAUB 4X98A 4Y5YA 5GGSY 3TZVD 1TZIA 5LBSH 5E4AA 2XWCA 5CFHA 3AGVA 2H1XA 1KB5L 4KK9C 3RY5A 4HAGA 2GAZA 4PRBA 5KBNC 4KV5E 4YEEA 3O2VL 1E7VA 2RCSL 4PRIA 4AMWA 2AJSH 2G9HB 3QO1B 3BDBA 2OMWB 2VYRE 5C0BA 2KL6A 2ZX7A 3BN3B 2YAEA 5E2JA 2VLRB 5I1EH 3QUXB 5EBMB 1KGUA 3FT1A 4FQLH 3HBZA 2EEDA 4LCUB 1CD1B 1X5MA 2YRPA 5ID1B 2F2HA 3EOBA 2PXYA 5KVEL 3VD4A 4N8VA 2W65B 1C7SA 4ZFZB 3X12A 3GHBH 1HYSD 2VLME 1EEQA 1JGEA 3LIZA 2J72A 1ZHKB 3D69A 2FT6A 4GQZA 3VDCA 2LU7A 3UJIH 2IDFA 4OUOA 3D2UA 1FNEA 4YK4C 3AG3B 4OLXL 4BV1A 1G1CA 1MW2A 4PB9H 1HCFX 1QBMH 2K0RA 1ID2A 1IGFL 5BRQA 4AKOA 5J56B 1H9DA 1RUKH 4AX3A 1J05A 1LO0H 3VYPA 3QRBA 4LSTH 4P9ML 5FK9A 3QWOA 3L4UA 2J3SA 1ZTXL 4UTBL 4KRNA 2UUDH 1JGEB 5IHBA 3NCJH 4KH2A 1P9MA 2L4OA 1P1ZA 3SDXA 3AQDA 4FA6A 4LCYB 4PRAA 4DW2H 1QSFD 2J6EH 5I19H 3H7LA 4ODSL 2A3TA 2AFNA 3EYSH 1F6LL 2D7PA 1KPRA 3HMXA 4CVZA 5CEYA 4BSVA 1FV1B 2DJ4A 3U7YL 1RZGB 5D72L 2GPZA 5DRWA 1VZIA 4EQ3A 4Z5RB 4G59C 3PV6A 1X7SA 4QHMB 2CRYA 3M17A 4XCNB 3L2NA 3SBRA 1EAOA 4DSYA 2FNWA 5E2TH 2A6KB 5L4FA 3QZWG 1S9XB 3K6SB 1NMBH 2DIBA 5DDHA 4DHLA 1OP4A 2IFFH 5C8JA 5DK3A 3R19A 4J8RA 4OFKA 5BJTA 5C08B 2C9AA 1AKJD 3QHFH 3CUPB 4JFPB 2DQDL 2I26N 3ENEA 4H44C 4NN6B 3WYRA 1PQZB 2NZ9D 3DYPA 3KW7A 2DRUA 1QSEE 4N1CA 4FABL 5C09B 1PMYA 5GZOD 2IWEA 1RUMH 5GRVL 1JGDA 3VGHA 2Y6SD 2HVBA 3HA0A 3O3DB 2F8IA 1ADWA 2VDPH 1L9SA 1PDKA 4MS8D 4Q0XH 1SXSA 4XODA 2YUWA 3U1SL 3UP1A 4YDIH 4DUXA 4L4VB 5FLUA 3T2QA 1EGJH 3FTGB 3B9KB 1I8MA 2Z31B 1H8SA 2BSTB 1E42A 1N6VA 1S9WB 3H2PA 2EDEA 2XPZA 4AWJC 2E7CA 1JZ8A 3LKOA 4FXGA 1MF2H 1XL4A 3MRRA 3A3YB 2CIIA 5INCB 1P7QD 1VFMA 1S9YB 1CQKA 3BVXA 3BC9A 1V7NH 1PZ5A 4JUSA 1I9JL 4IKJA 2XFXB 2WKGA 4QHLB 2PO6B 3KHQA 4L1SA 4Z18A 4AQ1C 2JKNA 3QQ4A 1N59A 3K71B 1RHFA 1AD0B 3S8GB 5F9JB 2YIHA 3JTSA 5DQ9A 4KI1A 1YMMA 5GGUA 1M6UA 1V8HA 2HUEA 4L8SB 2QVKA 2WNGA 4JGMA 4PRAB 3TWYA 3NZ8A 2YXVA 1U2HA 4UT9A 5FOBA 5C09D 3SGKA 4DPCX 5KUMA 3UOAB 2GITB 4LQFL 2WOYA 5TE7L 1AACA 3GI8H 2PPAA 1OP9A 1RJYA 2NY1C 3DV6B 3MRIB 4RVBA 3PWPA 4ZTOL 3LH8A 2BCMA 4Q2ZB 4DGVH 4M1DL 4L1LA 1XH2A 3JXAA 2QGDA 3O3BB 3FQXA 4N24A 1NOLA 2KZBA 3I75A 4R5VA 3MRNB 1UUSA 5K5YA 4MA1C 2EACA 1MCJA 3CMGA 3L7FB 2VO8A 4PWHA 1NC4A 2ZXGA 1X5GA 3MKGA 4HIEA 2AXWA 4OH2A 3T6WA 3D08A 3EFDL 2VWEC 2YJLA 4NZTL 2C7UB 5T33H 2Q3AA 2O6EA 4M7JH 4EI5D 3UTTE 3L1OH 4U3XA 3VNZA 1Z32X 3U0WL 2WZ5A 5DZ9A 3VGFA 4ONHA 3EYUL 4MNQD 1UWEH 4YDLB 3Q06A 5F88A 2EAEA 3QIUA 3NVQA 5ESAB 1VFAA 3L3OB 2PMZA 1HZLA 2ZF8A 1UA7A 3AT0A 3LN5B 5C0GB 4L5FH 2MH4A 3QJVB 3SOBL 4Z7UE 5FYKL 4MLSA 5DS2A 2OKMA 1YHPA 5K1JA 5J57B 4FFTA 3VG0H 1BD2E 3JWDC 2G2PA 2BCKA 4TUOA 2LGNA 2H47C 1WFMA 4DPAX 4Y4HD 1U2CA 4LASL 2XZQH 2VAJA 2XXGA 1IE4A 4Y2DC 5H35B 2O30A 3ZT5A 1FDLL 1KTLA 5LGHL 2OZ4H 2GKIA 2JLPA 3QIWD 4OGXH 3TBTA 2W38A 3TO4D 1FVDA 4KKZA 1LEIA 4JKPL 4WCYH 1MSPA 4FNUA 3PQYB 3WHE0 3KVQA 1FNAA 1G7MB 3REVB 2HAZA 3MRDB 5D70L 4HKZA 1NMCC 1DBBL 3BGFC 3I50L 4D0DB 1SXBA 1T5XA 1NKGA 4NFDA 1ONQB 2UXFA 3CFBA 4QAWA 1HYRC 3G7TA 4AH2A 2HX7A 1B6DA 1RZIA 2AK4B 3UZEA 1JXFA 4UQAA 2R69H 3QJQB 4ZMQA 1JZGA 1CLCA 1EWHA 1GS8A 5FHAH 3U0TB 1GGUA 3OXRA 4MA8L 3QPXL 5F0LB 2OXGB 1B0RA 5GGTH 2B0SH 2BSDA 2HJLA 4POYA 2ITCA 5C7XH 5LGJA 5KJRH 4PREA 5HI5D 2XKNA 4E68A 1BCIA 5HYSA 8CGTA 5I9QB 3W57A 3W39B 1JPGB 4H8WC 3QO0A 3UZVA 3CSYB 4GSRA 4WU7A 1OE3A 1UHVA 1HCYA 2Y5TA 3LZLA 4KKAC 1WA0X 3GSRB 3LKSA 4N9OB 4NO2B 4OGYH 3RDTA 3VRJA 3QEQE 2NXYB 1Z1WA 5LBVA 1ORQA 4M93C 1B0RB 4UT7H 2Z64C 5C6TL 1EBPA 3SKMB 3U48A 5MP6L 2VISA 3SGEH 4L9LC 1Y18B 5I5IA 1D5BA 3AM8C 3NCXA 1KY6A 2Z31C 1OP3H 5AAMC 3VD9A 4QI3A 5FYLH 1NFDE 1P0SE 2R0WH 2VC2B 3BDYH 3CXDL 3FO0H 1K8IB 1MCDA 1I9EA 3FB6B 4KROD 1MCLA 3B7YA 1XF4A 2AVGA 2L7UA 4CC1A 4DWHA 2BSRB 2I27N 3GK8H 4MCZA 2EUZA 1TTRA 1OVZA 1O6VA 1RZQA 2ZUQB 1AQKL 1RZFL 3BOVA 1CFQB 3N50A 5CR1A 3INUL 5JDSB 1LO4L 4XTRC 2R0ZL 3TZVA 4N2CA 1CICC 4BWUA 4UU9A 3SCMB 4NQED 4M5ZH 2N59A 1A6AA 5BRZA 4RFEB 3S48A 4MS8C 2WCPA 1A1OB 2DYPD 4JAMB 3CN2A 5I1IL 1SN5A 1W72L 2VKXA 4C4BA 3PHSA 1KDJA 4RA0C 3T9WA 4L8BA 5D2NB 5IESH 5E4OA 5L2JA 5D6DA 1DUYA 3EBAA 5GZOC 5KJ7E 4YE4H 1OARL 4EI5A 4G8IA 4PJ9C 5DEGA 4AL8C 5AZ2H 4W4NA 1Z9MA 2LVCA 1VDGA 4JVPA 3TZVB 2AEOA 3BT2H 1B3JA 3G08B 3CFBB 1XGQB 2ERJC 1OAQL 2DLEA 3UTOA 5CGTA 4WU5A 3PXJA 2VLKB 4UQBA 3T3PF 2IFFL 4X4YA 2ZWLT 3ECBB 4LZKA 1I8IB 3N9GH 1MCNA 1CK0L 2XBTA 2VABA 4S2SA 4AEHL 4D9RD 2V5YA 1BAGA 3QEUB 5B1CA 4XN7A 1NBQA 2WIMA 3VE0B 3N43F 4JFFE 4N2MA 5CLZA 1DQIA 4OW6A 1I7UB 1YN7A 4EOWH 2ZYRA 2ZWSA 3LKRB 2QZ5A 3ARDC 1U8QA 4TL4A 3GEFA 4ALAC 3VXSD 3O4LA 3VFUB 3KYOB 1KC5L 2O61A 2CR0A 4R4NC 2CBQA 3WE1A 5HGHB 5IW6A 4HP5A 3TS8A 1K72A 5IMMA 2ICEA 5JPNC 1FNLA 1YY9C 3BPOC 3ZY7A 4HLJA 4FFZL 2X9ZA 3H9SA 4N85A 1E6OH 1P6FA 2P5ED 3CBRA 4OV5B 2Y7MA 2D7NA 3UTZA 3FFCB 1N0LB 4Y5VB 1IL1B 1JWMA 1TF4A 2R2EA 4OM0L 4X5PA 3VH8G 2Z92A 1NM4A 3CDFA 5DT1L 5EORL 2DTMH 4YX2H 4ZSOB 1JGIA 2KUTA 3FQNA 1U93A 1YYCA 1MRDH 1SUHA 1F1AA 4MGXA 4AIZA 5F3BA 3RI5F 5AD0A 1B4RA 3Q6GH 5AVSB 1YA5A 4K8RD 4QOKB 1CWVA 4IBQA 1L9QA 1ZE3H 1YEEL 3RDTC 3HZMB 3QUXC 1C5DA 3D39E 2ZPKL 4IHOA 4X0KB 5I5RA 1A5FH 5B38B 4PWJA 3SPHA 1THAA 4RGOH 3QPKA 5LGKA 1UWXH 4CVXA 3FB7B 2HTLD 4GUQA 3V6FA 3HG1D 4GSUA 1T7YA 1JS4A 2VLMD 3PJLA 3LQMA 3N1PC 3IJYB 4RISL 4CW1B 4Z7UF 5HGBA 1DEEA 4YNYB 4WNSA 4Z7IA 5T3XE 1P4LA 1E3ZA 5GS3A 1H0DB 4MA3B 1E4XI 1Q0YL 3CVHB 3EYVA 3NPSB 2WZ0A 5CD3A 2NYKA 3FFCD 2H6OA 3L3GB 4PJEF 4ODWB 4P4RA 5EEYA 3BKJH 4PCKA 3SDAC 5IROC 3UBXG 4IU3A 3SJVA 1PL3A 2CJTA 4OD3H 5F7NC 1FNGA 4MQXD 2QHRH 5GRUL 4HH8A 1YYML 1N6QH 3P11H 1T1XB 4OFPA 4NBZB 4BJLA 1YMMD 5TD4A 4G7YL 1URZA 1PCSA 1VGKB 1NBCA 5AOLA 5KS9F 2AJZA 3FU0A 3LIZL 5DA0B 5E24E 1X4ZA 5DS1A 1Q9KB 3V0VB 1G6RH 4ACTA 3WTUA 3IJHB 3A6BH 4LLDB 5ALBH 1LL1A 3AFLA 3OKNA 2FQDA 3QFDB 4MMXC 3ZQXA 1YEGH 1E27B 3Q2CA 1T0NA 1T1XA 3N85H 1QHOA 5D72H 1HH6B 2XN9B 3FB8B 4KHTH 3CVDA 3HG3A 3S3BB 4A7UA 4DGUA 3CSTA 4JGNA 3L48A 3MLTB 1U8MB 5EIIB 2DQUH 3O3AB 1E30A 2JJUA 3MA7B 3QO1A 3LZNA 5EZIH 1MEXL 3WFHB 2K45A 4U1MB 3WO3B 2FSEB 5IJCC 4MA7L 3WJLC 1KOAA 4ANUA 4X6CB 4LHUA 4QXTB 3UYRL 4KTGA 2OYLA 1RU9L 5CLYA 1E27A 2W0PA 3D34A 4GUCA 5M7QA 2OMZA 2JB6A 3MO1B 1BLIA 1IIKA 4OZHF 4XVTL 5BZWA 2CHZA 1UXSB 5E94A 3QJHA 2Z93B 2QPEB 5BRZE 1G7PB 4RMSA 5CD5D 2AP2A 2EZ0C 1U6AH 4RBPH 4R7NB 3TIEB 1RUML 3E6HB 4A6YA 2B7DT 2B0SL 5CCHE 3I3DA 4KXZI 4BWWA 1DFBH 4JL1A 5C70A 3HBPA 2J1WA 3N41B 4YDIL 2ICCA 4XMLH 1P5VB 5BVJA 3V0JA 4UB0H 5DD6A 3FO1B 4BKLA 4LSSL 5IIEA 3HZVA 1U8HA 4X4XA 1XTLA 3PJSB 5TDPB 2DI9A 1AIZA 3MZGB 1BD2A 1T7ZA 3QRLA 3LDBB 5HHNA 5KYUB 2QSTA 5EO1B 5D2LB 5GGSB 4FNSA 3M45A 5DMIH 4AYID 4YLQT 1WC7B 2W0LA 3WTXA 1A6ZA 2X4TA 3LKOB 4DGIH 1XH3B 2Z4TA 3QNZB 3BSZH 2Y2WA 2OYKA 2WWNA 2CO7B 3ABZA 4WWOA 3EBHA 1P5UA 2CJSA 2XY2A 2RTTA 2YN5A 3PAUA 4TNWF 3BESR 3GT6A 3FU8A 4PRHB 1PKQE 2K9FB 3VB8A 2FCBA 2DWDA 3HPJA 3OB8A 1BD2B 4NHCH 4YSDA 4D8PA 4KXAA 1Y1DA 3B9DA 4P5SA 3R8BB 2RD0A 4OCYH 5H2BB 4Z78A 3VQ1C 4KRPC 4D8OA 2A6KA 1DZBA 1GYWA 3FOLA 3JUYA 3T0ED 4KUZH 1R24A 3K74B 1A7NH 4GUPA 2DQCL 1UOVA 1C5CH 4K7FA 2Y69B 1TYJA 4PVLA 4ES8A 4DF9A 1T4KB 2V2TA 1U8MA 2D7TL 3KS0J 4RSYA 5FC9A 4JFYA 5DHVB 2V2WA 4G9FD 1GGIL 4FDWA 3ZZQA 1D5MB 4FS0A 5AOZA 5E5UB 1U8PB 3OZKA 4PS7A 1UCTA 4ZFGL 3EOBB 2W9EH 3QYMA 1RZ7H 3IGUA 3MBEA 4ZI8A 3RZCA 2G3ZA 3QHFL 4I18A 1SXZA 3EH5B 1RSYA 4K5MA 4W9EC 3ARBD 4U1JB 4X6FB 3A4AA 4O2EA 1AS8A 3K8KA 4XC3H 5KBDA 4BFJA 3CNKA 5BZWB 2C9VA 1EEYB 2MNWA 2HVKA 3S97C 4KK5C 1JZHA 4YZFF 3L4CA 3SZKC 3DDFA 1CIDA 4P5KB 3JWNC 4F7TB 3QEQA 1SDDB 1XH1A 4FG6C 2BVOA 3CSFA 2XJLA 4JHVA 5F89A 3G6JE 5SX4I 25C8L 4X5WA 3OAUH 3QUXD 3HLKA 2AGJH 4X6EA 4YGVA 2G0LA 4G11A 3II1A 2DN7A 5DEFA 3JT0A 4X8GA 1QVOB 3J7HA 2XZQL 2WJ5A 1HQRB 1NCBL 2EE9A 2CDGB 5E0QA 4FFYH 1AZUA 2XQBL 2VGLM 3QZBA 3PJNA 1ZOXA 3CFJA 1AC6A 5LN8A 1TNNA 2VLRA 1V7NL 3QEHA 4OTXL 1BYNA 5IBUG 2JCCE 5K9JH 3W0WD 5JHDE 5GJSH 4NZRL 5BUGA 4GT0A 4HCRA 1UCBH 5HDQH 1A8JH 4P46A 3PWPB 4HK0A 4Y9BA 1BFVH 5E1HB 2QSCL 2J8UF 1BZ7B 1EV2E 4K9EH 1OAKL 3OXSB 4M7JL 1JMXA 1R17A 1GZPA 3L4VA 3U0WH 1T21A 2CXGA 1CFNA 2WO4A 2CCVA 3FMGH 3HS0B 4MQSB 2VXQA 2VRQA 3NN8A 4N4YB 2QFPA 5AKVA 5DZOA 4QHNB 3ARZA 1PF3A 4KTEH 4Y19D 4GI8A 3CUPA 4JFPA 5C0AE 3S5LB 2OL3L 3AWGA 2EKSB 3GHEL 2EC9U 4YHPA 3D18B 3BUQA 2OV0A 3Q2NA 3QFJB 4NC0B 1G5GA 4TNWK 5DHVA 4BELD 3D12B 3U46B 1E5AA 1GS6X 4KKLC 3NZSA 2CK0H 4HOZA 2X7LA 3B43A 4FF9A 1DQKA 3AGWA 4XBEL 5TDNB 1MFUA 4I3RL 3GFUA 4FXLA 3RJOA 2PO6C 2HT4C 5L88L 2IH3B 3S5LA 3D25B 5EULV 1X5HA 3MV9D 3MCG1 4JRYE 3CK0L 3WJJC 1AQDB 3G04A 4HUWB 2OSWA 5AL8A 2EQDA 1JK8A 1W6WA 1PCXA 2XN9E 2QVTA 2JKJA 3SO5A 4JVUA 1MIML 2HRPH 2X2JA 3B7RL 4X6DA 4WFGE 1TQBB 3WFDH 3VGEA 2P9RA 3H6JA 4L05A 5DUML 5B4MD 4YBQC 2N7AA 3K6FA 5FUOL 4IQHA 3G5XB 1CFTB 4RFOH 2ADJB 1XGTA 2XYBA 3H4FA 3GB7B 4CKVX 1T5WA 4GBXB 4M5ZL 4OZIA 2IMMA 2AXFB 5FB8A 5D2NC 2JKLA 3BD5A 1QI5A 3BPCA 3Q9QA 3QUHA 2GC7C 3IAPA 4OB5L 4M8QA 3WKPA 1XGZA 3FT0A 2WN3A 4L8DA 1BV8A 4RFEA 3CFUA 4M61A 4LK4A 4TVPE 3WY2A 1LQSR 2FEEI 2AS5M 1A6TA 3KEHA 1NCJA 3O8XC 4PV9A 3UGXA 4S0SD 1FC2D 4XPTH 3RWHA 2AJXH 2YEZB 5DRZB 4ZO9A 1NA8A 2F58H 4NQDB 4DPRA 5I24A 4M48L 4FI6A 4QRSA 2ZKWA 3F01A 4KMLB 4UIMA 3HHMA 4XN4A 5GSVB 2AVFA 1P5UC 1L9MA 3STZB 3W11D 3I6KA 3SYCA 3TJEL 4NC1E 5A2JH 4XMKH 3AG1B 4KC3B 4FNLL 2HKHH 4JRXA 1ML0A 2X87A 1TG8A 3K2MC 1YNLH 1IEBB 3NCBB 5KJRL 3C5SB 3CHQA 4ODVH 1EUUA 4HT1H 3UTTB 4Z7NB 5GJTL 3BO8B 5CFAA 2YK1H 4P2RD 1IKFH 5KVGL 4S2SB 4NBXB 4M5SA 4Q7DA 3AB0C 4YHNA 2B1OA 2DF3A 4UIKL 1HHJA 3K81A 4MMYA 1DJGA 4HEPA 1DSFH 4E5XA 3B1TA 2J7LA 4MASA 4G7SB 1A3RH 1LEGA 3LMJL 1GZQA 1OWWA 3DIFB 5KW9L 5LDSA 4K94C 4AZ8B 1QFHA 4BD4A 3UO1L 4U3CA 3FSWA 1P7KA 3QIBD 2A9MH 3VGDA 3WTSA 1ODUA 1J1OH 4BYHA 3IKCB 2G0KA 4ZMAT 4LRIA 4LLVB 1OW0A 1BIHA 3TTYA 3X1NA 3ZVVA 3NZUA 2ADGB 4NO0A 4JO2H 4CDGC 3SE6A 5FO9A 3WENA 2EP6A 2NSQA 1DQDL 4J28A 1VFBA 2WWKT 5F44A 1S3KH 4DO5A 1AD9A 3OMAB 5EEXA 5EA0H 4L4VA 4XNMB 4Z7OF 2FJGB 4PB0H 3U9UA 2IFGA 1S5IH 3WTTA 1ZLVH 1GY2A 3ARPA 2EH8L 4NQTA 5I9QC 4LCWD 4KPHL 3KPRE 3VXQB 3LKPA 2FT8A 4AQ1B 5EBWA 1OCWL 3QAZB 2NW2A 5JQHC 4HWZA 5EDXA 3DBSA 4ZO6A 4WWKC 1U8LA 3GMLA 3NABL 4HBCH 3WNPA 2DM3A 4ZMZA 3RNKA 3UIZA 4KHXL 4IDJL 1CYXA 4NN7B 1KB5B 4HUMB 5EUKA 1QLEB 3FUFA 3LIUA 2NCMA 4ZT1A 1A3LL 2WOBA 1O7DC 1ZD6A 3VXNA 1WBZA 4JFHD 2J1ZA 4OJYA 4NHUA 2OL3B 4M3KB 4ZMLA 2YO3A 2FQFA 3O6KH 1J10A 1CLYH 1G1OA 3AW5A 1JGLL 4G80B 3KYOA 4OLVH 3FQTB 3MXWH 3KPSD 4MYPA 3MBWA 1RJYB 2H1PH 5D7KE 4UZUA 3FN9A 2X5PA 1TOXA 4PJ9B 5CZXC 3UXFA 4G7YH 3WEMA 2NY7H 2XPGB 2D31B 2NX5D 4GAFB 2HT3D 3DJ9A 2HZHA 4GO8A 4MAUH 4NPKA 3L7FA 4XI5D 4GLRH 1JDDA 4WKZB 3E2HB 2X6CA 3SPIA 5GGRA 2MRYA 3LVTA 4IS6A 4IRSC 5E4IA 3ZZ1A 3JTBA 3GXIA 1IRAY 4P06A 3OV6A 5B1KA 5E5MA 4JDTH 5HJ3A 4Z7WB 1KIPA 4FNPA 1QG3A 4H20L 1QFWH 4MMZB 4N22A 2E7LC 3OD3A 1FVEA 4NZ8A 1H3PH 1P7KB 4RQQB 5K33A 3KWWB 2ZOWA 3QORA 2CO4A 4YUEL 3NIFB 1PAZA 4XN1A 2JKTM 1N8OE 1W0VB 3S3DB 1TMQA 4NAJA 3TYGH 3O6LL 4KRMB 3FHAA 3ARDB 2F7PA 3VXOB 2MPAH 2ZXDA 3PL6D 1F90L 43C9A 3UYRH 3OMIB 2BNUA 2WUBL 1Z0NA 4KK6D 4WFFD 2JWYA 3P2TA 1GS7A 2VSDA 5FYKD 4A2GA 4LEXH 4MAYC 4HJGB 4JDVB 2KERA 1YY9D 3DV4B 4AV5A 3T3MF 4PJXA 1C8PA 4K23H 5ISZE 1U3HC 3L3DA 1IU1A 4DO6A 3GSWB 5DJ6A 2NY1B 3ULUE 2DYPB 1FVDB 4WTQA 1LEIB 2VDRH 3ELAT 4PJCB 4I4WB 4U31A 4UOZA 3E7JA 1PLGH 3FAXA 4Z7VB 3D9AL 1RK7A 4ORGA 4H1LG 4TRPL 2K4WA 1BQSA 3IGAB 3FQ2A 2Z7ZA 2E6QA 1CCZA 2GIXA 3ML9A 4F8OA 2FEDC 1NINA 1KXQE 1RMFH 3ZKXB 4Y7OC 2HX9A 2WYIA 1CS6A 1R3KB 5FM5O 3QVAA 4AW7A 2QMJA 5DD0H 1NDMA 1I3GH 3P11L 4F27A 2Y7QA 4XXDA 3SJVD 5GRYA 4ZYKA 2Q7AA 2G5UA 4X99B 3T65A 1HE7A 3V7AG 1CGYA 5BZDB 5I1CH 4ODBD 3CK0H 4XH2A 5I16B 2MKLC 4YDLC 1OALA 3IRPX 5HYJE 2D3NA 3P4MA 3B8YA 1V3KA 3MACL 2CRMA 1L7TH 4GEJA 4IRJA 3PWLB 1FG2A 4NRZA 5CILL 3LKNB 3LKSB 4JHAL 3B5GA 4NN5C 1QO3B 1VENA 4RZKA 1TYRA 1KBGL 3GSOB 3EFFB 1X7QA 3AXIA 4HGMA 2YPLD 3WIHL 4Z8FH 2GJZA 2DQFA 4FLHA 3ILPA 3DVIA 1FP5A 4KY1L 1F45A 1G1KA 1Q0XH 2P5EB 4J3XA 4ZMOA 4JE0A 1T2QH 2ZX8A 2WYZA 2GFBB 1GGIH 1U8QB 1EFXB 4QXUL 2AJXL 3LH2L 3UX9B 2D2OA 2F58L 3ZQWA 2LOEA 3WXWL 4I0PC 1UJ3A 4PRPB 2E4TA 3N1QC 4JHWL 3CCHA 5B3NA 2RGSA 2ZCKH 3W9DB 1M42A 2QKIC 5KSAB 5E8EB 1EJOH 3DXAE 1KJ2L 1F18A 1CG9B 1EA9C 2R2BA 4JM2C 5FYJL 4YXHL 4ODUA 5B8CC 1D7CA 2Z92B 4KUCD 1TEGA 4BZ1L 3B9KD 2X38A 4WEUD 2L8AA 4NHCL 4Z7QE 3S8FB 4C56E 5IOPB 3I3BA 2IV9A 2YQGA 3TESA 5HYQA 5C0FB 5J11B 3C5JB 5B3SB 3BJ91 5JW4Q 2E59A 4TF4A 4JLRB 4O2CA 4L8CB 4L4TE 2LFEA 2N0KA 5JMOC 4HC1A 3FO2B 3V9EA 1QVOA 1P4BL 1G94A 2HMIC 1WVZA 3WJMB 2PO6D 1DJWA 5AOIA 4AXWA 2A4ZA 1LP9E 3ZZLA 2IG2L 1IFHH 4ANWA 4PJCF 5ADPL 5D1QB 1JCVA 5LDUA 5HTSA 4NCDA 2RFXA 2X09A 1D9KC 1HHHB 3O8XB 1UG9A 4PI2A 5B1BB 2N7SA 1EDYA 2MNJB 2P1YA 2JVUA 2VR4A 3QUZB 2OP4H 4GBXD 4Z7UA 1CXEA 1UH3A 4GRMA 4DZBB 1KYOJ 1IGML 3P4OA 1S9KC 3AS2A 2E76C 1U8PA 3DSFH 5FA3B 4APXA 5C9JB 2HT3C 4AQ8A 1GYCA 4HCRL 1MJUH 1AI1H 3GXFA 3JVGC 4PJHE 4HISA 4B9ZA 5AW8B 4NENB 1O5DT 3HB3D 3RI5K 3QS3A 2G2NA 4JQVC 3P9WB 4KDTC 3LQAL 4HJ0C 1KCKA 5IR1B 2EABA 4O02L 4ABWA 5CJBA 1DJXA 2O6CA 1G7LA 3QG6A 5T5NG 1G87A 3VU1A 3OGCB 1DJSA 2Z35B 3GIVA 3MRLA 3A47A 4ZXBD 2HRLA 3OKNB 5F89B 4JFDA 5IB1B 2CUAA 4JRYD 1D7DA 4G43A 5I0YA 3BWUC 2WINA 4MAYB 3OKEB 3ILDA 4XGZA 4M5YH 1S7SA 3W5NA 4XB7A 1JVKA 1ZSHA 2D0GA 3CFEB 4QRTA 4U6VH 3QCTH 1BHGA 5KG9A 5D4IA 1CLYL 2NY2B 2X05A 1WWBX 4HXBH 5BZZA 3OAUL 2XXMB 4DEPB 4KQ0A 5F0MB 1OSYA 3GZOA 1IM9B 5K1VA 3BN9C 5AUMB 5BO1H 1A4CA 1GCFA 1PX4A 2G30A 3I9IA 1L3WA 2OCFD 1FGNH 2R0KL 4WI3A 2BP3A 3EXJA 3MLRH 1YNTB 3LHPH 4ZS6C 2CLZA 1ZK9A 2YUZA 5KSVB 4NQSA 3UPAA 1XZWA 3ARTA 4YHIA 2BERA 2R4RH 3BSHA 1GSKA 2XA3A 3GHEH 3DIDA 1ZLVK 1KLGA 2H2PC 4A7GF 2JKRM 5HYJA 2VM4A 4LSRL 4Y4HC 5ESVA 1JFQH 4L0YA 4XPTL 1I8LA 2BSSB 4BFEA 4IBTA 4JRYB 1MFBH 2OW7A 3VXRD 4MD4A 3SD5A 2DLTA 3P3YA 1WK0A 5GRVK 1IAKB 3F04A 1P7BA 3OL2A 1MWAB 1HEHC 4JFQA 3VXRE 1SY6L 5MHSD 4YR6A 2DQMA 5CN1A 3VTAA 2BP8A 2YEQA 2VZVA 3UDWA 3V5KB 3TVMB 2AJVL 2YAOA 1WPCA 1AY1L 1IM9D 1MQKH 2NW3B 4YC2C 2N7BA 3PRZA 4LGRB 5H94A 3WKMH 1WZAA 2OL3H 1MIMH 2HRPL 3TCTA 3IYLW 1OZUA 2D4FA 3CFNA 3ZL2A 3CXFA 1FYTB 3B3IB 1JF6A 3DHJA 4K8RH 4Z95H 5E2WL 4J3OF 2Y6SC 3QWOB 3DROB 1SJHA 2V5SA 1E6JL 3P30L 4LBEB 1ACZA 1WRFA 2VJ8A 4B9JA 4Q9RL 4K94L 1D9KA 3I02A 1VADA 3LKQB 1WUNT 5E5LA 3SPGA 4N0UE 2WWOA 4XP5H 3KYAA 4FKHA 1LE5B 5E2UL 1RVFL 4K3HA 4PJAF 3OKEA 5IJVA 1E4WH 4GB9A 1K5WA 2H9GB 3EO0A 5A40E 2R56H 3BQUA 1Z66A 2GK0B 1N7ML 3O6ML 3OR7B 1XV8A 4PRBB 3DO7B 5HVHB 4IBUA 4QRPA 3SE8L 3RGVA 3WNNA 1ZLSL 1MZZA 1WFJA 4LCIL 4U1IB 4BDVA 3AS3A 1B4LA 2Q7YA 4Q4EA 3HE6B 4NQEB 3TJEH 4ZG1A 1LMKA 4N5EC 4WGKA 3DVNB 1AO7E 2ZUQC 4GQRA 5KSUA 5CBAA 2CUIA 5T3ZL 1EFQA 4XZ4A 2BINA 1MELA 1MCPL 1TU2A 3B2XA 1IILE 3FYIB 3MJWA 3QQ3A 4QHLA 4LSPL 1VJSA 4R96B 1JUFB 1DVFB 3F7QA 3QWNA 2RBLA 1GTNA 5CINH 2X28A 2CHDA 5DJDB 3ZKND 1QR4A 4DP8X 5K1NA 1IMHC 1B3IA 1JN6A 3N0AA 4N8CH 3STZA 5CJXA 4WLCA 3BVVA 3P54A 3S3PA 5DXWA 4MZ3A 3CHRA 1KIQA 4IEFB 5E6IA 3ECWA 2C3GA 2CO3A 2IXQA 3WIHH 4HC1L 1KYUA 4XRCB 1MCWW 3TP4A 4XAWL 4C57C 2H6PB 2D3LA 4MJHA 1OK8A 5FCUL 3MRIA 3QPQD 1INEH 1EO5A 3G5WA 4ZDHA 4JFHE 2YZ8A 1GGCH 3DSNB 3K7UA 3Q1EA 1KIUA 4GXFA 2XG5B 5L4MA 1ZA3B 4C58B 2FD6L 4Z7WE 1ONQA 4J4PC 3VXMA 1GH7A 3MCLH 4JHBA 1V3MA 3CBKB 2SEBB 2YRZA 5IKCB 4HKXA 4O02B 1OP3K 3ZRSA 1NOAA 2IF7A 4F7PB 1KJ2H 4PJDF 3R7RA 1I9JH 3QJXA 4QYOB 1BWMA 4GUPB 3Q5YA 3QZMA 4P46B 3EW3B 1HI6A 2P7TA 2FX8H 2X10A 5TJWK 4KTYA 3CLEL 2ITFA 2MOQA 2R4SL 1MVFA 2XKNB 2DQTL 2YKLH 4OZIF 1VHPA 3BISA 2E9BA 1IJNA 1NMCB 3A67H 4QLWA 2XA8L 4MRBA 5T3XL 3GSRA 2FWOA 4HKXB 4O02A 3RWEB 4CADB 5ADOH 2F53B 5IROD 3MNMA 2FX9H 5ACMA 1F2XK 5IB4B 4UDTB 1MJ8L 1Y18A 2W0FB 5E56A 3CLFH 3PWPE 4ZAKB 4MJ5A 1TXKA 3KPNB 5D5MB 1RY7B 4LVOB 1FSKC 5DC9B 5IV2A 2BVOB 2VL4A 3D0LA 2ROYA 2FT7A 5D8JL 2DV6A 3GSVB 1XF3B 3H2WA 3M7FB 4TLUA 2Y4SA 3MU3A 4EDWL 5MEQA 2WC7A 3DPDA 3NBNA 3FUIA 3KM2A 2EH8H 4AITA 3DX7B 4LT7A 3BAKA 1NH6A 3HLAA 3T2NL 4IMLB 3KJ4C 5D7LB 5E8PA 2WXGA 3FTUA 1MFAH 3MRFA 4HUWA 1GVIA 1NAMB 3PP3K 1H8LA 4Q4IA 4OI9A 1VZGA 3R06B 5IMLB 1UUNA 3CVHL 1EAPA 3NP3A 3HC3L 1F8TL 4AC4A 1FIEA 3COOA 5JHAA 4XB8A 3U1SH 1O7SA 5CJ5A 5HYSG 3Q5TA 5FYJD 5F1OB 5GISL 1DQMH 3LN5A 5C0GA 3WY4A 3LXBA 2P5PA 4RWYH 5L7XH 1NCUA 1GZHC 1UQSB 1HWWA 3DSNA 6FABL 1JF5A 4ZX6A 3RY4A 4KXCA 2UVFA 1OGAD 3CTTA 1G4MA 3PAYA 5JDJA 2MNUA 1YMMB 4YDKL 3DXAB 3NA9H 3E8UL 2JCCA 2WXHA 1LEGB 4HMEA 2P8MB 3T8XA 3AABA 2GITA 3BGFB 4TPRH 2MKWA 2QVFB 2G2RA 3CMOH 2Y07H 2ESVA 5EBLB 3SKOB 2CG9X 4MRCA 4U6VL 2YAHA 2EEBA 1GHFL 4KKBD 1M71A 1NGXB 4OSUL 3FH7A 4NQUA 1U36A 5GSVA 5C07D 3WL9B 3FQXB 4Q14A 4NO0B 5TTRA 5IEHA 5KANI 1QSFB 3D3VD 4PLOB 3Q6FB 1HHKA 4WY7H 4UQ2B 4NNXA 4DKEH 1K8IA 3FB6A 3LKNA 4XPGL 5TDNA 4AEEA 4BFIB 3QQXA 1HXMB 2Y2TA 3P2BA 2PTUA 1XZ0A 3GBEA 2F1AA 2ZX6A 1MREL 4FFWC 3OKYA 1GRWA 2NY5L 4YFLF 5EZOL 5IB4A 1HSBB 3REWA 2YZ1A 4UU9B 4G7VH 3FULA 3SCMA 3LXAA 4XNDA 3KWXA 5KTEH 3QEQD 2I9TA 3TA3A 3T8VA 3MRCB 4XNZC 3O8XD 4UYPA 2AC0A 3VMNA 1HHJB 5C0CE 3WEBA 5F7HA 2V2XA 4Y1TA 4YPGA 2C9SA 2WBJB 4MVBD 4NO2A 4IBLT 4B0MM 2EVIA 1A6WL 3TBYA 1FFOB 1Y0LA 4N1EA 2HWZL 1NGYB 4N2AA 1KXTB 5HHOD 2CUHA 5GZND 1ZIBA 3FQUB 3VI4E 4AEIH 3QQDA 3LEXB 3CG8A 1LNUA 5GGTA 4A6YL 1CMOA 1D5RA 3P4LA 3NFPA 4LPXA 1T22A 4WJKB 3CXDH 1BECA 1U58B 3FO0L 2APXA 3IMSA 4A7QA 3U6RB 5D7JB 3L3KA 1W0WB 2AQ1A 1KCRH 5IOKA 1ASPA 4M1CC 2OX5A 4WTZG 4ZYKB 5JPMA 4BFFA 4K5LA 1KXTA 2A6DA 2FLMA 2FJGA 4JDZB 3UCQA 4Y89A 3KBHE 3MLYL 2KPWA 3G5ZB 4C54A 1E5YA 1DR9A 2JF1A 3JTTA 3KPLB 5FLVA 6PAZA 1OT2A 3FW6A 3LEXA 3Q8EA 3QIUD 1QR1B 5F6IC 2LABA 3SPJA 1NEPA 3K6DA 3A6CL 5G2NA 5DMYA 2UZYB 5FWQA 4HWZB 2VQ1A 2ADYA 3CFCH 3FF8A 1KENL 5F9OL 1UM6L 1X7QB 1DBBH 3V8CA 4G3YL 3N43B 4XE0A 1R3JB 2IBZY 3QORB 1UXWA 5E99H 2I32A 3DGDA 3UAJD 1IVTA 3IDIA 2QMKA 4IJ3C 1HQ4A 4EXKA 1UWGL 1SEBA 5F7DA 3WE6A 4TSCL 3Q6FA 1JPGA 1IGTB 1SFHA 4KZCA 4PVBA 2GHWB 1IGMH 2AK1L 4J4PD 5L2KA 1LWRA 3C6LA 1NC2B 3C8DA 4AI7A 3P4OB 4JPVL 2OSLB 3O3EB 3MV11 3WLWD 2MJWA 4WDIB 5CIPH 1E9PA 1JZEA 2DQEL 3QR1A 3P1VA 1TTFA 4DEWA 1IEHA 4QTHB 3C8KA 1ZHLA 4NPJA 2CRZA 4V1DB 2FATL 3MRCA 4AYEC 4KKCD 5I6PA 1MI5E 2QZQA 5MENA 1QOKA 2VW6A 3L4TA 2ZCKL 1NANI 3PNRB 5BS0D 3MYZA 2IEPA 4EEEA 2E47A 1SMAA 5E2VL 5C0FA 1QATA 1HIMH 4H26A 3UFIA 3NOIA 2F7IA 3C5XA 2X9WA 4MAYA 4MQXC 2BXZA 3TBSB 2X4UB 4GW1B 2HJFB 2NNFA 1Z6JT 3HG1E 4XB3A 1PG7L 3VX0A 4LKXA 4QLRA 2WWMC 2F0CA 2R29H 3EUUA 4YDVA 2V3DA 2VDQB 4KFZC 2ED9A 2WQ8A 4LEBA 1T89A 1GIGH 1I1AB 1QZNA 1OAYL 1X44A 2BNUB 5I1GH 1N8ZA 1U95B 4Y5XA 3BH4A 1CR9L 2RHEA 4ODTH 4HDIB 4G6JL 4WZ9A 3S3CB 3U7WL 1SHMA 2ZPKH 5I74B 5CKAA 2UWEF 4BKLB 4U6TA 1DJIA 5LVEA 2V5RA 4J3OD 3VFWB 2I9LA 3CX2A 1QKZH 3G6JA 1IC1A 3KPSA 1D5XA 3GTVA 1F00I 5EO9A 1PYWB 5DK2A 2W80C 2P4AB 1HL8A 1SGKA 1JFQL 2GJZB 2H0JA 2NY6C 1QHPA 3H1ZA 1S4IA 4UZSA 5IHHA 2ZX5A 4GG6F 1WZ1H 5D93B 1MFBL 3MUJA 4U0RB 5FGCB 3CZFA 3TFKC 2IAAC 2AF2A 3FSVA 4R3SB 2ADFH 3Q2LA 4JREC 1HNFA 4FKKA 3QI9B 2YD6A 4GXVL 5I1DA 3VRJB 2ZXWB 2C9UA 1JNNH 4WI0B 1KLUB 1FL3A 4MS6A 1A2YB 1CGSL 5DJ8B 1IARB 4HXBL 1U30A 1FBIL 4F80A 2H0FA 1YMHB 1FNGB 4H0HB 5HI4D 2W95A 3DUUA 3B2DC 1UT2A 3H9SB 3N44B 3UGUA 2TRYA 4QTHA 1U3HD 2OJZL 3NFNA 2R1XB 3D5OF 3GDCA 2XYCA 5CP7A 1AO7B 1VIWA 1SHWA 4A2FA 1XBRA 4OFQA 2PWEA 3WMQA 4HCIA 1IFRA 3VGBA 1NCCH 5AKSA 4JFSA 1YQVL 3FQNB 1AP2A 5KBLA 1HZHL 4HAKA 1U33A 3V4UL 1KN4H 2F19L 4N0CC 1AFVH 4RIRA 2MSPA 5CUSL 2V8MA 3OWEA 3QZLA 4KH9A 5IIEB 3NA4A 4E9LA 4H88H 5TPWH 1DBAH 3HB3C 1RKRA 3ZDYE 3NCMA 4X9FA 4TPRL 1XXFC 2ICWB 3KM1A 3KLKA 5D9SA 4P05A 2Q7YB 1B0GB 4I4WA 5ICUA 4FTVB 5AB1A 3IDMB 5J6HB 2EICA 2VDOB 1AGCA 3FHQA 4WO4C 2OMYA 2IV8A 2XTJC 3QK0A 3IGAA 2PCXA 5LAXA 1SYSA 1DDTA 3BWUF 3GMPA 3SN6N 4KAQH 4PJ5E 1WG3A 4GP5B 2BRRH 4N0YH 4PJBE 3L7EB 3I6GA 2IQ9L 4GRLD 2VOTA 5DCCA 4LPYA 1B90A 3F85A 3C6EA 2OZ4A 4D9QE 4HMCA 3K72A 4GMTH 2DBLL 2FJHB 5FXCH 2OR9L 1Y7VA 1VFUA 4AQAA 1S78C 4LNRB 5A1AA 3NTCL 3QXAB 5JW3H 2V0AA 5GHWL 2E6PA 4CAGA 2PTTB 2B2XH 4M1GL 3MUGA 3TV3L 2G4EA 5C2UB 1I1FA 4J1UA 3VG9B 3B2PA 1MQKL 5T3XD 3WKML 2R0WL 2VDOH 3RWCA 2E9IA 3IJHA 3ARFA 4Y1AE 5I1HH 2Y7OA 3ARGC 5F70A 4ENED 1R19A 4AJ0A 1SJXA 5B7FA 4K8RL 2IAMC 1DUZB 1P84J 4G70B 1J0YA 4BM7A 1AMYA 1A4BA 4HS3A 4TNVF 4A6YH 1EXHA 3DGGB 8FABA 3IJSB 1BBJB 5CBEA 4X42A 3CPLA 3RGVB 4PYHA 1KGCD 4PRID 1TIUA 4GXUM 4AY0A 3S35L 1I9IH 3SDAD 5I1LA 1YYLH 5ADOL 3DX9B 3S37X 4BE5A 3QUKB 4ZS7H 1BGXH 1T2JA 1MOEA 1JXGA 3C2SA 1ZLSH 5C0JB 2BMKA 5TQ0L 1GSMA 2VW4A 1BZQK 2BRQA 2I07B 5EZPA 3GO1L 4M5TA 3DMMC 3MOBL 5GS0H 2FRGP 3V0GA 1IKNC 4JZJB 1RU9H 4RRPM 4YLBA 2CKNA 5DZPA 5HBBA 3ISWA 4EDWH 1Q9LA 2C3WA 4G8GB 2VWEE 4Y9GA 3TBBA 2NY4C 1NSNL 4UANA 3ZDZE 1CK0H 1UWXK 3QUMB 1LE9B 2Z7WA 1B4JH 5MEPB 1DE4A 1R3IH 4OQTH 5BUAA 2WCGA 3VXME 3SDXF 4D0BB 3EJYD 4NPYB 3PWUA 5G4NA 1ND0A 2J1KA 1JTPA 3TC9A 4X9HA 4P5MA 3NEOA 5DJYB 1DJZA 3R1GH 4HIIB 2ERJB 5FM5M 3U30C 3RHWF 2VAAA 1XSIA 4G8GA 2AGJL 1EBAA 2NT0A 4LSSH 2DH2A 4QHNA 4BK5A 3NIDB 3QJFB 3N06B 4WVRA 2WVSA 4YHYB 1Z9PA 1NCIA 4LEOA 1PZAA 1XIWC 4J1UB 4E9RA 5D71L 1HQRA 3HE6C 5AW4B 3IJ9A 5HJDA 4X80L 5AKRA 3BPNB 4KJPD 3SDDD 5IMKB 3CLFL 3QDGE 3W81A 4B27A 3D06A 4HIIA 4L5FE 4LVHC 5CZRA 4S10A 1NCAL 4QJ3B 3MRMA 5HSFA 5DVKA 3ZE1F 5IW1B 1G6RA 2D0HA 4L3EE 2LV4A 3T0DA 3T3MB 1NOFA 3UG4A 2DIAA 5AQ0A 4MBRA 3OJDB 2YFOA 4X6CA 4F9PA 3FMGL 3ULUC 1QLEH 2EDWA 2I7OA 4KUZL 4NUQA 3BUYA 2IC2A 3BUPA 3EJSA 4JKWA 4OFDA 4GQ9H 4G1EB 5E6UB 4U1JA 1A1MA 4X6FA 4ZUSA 4ALAH 2G60H 4ICXA 1U21A 4H5SB 4GMSL 2FUTA 3DROA 1EO8H 4FYRA 2DLIA 5JHBA 3LNDA 5C0BB 1KFAH 4FQJH 1KY7A 1DQJB 1T20A 3ECVA 4JFDE 1OAXL 1D9KB 1ZHBB 1KT2B 3I02B 2VIRB 3LKQA 4OF6A 5GGQH 2DH3A 3QULA 5TE4H 2IOOA 4PV9B 3P73A 4X5WB 2YSSA 1LWJA 4IOSD 1U8HB 2ZYSA 4N2BA 4ZUSB 3DO7A 4J23A 4IOIA 3L5XH 5AVQB 5AVZB 4D0DA 4PJAB 1ZTXE 3WG7B 4I85A 3GI9L 3X11B 4Y4HA 4TUJB 4G6AC 3W5MA 5DVNA 3V5HB 4NZUL 2X2HA 2IWGA 4FNQA 2VAAB 4UCFA 2JJWA 4XX5A 5DTFB 3IEAA 5CP3A 1NFIA 4TTDC 3U0TA 1UYWL 2YSSB 3Q8FA 5J9PB 4OKVA 4TNEA 1NCBH 4H8WL 1JZJA 4JDEA 4YDKH 3I75B 1MREH 1NBZA 1W91A 3IJ7A 4P9HL 5EU6D 3ZQ9A 3VQLA 2ZQKA 2AXFA 4MYWB 2YMOA 2D7MA 1MEXH 3MV8E 2HLFD 3E6FB 4LCYA 1W72A 4P3CL 4QWWD 5DEJA 4ZUVB 2CJUH 2NW3A 3HR6A 3L8QA 1K3IA 1NMAH 1BFOB 1D5ZB 1NC4D 2X12A 3P4NB 2QSCH 1HAUA 3RKDD 1E3FA 3BAEL 1KPVB 3HPLB 2EXYD 5ABZA 1MHHB 5FR3A 1MJ7H 2VDRB 3GBMH 2LVEA 5CCJA 4IKIA 4NIYE 3FTXA 4XP4H 1XAKA 2EXWC 4RMVA 2ZT9C 1N59B 3K71A 3SBPA 3WDIA 2VLRD 3QA3B 3GM0A 4XPBL 5H37H 4QHMA 4Y4FB 1FC1A 1VADB 1RIVL 2WQXA 4JREB 4OT1H 5I0XA 5TE6H 3ULVF 3KBFA 4NBYB 2R51A 2ZCLH 4G9DB 2X7LB 5HY9A 4DN4H 4FA8A 4MCYB 1I85A 2QTVA 5T3ZE 1JTTA 5J6SA 3SDCC 3S96A 3OZLA 4RFNC 4LKCB 3D25A 3POCA 5AL0A 3EZJB 5D1XD 4GW5A 1WAAF 4HLZG 1O7DE 1FORH 4BZYA 2CLVA 4JZNB 1MFDH 1ETJA 4MVBC 5I6NA 1PZSA 1RJCA 1ZVHA 4FYQA 4CNIA 4Y1AB 2VZ1A 2HWZH 1T1WB 1R47A 1YJDC 2E7BA 3PQYA 2E7LA 2F74A 3IJEB 1OGAE 4Y16D 1K9TA 3M86A 2W8CA 2W9LA 5KW9H 1UD8A 2XOTA 5TFSL 2F8VA 4YSAA 4F2ME 4G8IB 1QLFA 1VFOA 3QP3A 3GMNA 3OB0K 1J9QA 2BDNL 1AHKA 2AK4A 2YD3A 4OKDA 5AW2B 4MBOA 2HG5A 3GNMH 1A47A 4HIQA 4TUJA 1BMZA 4CNIB 5F88B 3IN0A 1HAWA 3US9A 1CUOA 4OLUL 4FMVA 3HVNA 3VVWA 4UNTA 2A74B 5KYNA 3NJJA 1T04B 4YEFA 2RMNA 1CBVH 3WLBA 3RIKA 4PP2B 5C0CD 1S5IL 3MJ8A 2PETA 4C4KT 4KXBA 4PW9A 4I89A 4BKSC 4DP4X 4ELME 2PN5A 1JV2A 1OLZA 3MREB 4Y9EA 2Y06L 3HG0A 3KGRA 3LPWA 3MJGX 4N2EA 5LNEA 3T09A 4PI0A 4FFZA 3VD1A 5BPPA 4F15B 1A4AA 3GKWH 3RVWD 5E03A 3BUTA 3S36H 3ZE0E 3MRQA 3ZTEA 2VCOA 1KPRB 1GGBL 2W60B 4PJBF 1IGJA 1EVTC 4F3FB 1D5XB 4NQEE 2CO1A 3FHEA 2OSLA 4KHXH 2H4EA 3RILA 4UDUA 12E8H 3UADA 1OM3H 5T1LD 1RIUL 1LJMA 4RMWA 3DURA 4GXVH 3FAWA 3QJRB 2PKDA 1ZJBA 1CXLA 5LXGH 3VI3E 4LCCB 3VXSB 4CSTA 4PG9A 3RVVD 1IGJB 4D0CA 2DQEH 4WK0B 4MNGB 2PXYD 3V52L 5EWIH 2W0KA 4YN3A 1EZLA 2NQ3A 3S96B 4QXGL 3GM8A 1JNLH 3NMEA 4OLEA 5F7AA 2WQAA 4FEMA 3M88A 1T22B 2CLVB 4IMKC 4ZMPA 4LHJB 2XTJD 3CC5B 4MJ6B 3U9PL 1KEML 2WHVA 4XBGB 1FNSL 3EDDA 3PGFH 4Z3IA 1INDL 2MQ3A 1JHKH 4GSDH 1P6AB 4JFEB 3CN4A 1KBKA 3QDJD 1KIPB 4PREB 2AQSA 2XTJE 1BVOA 3GPSA 2Q8AH 4IJ3B 1S9WA 4WEMB 3R0NA 1M7XA 6CGTA 2Z9TA 4IYKA 3BKCL 3LS5H 5KEZA 3RTQC 4NFBA 2AAAA 4WFFE 2WD0A 3PHOA 5EA0L 5FEBA 1NCWH 3DJRA 3DMMB 1MH5A 4FTDA 4Q56A 2JB5L 4CSPA 3EGDB 1CDUA 5ID0B 3IDMA 5I28A 1P2CA 4JB9L 4ODXA 4I48B 3CZEA 3WY1A 3ZJAA 43CAB 5DRNA 5BQDA 4BRVA 3MREA 4XVJL 3V6OA 1J0ZA 1QWNA 3TN0D 4QNPF 1AJ7L 3K91A 2G3XA 4RGMC 1CD8A 1WWCA 4FULA 2ZWNA 3SDYH 1UM4L 2KZWA 1VZHA 2CKBA 2WLNA 1G4RA 1USZA 4LSUH 5JR1H 2WLLA 4QF1A 2AQRA 3ESMA 1MCCA 1BAWA 3B6SA 1OF0A 3MPCA 3QDJB 4QRPE 1A7BA 5IM7A 1TLMA 5FV1L 2WQSA 2BZDA 1EVUA 4TQEL 1Z7JA 4I0PD 4FQJL 4FI7A 4N0FA 2EYTB 4MJ2A 1AO7A 1XGQA 3PF2A 4B41A 4EDXA 3WELA 4H88L 4R97B 1DBAL 1AOHA 2FQEA 2Z8VC 4X5LA 5TPWL 5KSBA 1HXMA 4B3EA 2E7DA 2VR6A 1JMZA 2E75C 1ZXQA 4IRSA 1CDJA 3WHE1 1N9PA 3RL2A 3OPZH 1LK3L 2BWDA 3L5JA 5ACZA 5ESAA 4QHKJ 4Z7VF 1FZJA 4X9IA 4W1TA 1H6FA 1SHSA 2IJ0C 1ANUA 1QFWL 1HZHH 2PP8A 3JWNE 1BOGB 4JGJA 3BP4B 1C8QA 1H5BC 3K6IA 3RX5A 1S9VB 2AK4E 4PGEB 4N0CD 2YMTA 3HRZC 4G8EB 1AR1C 4G6AD 2VDML 3PHQA 4AKPA 3BAWA 2DLHA 1JWUA 1MCSA 3LEYH 4LLWB 3U2JA 1NGZB 3OLEA 3QI9C 4JLRA 2NW2B 4KFMA 3U83A 4R4BA 4I0PB 1IL1A 1JWMB 3DX2A 5I5MA 1RULL 4ZTPH 1J8HE 3ARRA 4YXKL 1WUZA 1VESA 1EFXA 2JK5B 4R8WH 4IIQC 5IVZB 3X1EA 4C47A 3QFJE 5EF2A 1A1NA 3H9HA 3RNKB 4JHWH 4L37B 3VXMD 4PBWD 5FGCE 4XP4L 4NQCA 4TL5A 4BCXA 1BBDH 2AJZB 2VLJB 4EF3A 2BOCA 2CO7A 5JW4M 3ZHNA 2DMGA 4S1QH 4LPCA 4CGTA 1RIVH 1IAIH 3PFQA 2F5BL 2CALA 1JHTB 3PWUB 2BS71 2DBLH 4LU5H 3BKMH 1PVHA 5EEVA 4LBAA 5J1AB 3RAJH 1SM3H 3V6FB 5FFGA 4EN3C 5D2LF 5C07A 2FX7H 3ULUD 5FM4A 1RMFL 2I7SA 2FIRT 2NSMA 4HS3B 1UOWA 2KDGA 4BCYA 3IDIB 1P4LB 1YEHL 2F54E 3F6JA 2C3HA 3TWCH 1M2VB 5FA4A 2FEEL 1RZJH 2UYLB 4Y1SA 1BD2D 3DOIA 3TNMA 3LPFA 5FYKE 2I9LB 3KPSB 4H40A 1OT1A 4Z0XA 1A21A 2WJ7A 1CQYA 4N5UA 3ULVC 3L5IA 3ABGA 3FB5A 2YXFA 2Q7NA 1L7TL 2IPKA 3ZR6A 5JYLA 1SLVA 4L9DA 4AGNA 1ILUA 2XHNA 1YEIL 4DP6X 3II2A 3P9MA 1NFDA 5FCSH 2GBUA 2KI6A 1YNTF 4PJ8B 1JZ7A 1AXSB 5DVOA 3MXVH 4IGBD 5ICZB 1R34A 1GL4B 4XX1E 5H37A 3ZYJA 4XVUC 2RH0A 3WS3B 2DQGH 2GJ6D 4JFXB 4M62H 2JKSA 32C2B 2KLSA 5GRWA 4B50A 5JIHA 2OSXA 3SO3B 1FSKB 3VCLB 4YSOA 4JK0D 4LAJH 3C60A 4HUVA 3FSOA 2ZXBA 2CDGA 2WXIA 3JBG7 3MJ9H 4FHJA 5DI8B 2R29A 3ECQA 4XNYL 4BRJA 1A1NB 3H9HB 2AW2A 3E80A 4LAQL 2X6AA 1E4HA 4HULB 1IKOP 1QEWA 2Y2YA 4WI7A 3FO9B 1VEOA 4IK7A 3SE9H 5IJKA 5FYJH 3KJ4B 4QGTA 5AOMA 3VD3A 1BQHA 1LO5A 3QCUL 4MLIA 3KYKL 4P5TA 5LXGL 4MXWL 4NC2B 2NUTA 1B9KA 3OHXA 4U1MA 1FFTB 1TQCB 3WNOA 2HN7B 4NC1C 1KCUH 2LTQB 1ETZA 2EVJA 5CHNB 5D1XB 5D1ZC 1ZS2A 5BZXA 4EKXA 5C0CA 4URTB 4IEFA 5E6IB 4WI8A 4KKAD 3ARWA 4H20H 1R1CA 1WZMA 2NXZB 1ZGLA 4OF8A 5MHSE 2VERA 3GLZA 1IC7H 2DM4A 2L7JA 3VFPB 5C2BH 3MUHL 5E0FA 5EN2A 3DHMA 1AOZA 2X6UA 1MPAL 3KW8A 4OCRH 2IGFL 2JI3A 5D1ZD 3E8VA 2B5IB 4LBEA 3S34H 2QBWA 4GI6A 5LQBL 5HYIA 3CN1A 5HHPA 3VGGA 4LSVL 4YBHA 1F90H 3LX9A 2VR3A 4XCNA 1X9RA 2PR4H 3IPFA 1FO0H 3HHSB 1I7TB 2XQ0A 4PJEE 3T1FA 4L9LB 1A6PA 3GMOB 4C8XA 3AJ7A 1J1XL 5C6PB 4YSPA 4WNQA 5FFOA 3BQUB 4J2QA 4YHYC 1IAKA 1X5AA 4QJ4B 1NCWL 1XMWA 3IFNH 5EZJA 4OBSA 2B1HH 1UT1A 1UD2A 1ORSB 2WXRA 3VQ2C 1F1GA 3SDCB 3MCKB 3SKJL 3OTTA 3MI6A 1FE8L 3BMVA 4P2OD 2C34A 1I8KA 4ALAL 5I66B 4GMSH 2GHZA 2NY1D 2X4QA 2CH8A 4LHQB 4EIZC 1BFSA 4D8PB 4K3EH 2K3TA 4NWTH 4PG2C 3ALPA 3BIAX 1WBXA 4FNTA 4L4TA 1WS7A 1DBJH 5B21A 2DJUA 1CBJA 3DRQA 3C9NB 4FHKA 4QRFA 3E6HA 3D05A 4A6YB 1QLRA 4L8DB 2FAUA 3EJZD 1NL0H 4OM1H 3W11C 7CGTA 3VH8B 4XO8A 4FOMA 4Z3EA 1BYOA 1B2WL 1GMEA 2CIIB 3RVWC 4U1SA 1OSPH 3HE7D 1MLCB 2DQCH 4YIQA 3WS6C 3I50H 3V4LA 2C3XA 3QDGA 3HKFA 1N12A 4DETA 4Z1PA 4WW2C 5IF0A 4ELKB 4EUPH 4LCIH 1MCHA 3BJLA 4HPOH 2HT4D 3SKNA 1R5WB 3DTXA 3GJFB 4QOKD 5FHAL 2DWXA 5IVXF 3MLVH 4Z3JA 4Z77A 3GSXA 1BJMA 1CBVL 2XRAH 3QNZA 2GBTA 3RURA 5BCAA 4KK8C 2PR9A 5I15H 3KG5A 2XN9D 4PTUA 4XO3A 4OQ1A 3UTTA 3HMXH 4F7TA 4EAEA 1CFVL 1MFNA 3AREB 1JV2B 2IPUG 3VDAA 4F2EA 2NQDA 1G9NL 1XGRA 4J3VA 1AANA 3LH2H 3DXAA 5D1QD 25C8H 3S37H 1S2EA 1JPTH 4NQCD 5EFIA 5GRZA 4HIEB 5G4MA 2Q20A 3GMOA 3MCYA 3S3JA 3DMMD 4J7RA 2UZPA 3U82B 1NIFA 2XV2A 4NXSA 1G0DA 2QQQA 4LVNB 1OCOB 2CUMA 2AJVH 1KT2A 4LARL 4OFVA 5DMGC 1R0AH 1CPUA 1O5PA 4OF0A 5MI0B 4I13B 5J12C 2W94A 1CFNB 4U4IA 3WS6A 4GKSB 1NPJA 5FO8B 2JB6B 4U1HB 1IIIA 1K85A 1RZFH 3PAZA 4AYDC 3H2QA 5KG9B 3ASOB 2WAQA 3BXNA 3SBWC 1KXHA 3ARXA 3KH3A 3ZT6A 4NXKA 1MCOH 2QKIB 3T5WA 5KSAC 4XNXH 4XVUD 2Q6WB 2XA8H 4HJUA 5IMOA 1X4XA 4QHUB 4QD2E 5F9WB 1Q9WA 4FLSA 5ADPH 4CILA 5I0ZA 3DLQR 2C4FU 5CWSB 5E8OB 1C08B 2PLTA 3O6MH 1YDPA 1RZJC 2VN3A 3VG9C 2V9UA 2NT1A 5GS1A 4GG6E 5CEXB 1QABA 3SY0B 3F12B 4JO1H 3GXNA 1TQCC 1WT5C 2MMXA 2J4WL 2VERN 2YOAA 4N5ED 1JN6B 5CNHA 4UINH 1YUHA 2X1WL 3NDZE 4POUB 5KYWA 1A14L 1OPGL 4Y9CA 3GSXB 4I3RH 1W0WA 2V6HA 5EEUA 3SKUD 3B7SA 3FJTA 3HAEG 4HZLA 1MWAA 2WGNB 4ZD3L 5JPMB 3QRFM 5EWIL 1CI5A 3BWAA 1D6VH 2PO6A 3S4SG 4ZQKB 2BP8B 3JV5A 3P0VL 2M83A 4HC1H 2NQCA 2OMVA 4X6DB 5ES4B 1T89C 3WU1A 3FQ1A 5F71A 3QO0B 3NK3A 3UZVB 2ZICA 3PPSA 3WFDL 1FAIH 3QI9D 1WCBB 2DD8H 2FL5B 2ZOLB 4N26A 3W1ZA 4D0CB 2EC8A 4E9YA 1GGYA 4WV1C 3MZTA 3VFRA 4F7PA 5JZ7C 1MAJA 1BF8A 1D6EB 1KTJA 4FCAA 4PJ9D 2CBMA 1ADQA 3ZW3A 5T1MA 1XCQA 4UM9B 5BO0D 1ULVA 1Z5HA 2YD0A 5F3HB 1BJ8A 3QIBA 1NQBA 4HEPG 1C12B 4W9GC 1HYSC 3AU1A 3GRGA 1R4XA 2FDBP 1IEAA 1WGVA 2R0LL 4BWT