4P5SA

Structure of reduced w45y mutant of amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTYINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title The sole tryptophan of amicyanin enhances its thermal stability but does not influence the electronic properties of the type 1 copper site.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4p5sA00
2TSAA 2B3IA 2IWFA 1BYPA 2PCFA 1BQRA 3EH5B 1E5YA 5TK4A 4F2EA 5I6MA 2HRGA 3D12B 1PZAA 4K9JA 2YAHA 3CDZB 4HCIA 2EILB 1AACA 1JVOA 2XVBA 3H4HA 3MBWB 1AZCA 3CVDA 4HZ1A 4YL4A 1TKWA 3CZUB 4G7SB 4HALA 1ILSA 4YSSA 2X87A 1NPNA 4M3HA 2MRYA 3OMAB 1OE1A 3U25A 3CDZA 2J57A 2IWKA 3NJJA 2BWIA 1PLBA 1X9RA 2OV0A 1WA2X 1SHWA 1AS8A 1NIBA 1AZUA 4E9TA 5I5IA 1JOIA 1B3IA 1E65A 1BXVA 3FQ1A 3X1GA 1OCRB 1M56B 1KYAA 4GP5B 3OMNB 2YAEA 3HEIB 1XB6A 3WIAA 1L9SA 5B3SB 1DYZA 3S8GB 3TBBA 4YSCA 3C75A 2FT6A 3V9EA 4TXVB 3FU9A 3UACA 2IDUA 2UXFA 2LLNA 3N55A 4AKOA 3S3BB 4G72B 1PMYA 2BWDA 4W1TA 2E86A 4HCGA 4DPBX 3NSFA 2CCWA 2HX7A 4ZK8A 2VW4A 1A65A 3TU6A 1AG6A 2VM4A 2FT7A 4WKXA 1PNDA 2MTAA 2CBPA 2IDSA 3L45A 4BDVB 1MZZA 3BQVA 3FYIB 4HHWA 3G5WA 2AFNA 2J5WA 5D4IA 5ANHA 4DP0X 3ERXA 3TA4D 4DP5X 3NYKA 5F7BA 1CUOA 1KBVA 2BZ7A 2EIKB 3NJIA 1MZYA 5B1BB 3UAEA 1NPJA 3WKQA 2XV3A 1ET7A 1AOZA 1KDJA 2DWSA 2XX0A 3IBOA 1DZ0A 1AQ8A 2VSKB 1MG3C 1FA4A 2DV6A 2DY2A 4DPCX 2EINB 2JFCA 2PPFA 1ZPUA 1KDIA 4YSEA 1HAWA 1GY1A 1KV7A 2ZOOA 3ABKB 2VSMB 1R1CA 1PAZA 1NDTA 1V55B 3S8FB 4KNUA 2HRHA 3DKHA 4GXFA 2I7SA 2XV2A 1F56A 2I7OA 1EHKB 3WI9A 2TSBA 4PAZA 2HXAA 3CVBA 1J5DA 3FSZA 2OJ1A 1QNIA 1E30A 1SJMA 2WO2B 1CYWA 2QDWA 1ZIAA 2PPDA 4KNTA 4E9QA 2XLLA 1AS6A 1SFHA 2EIMB 1WS8A 3DTUB 1GS7A 1KCWA 1W6LA 4UANA 4W9ZA 1QLEB 4NAJA 2HZHA 5I26A 3PLYA 1HFUA 4DP6X 4AI7A 5B7MA 1OCZB 1QHQA 3X1NA 5EHFA 4AKQA 4DP4X 2HX8A 2IWEA 2XV0A 3KW7A 4ENZA 2YXWA 3FYEB 6PAZA 1AG0A 1SDDB 2QPEB 1L9TA 2PPEA 1ZDQA 3AG1B 2PP7A 2FWLB 4E9XA 1OE3A 1JERA 1NICA 4GP4B 3FPXA 1NWOA 4BXVA 1ILUA 1XB8A 1JXDA 1SDDA 2BHFA 1PNCA 4QKTA 4WTQA 1AZBA 1JVLA 5I6LA 1HAUA 3WG7B 2VMJA 3PCYA 2GB2A 3EH4B 3TBCA 3FU7B 3NP3A 2XU9A 4YSRA 2CJ3A 1GS8A 2UX6A 1L9OA 1M9WA 3CG8A 1URIA 2QT6A 2CALA 3NJHA 4KOCA 1T5KA 1ADWA 1SHXA 1WA1X 2GSMB 5B1AB 1ZDSA 1TEGA 1SNRA 3KW8A 4G7QB 5I6PA 3UGEA 3QJVB 1ET8A 3QJTB 2BP8B 4BXSV 2FJSA 1FWXA 3WNJA 2UXVA 2BW4A 3X1EA 1GW0A 1IKOP 1FFTB 2QDVA 4G70B 3AG4B 2BZCA 2FQFA 4KO6A 3ZX1A 1ET5A 1JXFA 1PZCA 3T6VA 4BWTA 2BP8A 4HIPA 5A7EA 2JXMA 3X2QB 4EF3A 3JT2A 1PLAA 1PLCA 2DWTA 3SBPA 1A3ZA 3WKPA 1XMEB 1J5CA 4A2GA 4A2EA 4Q89A 2P80D 5I6OA 5F7AA 5I6KA 3T9WA 4E9WA 4JKNA 1GY2A 2XYBA 3ABMB 3GDCA 2XUWA 2Q5BA 1JZIA 1E67A 4BK5C 2N0MA 1L9QA 1TEFA 3EF4A 1ZV2A 2P80A 1GS6X 5B1KA 1KGYE 3AZUA 2X88A 4KOBA 4HCFA 5PAZA 5AFAA 1ASQA 4BDVA 3ASNB 4HAKA 4UAHA 4YSQA 1NTDA 3GYRA 5B1JC 1EZLA 1GYCA 3NJGA 4HHGA 3SQRA 3X1FA 4BWUA 5D4HA 2PPAA 4GY4A 1A8ZA 2XX1A 2GC4C 1X9UA 1ASPA 3FU8A 3NSDA 2GIMA 1A4CA 2Y69B 4A2FA 1GR7A 2CAKA 2PCYA 2WSDA 5AKRA 9PCYA 3UADA 4P5RA 2WO3B 3IE9A 1AS7A 1A4AA 1MDAA 2ZWNA 4AX3A 2XXFA 4UF7C 1SFDA 5B7FA 1AZRA 1IBZA 1V54B 2PPCA 4YSTA 4DP7X 4KO9A 1PY0A 1NWPA 2H3XC 2YAQA 3QJUB 1KBWA 8PAZA 2FTAA 1ASOA 2VM3A 2W8CA 3QJRB 3T6ZA 3T6WA 3EH3B 1PCSA 1OF0A 3FQ2A 2XXGA 3AG3B 1RKRA 2YAMA 4YSAA 1IBYA 4F7KA 2NRDA 3BVDB 4KO7A 5I5MA 1RZPA 1YLBB 2CUAA 3HB3B 2Y1AA 4BWWA 1I53A 3H56A 2EIJB 7PAZA 4Q8BA 4M4RB 5TK2A 3OD3A 1NIAA 2OCCB 2YAFA 1V10A 1JZGA 3NT0A 1BYOA 1BXAA 3AG2B 3PAZA 3X1BA 1SF3A 2BO0A 3NJLA 4L0PB 3T6XA 3QQXA 1JZHA 2VW6A 3ZIYA 4G71B 4YSDA 2IAAC 3SBQA 4DP2X 1VLXA 3S3CB 1CURA 3ABLB 4JHUA 3V9CA 5IY5B 1TU2A 4YSUA 2DYRB 2B08A 2Q9OA 1E5ZA 3RYMA 4CSZA 1AANA 2YAOA 3FPYA 4F2FA 1ZIBA 4KO5A 1OOWA 2A3TA 1JZFA 1BAWA 3FU7A 3ZDWA 1AZNA 3FSAA 2VN3A 3IN2A 5FC9A 1JZEA 3PPSA 2YXVA 5PCYA 2GI0A 4QLWA 3FS9A 3S3DB 1N70A 2UXTA 1AAJA 2RACA 4E9RA 4GYBA 4NERA 2J55A 1J9SA 2HLEB 2J56A 1KCBA 2PLTA 2XWZA 2ZONA 3AW5A 3FSVA 4N4YB 2W88A 3FSWA 2H47C 3IN0A 5I6NA 3QJQB 3PXLA 4P5SA 2PP9A 3CVCA 3GXUB 3PAUA 1OCCB 4A67A 3DIVA 3NP4A 2FQGA 2HX9A 2QPDB 1WS7A 3NSYA 3EHBB 2GBAA 4MFHA 2AANA 2IDFA 1JXGA 3ZBMA 1UATA 3UABA 4DP8X 4E9SA 1RZQA 2FQEA 4AKPA 1W8EA 3AY2A 4N8UA 4A68A 4FAAB 1J9QA 2I85A 3IEAA 4NB7A 1IC0A 1W6WA 4KNSA 2FQDA 2VW7A 4RH4A 1J9TA 1NZRA 2FNWA 4JHVA 3ASOB 4DP1X 4YSPA 4E9YA 1OCOB 1XB3A 4YSOA 1L9PA 7PCYA 4PCYA 2R7EB 6PCYA 1PF3A 2H5UA 3H4FA 4FA7B 1NIEA 3N2JA 2AVFA 4X4KA 3FQYA 1ID2A 1NIFA 1A4BA 3FT0A 2IDTA 4GP8B 4AZUA 4DP9X 2DYSB 3NJFA 1CYXA 1RCYA 2R7EA 3UAAA 5D4JA 2UX7A 3ABGA 1BQ5A 1GSKA 1WA0X 3NJMA 1IUZA 5I28A 3NJKA 4YVNA 3OMIB 2BW5A 3T71A 3NJNA 4E9VA 1J9RA 3OQRA 3JTBA 1OE2A 2UXGA 4G7RB 4CSPA 1BXUA 2ZXWB 1M57B 5I5JA 4YVUA 1NIDA 1MG2C 1BEXA 1SF5A 1WAEA 2BP0B 3PAVA 2YQBA 3OM3B 2AZAA 2AZUA 4A2HA 5LDUA 3QPKA 1OV8A 1ETJA 2YARA 2JKWA 1AR1B 4A2DA 1N68A 5E9NA 5B7EA 1L9RA 1NINA 2IH8A 2BP0A 4A66A 1CC3A 2FT8A 3QJSB 3WNIA 2GC7C 2GHZA 3TASA 1JZJA 1BQKA 1AIZA 2YAPA 2IH9A 5B1JA 3MX0B 3NSCA 2PP8A 4DPAX 5AZUA 2IDQA 3SBRA 1PZBA
chains in the Genus database with same CATH superfamily
3X3FL 4AVHA 2GTWA 5ALCL 2VIRA 2ZAIA 2UY6B 1CE1L 4HMCA 1GCFA 2DQEL 4F2EA 3MXWL 2MQ3A 2YAHA 3ZHLA 1EJOH 4PLOB 5SWSE 3GJEA 1LWHA 2D0HA 4HZ1A 4K5PA 1NC4A 1ONQA 2WZPA 4HALA 4M29A 3E6HB 2AEQL 5HGGS 2X6UA 2XXCB 5D93C 4D9QE 4ZUVA 4ZQTA 4MQSB 3IRZA 4HXAL 1UGKA 2NSQA 1A4JA 3KLAB 4PJHA 4R97C 4TLKA 5T5NG 2OSYA 3EOYG 5HYJE 1PLBA 1DVXA 4FQ2L 1KPVB 2LU3A 4NKDB 3TZVB 1W0WB 4HKXB 4KWUA 1JOIA 3EOBA 3II1A 2XN9B 4R3SB 5DD1L 2GAZB 5CCJA 4FMVA 4BJLA 4P5TB 1XR9B 2BIIA 1XB6A 5T33L 2ZYSA 3UP6A 1E2WA 3WIIL 4DN4L 2DRUA 4MHHG 4Z7WA 3G5ZB 2FECI 2WGXA 4S1DD 2VMDA 4YSCA 4JG0L 3FFDB 4NQVB 4XXWC 4TSAH 2EC9U 4FXGB 5K1VA 3UACA 2F08A 2LLNA 1IGIH 2ZYRA 4GBXC 1PDKA 3PIQB 1TVHB 1CBJA 2Y3AA 4IBTA 4YHML 2OMWA 2DYPB 3GKZA 1HQRA 5KYYA 1UCBH 1JZ6A 4QHKI 4FYTA 2Z35A 1AE6L 3CMOL 3GXTA 4YHPB 4D7BA 2VLLB 1WK0A 1L0QA 5E9DE 4U1KB 2H7WA 4OCSL 4GKSB 4DOHB 1QWHA 2IGLA 4LLDA 4HUVA 4P8QA 3AREC 3BWAB 2X1QA 3G5WA 1NAMA 1TNNA 4TULL 4X98B 4XPTH 2BVQA 5KSBB 1S46A 3VRJB 1V3KA 1CDUA 5EO0A 4ZW7A 5I8OH 3S3PA 1D5BA 3VQLA 4OW6A 4BFBD 4PJCB 1KDJA 3DGDA 4Y5YB 3K4AA 3O4LE 2L04A 2QSCL 2ARWA 2WQWA 2FDBP 2P44B 3GGWA 3QWOB 4XMXA 5IG7B 1P7HL 1OP9A 2DV6A 2EDDA 4P46A 4FLHA 4C56D 5LNEA 3HS8A 4GSXA 1ZTMA 2EINB 2P5WE 4YWGH 1SOQA 2BP5M 2ZUQC 5KJRL 1MCCA 3TM6A 4PGCA 3TCXA 1E8XA 3L9EA 3MACH 2NSXA 1HL4A 1YN7A 2PNDA 1QPKA 3VMNA 4Z3IA 1NAMH 3QZOA 5CLTA 2VSMB 3HR5A 4KNUA 2HRHA 4FQ2H 2I7SA 2XV2A 2QEJA 1CT8A 3UGUA 5KW9L 4PJGA 2HXAA 4N6QA 1J5DA 4FDWA 2EIEA 4V1DA 3VXME 2V17H 5EORL 2X05A 3QYCA 5IJKC 2K70A 1D3CA 2FGWH 4TVPL 3DTDA 3D2TA 3D39A 5CGMA 4B7LA 1RZJC 2R8SL 2C4XA 2G5BA 1OKEA 3BIKB 4ZUUA 1I7RA 4KK8D 1QLRB 1UCTA 1NUGA 3D25B 2GBUA 3GIZH 5EHFA 3IU4H 5HGHA 3TJHC 4FQJH 1BFVL 4AKQA 4XOCA 1XF3A 2IWEA 2CMRL 3GINA 2OMUA 3DURA 3VSQA 1S7WB 4LHUD 2A6JB 5TE4H 4ENZA 3Q06A 3SE9L 2BSCA 1KV3A 2D31A 4LP4A 2SEBB 3BRGC 1BXXA 1KIUA 4AZ8A 5AG8A 3FH8A 3CDYA 3QW9A 4AWJC 4AIXA 3EAKA 5MI0B 4JEGB 4TUJB 3ATDA 4UQIM 4ZZKA 1KFGA 3I84A 2WBJA 4JDVA 4UU9B 1VFBB 3S5LG 3VD5A 5ICXA 2E6PA 4ONHB 3C09C 1YPZB 1T04B 2RCSH 2WLIA 2YA1A 1ML0A 1N6VA 5ANMA 1PNCA 2X09A 4PWEA 5E24E 4PWFA 5I6LA 1QI4A 4JY4A 3AMLA 1A6TA 2E75C 3EH4B 2YRPA 2LGNA 4YSRA 1CFQA 1FJ1B 4OF7A 1JTPA 3DX8B 2VB5A 1JHTA 4R9HA 1T20A 3K91A 3NFPA 4P23D 1FH2A 1V7NL 5JORA 1QUNB 1EPFA 3IJYB 4OM0L 5CN2A 4D0DA 3FN0L 2BNUB 3TNNB 3SDXF 3VNYA 1KZQA 1TXKA 4CRPA 3DGGA 4I85A 4ALAL 5CBAA 2GSGA 1W72H 3NJXA 3NZ8A 2WSKA 4UIKH 1BIIA 4UT9L 2QR0A 2ICWA 4GKLA 1ODAA 5CFAA 3WFHA 3O6KL 4W4OC 2HN7A 3AABA 4LAQH 3WJJA 4MJ5A 4APQA 2OMYB 2W65A 4G70B 5T1MB 5DJCA 1UJ3C 3B9AA 5HJGA 1RHHB 2CJUH 2OLDA 2R1WA 4MMZA 5DD6B 3P3RA 4BWTA 2VSCA 4JJ5B 1S78C 1Z9OA 3NCEB 3VNZA 3X2QB 1YEHH 1CZ8H 1QA9B 2BLFA 5D1XE 1AYRA 3Q9PA 2GABA 2CMRH 5AOIA 4A2GA 4QRSB 1U8QA 1MRDL 4G7VL 4DZ8A 1F86A 3SE9H 3T77A 4HFUH 3HI6L 2NY1C 4HGKC 2VISB 4U1SB 2XNAB 2XYBA 1HL5A 4RAHA 2OS7A 4PJ9D 5CAYB 4OCXH 2ED7A 4KU1A 1JZDC 2BHZA 3RFZB 4Z7UB 5F88A 3G6AA 5F0JB 4AYBA 3HLAB 3BZ5A 1IILE 4JO2H 5EIQA 1KYOK 5FLVA 1TTAA 4NM4H 5FYJE 3CFKB 2Y7OA 5FECB 1EO7A 4BH7B 4X50A 1I8IA 2EICA 4PJDF 5IQNA 3N42F 4CU8A 1DUYA 1DEEB 2BY3A 2IG2H 4GSDL 1CMOA 1TZHA 2Y69B 3BKJH 3L9BA 2PCYA 4KAQL 2KI6A 4OM0H 1S9YA 4C56A 4NP9A 2NT1A 3KYOB 3GK8H 1NMAH 3OXSA 4R6UA 3VD1A 1MAKA 5LB1A 3CC5B 1AZRA 4FQIL 1IBZA 2QBWA 4FTVE 1G0YR 1ADQA 4WK2B 3GM0A 4NNXB 2VDQB 3QJUB 1F3DJ 5EA0H 2P5EE 5JA8B 1ZE3C 5E8EA 4LLWA 2A9CA 3EF7A 1B0WA 1OF0A 3HHSA 5D7LA 2C9XA 3TJPA 3MLUH 3PJSB 3RA7H 5HJ3B 3AACA 1RZIB 2OW6A 2B2XH 3K2MC 1RZPA 3KL0A 4QHUB 4GXUN 4JANB 3MGOA 4JGMA 4YDKH 4BWWA 2M83A 1I53A 3GEFA 1A14L 1KN4H 1Z3RA 4G9FB 4U4IA 7PAZA 5IJVB 4PRPE 1AGEB 4J3SA 1ANUA 4R4ND 3QXVA 1RIUL 2CCVA 2JJUA 3RVVC 2OCCB 3QUYD 5E6SB 1I9RH 4WAFA 4ABWA 3IE4A 1I8KA 3WN6A 2VXTH 4Q0XH 5HBBA 1E43A 1T2XA 3WHXA 1YY9D 1XR8B 4CVZA 4FHJA 4LHUA 5CEYB 4UQBA 4GS7B 1P5VB 4BA8A 4KKBD 5KAQF 3OX8B 5IFHL 4DF9A 1KEGH 1UACH 1KACB 1FYHB 4MCNA 3PDDA 5CJ5A 4I4WB 3KWXA 1CURA 3FUJA 5T1DL 4LGRB 1WFIA 3HBQA 1TU2A 1MHPL 3RZCA 2CXKA 1BA9A 4Y89A 1SGKA 3ZL2A 3PQYD 1Z6JT 4GMSH 1IAMA 5JDSB 3CZFA 3ZIMA 1T89A 5D4QA 1N5AB 1OAZL 2ATPA 3SPVB 3C6EA 5EUOB 5BZDA 2K4AA 5DD3L 3FSAA 1PQZB 1BAGA 3SBWC 2UYLB 2VN3A 1FBIL 3CLWA 2XC8A 2X1WL 4G6KH 1NLDL 5EDSA 3PPSA 3IGAA 3CVHL 4PV1C 3FS9A 1AAJA 3JWOC 4JY6A 3W56A 2HLEB 3PF2A 4P9ML 3FTSA 2DD8L 5ILTL 2G2NA 1FPTL 2BZDA 2I60L 3QDJB 1LP9E 1JGVH 3MRBB 2Y5EA 1CL7L 3PP3H 4X80L 4WWOA 5C7XH 3BGAA 2C3VA 2BIOA 3NDZE 3BO8A 3UZEC 2CSPA 3Q05A 3DX6B 4LSTH 4WGKA 4X83A 5DJ0A 1AGBB 2H6UA 3ZRFC 3S3JA 4PJAA 2WLJA 5IHBA 5FW6A 2C4FU 4G1MB 4F7TB 2ADYA 3CFDA 1INQB 3BUYB 4QRQA 3G6JE 4HIJA 4PJ5D 4MNGA 4JCMA 4UM9D 3E6FB 4MXWL 1S7SB 2Q2EB 4HJUA 4YUEL 1P53A 3Q5TA 4DP8X 1OHQA 5BS0B 2Z7ZA 3P4OA 4YEEA 3U9UB 3VXNA 4LARL 1T1XA 4FAAB 4Q14A 4P4KB 4X0NA 1CR9L 3QWRA 4BK8A 1CPUA 3ZE2B 1IC0A 1AR1C 4ODXB 5F44A 4KK8C 3MMEA 4J8RA 3UJJH 3GXPA 3RDTC 1UM5L 4LRIA 5EBLB 1YECL 2XBTA 3B5TA 2E8ZA 1M7DA 3DTXB 1XIWD 1NUFA 2J6EH 5KUMA 2XACC 1NDGA 3AUWB 2NY7H 5AOJA 1AY1H 4F37F 4MJID 1H3VA 2E7HA 3ZDZB 1ZT4B 2EO1A 2UVEA 2WKOF 2B1OA 2Z8RA 5AVXB 4AZUA 4ZMQA 4NWTH 1IBBA 1KB5A 4G5AA 3BDYH 4EEEA 5BOJA 5H35B 1NBZA 3K1KC 2W07A 2JJTA 4HLZH 3MDJA 1VFMA 4LXFA 4CL7A 1S7RA 3KGTA 2ZSWA 3NJNA 2HVJA 1DN0A 3HC4L 5DFAA 1TNMA 4Z23A 1J9RA 1CL7I 2WMPA 1BXUA 1YZZA 4P23C 2F54A 2N7AA 4C58B 2MPVA 4OZIB 3WN5A 1VAHA 2A73B 1MCFA 4KZDL 5AVUB 3B7UX 4J3OD 5LNGA 3VXTB 2CR6A 1JWUA 1MCQA 1OV8A 3BZDA 4F9PA 4KFZC 4XVJH 2X2YA 4X99A 3BUQA 4PHZA 3EGXA 5DEGA 1Z5LA 5CNHA 3BAYA 3RWCA 4P5TC 2EDWA 4JZOA 1NINA 1MNNA 2AABL 1U3HB 4X4MA 2JKXA 1I75A 2FT8A 1K2DA 5DRXA 3UBXI 1CBVL 1HEZB 2WZ0A 4XNAA 1FORH 5CD5D 4PRBA 2BOBB 2YAPA 3LVEA 4HU8A 2ITDA 2W80C 4X9IA 2ZWYA 3E80A 1UVQA 4K7PY 1B90A 4QRRB 4FLQA 3B9DA 4K8RH 4MQXC 4XMKH 3TH4T 3B43A 1BM3H 1Q1JL 1IFGA 4HS3A 3S98A 1E3ZA 2YPLB 4W9FC 3WD5H 4AW4A 1PZAA 5L9DH 4PJ9C 4FNPA 3RU8H 3MOAH 1N59A 5C3LD 5HYQB 2H4EA 3PQYA 3DRQB 5KVFE 4PG2C 2MOGA 1KPRA 1JNHB 4U6YA 1LGVA 4YL4A 3GSQA 3MNZA 4KZCA 4UDUA 4JKPL 3TH2T 4EZJA 3CSBA 4POUB 2XJLA 4KQ4L 3FT4B 1U8NA 4B50A 4N2FA 2WXJA 4FP8L 2XIDA 1KYFA 5HDWA 2YZ8A 3BQUA 3EOAA 3CFBB 2WTPA 3I2CL 2R0LL 4NQSA 3ULSA 3QJHB 1HHKB 3HC4H 4UV7H 3VSUA 3DV4B 4E9TA 5C6TH 2D9QB 3EOTH 5D1QD 4LU5L 5JW4M 1RU9L 1XH3A 4AQ1A 4CVXB 2F1BA 1MVUA 3LXAA 4NO0B 1L9SA 1ZLDA 3QG7L 5D9SA 4MLIA 1NGQH 3SGJA 5LBSL 4TVSa 1G6RL 5E4OA 4NM8H 4EXPX 5JIKA 3FO1A 5J9PB 4WUKH 1FAIL 2AABH 3GUFA 1CDHA 3UZQB 4LEEA 2AXWA 4PJ7F 3TU6A 1VF5C 1PKOA 2H9GA 1YEKL 3ECVA 4P4KD 4WI5A 2F74B 3EO9L 3ULVH 4APXB 5C0GB 5GS0L 2F0CA 5GZOD 5KBPA 43C9A 2X4OA 1VDGA 1XGPA 4FHKA 3U7WL 1QD0A 5EBWA 2E7CA 3NYKA 3HPLA 3QUML 3OKEA 4KQ3H 4AM0B 4WW1A 2G5UA 3QUYC 4NOFA 4OZFA 3RIAK 4DW2L 1TZIB 4QOKB 1P5UB 3H9HA 1FG2A 2IANE 5GGSB 3SE8L 4LF3B 2Y06H 5L8KB 5MI0C 4KJWD 4PRIE 1RUML 4QNPF 1QYGL 3B2DC 1FUNA 4TNFA 2MPAL 4UDTA 1H6UA 5JPNA 4ONGL 2N1KA 3O45B 4WWNA 3OKLA 3PWJB 3WAJA 3QR0A 3CV5A 1JZ2A 3SE4A 2VSDA 1KV7A 4MJIA 5I0DA 2BNQD 1N26A 1YEEH 2EUVA 3CUPB 1R1CA 1IM9B 1V55B 2O5ZL 4JFUA 3L9YA 1SUJA 3REVB 4D7PA 1JHKL 4HIHA 1HS6A 3MYJA 4JHAH 4M6OL 4M8UA 2LLGA 3BESR 4OZFH 1W0VA 4CBPA 1JGUH 1Y18B 3T2OA 1C12A 4XPGH 1QNZH 3G5VA 2AV1B 3S5YA 2NXYB 1FNGA 2DTSA 4O51A 2Y5TA 3RPIA 1UXWA 3R1GH 1F5WA 1HESA 2EIMB 4Q7DA 3SYOA 1JNLL 1KCWA 1JV2B 3O3EB 3NK3A 1RURH 4NAJA 1WYJA 1NDMB 4I77H 1ZT1A 1O7VA 4JPVL 5F6IC 3MGAA 3SQBA 5KEZA 5I1GH 1U3HD 3OR6A 1SJHA 1HZKA 3LB6D 2J44A 3BP4B 3GM8A 4HOXA 2NYYD 1YEKH 4FABH 4B9KC 2AK4D 1E6OH 1U95B 4FQHB 4IBQA 5FUZH 1K4CB 2LE9A 1SEQL 1NGPH 3AG1B 2OMZB 2ZXQA 3ESOA 2I32A 5T3XH 3NIFB 3P0VH 4Q6IA 4UYPA 3ZLQC 3L3OA 1JMZA 2UZPA 4DW2H 4D94A 2NPLX 4EBQH 5AL8A 1JXDA 3WIHL 2IV9A 2H6PB 2OXHA 3QQ4B 3FTGA 1QSVA 3QZLA 4ELMA 2YPKB 3CSGA 5FO9A 2JKTM 1UFUA 5K9KA 1QYGH 3TL5A 3RFZC 2FLMA 3FB8A 3KVQA 4BZ2H 3MA7A 4YO0A 2C9PA 1FI8C 1EVUA 1QLEH 4JL1A 4FQXD 2BSSA 3OKDA 3QXDA 5F1KC 3QISA 1OZTG 5D1ZB 3NJHA 5CILH 3B7TA 5IBLC 3VD7A 4Z8FL 2I9TB 4KI1A 1SHXA 4HW6A 1MCBA 1TEGA 2ADFL 3DVNB 4OZHE 5A2LH 3OGCA 5ISZA 3H3BC 3L1GA 1G7IB 2XYCA 1LTXA 3DOSB 4L3FA 3UEZA 5BVPH 5GS3A 4KKLC 1F3JB 4QRPA 5I19H 3GWJA 1XIWC 3BRDA 2OSLB 2J4WH 3X1EA 4PJ8B 3POCA 3LKNB 1FFTB 4X6BA 3O2DH 1ZA6B 3HNTH 2E74C 4FNRA 2NY6D 1EAJA 3WL9A 4ONOA 5L7XL 4ACTA 3MXVL 5D1QA 2B14A 1J8HE 4LEOA 4G6MH 4PM1A 4IKIA 1ZT7A 3DXAE 1BX2B 4JFPA 4BFIA 3V8CA 1KNOB 1MIML 5IB5B 4RQQA 3LQAH 4F8QA 2NW3A 3IMTA 4WFEE 3VA2C 1KCSH 2P5PA 2X41A 5GGTA 3ECWA 3RL2A 4OVUA 1MW2A 3O9WD 3QXAA 5F7AA 4NHCL 2D4FA 5JR1L 2H1LM 4YFLF 3VB9A 1R4XA 2CGRH 1J8KA 1OTTD 5E7BA 1MFNA 5DYFA 3UH8A 5CO1A 2X88A 4ZMLA 3BSZA 1YMME 4GAYB 4LOUD 5E5UB 5GHWH 4IGBA 4MA3B 4OM1L 1MJ7L 2YGOA 2VDNL 3ASNB 4X7SL 4Z3FA 1KGCD 4JRYB 3IJEA 1KXTB 1RULH 2NZ9D 4QOKD 3U4EB 1N8ZB 4QUOA 5GGTH 2IC2A 4LKXA 2FCBA 1RZ7L 1Z9MA 2GC4C 3CXDL 5TTRA 2EVIA 3EYOA 3ES6B 3GI8H 4IM8A 1GPOH 1E8YA 5AALA 1FC1A 4AVJA 4C4KT 3N91A 4D9LH 2FD6L 2ORBL 5D55A 4LNRA 4QO1B 1CU4L 1BBJB 3BUPA 3BSZH 5E23A 4LP8A 3MBXH 5E8PB 3L3HA 3WO4B 1XF2B 1GGTA 5KANG 4G1EA 5F97E 3WMSA 2MQ0A 1GXEA 1I8UA 1U33A 3T65B 4GAJH 3P2TA 3MXVH 3T0EE 4ODWB 2F61A 4M7LT 2K78A 3GI9L 4DH2A 1SMDA 2GITB 4JM2A 3LN9A 2XN2A 4L1HA 4YHNB 3H0TA 5AAWC 3CDGA 3HB3D 2W0PA 3QUHA 5EEXA 3BISA 3UTPE 3THML 5JIIA 2WXKA 1OD7A 3JTSB 1UT2A 3ARGB 3LH2L 4M1DL 3UTTE 4YGVB 2Q6WA 1S7TA 2D9CA 4NQCD 5ESAB 2J1XA 1BYOA 4ODTH 3X1BA 3N43B 1OD9A 5A6IA 3GSNL 1WSST 3S2AA 1QR1A 4PV9B 1F00I 5FO7A 2XOTA 4NQEB 2H41A 5HHMB 3SKJH 4MGXA 4IKNA 1MAMH 2CLZB 1MJ7H 4RMTA 2FR4B 4ATWA 3FO9B 3VWJB 5DK0A 4PJXA 1W0YT 1LQSR 3L7EA 4L8DA 3VFNA 2VKWA 3LQZA 4K9EL 4NRYB 4W9GC 4DGWC 3V9CA 5AWNH 2XY2A 1M71A 1JUFA 3RL1A 4K07A 4A6YB 3GJFA 1MEXL 1MLBA 2PETA 1KGXA 1FFPB 3VH8G 3QEQD 4YBHA 5KS9F 3AAZA 3FMGL 1CDYA 4WK0B 1WIUA 25C8L 4P4KC 2WHVA 2DMCA 2YAOA 5HGBB 1BJ8A 3FF8A 4JKWA 2DQJH 2YD6A 5DZJA 5CBEB 5GZOC 4KZEL 5AL0A 3CJJA 4V11A 1EEQA 5DGQA 5IHWA 2OI9B 4H25A 1T66C 3KPPB 3N1GC 4UUJA 4BFNA 2BNRD 4JJHA 7FABH 2LQRA 2MCPL 4NNYB 3RURA 2P8PA 2FX9L 2YXVA 2ZX6A 2CUIA 5D71L 2NDGA 4N22A 4GYBA 3APCA 4X9HA 1FZKA 1Z32X 3K2UH 4U1MB 1DVFB 3E9UA 2HFFB 3GJFH 1D6EB 4MZ2A 3OZLA 4KJWC 5HHVH 2E27L 4KTGA 3PXLA 2IFFH 3BFQG 4G80A 4G8FA 5KSVA 1OCCB 4GSRA 5IKCB 4NP4H 4MLSA 1DLHB 3WYRA 2FQGA 2WNWA 3N44B 5BRZA 1WS7A 12E8H 5EU4B 5EZIH 3RWGA 4NFDA 1JXGA 1NUDA 4UTBH 1NCOA 2B9AA 3C08L 3AXHA 3QZWA 4L5FL 4L8SA 5AOMA 5D5MA 5B21A 4ECNA 4B3VA 1Q94B 2VDPB 3L81A 4UT6L 5BW7C 4I1NB 3OG6B 3O6ML 4HUWA 4F8NA 1N8OE 2H32A 3CXFA 4GRWB 4N2EA 1BVKB 4O58H 1E4KA 1O6VA 4JRYD 4JFSA 1W6WA 2Y6SD 3GMMB 3BXNB 3Q01A 4E36A 4HKBA 1IARB 3O3DA 4U1JB 3LRGA 3VI3A 1HHHB 1U3HC 2QSQA 1G9ML 3D3VE 4EI5D 4BE6A 4U1GB 2K7PA 1OCOB 2NYYC 2HJLB 4L05A 5I6XB 5BQDA 1QSFE 4F3FB 3SGKC 1HWGB 4OTXL 2X6VA 1AIFB 5LN4A 5HDQH 2R4SL 3IU3A 2OL3H 3MCKB 4AEIH 4B3EA 1U6AH 2X4RA 1KJ2B 5DJDA 1YVLA 4DCQA 4XXCA 5DJ8B 3ATEA 3NCWA 1F4YH 3NJFA 2WTOA 3P9WB 4PGZA 2W38A 1ZVSB 3ABGA 1BQ5A 3CE1A 3VA6A 3VTTA 4KTEL 2WBKA 4R26L 5I28A 4YVNA 5TQ0H 4P2RD 4KRPD 3HVDA 2BW5A 5B8CA 1NCIA 5FV2A 1IQDA 3ZE1F 2FH8A 2BERA 5L6YL 1IAKA 1TQWA 2ZXWB 1XCTA 1M57B 2WKLA 2FVNA 3Q2CA 4LZKA 4JZNA 3SCMA 2PXYB 2NUPA 1F4XH 3N9GL 3CSTA 2YQBA 3K46A 3OM3B 3SKNB 1S5HB 4ZTPL 1F58H 3NSXA 2CO2A 4U1NA 1LJMA 1B4LA 1U8HB 1F6AB 1KELH 4WV1B 5ADOH 4YXLH 2NW2A 5M95B 2C9AA 4PJFA 1DVZA 4DKAA 1EHNA 3TOPA 4NQCA 2ADIA 2GTWB 2WQSA 3OAWA 1CVRA 2VIRB 3QFJB 5DZLA 3REWA 3UPRB 4FFZH 3V5HB 2VRQA 2C8NA 3VWJD 4G8GB 4Q97A 4LEBA 3TIEB 3DUHA 3T8VA 3LD8B 5CSBA 4FFVD 4GIOA 5ESQB 1A7PH 2Z92A 3GJEB 3GMQA 1G9MH 2D3LA 3VRLF 3ARQA 1ONQB 3RGBA 2I27N 4TRPL 4ZMTA 3GXIA 1DANU 5F7NC 1KXQA 3VX1A 4F80A 4PYHA 3CC1A 4ZUVB 1UYWH 1MCWM 1RERA 4HSAC 3QEQA 1A4JB 3ESUF 1OTTC 4PJHB 3RWEA 2QPFA 3VXOB 2NNAA 2IOIA 3L5IA 1AGCB 4ELKB 3CU1A 2QADB 5JHLA 4M3KB 1PZ5A 3L2LA 3QT2A 4MB3A 5K69A 1JPSL 1NPNA 1E9OA 4WI6A 4I18C 3TEXA 3RUGA 5JDJA 2E8YA 2OULB 1C5CL 3NPSB 1HKLH 2HRLA 4KTEH 4IHOA 4OQTA 1DVFD 1LO3H 5BPPA 2FL5A 1CGSL 4Y5XB 4HXBL 1EDQA 2JJSA 4P2QA 5IVZA 5CJXA 3K7UA 3MV7E 4N26A 3SJVD 1CXIA 1IC4H 1OB0A 3FB6A 3ZTEA 5A40E 3TO2A 3WLBA 1QKZH 1A6ZA 4P9HL 3HEIB 4MZIA 4QXWA 2VLJD 3TV3H 2BFGA 2FX7H 1HQRB 3CLEH 3TBBA 2Z35B 5HHOE 1RMFL 1BREA 3IJ9A 3KWWA 4HHAA 1SN2A 1L6XA 3QI9B 3V9EA 2EDBA 3N50A 3VFUB 3FU9A 3NH7H 1ZVNA 3OF6A 4IHBA 4PGDA 1JMXA 1KJ3L 4NEHB 3GBNL 3DO7A 4HUVB 4QRBA 4LEXH 3MLPA 4OQTH 2NXYC 1NAMB 4JHWL 4ZS7H 2BVQB 3HN3A 1CFNA 4LVHB 3LPFA 3FTXA 4OLUL 1E4WL 2QMJA 3JWDC 1T2JA 2MH4A 5F1NA 1D5BB 3G5YA 2DQHL 5E70A 2VZOA 5EPMA 1EBPA 2HTKD 4HHWA 4XH2A 3GGWB 3QEGH 4HU2A 4O9HH 3T2LA 2CPCA 3HB3C 4N5EC 4PJCE 1P2CA 4DP0X 1NGZA 3ERXA 4P46B 4YS4A 4DP5X 2ARJA 1DQJA 5IESH 1ZEAH 3MTXA 4H1LH 2PWFA 3NJIA 5E94B 3QFDB 1MCOH 2O5XH 4L3EA 4WO4D 3S35L 1AOHA 4P2AA 5ITFA 3SQOH 4FMFA 4N20A 5DSCA 3F84A 2XVLA 1JPSH 3L8QA 4AL8C 1CT8B 1B2WH 3MNWA 4PJGB 1KOAA 1KDIA 4V1DB 3LX9A 1RVFH 3I02A 2AI0H 1C16B 5LNDA 3GBDA 3BC9A 5BZWA 2P49B 2ENJA 3QDMA 1JJUA 3QPQD 4JFYB 3VM7A 2F5BH 1U9KA 2PWGA 3PP4L 3ZZSA 5BV7C 3UGXA 2E7DA 2NY2D 3G6DH 3P77A 4XPBL 4KK9C 1I7RB 4AQ8C 3N06B 5CP7B 4D3CL 2O61A 5D1ZC 4F58H 1FVCB 4AIZB 5HGHB 3VQMA 1HEHC 2Q7YA 3S36H 3VXQB 3DTUB 4PS4H 3K2IA 1GS7A 3C9NB 2OMUB 1W6LA 3DURB 3HS0A 4UANA 5D7KD 3UIZA 2EO9A 1CFBA 2FWSA 5I76B 4YH6A 2D31B 5HD8D 5CSGA 1KIUB 1LK3L 2AKRA 3US0A 5D6DC 1IKNC 1NL0H 5AB0A 5IVNA 4AVIA 3X1NA 4PJ8C 5D96B 3MV8D 1T80A 1NBVL 3KM1A 5JMRA 2WBJB 3LXUX 3QFJD 3H8NA 4JDVB 4F8OA 4JN2B 4DKTA 4X6CB 3KS0H 1S9VB 3KYKH 2F5AH 5ANMB 5EOQL 2ZPKL 1W72B 3L5JA 4WTZA 4AYSA 3DX7A 3AJ7A 5I30L 3KLLA 1A6TB 1BJ1J 1DQIA 2GFBA 2AP2A 4OCRL 4CVWA 1M3IA 4BXVA 1NWOA 1IAOA 4QRUA 1CFQB 4A55A 3RILA 2XDHA 1EZUA 2VN7A 1A1MB 1JHTB 4MAYB 1T20B 3NFPB 4PB9L 2ITEA 4QKTA 1YNKL 5AW8B 1C1EL 1OGAA 1LE5A 2JCWA 5AZ2L 3AY4C 1ORQA 2APTA 3V4VH 3TWCH 4CC4C 4F8TA 5IWLA 3D4ZA 4HKZA 2CJ3A 2QZ5A 3CSYA 3V6OE 1L9OA 4G6FD 4OF3A 3DGGB 5CBAB 5C0CD 3INOA 1BIIB 4ZPVA 2QR0B 1U8IA 2CK2A 2CPUA 2Y6SC 4YL9A 1YNTA 2UZXA 3U6RA 3WFHB 4APQB 3O11B 4XMZA 4MJ5B 4ONFL 3QNFA 2W65B 5DJCB 2X4UB 2R1WB 3CZKA 1THAA 3PGDA 5EH1A 4EI5C 5LBGA 2W92A 1LO2H 5IJDC 1E4JA 1RZKL 3RIFF 1UA6H 4N9GA 1BPVA 2X4TB 5E2VH 3Q48A 3P4NA 3SJVA 1U8QB 5KOVC 3QI9D 5JHDD 3T77B 1CO1A 4GKOA 2ZICA 4RFOL 1I31A 3WO4C 1MRCH 2V8MA 3EJCA 4KMQA 2C3WA 3TFBA 3OPZL 2JI1A 5KYXA 4WK4B 2VKXA 3WXVL 4GG6A 3HMWL 3ULUC 5INCA 1MJ8L 5AW1B 1XMEB 3WFZA 3G6AB 3KG5A 1A7NL 4K94H 1R3KA 1ACYL 3O6FB 4HPYH 1JFQL 5EOQH 2TRHA 2ZPKH 1CFSA 1CI3M 1GY2A 4Y19B 1GA2A 4OJAA 5HGDA 3OL2A 5I30H 4HJJH 3BP7B 4HVBA 3DX0A 5J1TC 5JQ6L 4K3EL 3IRCA 1ZS2A 2KH2B 1DUYB 3D18A 2DAVA 1VIWA 1TZHB 3ARGC 4DKEH 4C4UA 1I85A 1U8OB 1XV8A 2NY4D 3HZMA 5KVGH 4MAUH 4FG0A 1S9YB 2EH8L 1VKXB 4DPBX 4JO3L 4QAMB 3OXSB 1A8ZA 1S7UA 4I0PA 2LV4A 3EYSL 4WO4A 3I9PA 3OXRA 5B38G 4Q9QL 2CAKA 3VWJC 5AKRA 2AW2A 1YG9A 5E8EB 4LLWB 3E1F1 1BIHA 2JELL 4YXKH 5AVTB 4N28A 1TZ8A 2L3BA 1MDAA 4FFVC 3KPNB 5D7LB 1WH0A 4KUCD 3QYNA 1RQ5A 1OAJA 2X9ZA 5D7IA 2EXSA 1JRHI 5AZEH 2Q2LA 3MGOB 5C71A 1INDH 3V0JA 4ZTOL 3MLTA 5FHAL 4NGHH 4HMEA 1YUKB 1CDJA 4D0CB 3ZHFA 4RFOH 1KCUH 1ZJBA 3KDMB 1EK3A 1SLVA 2GJPA 4O2EA 3HZ3A 1ZOXA 1H9VA 2FLRT 5DHEA 5IQ7L 1DVFC 1E7VA 3EJPA 5BUAA 4WI4A 4W9LC 2JLPA 1N2RA 4CSSA 5EZOL 3LV3B 3PAZA 4W9EC 4JG5A 4G42B 3CPLA 5JQ6H 3L48A 4BFRA 1ACZA 1TU2B 3RZCB 4LAJH 3R0NA 2XPZA 3T6XA 3QQXA 4IRSA 4FLSA 4K5NA 3U9WA 2EE0A 1WVZA 3DUSA 4GQZA 4UI2A 4MAYD 4P0DA 2Z31D 1JBJA 5IOKA 4JO3H 4WFFE 1GZQB 1XCWA 5FHBL 5C0ND 3FU5A 3LKSB 2D3JA 5BZDB 1X9LA 4KUZL 4TQ8A 5E2WL 1OM9A 1KIQA 3WE6A 3ZTNH 5C0FA 5A3ID 4NBYB 1H9DA 3QEHA 3HKFA 3B2VH 3WEMA 4JR9L 3T3PB 1FNLA 2C7UA 4WGWB 4X7DC 3IGAB 4AMKL 2PKDA 4A39A 5JUEL 1P1ZA 4JY6B 1MFBH 1MLCA 1XH2A 2WSPA 2Z7WA 3QCVH 3WJMB 3EG9B 1MVFA 3V2AR 4NKOA 3T2QA 2C3VB 3QDJE 1JZEA 4RBPH 4U1GC 4XR8C 4XB3A 2C9RA 3SZ6A 5I6XC 3IS0X 1AO7D 1OANA 2XWZA 5FHAH 3P73B 2E76C 5DVKA 4EQ3A 4CAGA 2ROYA 4ZFZA 5KSUB 5HI5C 4QRQB 5I6NA 5FA3B 2QGBA 1L0XA 2AV7A 3H7LA 5FX3A 5GRZA 4RGNB 1CK0H 4WU5A 3JT0A 3TBYA 2HX9A 3P30L 4J3XA 3H6JA 5EFIB 2ZOKA 3EO1A 1Z0MA 3BAKA 3T2NH 5BS0E 1T1XB 4XPAL 1GTFA 4AJWA 3JV0A 3BT0A 4TL4A 5DJ2A 4Y19D 2MCG1 3TA3D 3EJYC 2NY2C 4K3DL 3HJ0A 4H26B 1U41A 2JKIS 2VXVH 3CXHJ 3MRPB 4LHUG 5LUMA 3ZHDA 1QRKA 2HKFL 4J8RB 2PXYC 3G7TA 3MBED 3DSNB 4QXUH 3VSVA 1OAKH 3MV01 3NZHH 2GT9B 4KI5D 3MLVL 1NBQA 3KM2A 2E9IA 1M7DB 5FHBH 4GG8A 4HV8A 4OR1A 4WV1C 4M8QA 5HD8C 1NDGB 2VAAB 5DVOA 5J6HB 2VW7A 1TLKA 5B1CA 1SBBA 1URZA 3GMOA 5DD0L 2CCLA 3P40A 4JPSA 1IAIH 5E5MA 5JUEH 2VERN 3TEWA 4OCYL 4U1HA 1KB5B 1WDAA 4PCYA 5HI4D 3LD8C 2PYFB 1FYTA 3QNXB 2W07B 4U33A 3N2JA 4N24A 4GQQA 3BGFB 4MNQA 2G2RA 3HBPA 5CWSA 1PAMA 1AR2A 2EE3A 3V52H 1A3LH 2ZSWB 1DN0B 1CQKA 1JGDB 2YQ3A 5FFOA 1PIGA 4LSUH 5AVQB 3V5DB 1LP9F 2OR8A 2VLKD 4PV8B 2CH8A 3V4PH 1YEIL 2MHAA 2F54B 3HI1A 1UXSA 3D30A 4PUBL 4WY7L 2Q76A 3E38A 1MN4A 2QADC 1M6UA 3C5SB 4JFFD 1IFRA 5DTFA 3EGXB 4JFED 1Z5LB 4G7RB 1A21A 4IRJB 4HDIA 3RWCB 3GZQA 3F58L 3G6JF 2ZNXA 3LS4L 1NIDA 5CN3A 4WWKD 1BFSA 3NPSC 2EC9T 5DHVA 1RPUA 3VGGA 4JGUA 3I6LD 1K2DB 3UC2A 4Y5XC 5GRXG 3OAUL 5A2AA 4KX9A 4PRBB 2OXGA 4TQPA 4GXUM 4MXQC 1AP2B 5CMAA 1TZOA 3ZL4L 2RQEA 4RAVA 2H8PB 3EBIA 4MA8L 1PSKL 1N68A 2YN3A 4Y1TA 5GGSY 4Z7VE 1J5OH 1XH1A 2BP0A 2FJUB 1BM7A 3INUH 4DVBA 2GC7C 4QRRE 3KPMB 2APXA 3QI9C 3CZGA 4XCFH 3DRTA 1HXKA 4HS3B 6TAAA 3WFBL 3ARDD 4Q56A 1URLA 1LE9A 1EO5A 2DQIH 3FTZA 2VGLM 2W0LA 2ZOLB 1N59B 3N6YA 5AZUA 1TUPA 2Q3ZA 2YPLE 5DHVH 2B0SL 5JIMA 4B6ZA 1ZVHA 1A7RL 3N85H 4LVHC 3MNZB 2Z31A 5DD0H 3WNLA 4EIZC 4LSPH 3OZKA 2ZXDA 1H3UA 5E2UH 1N5YL 4RCAA 2G0KA 3NGBC 4I2XA 5F7FA 4DZBA 1N9PA 4ZG1A 2BSTB 1RJCA 2HRGA 1KJMB 3L1OH 1SXZA 3N3EA 2XTLA 1AD0A 3T0WA 3HTLX 3EOAB 4ZXBD 2VXUL 4NQSB 1MW0A 4N90E 4AUJA 2IFGA 2GY7B 2CHDA 5BZZA 3BLPX 1SJEA 2OZ4L 3R0MA 3OMAB 4O2CA 4AQ1B 2NY4C 2OAAA 1FLRH 3X3GL 5SV3A 4K3JL 4UM8B 1E6JL 2VDRL 3H9SB 1YYMH 3R4RA 4KRMB 4Z76A 5F7HA 3W11D 1AS8A 4KTDH 4PJDB 1UGNA 3CFTA 4RMRA 2XQYA 2H3KA 5CZVL 2YAEA 3RGVD 3WEBA 3QIWB 3CMGA 4PW4A 1G7JB 4ICXA 2V37A 2H9GB 3VCLA 4AEHH 2N59A 3QULB 4RMVA 5CUSL 4PTUA 4FA6A 2BWDA 4HJTA 4I9WD 4R90L 1MCWW 5FO8B 2FZ3A 5I1JH 43C9B 4M02A 4QLRA 1XGPB 2VR9A 5EBWB 1UM6H 1G4RA 4ZK8A 4I88A 3UJIL 4QWWD 4UT9A 2BIPA 1QHOA 4JFDD 3TBVB 2MTAA 4OZFB 3TLRA 4OJEH 1QSED 2CBPA 3MA9L 4V2BA 5CGTA 3H53A 4QYOA 4Q52A 1FLTX 4AVKA 1FG2B 5E00A 1GZPA 1JFHA 4OD2B 4XODA 5D96C 3LS5H 3FUHA 1BVLB 1T22A 4ZMWA 2WBJC 5JPNB 5MENE 3O8XB 3ELAT 1R47A 5CJQL 4OAWB 2WQRA 3WDIA 3GMLB 3K6DA 4JB9L 5MEQA 3T8XB 4Q9CA 3TURA 4EN3D 3M1BA 3CAFA 4WUUD 4HIHB 2XWTA 1AHWC 2C9SA 4TL5A 2D7MA 5EOTB 1C12B 2CGYA 3G5VB 4MAYC 4BZ1L 4KDWA 2LHAA 5IB3B 2P47B 2ESVA 3HI5H 4NS0A 4K3JH 3RP1A 5C0NC 4O51B 1VPOL 2Y5TB 1UXWB 2YPVL 1HK6A 1AMXA 5GS2H 4HWNA 1TETH 4PY8J 3V79C 4EAEA 2VLKA 2RJMA 3DJZA 3WI9A 3X17A 1SHSA 5DVMA 4NDMA 1ZT1B 1Y1UA 1J0YA 3SOBL 4GXVH 1BCIA 3MLYH 3HN8A 4XNYL 2GYSA 3K71B 4OBRA 2QTEA 5EWIH 2IQAA 5M94B 3EDKA 5F8QC 2Q7AA 5CM1A 4LL9A 4YHLL 5JIDA 1BD2E 3BX7C 4N2AA 1QLEB 3ESVF 2R56L 2HZHA 4WHTA 3RWHB 3HC2A 1PU0A 2A9AA 3F00A 3U0WL 3P3SA 1R19A 1BMZA 4Q6IB 1OSEA 5C2BH 2ICEB 2W9DH 5TF0A 3HUJF 4QF1A 5FYJH 3FTGB 3NUKA 1D9KA 2YQGA 1EZVY 2R69A 2YUZA 2PP7A 5K9KB 3US9A 3BAEH 1T4WA 4GP4B 3FB8B 3H9ZA 2ZD0A 3MA7B 2PWEA 4OZFG 4YLCA 4EE2A 3O6FC 2BSSB 5C0AD 2BVOA 3OKDB 1TF4A 1SDDA 3QXDB 3LXCA 3QUXD 3TA3C 5DJ6A 4HUKB 5J0BA 3QZMA 1NMBH 2J2ZA 3PWNA 1D5XA 1JXKA 2GB2A 4P49A 1IT9H 1GIGL 1Q9WB 2V3FA 3ZDYE 1A25A 2FBJL 4I3GA 4XBGA 4QRPB 4HUXB 3KPTA 3CHSA 1YEDA 2R69H 1EDHA 5EO9A 2Y1ZA 4ETQB 5IFJA 4ZXBA 4XNUL 1T5KA 2OZNA 4X6BB 4AITA 5EC1A 3WL9B 3H9SD 2Z7UA 2F7RA 3NIGE 1ZT7B 4JFPB 1E27A 1G9NL 1ET8A 4BFIB 3V4UL 4JFOA 5KVEH 4IK6A 1UZ6E 4RQQB 1EJFA 4HKJA 3U7YL 4U2YA 4UQDA 4ZO8A 5HI4C 4LCYA 3QIWD 4RESB 4LCIH 1WFMA 1N3NB 3EYFA 5FW7A 3RL2B 5I1HH 4NYLA 3QXAB 5H2BB 2RR3A 2R56H 4FYQA 2DQGL 3ZX1A 1D6VL 3KPSA 4U3SB 1PG7H 4J3OG 5F9WB 2ZUTA 2E59A 3BPLB 4MA7H 2IIJA 1JGLH 1NFKA 2X2IA 5DT1H 1I4FA 2D7QA 3P4LA 3D85A 3MJGX 4NXKA 5GRJL 3RTQD 4IGBB 5I6KA 5GISH 3U9PH 3B1TA 1DBBL 4HIXH 1U3YA 3IJEB 3IFLL 2E56A 4J1UB 3HG3A 4QT5B 5LKNA 3MRMA 3EF4A 4JCLA 3H42L 3P0YL 4WI9A 4WWKC 4LKXB 1ITBB 4HG4K 3OLGA 1QSEA 2A6KB 3GMPA 3NQKA 3EYOB 5G55A 2NUTA 4KH2A 2PCPB 3RB7A 4IMKC 4H20L 4NQQA 2VXSH 3IKCA 5TF1L 3WNMA 4CADB 1TCMA 3C8HA 4X2UA 5FA4A 3L3HB 4RGOL 5GS0D 4RMQA 3UBXA 2DWYA 1EIBA 1KBGL 2Q8BH 5EOCJ 4G1EB 2W9EL 1CLZL 4NZFA 3ARDC 3QJZA 4ILDA 1W8NA 1O7SA 5T3XD 1SFDA 3KXFA 4QY8A 1MIEH 3ULUE 3D34A 4GI9A 2PPCA 1GC1H 5BOZG 2R0KL 4LNVA 4B7IA 3U7YH 1R3JA 4JM2B 1J10A 1ZAGA 5IUSA 1ASOA 3L2NA 3MUGB 4KHTH 2A77L 3T6ZA 1JHLH 5DHMC 3KNBA 1PCSA 5AW6B 1AXTH 1P7QD 5I9QB 4WJ5B 3AB0B 4XVSH 5IBUB 2XXGA 5LGHH 4EUPA 4BSVA 2NRDA 1ZXQA 3HNVL 4ODVL 4ACPA 4KO7A 3HMXA 3QBTB 1GRWA 1I3VA 1C8QA 4Y7OC 1DBMH 4FKKA 1QR1B 4YE4H 3ZPDA 2G5RA 3FUDA 4M4RB 5DRNA 4YFDB 5CSZA 3VDCA 5GRJH 5HHPA 4KRLB 2D0FA 3SDXA 4NQEE 1OZUA 5HHME 1V10A 4R7LA 4E41B 4FQ1H 3D0AA 1ZGLA 1BWMA 2QPUA 3L7EB 4L8DB 2LU7A 4CMMB 4RGNC 3FQXA 1XSOA 1MFEH 1SF3A 4LHQB 3KWUA 1M71B 3Q3GA 2BCKB 1JUFB 3RGVC 4M5ZH 1ZK5A 3GJFB 4PP2B 3U2SB 1MLBB 3MJ8A 2JIXD 3AAZB 5BMFH 2WWKT 3K74B 4AXWA 2LVCA 3HMXH 5E2JA 1TSHA 4NNPH 5D7JA 1TJGL 3EW3B 3LVTA 2HKHL 1Q0YL 4NKIH 2Z3FA 2EDNA 4X5QA 1EMTL 1NCWL 3VG0L 1IC5H 1UH4A 4N8CH 2B08A 2Q9OA 4QWWC 2BIMA 1KBGH 2VLRD 5DVPA 2P8PB 2CZNA 4JFVA 1MFCL 2OTUB 2Z0BA 4GW1A 2KLSA 4QCIA 2A3TA 1OOAA 3DJ9A 1KLFA 1WFTA 5FYLL 5E1IA 5C0JB 2W81C 4JO4L 4PRHE 1WFUA 8FABA 4ORGA 2R0WH 2W5PA 2DQUL 1AHKA 1RSFA 5FDYA 3TT1L 5FC9A 5PCYA 5J1AA 4G8FB 4HCRH 4HIIA 5KSVB 2Q87A 4KVNL 3CHRA 5C0RL 1IE5A 3HE6B 3NCMA 5BRZB 4U7KA 4LMQI 1BZOA 4PSRA 2QHRL 3RWGB 2JJTC 3VYPA 2VRAA 3VXUA 2JB5L 3BGFC 3CBJB 3EJRA 4P5SA 2PP9A 3HFML 4NXSA 5D5MB 3MUY1 5GGVH 4GMTL 1DCLA 2JCCE 2MJWA 3RY4A 5IBUG 3NSYA 3DARA 4HUWB 2UWEB 4K8RC 5JW3H 1Y07A 2A4EA 2DQDH 2WXFA 1IMHC 4J2QA 4B27A 2IH1B 3DMMA 4YLQT 5GJTL 4DPRA 1I7TA 1MREH 1RP9A 2IGFH 4IYKA 4ZQKB 4IRJC 4HKBB 1DSFL 5DFVD 1UZ8A 1T03L 3RTQA 3A67H 4JVUA 5E8NA 2Z7YA 1ZANH 1UC6A 3KVDD 4KHXH 4RMWA 3VI3B 1RJYA 1ZHBA 2IALA 4ZMNA 1EO8H 1MCKA 3UBFA 3KMDA 3NN8A 4OKVB 3WCYA 3DETD 2HLFD 2AAVA 3ILDA 4MJ6A 1G6RA 1J11A 2WINA 5DEZA 5EN2A 2EYRB 3ZL1A 4B53A 3VWKD 5KVFH 3PNRB 4LLQA 5L88L 1UM4H 1AH1A 4HWEL 3OLIA 1FNEA 1G94A 3KHOA 5DLLA 1MFCH 4LASL 5DJDB 5EU5A 1EEUA 1L9PA 2YKLH 5AAMA 3WIFA 4DCQB 1WZMA 1LEIA 2O72A 1WPCA 1PF3A 2V3EA 1O6SB 2Q3XA 3ZXAC 4NQDD 1U8CB 4E5XA 1NIEA 4HBCL 3ILQD 4YDVA 1NIFA 2XA8H 1HC1A 2AJYH 5B8CB 4ZD3L 3P02A 3PGCA 3OHXC 1SQMA 2Z8SA 3LHPH 1S5IH 5IBTH 3QUMA 1IQWL 3TH3T 4MBOA 3SCMB 2QHRH 2QVFB 3GTVA 2JB5H 5FWQA 1P4UA 2E9GA 4L48A 3HC0A 5B4MD 1PIFA 4U1NB 3F5WB 1P7QA 3PNWB 2IBGA 2NW2B 4GMTH 1MCJA 3ULVC 3W1ZA 1IEAA 4CSPA 4PJFB 4AQ1C 2IJ0C 5KTEL 3IFPB 5TQ2H 3IDUA 2ADIB 3M46A 3REWB 3KPRB 4E41D 1MOEA 1UEYA 3LNFA 3QZWG 2H0FA 4LCWA 4LCUB 4W9KC 5K9JL 5I16B 5L0QB 2JKWA 4NRZB 2Q1EA 4F8PA 5HHNB 3QIWC 1CE6A 2WWOA 2Z92B 3GMQB 4R5TA 2Y2WA 4A66A 3QDGA 3WEAA 3M1CA 1YDPB 1NCBH 1UXLA 1Q9OA 4UOJA 3Q1SH 2BS71 1J48A 2COQA 3V0DA 4H8WH 4Z3TA 1JF1A 3BKML 3P54A 4W9IC 5E0FA 4U1IA 4P07A 5T5NF 4HSQA 5F6HJ 3J2PA 5DWUL 4OIIH 3FRUB 4FFYA 4PJHE 1PZ5B 1RH8A 3E7JA 4PTTA 4JL2A 3QRLA 1RZJL 4Z95H 2EILB 1AACA 2FEJA 2XVBA 3H4HA 4IHOB 3V6FA 4HBCH 5I8EA 2FL5B 2VLRA 4NCC2 1F13A 1HI6A 4V2CB 5FAAA 1IGML 3DPBA 3T08A 4TQEL 4G7SB 2AEIT 4FG4A 1KSRA 2CD0A 4P2QB 2WOYA 4Z7WE 4YSSA 5JPNC 3U48A 5EZPA 3O8XC 3FB6B 3TO2B 3WLBB 4UZUA 3MO1A 4WEBL 1A6ZB 3VAEA 3TNMA 3CDZA 1EHLL 2G0LA 5HGAB 2FHCA 4DO4A 4J12A 3BH4A 4P06A 3WIHA 4B9CA 3L3IA 4WHCA 3MVSA 4FFYH 1BOYA 1TCRB 3KWWB 2ALAA 2WKGA 4JG9A 1UWGH 2AQRA 1LK2A 1QEXA 1U8KA 2YLHA 4L4JA 1E2ZA 4MD4B 3WKMH 4H1LB 3O2VH 1Z9NA 2XPGA 3DO7B 4MJHA 2R2CA 3WIAA 3TV8A 5BO1H 1CFNB 2F58L 1D2PA 4NX0A 1QVOA 5F1NB 2E46A 2V33A 2WKOA 2YIHA 3MRKB 4AQZA 4K23L 4LQ1A 5ITBL 1U4FA 3S3BB 2OMTA 2EVFA 1S9XB 4ZBJA 1RXLA 3UG3A 2HFEA 1X4YA 3DX9A 3MRHA 1NGZB 1FZOB 3GJFK 3FO0L 2ARJB 5G2NA 1DQJB 4WKXA 2BXZA 3WGVB 2YS4A 4KY2A 4ODUB 1J1PL 2Z91B 2IDSA 4L3EB 2AJXH 2N7BA 4Y4FA 4FQCH 5ITFB 1CD8A 2AFNA 4Z3EA 2FO4B 4K7PX 4Q6IC 1A3RL 1I1AD 1CUOA 3NEEA 5LQBL 2ICEC 1PLGL 4LVOB 3VFOA 3VWKA 5MHSD 3I02B 2XV3A 4PJGE 3TPUA 1AI1H 3N40P 3NACH 4V1DE 1D5ZA 2H0PA 3C5ZD 3QDMB 1WUNT 3QIUA 1I9JH 2JQAA 2MSPA 5EZJB 3MFGB 3FQTA 3D39E 2QQLL 1A1NA 1IJNA 1EX0A 4MJJA 5IM7A 2O61B 3LQAC 5DU7A 2DDQL 5C8JA 2O6EA 4GAAA 43CAB 4W6WB 1NOAA 3IJ7A 3HS0B 4B41A 3JZYA 1S9WB 3BWZA 2JQMA 3TJEL 2BINA 2ROXA 2AKRB 3QUZD 2H0EA 1O75A 5E08H 3D48R 2QDWA 2SODB 3A6CH 3GEWB 1B4RA 2NX5B 4I3RH 3BP6B 5JOFA 3WXWL 4YHOL 5BQ7A 1MCIA 2DQFA 3NCXA 3ECQA 2WWMC 3KJ6L 1TEYA 3AXLB 3DX7B 2E7LA 5ANME 2E7BA 2WUBL 1NAKH 5KSBF 2GFBB 5F7MC 4ZFOL 1II4E 5C09D 1OARL 3L5WA 4NBXB 5IMLA 3CN2A 4PJCF 1MF2H 3MLSH 4DN3L 3RRQA 5LCVL 1BF5A 5LGJA 5F9WC 1ORQB 3BPLC 4OD1H 1OF2A 4HKZB 5JW4R 3IVKA 5E6ZA 3BOVA 2ODIA 4CNIA 3KL3A 4HH9A 4ZPVB 4GEJA 2QTVA 1U8IB 4JPKH 4C4KO 3WEOA 1YNTB 2UZXB 3FFCA 2VMJA 3GS7A 4M7ZB 3AM8C 5AKTA 1DHKA 4X4YA 1WBZA 4AV4A 2IDCA 1UXMA 3SDYH 3AWGA 2V3DA 3GSNA 5C6WH 5LLIC 3PGDB 4L9LB 3O41A 3NZSA 2J8UA 1JPGB 4HGWA 3SGEH 5MERB 5DR5H 2CUHA 1J12A 3A6BH 1QWUA 3JQOB 5HPMB 2APVA 1JE6A 3QCUL 4LSVL 5DJAB 2WCGA 3D8MA 3P4NB 2OR7A 1HL8A 1QBMH 3Q2WA 2O6PA 2AQTA 2X7LA 2ZWLT 3L5XH 2HUEA 4KY1H 3QJTB 3BRFA 1FRGH 5IROC 3RTLA 3IBEA 5E1HB 1DVUA 5JXAH 3QJFA 1GL4B 3UTSD 1XCQA 1CICD 1XO8A 2BH0A 4KJYA 4UV4L 1U92B 4GG6B 1CTMA 5IVXA 1QBLH 1A6PA 4N3UA 4AUUA 1C8PA 4LHJB 3ILQC 2FQFA 1QG3A 1WFNA 1E9PA 1BBDH 3FUIA 1T0NA 1CFSB 2C9QA 3WHE1 2MEJB 5JIHA 1KY7A 2JKNA 5D70L 1ULVA 4RWHA 3G04B 3SBPA 4UILL 5I9QC 3AB0C 2F53A 1YPZF 3CQQA 1OXYA 1N12A 1KTJA 2VDKH 3JYBA 2GI7A 4Y1AB 3T9WA 3ATFA 3M17A 3HZMB 4WTZG 1DQMH 3HKZA 1P6WA 4R8WH 1OAXL 1L9QA 3ZE1B 3BEWA 3JWOL 4XNMB 4C56E 4I0PB 4H0GA 1NBYA 3BAXA 3QRGL 4S1QH 3KLDA 2YBGA 3CK0H 1FP5A 3GO1L 3MLXH 1MCPL 3BEVA 1O7DE 4H88L 4Y2OB 2KUTA 5I1DA 1I1AA 4UB0L 4D0BA 1X3DA 5HHQB 4WSKA 1XGRB 3MCLH 4NJ9L 5D7LE 4UT6A 1Q0XH 2VXQA 1YJDH 5C9KA 4Y2NA 5I17A 3WFEH 4K5LA 4XMPH 2EDMA 4NUGL 3C5ZA 1B0RA 9PCYA 1DQLL 4R96A 4F9LA 4AX3A 1XZ0A 4OZ4B 2CRMA 3JYCA 3LZPA 3FRPA 4G7YH 1AGDB 4OCLC 1V54B 1U2HA 1PY0A 2X6AA 3GUTA 4O2EB 2VL4A 4YNYA 4B0MM 2EABA 1MRFH 4ZS6D 4Z3GA 5F96H 1KIRA 1J1XL 1JI1A 1T5XA 2NX5D 5EU7E 5T3ZE 4HA1A 3VFVA 4FYSA 3QUZA 4F7KA 1YEGH 2VXQH 5GGQL 3MODL 1N2RB 4PMFA 4OJFH 1AFVL 1R3HB 4P4RA 3RAJL 4Z7UF 1KJVA 3HE6C 2XWJA 2Z1PA 3VXSA 2DEYX 4XOBA 1LDPL 4IRSB 3VJ6B 3FBKA 4BSWA 4ZO7A 2Z64C 4XC3L 1CGWA 4IBSA 5EN3A 4DGUA 3SE3A 2AMUA 4LCVA 3MRDA 3QEUB 3SODB 5B39A 1IM3D 1DLFL 3PHOA 4L8CA 5C09A 5C86A 2CNYA 1KIQB 5C0FB 3KHQA 2EE2A 3FHEA 2VW6A 3L08A 1QRND 3NTCH 3I9GH 2JE8A 4ZAKA 4IOSD 2FATH 3SBQA 5LWYH 1OP5K 2EXWC 1P1ZB 5DHDA 3IFOA 4Y4HA 3W2DH 1DDHA 4H5SA 1J5HA 4NKOB 1KLUA 2Y24A 1EDYA 1MCRA 1OM3L 3RVWD 5JHAA 3IK2A 4KX7A 1JN6A 5J06A 3QIBD 3DUUB 1KN2H 1KB9J 2NXZB 4G3YH 4YFEA 2AJSH 5IT2L 4PD4K 3WE1A 1BAWA 2YKKA 1R3LA 4ZFZB 5GS1A 4PJAE 2AV7B 1EA9C 2R29A 4Q58C 5FFGA 3RG1C 4PGEA 1B2YA 5L2KA 2ZSVB 1BZDA 2EKSA 1NCCL 2J55A 2W0FA 2VMFA 3TBYB 4DGYL 4OD3L 4RGNE 2LTQB 3MGTA 3PGFH 3VSTA 2H47C 5A2FA 1HCZA 5B8CC 1CLOL 4BIKA 3HZKA 5I75B 1DJIA 3OGOE 4U6XA 5HYJB 2XG5A 32C2A 4L4TA 3SCMC 1SYVA 3B9VA 1EFQA 1A2YA 1G9MC 5JPMB 2X3AA 1NFDA 2AANA 4TPRH 2IDFA 3EJZD 2HPTA 5GGUB 1OGSA 3NSJA 2R29H 4ZPTA 5DC0A 4GG8B 2DWDA 4M8QB 1E4XH 2RMNA 1WWWX 5CZKA 3V4PB 1XGTA 4JREB 3D0LA 4RFNB 5DMGD 1G9HA 3IAGC 5KVDE 2G9KA 1WO2A 2Z65C 3GMOB 3X14A 1S8DB 3RIAF 1RJZA 3WTUA 5E5MB 1C5BL 3L3DA 4U1HB 2E4FA 5I71B 5C0DA 1GHFH 2IMNA 1MCNA 2XZQH 3CFJA 4FLOA 5EUOF 5AVYB 5L0QC 1M05A 1FYTB 1DANT 2F2HA 1GGIH 4JVWA 2BSDA 5FUCC 5IMKA 3VXRA 2BOCA 3QCTH 3V0WL 2L4OA 4MNQB 2G2RB 3MNMA 5E9DB 1X4XA 3IWUA 4AQAA 4YK4B 4H8VA 5H4ZA 2AAAA 3E2HB 2JJVA 2NNCA 2V5MA 3QG6A 2H0JA 1RZGA 2MHAB 1RFDL 4U0QB 5JIPA 1CF8L 4JRXA 4X7CC 2C9VA 4O4YL 1UXSB 3TIDA 2F54E 3P11L 3P9MA 2UY7A 2AEPH 2DJMA 2Q76B 4N0YL 2UUDK 4L1TA 4H8UA 2G2PA 4HDIB 2UX7A 4OD3H 3DLQR 1IUZA 1OK8A 5DHVB 1MI5D 5D8JL 1JGEA 1Q72L 2P5WB 4CVUA 5KS9A 2AXFA 4X4ME 1KCVL 3CH8A 5FCSH 3NCCB 5CJXC 2Z6FA 3HHMA 4XPFH 5I24A 5K5YA 5CMAB 3JTBA 1GYAA 4RAVB 4Y16B 1ZTXL 3FTYA 5C08A 4JN1H 1AC0A 5I1CH 4HZLB 2BP0B 3PAVA 1GGCL 2FB4H 4DVBB 1MFMA 1YNLL 2J73A 3W0WA 3VM5A 3GMNA 1IL1A 3UC0H 2R1XA 3ZE2F 3DRTB 1H19A 2CKBH 3V0VA 2E7MA 2OA9A 1G7PA 2EDKA 1LE9B 3BE1L 2DTML 4XCYB 2X70B 1KYDA 5KBLA 3PQYE 4P59L 1HCFX 1C5BH 3EGSA 4K15A 4R7NA 2LOEA 4AT6A 2HSIA 1JK9B 2IH9A 5B1JA 2N56A 1EXUA 1YUHA 2IDQA 3ZVVA 5IQ9A 2BSED 2WQVA 1PZBA 3OJDA 3SIKA 1QFHA 1QRNA 3ZDZF 1DO6A 4IOSA 1JYVA 4FD0A 3OKOA 3QAZC 4XBPA 2K8MA 4O2CB 1E5YA 2HLAA 5J3HC 3C60B 3GRWH 4S1RL 3WNPA 2PWDA 1F1AA 3MBWB 1IGJA 3AADB 3FT3A 1S2EA 2AQQA 3CFUA 4QRTA 5E6ID 1IU1A 3U36B 3NFNA 4WU7A 4LVOC 4XP4H 3PWUB 1I3GH 3WY2A 3CGTA 4BE5A 4OZIF 2Y2YA 4HQQL 1BPLB 5SWSD 4EIBA 1IBGH 3LMJH 3MUHL 1D5IH 4M56A 2XPYA 3WOVA 1ECYA 1HHGB 1SXSA 4PY8I 1YEFH 1SHWA 3VCLB 1B3IA 1E65A 1JPST 4D9QD 4MMXA 1DBJH 4NUJA 1MFDL 1OAUH 3ARTA 2H1PH 2XZCH 4OLWH 3FDWA 5HYJD 2NY0B 3T4AB 1CLYH 2Y7LA 3LKPA 1MFUA 2EDJA 3D9AL 3QHZL 3VMPA 5I0WA 1UB6A 3B5HA 1Q9KB 3E8UL 5E99H 3UG5A 1T83A 3ZGHA 5J8OA 3IM1A 3LZFL 3NABL 2VWEC 1A7QH 4QYOB 2UZYA 4X5LA 1FE8H 4F5CA 2EUWA 3ATBA 2YSTA 1H3PH 2G30A 4ZS6C 3DO3A 4LGSB 2VW4A 3Q6FA 1U8JA 4TNGA 4P59H 4TSCL 2DZEA 2VM4A 5DMIL 2YXFA 4JO1H 4GLRH 1FVEA 4LLMB 5DD5L 2B39A 4M43H 4XAWL 5KYUB 2FEEL 4AYMC 5MEQB 3H3PL 5F70A 6FABH 3TBSA 3FONA 2XWTB 5BVJA 3B7SA 4UTAL 2PW2B 2R9HC 1JPFB 1JRHH 3RNKB 4M5YL 3BPOB 2MKWA 3DVIA 2ESVB 4X5PA 5IEKA 2VDQL 3TN0D 2F7IA 2I25N 3SDAA 2PMZA 4JM4H 3ML9A 1BV8A 2RIKA 3JVGA 4UYQA 5JQHC 2DEXX 2XQ0A 3LKOA 4XX1G 4NDMB 4HQQH 3O4LD 3U79A 1OSZA 4LB8A 5T1KA 2ZX7A 4LFHD 2BRQA 3HR6A 2IQAB 2HT2D 1TT6A 4M7ZC 4GXFA 2P5WD 1V3LA 2HH0L 1LNUA 1UKQA 3MLZH 4JKMA 4K94C 2XQYG 4L9LC 4KDVA 5FV1L 3SDCB 1CCZA 1SEBA 3D9AH 1G1OA 1RZFL 1VHPA 1VGKA 1EAOA 3ARBD 1IKFL 2YGQA 3UO1L 4F7PA 3CFEB 1ZWIA 2AITA 4A7GF 1SY6A 3JV4A 2GEQA 4W9ZA 1Y6NR 2P5EB 2WPGA 4QF1B 5I26A 3VXMD 2HG5A 4YPGA 3NEOA 4YDLB 1KTBA 2DLHA 5JXEA 4YEFA 2R15A 1JPTL 2Q8AH 1EJ8A 4ELME 3QXUA 4GUCA 3IDNA 1UG9A 3RI5K 4CGUB 2BVOB 1SDDB 2CA4A 4YDIH 5DJ6B 4PRPB 5C0BA 1D5XB 1WEJL 2FEEI 1U93B 1OE3A 3WSQH 4D8PA 2YO3A 1MWAL 4UTAH 1SY6H 4NOBA 1WBYA 3OJVC 1ILUA 4ZUSB 5ISZE 1YEDB 1XB8A 3BGMA 4U3CA 1P0SE 2HWZH 1WHPA 3POHA 5EO9B 1AZBA 1VZHA 5IFJB 4QRPE 3IDMA 4WI2A 1GZHA 5EC1B 4LQFH 3ARRA 4AC4A 5DMGC 3LIZH 4J27A 2V9RA 3DNKA 2HFGL 2CU9A 4UMGA 4JFOB 5D1QE 5ALBL 1AKJA 5MEOA 2A6DA 3GC3A 1BOGA 4HKJB 4MKMA 1KC5L 3KCPA 3EZJB 5I18L 2HJFA 1KXVC 2Q20A 3K6NA 4Y4KA 1SNRA 1MQKH 3WJLA 4CU6A 3EBAA 1UOVA 2E0PA 3UGEA 1WD9A 1ZA3A 4KRNA 2ZUSA 1J0KA 3KPSB 5SWQA 5FKPA 1KWGA 4K5MA 3CHOA 4B5ZA 4N2IA 3U30B 2D03L 4RSYA 3D06A 2IOOA 1NQBA 4PS8A 5JW4N 4AYDC 4JQIL 4I3SH 1TSRA 1I4FB 4CN6A 2OM5A 3R4DA 4KO6A 2CO7A 3I85A 1QFUL 4NQTA 2DI8A 3TS8A 4TOYH 2DH2A 2WTRB 3Q7JA 3WDJA 3TT3L 1SM3H 2AJZA 3MRMB 1PG7W 3NIFF 4OT1H 1JPTH 5L8JB 4JFHE 2R1YB 5GS2D 3BVWA 2P80D 3K6IA 3GMPB 4HD5A 2NUTB 4XC1H 1XL4A 5DRWA 4MCZB 5SWZA 4DKFH 4E9WA 4F57H 4AENA 1X5YA 1DFXA 3HE7D 4BK5C 1N7ML 3M45A 3HCVA 2WP3T 5D1XD 3VFSA 3IKCB 1HX0A 3PJNA 5H94B 3U46A 1FNHA 1Z7JA 2NR6A 3S34H 4AV5A 4HCFA 5GRVL 1L5GA 3MROA 3MRRB 2DMGA 3UBXB 1OY3B 4UAHA 3CVIH 2WVVA 2PPAA 3FHQA 3PDOA 3PL6A 3B2UD 3BVNA 3KXFB 5DUPH 5D7SH 2FH6A 2Q10A 4YXHH 3KH4A 1N4XH 2Z8VC 5DC9B 1UWXK 1R3JB 2BDNL 3TN0A 2XQYK 5FYJD 4C8XA 1SVCP 3FOMA 1GMEA 5EZLA 4P5RA 3NIGF 2QVMA 3T3MB 2XTSA 3FW6A 4LRNL 1R5VA 2XXFA 4EZMA 1UZ6F 1IB5A 1T3FB 2G4EA 2YRLA 2IAMA 4KO9A 1NWPA 1TVBA 4RX4A 2CG9X 2MOQA 4XB7A 4BKLA 5IB4A 3SDCD 2NY3B 2BSRB 5HDLA 1ACCA 1QLFA 3VFGL 5DRNB 4YZWA 3CIAA 2J7LA 1TJIL 1Q1PA 5HHPB 4FTVD 3ZT5A 1FDLH 3KYMA 1IBYA 1A6WL 4NCC1 1ZGLB 1A6VH 2P5ED 3L17A 2WCPA 3ARBA 1U3ZA 3QHFL 4OIFA 2BWQA 5CEXA 4PJXE 4ZNEA 1IV8A 5I1LA 4Y2DA 5F71A 1NUNB 1DO5A 3MJ8B 1KMGA 1C7SA 2NOYA 2P1YA 1JZGA 4BQBA 4Z78A 3C6LD 1P9MA 4GQRA 5I75C 4U6TA 3GXFA 3L1EA 4PRPD 3MFFA 5CJBA 2N0KA 4L4VD 3RLSA 4JRWA 3WFCL 5JOPE 1VFUA 3IJHB 3MV9A 3EDFA 2X1PA 5JPMC 3EFDH 2CNZA 3C2AH 3MU3A 1N18A 1BF8A 1NEZA 5EC2B 3CSFA 3GNMH 1P4IL 1J8RA 1KLFB 3BDBA 2MKLC 3HA0A 4JREC 1WGVA 4RFNC 5F7KC 5DJZA 4TTGA 4ERSH 4ORGB 2GK2A 2G3NA 5F1OB 4QXGH 4XVTH 3GHEH 4LO9A 3UBXG 4LPUA 1RIHL 5HYEA 3ARFB 4R0LA 2M8XA 5J1AB 4U3HA 5ENWB 3HZYA 2X28A 3ULUF 2ZYIA 5I71C 3HG1A 1RLWA 4OUUA 5G5DA 3DYOA 1AZNA 5EU6A 5BRZE 1N67A 3VXUB 2EZ0C 4HPOL 4XE0A 4XAKE 4YK4C 4PRAB 4CSTA 3EJJX 3AQDA 3UOAB 2J43A 3D69B 2R4RL 4AW7A 4DEPC 5INDB 5AOLA 2ZONA 3M6DA 5D5ME 4EUPG 3KPOA 3NAAH 4F2MA 2P8MA 2Y7SA 3BH8A 3ZZLA 3WNKA 3ZR5A 4DHLA 3N43F 4NHUA 3ZKMC 4PFEA 3BP5A 4HAGA 3MOBH 2A9DA 3P1VA 4PJ6A 3DV6A 1UZ8B 5I1EH 2QPDB 2XTJB 5E8NB 1GOFA 2X4NA 4L8BA 4PP1D 1RJYB 2IALB 3VI3E 5MP6L 2WXRA 3NN8B 2WXMA 4F7MA 5LVEA 1MDTA 4MJ6B 5EN2B 4Y16C 1QABA 4LSDA 5HDRA 3BI9X 3WGUB 2F8OA 2IPUG 2FQEA 2VDOH 1H3TA 3QO1A 4AKPA 5K9OA 1N0XL 3Q2NA 4UQEA 5EU5B 3WIFB 4KPHL 1LEIB 2BP3A 3O2WH 4KKPA 1GGBL 2GJZA 1WC7A 4PJEA 1AQMA 2ZCLH 4ZSOA 4F33A 5DEJA 2PO6D 1SDYA 4E5XB 1NZRA 5AVSB 2VUOA 5E8OA 3MZGB 5IEHA 1BVZA 4NKMB 2B59B 5K59E 2JMRA 2RD0A 3CTTA 3PGCB 5E2TL 1S9KC 4U3XA 2FSDA 4O5LH 4FCAA 1REIA 4NPYB 4KMLB 4J3TA 1QEWA 2ZKHL 2AQPA 3I6KA 5A2IH 3JWDL 2CIKB 1MFAH 4YX2L 2XVKA 4DP9X 2P4AB 3FQUA 1IEAB 1CYXA 3N44F 4G5ZH 4UQ9A 2IANB 2YC1A 4JPWH 3C60C 2DICA 4YDJA 4WNQA 1LDSA 4PJFE 2BS9A 3OSVA 5DUML 3NJKA 3K8KA 4ZX4A 3OMIB 4MCYA 2OP4H 5E1AB 1RIVL 5HTSA 5CLWA 1WISA 4NQCE 4XMLL 4LCWB 1F8TL 4CDHA 1SLWA 2NYKA 1Z3GH 3WY4A 5EU3A 3LKQA 1IX2A 2IXQA 2AQSA 1CE6B 1MG2C 1HSBA 4QTIH 4GRWF 3ZK0A 1JK8A 2VR7A 3B2PA 2JWYA 3QDGB 1UT1A 4BZ1A 1L9MA 3DWTA 5FUCE 1SYSB 2DL2A 2GHWB 2YPVA 1KULA 2V4LA 3Q0HA 5DYOA 5TE6L 4AL8L 2VDLH 2CM6A 1KXQE 1WTGT 3BJLA 4P2OA 5CXPA 4LPTA 5E9NA 2KHAA 2EUZA 1IFHL 4U1IB 2NY0C 3TVMB 1HCVA 3T4AC 4OV6F 5GGRY 2N01B 2IMMA 1NGYB 3D51A 4HC1L 4XN1A 3VU2A 2CJSA 4FZEL 4L4VA 2EXTA 5IFAL 1INEL 3V6FB 3H3KA 5I8EB 2GY5A 3F64A 3OAZK 1HI6B 3RUGE 2VE6A 3DPBB 4H8HA 4IMLA 4B95C 3ARFD 5CGBA 4N8VB 4ZUWA 3U1SL 1OW0A 3DGCR 5TK4A 2G3ZA 4P2QE 2Y4SA 1WT5A 5I5RA 4E5XG 3CDZB 3F85A 3K6FA 1NPUA 3HE7C 5CINL 1ZLUK 1TG8A 5D1XC 3BN9D 1FGNL 1KCRH 2V0AA 3L3IB 3LRSA 4LBAA 4P3DA 4Z7OE 1ZGLP 5KAQG 5FEBA 1TKWA 5EMYA 2WNGA 5IW6A 1U8KB 4L1LA 4MDRA 2HT3C 4RETB 1KENL 4P2CG 5G4OA 5FR3A 1M42A 3CN4A 3BPOC 4LLYA 4X6EA 3FL7A 3B2UC 5CIPH 3MUJA 5D7HA 5DJYA 5IW3A 3DHMA 3BZEA 2FO8A 3SDDA 1CLVA 2MOVA 1F1DA 3JTTA 4N87A 5ADPH 2R83A 2BS8A 3C87A 4EOWL 2EE6A 2CHXA 2HFEB 4OZHB 5D72H 5IF0A 5DURB 5J7CC 1UASA 2IPUK 4BHUI 4CW1A 4MDIA 3Q43A 5TE6H 3S37X 1HYSD 1EGJH 1HIMH 4MD0B 1GGUA 5EUKB 4UNIA 4XCCL 3V8OA 1H15A 3ZTJG 4AKOA 3SDCC 5JTWA 2ZF9A 5JW4Q 4XHJD 4L3EE 4EVNA 3NSFA 1J8HB 4JQVA 3WTTA 2I5YH 2JSFA 1L3NA 2IPKA 4XWGL 1UUSA 2VJ8A 3UTQA 2B16A 4DNLA 1B9KA 2G60L 4PJHF 3TPUB 1ZV5A 2B7DT 5IP4A 1D5ZB 3G6JA 4YDLC 1NFIA 2J5WA 5DS1A 5FK9A 3HS9A 2FHBA 3QIUB 4OLZL 4A7QA 3SE3C 3QDME 1LLAA 2EIKB 3LNHA 3FQTB 5E4EB 3C5JA 2PO6A 4FEIA 3C6LC 5IM7B 3SSGA 1KPUA 3NA9H 4UT7H 1DQQB 3H85A 3QB7C 1FQ9C 1A7OH 1AD9A 4G59C 5CZRA 2HPOA 2VSKB 1MG3C 3RX7A 1YMMB 1SLXA 3ULUL 2F1AA 5DVLA 4XPHH 5T1LA 1ZHLA 2BSBA 2QLVB 2QGCA 2IAND 2FYYB 3L3GA 2ALWA 5KSAB 2AVGA 4PRID 3IGKA 1WIPA 4LOFA 5FUOH 5JOFB 1XSKA 4Z3HA 5BQ7B 2DQFB 1BP3B 4OV5A 1Q0EA 3S4SA 5GZNA 2F8VA 4ZMVA 2MNWA 4E68A 3N1QC 4KNTA 4E9QA 2J5LB 2VDMH 2VLMD 2ZX8A 3VFWA 2KL6A 3LAFA 2XSKA 3ZMEA 5IMLB 3NEXA 1M7IA 1TR7A 4R2GD 5IK3A 2HRPH 1T4KA 1HILB 5LGJB 3ARED 3TVMD 1WWBX 3T0EB 3U30C 1OGAE 2QZQA 5I74B 2CGZA 3IVKB 2DKUA 2QMKA 3HC3L 4HLJA 4IRZL 4M00A 3FYEB 1BVNT 1AG0A 3NBNA 1E5BA 1J1OH 2QPEB 3Q6GH 4HH9B 3VTMA 4BZYA 2RH0A 4EMZA 4XI5D 4IBUA 5TDPA 5TH2B 3CN3A 1WBZB 2WCSA 4PP1C 4PJGF 4RNRA 1EEZB 2QQKH 4G6JL 1GC1C 2AK1H 3MX0A 2J8UB 3FQNA 1LEKA 4HGWB 5J12B 3UFIA 1X7QA 3PWVB 3DA0A 3GSWB 3LEVH 4JZJB 2EIZA 5DQDH 4A7UA 4MNHA 1GS8A 3E0GA 2VDKB 4Q6YA 3SJVE 5AG9A 2VABA 1BZEA 2HJKA 1T1ZA 4GQ9L 5DO8A 4KJYB 4HFWB 3WENA 5IVXB 2CIIA 3FQWB 1MPAL 4FNUA 5D6CB 2D7TL 4Z77B 5CCKH 4GG6E 2WNKA 4YLBA 2NT0A 3IGUA 1E9PB 3B2XA 1QFPA 4S2SA 1OPGL