4P6BA

Crystal structure of est-y29,a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
390
structure length
386
Chain Sequence
b'SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Est-Y29
molecule tags Hydrolase
source organism Metagenome
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
total genus 119
structure length 386
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p6bA00
3WS5A 3UE3A 4OP8A 2VGJA 1ONHA 4GZBA 3ZG8B 2B5RA 3O86A 3IH8A 3TG9A 5EVIB 5EVID 3GSGA 4WEJA 3IXHA 2ZC5B 1M6KA 1IYOA 1TDLA 1N4OA 4R3JA 5FA7A 1EWZA 5CEBA 5A90A 3VOYA 1FSYA 3FKVA 5EUAA 1ZKJA 4KZ7A 4DE0A 5CECA 1O7EA 2DNSA 1H8ZA 4S2LA 3SS3A 5E43A 4C6YA 1BUEA 3ZNYA 1NY0A 1XA1A 2Y2HA 4FD8A 3M6BA 4JXVA 1Z6FA 1KE3A 4EWFA 1TDGA 1I2SA 1MWRA 3V5MA 3OCLA 4IVKA 1W8QA 2OLUA 4S2PA 1C3BA 2EX6A 3BFDA 1KE0A 3ZG0A 1ES5A 1QMFA 2G2WA 3DWZA 4FH2A 4OOYA 1I2WA 5KSCA 3FWLA 4S2MA 3C7UA 2RCXA 5D3OA 2ZLYA 1FSWA 5I94A 3CJMA 3W4PA 4WZ4A 1PI5A 4JF4A 4RA7A 2WGWB 4JKTA 2R9XA 1HZOA 1CEGA 2ZQCA 1CEFA 3OPPA 2ZM2A 1S0WA 1W5DA 4X56A 5F1GA 3V39A 1Q2QA 1GA0A 1RGZA 5EVIC 3TSGA 4HBUA 3GR2A 2HP6A 3NY4A 4RX3A 1SKFA 1G6AA 4DDYA 2HDSA 3DW0A 4WEKA 3IHAA 4IBRA 2PU2A 4JXSA 4RYEA 1KGGA 1NXYA 3PBSA 3PTEA 3M2JA 1XGIA 2Y91A 4P0MA 4BD1A 3LCEA 3HUOA 3SOIA 5A91A 1ES4A 1KGEA 4GKUA 4S2NA 1QMEA 1BLSA 1FCNA 3PAGA 1IKIA 2ZQ8A 2FFFB 3MFDA 5CXWA 4EV4A 3G4PA 4DXBA 1TVFA 5TR7A 2E8IA 4E3JA 1BULA 3NC8A 3PBTA 4QHCA 5G18A 2HDUA 2WKEA 4B88A 3UPOA 3P09A 5F1FA 1MXOA 2WGIA 1NZUA 1PW1A 1DY6A 3PBOA 3OPHA 1ONGA 3ZG5A 3PBQA 3UPPA 4BL2A 3ZG7B 2WKIA 4N9LA 1N9BA 3IXGA 5DF9A 1BLCA 1JVJA 3GVBA 3P98A 5HL1A 2XDMA 1CI9A 1L0GA 5GHXA 2H5SA 4U0XA 4WM9A 4JXWA 2WZZA 2R9WA 4OOMA 2P9VA 1IEMA 4OPZA 2HDQA 4L0LA 2XFTA 5E2HA 4B4XA 4WMCA 5GL9A 3G2YA 3ZFZA 3N8SA 4OONA 1BLPA 5F83A 1XGJA 3MZEA 3Q7VA 1YMXA 1L2SA 3Q07A 4OQIA 3HLBA 1G68A 2XR0A 3N8RA 3GMWA 1YQSA 1E3UD 1PWDA 3SS5A 3E2KA 4EBLA 4IEDA 2I72A 4X6TA 4N92A 3RJUA 5HW3A 4ZAMA 2J8YA 4DF6A 1K56D 3SS4A 3ISGA 4XXRA 1LL5A 1YLJA 1PI4A 3BEBA 5AQAA 3UDXA 1RCJA 3FZCA 4DE3A 3G30A 4C75A 2X02A 4GDNA 1GHIA 1ES3A 5FI2A 4P87A 1FR1A 4JBFA 5GHYA 1DJAA 4S2OA 4PM5A 3NBLA 4R3BA 3VP1A 4XUXA 2IWDA 3MBZA 1H5XA 1JWZA 2HP5A 3O3VA 3VFFA 1GA9A 2Q9NA 4MLLA 2XF3A 1MBLA 1Q2PA 1VM1A 4P85A 4QD4A 3CZDA 1FCOA 4C3QA 4KZ4A 4GB7A 5HFOA 4CJNA 4YINA 4NK3A 4HEFA 3C7VA 2WAFA 1ZC2A 5FQKA 4DE1A 5EVIA 4PM6A 4EUZA 2HPBA 5HAIA 4OPYA 2V1ZA 2J7VA 5J8XA 1MWSA 4OPQA 1K55C 1LI0A 3HREA 4QJGA 4OPRA 5KSHA 4E3OA 2ZQDA 5IHVA 3O87A 4BL3A 2XK1A 5A93A 4E6WA 1IYSA 4ZTKA 4IBXA 4KZ5A 3VSKA 2Y2OA 1XPBA 5FQ9A 2VGKA 2FFYA 3AGDA 4GOGA 4QU3A 3CG5A 3ZVWA 5FAOA 3ZHHA 1J9MA 3OPRA 4LENA 4YFMA 2WYXA 4O7DA 3LY4A 1RGYA 3IWQA 2ZC3B 4S2NC 4PM9A 3V3SA 2WZXA 5E2FA 3MZFA 4KQQA 4EBNA 1NYMA 4KZAA 2JCHA 4BLMA 3MZDA 4KZ3A 3N6IA 3S1YA 4EBPA 4RX2A 1MPLA 2WGVA 2Y2JA 5F82A 2ZMAA 1CK3A 1YLPA 5DTTA 2DRWA 4WMCD 1PZOA 4LV0A 4X55A 5DTKA 3HLCA 4CPKA 1BLHA 1K25A 3M6HA 4OVDA 3UO9A 2XD5A 3BM6A 4ZBEA 3N4IA 4LV2A 3BFEA 4JF5A 3GTCA 3PBRA 1W8YA 3A3EA 1K6SA 1PIOA 2WAEA 3IXDA 3HL9A 4LCLA 3UN7A 1PWCA 5GLCA 5JYOA 4U3TA 3B3XA 2H10A 4PPRA 5CTMA 2ZM0A 3ZGAB 4MBKA 3BFFA 4A5RA 2ZQAA 3W8KA 2XH9A 5AQBA 2Y2MA 1HTZA 3C4OA 5DTSA 1WYCA 5M19A 3BECA 2XD1A 4M3KA 2XLNA 4E6XA 4WBGA 4BD0A 4GD8A 2C6WB 3QNBA 5FQQA 3EQVA 3ZDJA 3WWXA 1E25A 2ZQ9A 3IQAA 4MNRA 4R0QA 1FR6A 5TGFA 1YMSA 1KE4A 5DF7A 3VP2A 4XUZA 3FYZA 1O07A 1BSGA 4Y0UA 5EOOA 1ESIA 3HLFA 5GLAA 2Z2MB 1K57A 4E3NA 4P6BA 4Z9QA 4DRTA 1KDSA 4WZ5C 2Z2LB 4GDBA 2ZC7A 2QMIA 4FH4A 3A3JA 5CHMA 5CHJA 5DVAA 4ZDXA 4KZ6A 1M40A 5CTNA 1U60A 3W4OA 4D2OA 3Q1FA 3UPNA 4KG6A 1I5QA 3A3DA 4GN2A 4EQIA 3RXWA 5GLDA 1ESUA 4UA9A 3N7WA 1LL9A 5FSRA 4ZJ1A 2UWXA 3Q81A 3V50A 3EQUA 3NIAA 1Y54A 3AGEA 1YM1A 1IELA 1OMEA 5HX9A 3VP3A 2EFUA 3G35A 1GHMA 1LI9A 3LEZA 2EFXA 1K38A 3S22A 2WUQA 2CC1A 3IHBA 2Y55A 5M1AA 1K54C 1ERMA 1ES2A 2J9OA 3C5AA 5KZHA 2XEPA 3HUNA 1YLYA 1JWPA 3Q7VB 3SH9A 1L0FA 3UNWA 5EVLA 3E2LA 1JWVA 2QPNA 5L2FA 4R4SA 3IH9A 3IWOA 3Q82A 1K55A 2P9VB 1AXBA 4PM7A 5FQJA 1WYBA 2Y2GA 4QY6A 5GLBA 3UE1A 1SDNA 1K56A 5DF8A 2ZJ9A 3FV7A 4PM8A 3C4PA 2OSUA 1W7FA 1ZG4A 4OKPA 4WZ5A 3V3RA 3BFCA 4OQHA 4KZ8A 2EX9A 3VMAA 4UAAA 1HVBA 2XGNA 3HLDA 4X69A 4Y0TA 2BG1A 3SH7A 3MKFA 2EXBA 2WADA 4X53A 2EX2A 2OLVA 3O88A 4B4ZA 2A3UA 1PZPA 2Y2LA 3ITAA 5EOEA 4UHUA 1KGFA 1YLZA 2G2UA 5JYPA 3IT9A 1YLTA 5CHUA 5CGSA 2QZ6A 3HLWA 3DWKA 2BLSA 3OPLA 5AQ9A 3HLEA 3VP4A 5M18A 1NZOA 1SDEA 1KVMA 3MKEA 4OP5A 1K4FA 3ZNTA 1BT5A 3IF6C 4FCFA 3OZHA 2Y2KA 3FKWA 5E2EA 4HBTA 1LLBA 1XKZA 4N1XA 3JYIA 4MBHA 1H8YA 1MY8A 1PWGA 5HAPA 1SHVA 4OOLA 3A3IA 1L0EA 3G2ZA 5EECA 1WE4A 1MWTA 3W4QA 4Q8IA 1XA7A 3AGFA 1RP5A 3WS2A 3NI9A 4LV1A 5KMWA 4MEZA 2H0YA 5FASA 2Y4AA 4OQ0A 2WKHA 3BLMA 2DCFA 4UA6A 2JE5A 4KG2A 3IWIA 3LY3A 3M2KA 5CRFA 3WRTA 4UA7A 5AQ7A 3WS1A 4KG5A 3UDFA 2V20A 4NETA 3VOZA 2A49A 2IWCA 2JC7A 5EPHA 2ZC4B 4WELA 3MXRA 3IXBA 4KQRA 4HESA 2EX8A 4KZ9A 5FI6A 4JPMA 3VSLA 3ZG9B 4BQMA 2WK0A 2EXAA 4PMAA 3G31A 1ALQA 4Y7PA 1IKGA 3PBNA 3IF6A 2Y59A 5FQIA 1K6RA 2X01A 4OQGA 1LHYA 1W79A 3GRJA 1PW8A 1XXMA 3HBRA 4FSFA 4WYYA 5A92A 4ID4A 3ZCZA 2WGWA 2XQZA 3QNCA 5FQMA 3UE0A 4E3LA 1EI5A 1K57C 3S4XA 3MXSA 1CI8A 4KZBA 2GDNA 3BYDA 1TEMA 3ITBA 4GD6A 1GHPA 5BOHA 1NRFA 2HDRA 2JBFA 3HVFA 4R23A 4DXCA 5HAQA 2Y2NA 4GNUA 4LCMA 2H0TA 2J9PA 2ZQ7A 3Q7ZA 1SCWA 3RXXA 3LO7A 1YLWA 3WS4A 1HD8A 2ZD8A 3TOIA 1KDWA 3WS0A 4E3IA 1K54A 2Q9MA 4DE2A 4F94A 4ZJ2A 1JTGA 1VQQA 3DTMA 2ZC6B 2Y2IA 4KENB 1NJ4A 4RVAA 1KVLA 1XX2A 3G34A 5TFQA 3HLGA 5FAQA 5E2GA 3GV9A 1EROA 2C5WB 1PYYA 4OLGA 4Y0OA 3IF6B 3SH8A 1GCEA 4IVIA 3OC2A 2IWBA 4R1GA 4K91A 3QHYA 4N9KA 3BLSA 1FCMA 5CERA 3A3FA 3NCKA 1YT4A 4E3KA 3PAEA 4KQOA 3IF5A 1E3UA 3BFGA 4MBFA 4N1HA 5U47A 3UY6A 2P74A 1IYPA 2XFSA 3CMZA 3I7JA 5FI7A 5FAPA 3N8LA 1L0DA 3HUMA 3ZVTA 5CEDA 3WRZA 1K4EA 2RL3A 4LV3A 4OH0A 4E3MA 3NDEA 2Y2PA 4QB8A 1BZAA 1XP4A 1ZG6A 2PBYA 4JF6A 2HP9A 3G32A 3OCNA 1BTLA 4R4RA 5GHZA 1FQGA 2X71A 3UDIA 4S2JA 2ZM8A 1E4DA 4X68A 4ZJ3A 4DDSA 5EE8A 5CGXA 5HARA 4JLFA 3BRMA 4BJPA 5FDHA 4JXGA 4H8RA 2Y2QA 1ERQA 1DJCA 3GQZA 1JTDA 3VFHA 4K0XA 1IYQA 1NYYA 3NDGA 4QY5A 4S2KA 4U0TA 3VP0A 1S6RA 4OLDA 1FOFA 2V2FF 2OV5A 4S2IA 1MKIA 4K0WA 5CGWA 4DKIA 1MWUA 2PU4A 3D4FA 4BENA 1DJBA 5FATA
chains in the Genus database with same CATH superfamily
1J3WA 3ZG8B 3O86A 5EVID 1XJ6A 3IXHA 1DP6A 1P9WA 2ZC5B 1IYOA 4B93A 2W3EA 5EUAA 1ZKJA 4KZ7A 1O7EA 1BUEA 3ZNYA 3JVUA 2VX8A 1D06A 2M1CA 4FD8A 1OPXA 4EWFA 4EEUA 4Y5FA 4BBVA 4S2PA 2EX6A 3ZG0A 3DWZA 1QMFA 4FH2A 3FWLA 4S2MA 4RA7A 2ZMFA 4JF4A 2ZQCA 1JNUA 2ZM2A 1W5DA 2HP6A 1SKFA 3IHAA 1KGGA 1LT0A 1XGIA 4P0MA 4BD1A 3LCEA 3SOIA 3FPVA 3H82B 3MFDA 5TR7A 2ZL1A 2FH5A 4B88A 4QHCA 1LSVA 3PBOA 1DY6A 2O9AA 1ONGA 2VV6A 2WKIA 1UGUA 3IXGA 3P98A 3T4SA 2V9AA 1MKMA 5L10A 4U0XA 4JXWA 2PYPA 3MMHA 4OPZA 1ZTUA 3QP6A 2XFTA 5E2HA 4B4XA 4WMCA 3G2YA 3OLOA 2OAP1 1YMXA 2QHKA 4OQIA 3GMWA 1YQSA 1PWDA 4O8GA 2QWSA 4IEDA 1T18A 4CLCD 2PRFA 4ZAMA 2J8YA 2W1RA 2V0UA 4R6LA 4Z1WA 1PI4A 3FZCA 4JGOA 1GHIA 5FI2A 4HH3A 4JBFA 2JKRI 4R3BA 3JVVA 2BASA 2M7VA 1Q2PA 4QD4A 4C3QA 4KZ4A 4R38A 4WL9A 4HHDA 4EEPA 3D9YA 5FQKA 1XFNA 5HAIA 2LB9A 2V1ZA 3CUEC 3HREA 2J3WA 5A93A 3EEAA 2Y2OA 2K7SA 3AGDA 4EERA 4YFMA 2J80A 3IWQA 3MZFA 2JCHA 3E0YA 2A24B 1F98A 5EV0A 4X55A 3UB5P 1BLHA 4OVDA 2XD5A 4ZBEA 3TRCA 3T4QA 3UB9A 4GLQA 3LYXA 3HL9A 4HQAA 2PBDP 1PWCA 3E4PA 5DKLA 4PPRA 2B02A 5CTMA 3ZGAB 2OAQ1 3BFFA 3QP5A 5DTSA 3MQ0A 5M19A 1V9YA 2XD1A 2P04A 1S4RA 1E25A 3LIDA 1YMSA 5HPIA 4XUZA 4EETB 2BTFP 1BSGA 2Z2MB 4WZ5C 5CHMA 4FH4A 4ZDXA 1CQAA 1U60A 3UPNA 1I5QA 4EQIA 3IBJA 3NIAA 4HP9A 5F5YA 3ULFA 2A24A 3VP3A 5HL6A 3LEZA 2EFXA 1K38A 1ES2A 2J9OA 2XEPA 1YLYA 3EOIA 3SH9A 4ETZA 1JWVA 2QPNA 4R4SA 3IH9A 1K55A 5FQJA 3E4OA 5HDDA 3FV7A 4PM8A 2OSUA 1OT6A 3BFCA 4KZ8A 2EX9A 4X69A 3SH7A 4GS9B 3ZQ5A 3E98A 1TF1A 4IUKA 3ITAA 4CLCC 3IT9A 1YLTA 1T1AA 3S7NA 2BLSA 1DP8A 5AQ9A 2O99A 1H8MA 1KVMA 4HY8A 1VEUA 1L3LA 2Y2KA 3PYPA 5C5KA 4IJGA 4HBTA 3QP2A 1VETA 2KOIA 4MBHA 5HAPA 4OOLA 5EECA 1L0EA 1MWTA 4Q8IA 1XA7A 2JHEA 1RP5A 4LLOB 3NI9A 2HJ9C 2O9BA 4I3IA 3BLMA 2WKQA 3WRTA 4UA7A 4KG5A 2A49A 2IWCA 4NXGA 2ZC4B 4WELA 4HESA 4KZ9A 3VSLA 4JPMA 4PMAA 1IKGA 3IF6A 5FQIA 3UB7A 1F2KA 1W79A 2AVXA 1MC0A 4WYYA 1KOUA 2XROA 4UQIM 3QNCA 3LR0A 1K57C 3PXPA 4KUKA 1TS8A 1TEMA 1GHPA 2JBFA 3HVFA 4R23A 1MZUA 1SCWA 4NXBA 3WS4A 1HD8A 2ZD8A 4E3IA 4DE2A 3MF0A 3FG8A 3OBFA 4KENB 4L9EA 2KX6A 4HP4A 2IA2A 4Y0OA 3KO6A 2VJWA 3IS2A 1K0KA 2W27A 4R1GA 4II7A 3BLSA 3A0RA 5IU1A 5CERA 3CAXA 3IF5A 2GNXA 4MBFA 4N1HA 1IYPA 5CEDA 3N8LA 3ZVTA 2RL3A 4OH0A 1XP4A 3F1NB 4R4RA 4JF6A 2HP9A 5GHZA 4X68A 4DDSA 5CGXA 5FDHA 4JXGA 1JTDA 3HJKA 2M7UA 3KSGA 3NOUC 4S2IA 4DKIA 4WF0A 2B95A 3GECA 4QU3A 3CWFA 4OP8A 4GZBA 1PFLA 3UMDA 4EESA 2LB5A 1M6KA 1TDLA 1N4OA 1EWZA 4X1MA 4M4XA 3UE6A 2WKRA 4S2LA 5E43A 1XA1A 4IHQA 1KE3A 1TDGA 3OCLA 4IVKA 4Q0HA 1C3BA 5FDSA 1I2WA 5D3OA 3CJMA 2VV8A 2Y8HA 5CX7A 5L07A 2VV7A 4LPZA 2WGWB 2R9XA 1HZOA 1CEGA 1CEFA 5F1GA 3MFXA 3V39A 2OWJA 2OOLA 1GA0A 3TSGA 5EVIC 4HBUA 5DJUA 3NY4A 4HJ3A 1G6AA 3UB8A 2HDSA 4WEKA 4IBRA 4RYEA 3PBSA 3PTEA 2KLIA 3M2JA 2Y91A 3HUOA 5F6AA 1KGEA 3G6OA 4GKUA 4S2NA 1BLSA 1FCNA 1IKIA 2ZQ8A 2B18A 4DJ3A 5CXWA 4EV4A 4YOFA 3G4PA 2E8IA 4NG2A 5G18A 2HDUA 2WKEA 1NLYA 1MXOA 2ZBBA 4HJ4A 3OPHA 3ZG5A 4BL2A 3ZG7B 3NULA 1N9BA 3GVBA 3S7PA 1L0GA 5GHXA 4WM9A 4LRXC 2WZZA 1PNEA 4L0LA 2GZAA 5GL9A 1BLPA 4Y3IA 3EGXC 3Q07A 4KQDA 3H82A 1FIKA 1E3UD 3SS5A 2XSSA 2I72A 5HW3A 1F5MA 1BYWA 3SS4A 1YLJA 1XFQA 2VEAA 3BEBA 4MN6A 3UDXA 1RCJA 1N9LA 3G30A 3NOTC 2VLGA 3NBLA 3VP1A 5AVFA 2IWDA 3O3VA 2Q9NA 2JKTM 1DP9A 1MBLA 1VM1A 5DKKA 4CJNA 5HFOA 3CI6A 4NK3A 4HEFA 5EVEA 1VETB 3C7VA 2WAFA 1ZC2A 4PM6A 2HPBA 5J8XA 4BBTA 1K55C 4X1LA 4WLAA 4YWZA 5KSHA 4E3OA 4BL3A 3C2WA 3KYQA 2XK1A 3O87A 3EEHA 3VSKA 4IBXA 2VGKA 3V67A 3ZVWA 5FAOA 1J9MA 1YSQA 3LY4A 1RGYA 3ICYA 2ZC3B 2WZXA 4KQQA 4BLMA 3MZDA 4KZ3A 4HH2A 5HD3A 5TBMB 2WGVA 5F82A 1CK3A 1YLPA 3BY8A 2DRWA 1ODVA 3W2ZA 1ACFA 4BMWA 3UO9A 3RTYA 4LV2A 3GTCA 3PBRA 4I3JA 1W8YA 3A3EA 1K6SA 2WAEA 5GLCA 2JKFA 4MMNA 3QP1A 4Q0IA 2ZM0A 3H9WA 4EQ1A 2Y2MA 4ARZA 3F1OA 1WYCA 2ZOHA 5LBRA 2XLNA 2ZQ9A 3IQAA 4R0QA 2Z6CA 3VP2A 2YKFA 3K3CA 5J3WA 5GLAA 5EOOA 4P6BA 4Z9QA 3EWKA 2JKGA 3RFBA 1S1YA 1KDSA 2MJ6A 1P0ZA 2J3TD 3W4OA 4KG6A 3A3DA 3RXWA 1ESUA 1LL9A 3Q81A 5DFYA 1Y54A 3AGEA 5L8MA 4Q0JA 1IELA 5HX9A 4XT2A 1SZVA 1GHMA 1LI9A 1TS6A 3EGDC 5KZHA 3NJAA 3Q7VB 2PD8A 2P9VB 1AXBA 3NOPC 1WYBA 3UE1A 1Y28A 5DF8A 4CQHA 1IFQA 4EU0A 2ZJ9A 3LI9A 3PHYA 1ZG4A 3V3RA 2GX5A 1HVBA 1P97A 2XGNA 5IT5A 3MXQA 4X53A 2A2LA 3O88A 4B4ZA 2A3UA 2Y2LA 4LFUA 5I5LA 5EOEA 4MCWA 1KGFA 1YLZA 1XJ4A 1OT9A 3DWKA 3HLWA 4OP5A 3MKEA 1K4FA 4FCFA 3S7QA 3OZHA 5E2EA 1LLBA 3F1NA 1XKZA 1SHVA 5FEGA 1T19A 4LRZE 3HJIA 5KMWA 4MEZA 2H0YA 4OQ0A 4O01A 3D72A 3BJNA 4UA6A 2JE5A 5CRFA 4PAUA 2V20A 3VOZA 5EPHA 4KQRA 2Y79A 2EX8A 3ZG9B 2WK0A 3UMEA 2KDKA 2Y59A 2X01A 3LR4A 5A92A 3ZCZA 1TS7A 4PKYG 3UE0A 4E3LA 3ITBA 1NRFA 2HDRA 5HAQA 2Y2NA 3WS0A 4F94A 1VQQA 3T1RA 2Y2IA 4F3LB 1KVLA 1XX2A 3G34A 5TFQA 5HWTA 2C5WB 1PYYA 4OLGA 3LFVA 4IVIA 4K91A 2VGLM 1SKOB 3A3FA 1YT4A 3PAEA 2NUTC 2P74A 3I7JA 5FI7A 3CLOA 4GHIA 4JGPA 5G4ZA 4EUVA 3CHWP 1BZAA 4FTXA 1CJFA 5J4EA 4LGWA 3OCNA 1FQGA 2X71A 3UDIA 4ZJ3A 4ESPA 1S67L 1ERQA 2PDRA 1DJCA 3VFHA 1IYQA 4OLDA 1FOFA 3BWLA 1AWIA 2OV5A 3MS6A 5AJGA 1MWUA 3VE4A 1OJ5A 2H28A 3D4FA 2OWHA 4EBNA 1ONHA 2HGVA 4F3LA 3GSGA 4I5SA 3LICA 2VKSA 3VOYA 1FSYA 4DE0A 5CECA 3SS3A 4Y15A 3T4LA 4GW9A 1NY0A 3M6BA 1Z6FA 1I2SA 1MWRA 1W8QA 2HZ5A 2OLUA 1ES5A 2L4RA 4HNBA 1VEUB 3W4PA 3A0SA 4WZ4A 4JKTA 1S0WA 5HWWA 1Q2QA 1V9ZA 3GR2A 4RX3A 5EM1A 3A0VA 3DW0A 1D7EA 2PU2A 4PKYA 3IX4A 5MC7A 3T4TA 3KSHA 4Y13A 3IX3A 3C38A 3PAGA 2FFFB 4R70A 5A8BA 1BULA 3PBTA 1IOUA 2O0YA 5DFXA 1NZUA 1PW1A 3PBQA 4G3VA 1XJ2A 4N9LA 5DF9A 1BLCA 1JVJA 5HL1A 3IX8A 5EM0A 1CI9A 3BQ8A 2H5SA 4ZRRA 1NRJA 2R9WA 2P9VA 2JKRM 2QKPA 2HDQA 3ZFZA 1N9OA 1XGJA 3MZEA 3Q7VA 3RH8B 5FATA 2YKHA 1G68A 3N8RA 3BW6A 3VOLA 4P6ZM 4X6TA 4ARZB 3RJUA 5HD5A 1OTIA 2P08A 2QYBA 4DF6A 4D60A 1K56D 4XXRA 1LL5A 2K2NA 4DE3A 4C75A 3MQQA 4GDNA 1Z09A 1ES3A 4JGQA 4P87A 1FR1A 1DJAA 2V8FA 4PM5A 1H5XA 3KSIA 1GA9A 3SZTA 3LIBA 1GSXA 2XF3A 4P85A 4YINA 4FUWA 3LR5A 3T1QB 4EUZA 2W3DA 4OPQA 3GDIA 1Y4OA 4QJGA 4OPRA 2ZQDA 1IYSA 3ZHHA 2WYXA 4O7DA 4PM9A 3V3SA 5E2FA 3FPWA 3N6IA 4EBPA 4DJ2A 4RX2A 1MPLA 5G4YA 3IBRA 1PZOA 4LV0A 3T50A 3HLCA 4CPKA 3BM6A 4L9FA 3N4IA 2HV1A 3BFEA 4JF5A 1PIOA 2W3HA 3IXDA 4LCLA 3UN7A 4CLCA 4U3TA 2ZMVA 3B3XA 2H10A 3LI8A 5TJJA 4MN5A 4A5RA 2ZQAA 4GJ4A 2XH9A 1G5UA 1HTZA 3T1SA 2I9VA 3L9KA 1OTEA 4E6XA 4BD0A 2PR6A 3LEQA 3EQVA 3ZDJA 3WWXA 1HLUP 4HOIA 2FZ0A 4MNRA 5TGFA 1FR6A 1KE4A 4JGRA 3SW1A 1ESIA 1K57A 4P6ZS 5HZHA 3CPTB 4GDBA 5DVAA 2JN7A 5CHJA 5CTNA 1NWZA 4D2OA 3Q1FA 3OOVA 4CLCE 4GN2A 1GSWA 4UA9A 1LL8A 3N7WA 5FSRA 4ZJ1A 3BY9A 3T1XA 1YM1A 1OMEA 2Q0OA 2EFUA 3G35A 3K3DA 2V0WA 2WUQA 2CC1A 3IHBA 2Y55A 3VV4A 1ERMA 3C5AA 3HUNA 1JWPA 3UNWA 3E2LA 3LIEA 1S1ZA 5L2FA 3IWOA 3Q82A 3TW8A 1SDNA 1K56A 4K08A 3C4PA 1W7FA 2EA9A 2L0WA 3B47A 3DTKA 3VMAA 4UAAA 3HLDA 4Y0TA 3MKFA 4MN7A 2EXBA 2WADA 3L7HA 2EX2A 2OLVA 3P01A 2G2UA 2QZ6A 1SKOA 3T4KA 1NZOA 3ZNTA 1BT5A 3IF6C 4NKPA 3FKWA 3DTEA 4N1XA 3JYIA 1H8YA 1MY8A 3A3IA 4ETXA 1WE4A 3AGFA 3MR0A 2NUPC 4LV1A 2PHYA 5FASA 2WKHA 2XA7S 4KG2A 3IWIA 3LY3A 3WS1A 4EW7A 4NETA 2JC7A 2VZWA 4X25A 3T12B 4BQMA 2EXAA 2PYRA 4Y7PA 2XA7M 3PBNA 3H7WA 5HPFA 1K6RA 2P7JA 1LHYA 1PW8A 3HBRA 3DBAA 4MDZA 2R78A 2XQZA 4H6JB 1EI5A 3S4XA 2Z6DA 4UEYA 1CI8A 2GDNA 4GD6A 1STZA 4GNUA 2ZQ7A 3RXXA 1YLWA 4E04A 1KDWA 1K54A 2Q9MA 1XJ3A 2WKPA 3F1PB 1NJ4A 1YPRA 3HLGA 3GV9A 3CPTA 3PR6A 3F1PA 3SH8A 1GCEA 1TS0A 3C8CA 5HDSA 4N9KA 3NCKA 2VA0A 2PT7A 1E3UA 3BFGA 3S7OA 3R7WA 2W1TB 3D3OA 3LUQA 4QPRA 5FAPA 3MSHA 3WRZA 1K4EA 4G3WA 4LV3A 4E3MA 1YSPA 3NDEA 2Y2PA 1ZG6A 1T1BA 3G32A 4CLCB 4S2JA 1E4DA 3BRMA 4BJPA 4H8RA 2Y2QA 1NYYA 4QY5A 4S2KA 1S6RA 2K31A 4HI4A 2V2FF 5CGWA 1MKIA 5F68A 5FEFA 2PU4A 4RQ9A 5HSQA 1DJBA 3WS5A 1G28A 3UE3A 2VGJA 2B5RA 3P7NA 3IH8A 3TG9A 4WN5A 5EVIB 4BWIA 4WEJA 1NLZA 4R3JA 5FA7A 5CEBA 5A90A 3FKVA 2DNSA 1H8ZA 4C6YA 2Y2HA 4JXVA 3V5MA 5KIZA 5EFWA 2PAVP 3BFDA 1KE0A 2G2WA 4OOYA 5KSCA 2UV0E 3LIFA 3KSFA 3C7UA 2RCXA 2ZLYA 1D1JA 1FSWA 4I38A 5I94A 1PI5A 1OTAA 3OPPA 4BBUA 4X56A 2CMNA 3UB6A 2PR5A 4PHTA 1RGZA 4DDYA 1YKDA 1X0OA 4JXSA 1NXYA 1DRMA 3QP4A 2ACGA 5A91A 1ES4A 4FOFA 2W0NA 1QMEA 4DXBA 1TVFA 4XT2B 4E3JA 3NC8A 2D02A 2GJ3A 3UPOA 3P09A 5F1FA 5AVEA 1PRQA 2WGIA 4HJ6A 3UPPA 3MQOA 1W63M 1LSXA 1GSVA 2XDMA 2J3TC 4WUJA 2QJ7A 4OOMA 1F9IA 1IEMA 4NXEA 3N8SA 4OONA 5F83A 1L2SA 3HLBA 2XR0A 1N9NA 3E2KA 4EBLA 2VGLS 4N92A 1A0KA 4IUHA 3ISGA 3QP8A 3TE8A 5AQAA 5HWVA 2O9CA 2X02A 1EW0A 5GHYA 4I39A 3B42A 4S2OA 4XUXA 3MBZA 1JWZA 2HP5A 3VFFA 4MLLA 2W3FA 3CZDA 3DTIA 1FCOA 4GB7A 1H0MA 5J7EA 4DE1A 5EVIA 4OPYA 4UQIS 2J7VA 5IS1A 1MWSA 4KUOA 1LI0A 2G7UA 4ME4A 3F1OB 5IHVA 4E6WA 4ZTKA 4KZ5A 1XPBA 2INWA 5FQ9A 2FFYA 5FL3A 4GOGA 3FC7A 3CG5A 4Y17A 3OPRA 4LENA 1OTBA 3T4OA 4S2NC 1NYMA 2XRNA 4KZAA 3S1YA 3VE3A 2Y2JA 2ZMAA 5DTTA 4WMCD 3NECA 5DTKA 1K25A 3M6HA 3R4KA 2VK3A 1T1CA 4I3AA 3TJZC 5JYOA 4MBKA 3NHQA 3W8KA 5AQBA 5HDCA 3C4OA 3LIAA 3BECA 1UWNX 4M3KA 3CITA 4WBGA 4GD8A 2C6WB 3QNBA 5FQQA 5DF7A 3LGOA 3FYZA 1O07A 2D01A 4Y0UA 3HLFA 4E3NA 2EWWA 4DRTA 3O5YA 2Z2LB 2ZC7A 2QMIA 3A3JA 3DAVA 4KZ6A 1M40A 3JPUA 1FILA 5GLDA 2UWXA 4GCZA 3LR3A 3EQUA 3V50A 3U2AA 3KX0X 5TBMA 1P9RA 5DJTA 3S22A 4QWOA 5M1AA 1K54C 4R3AA 4Y2FA 1L0FA 5EVLA 3K2NA 4PM7A 2Y2GA 4QY6A 2QJ5A 3ZYTA 4OKPA 4WZ5A 4OQHA 1S4SA 2BG1A 2V1AA 1PZPA 4DN0A 3E4QA 4UHUA 5JYPA 5CHUA 5CGSA 1G6OA 3OPLA 3HLEA 5F69A 3R7WB 3VP4A 5M18A 2EWVA 1SDEA 2ZL1B 1WA9A 3H7WB 2PD7A 2JKTI 1H3QA 2L1MA 3C30A 1UWPX 1PWGA 3G2ZA 2HF6A 3W4QA 5K5BA 3WS2A 1S66L 1VB6A 2Y4AA 2DCFA 1ZHHB 3M2KA 5AQ7A 1OTDA 3UDFA 3T4JA 4AFIA 2DMWA 3MXRA 4EXOA 3IXBA 2W1TA 3BQAA 1W63Q 5FI6A 3MJQA 3G31A 1ALQA 4YNRA 3IS2B 3KYEA 3HCYA 4HIAA 3KYZA 4OQGA 3GRJA 1XXMA 4FSFA 4NXFA 2V8CA 4ID4A 2WGWA 5FQMA 3MXSA 4KZBA 3BYDA 5BOHA 4H6JA 4B9OA 4DXCA 4LCMA 2H0TA 2J9PA 3Q7ZA 3LO7A 2W3GA 3TOIA 1YAXA 4DMZA 4ZJ2A 1JTGA 3DTMA 2ZC6B 4RVAA 4O0PA 5FAQA 5E2GA 2V1BA 1EROA 4G3KA 4NEED 2ZOIA 3U4LP 3IF6B 3OC2A 2IWBA 3QHYA 4LRYC 1FCMA 4GHIB 4E3KA 4KQOA 5U47A 3UY6A 3CMZA 2XFSA 1OJGA 1L0DA 3HUMA 2HJEA 4GS9A 4QB8A 5L09A 2PBYA 1BTLA 2E8JA 2ZM8A 3B33A 5EE8A 5HARA 4JLFA 1CF0A 1VHMA 3CUEA 1LSWA 3GQZA 4K0XA 3NDGA 3VP0A 4U0TA 1TD5A 4L9GA 4K0WA 4BENA 5GLBA
chains in the Genus database with same CATH topology
3WS5A 3UE3A 4OP8A 2VGJA 1ONHA 4GZBA 3ZG8B 2B5RA 3O86A 3IH8A 3TG9A 5EVIB 5EVID 3GSGA 4WEJA 3IXHA 2ZC5B 1M6KA 1IYOA 1TDLA 1N4OA 4R3JA 5FA7A 1EWZA 5CEBA 5A90A 3VOYA 1FSYA 3FKVA 5EUAA 1ZKJA 4KZ7A 4DE0A 5CECA 1O7EA 2DNSA 1H8ZA 4S2LA 3SS3A 5E43A 4C6YA 1BUEA 3ZNYA 1NY0A 1XA1A 2Y2HA 4FD8A 3M6BA 4JXVA 1Z6FA 1KE3A 4EWFA 1TDGA 1I2SA 1MWRA 3V5MA 3OCLA 4IVKA 1W8QA 2OLUA 4S2PA 1C3BA 2EX6A 3BFDA 1KE0A 3ZG0A 1ES5A 1QMFA 2G2WA 3DWZA 4FH2A 4OOYA 1I2WA 5KSCA 3FWLA 4S2MA 3C7UA 2RCXA 5D3OA 2ZLYA 1FSWA 5I94A 3CJMA 3W4PA 4WZ4A 1PI5A 4JF4A 4RA7A 2WGWB 4JKTA 2R9XA 1HZOA 1CEGA 2ZQCA 1CEFA 3OPPA 2ZM2A 1S0WA 1W5DA 4X56A 5F1GA 3V39A 1Q2QA 1GA0A 1RGZA 5EVIC 3TSGA 4HBUA 3GR2A 2HP6A 3NY4A 4RX3A 1SKFA 1G6AA 4DDYA 2HDSA 3DW0A 4WEKA 3IHAA 4IBRA 2PU2A 4JXSA 4RYEA 1KGGA 1NXYA 3PBSA 3PTEA 3M2JA 1XGIA 2Y91A 4P0MA 4BD1A 3LCEA 3HUOA 3SOIA 5A91A 1ES4A 1KGEA 4GKUA 4S2NA 1QMEA 1BLSA 1FCNA 3PAGA 1IKIA 2ZQ8A 2FFFB 3MFDA 5CXWA 4EV4A 3G4PA 4DXBA 1TVFA 5TR7A 2E8IA 4E3JA 1BULA 3NC8A 3PBTA 4QHCA 5G18A 2HDUA 2WKEA 4B88A 3UPOA 3P09A 5F1FA 1MXOA 2WGIA 1NZUA 1PW1A 1DY6A 3PBOA 3OPHA 1ONGA 3ZG5A 3PBQA 3UPPA 4BL2A 3ZG7B 2WKIA 4N9LA 1N9BA 3IXGA 5DF9A 1BLCA 1JVJA 3GVBA 3P98A 5HL1A 2XDMA 1CI9A 1L0GA 5GHXA 2H5SA 4U0XA 4WM9A 4JXWA 2WZZA 2R9WA 4OOMA 2P9VA 1IEMA 4OPZA 2HDQA 4L0LA 2XFTA 5E2HA 4B4XA 4WMCA 5GL9A 3G2YA 3ZFZA 3N8SA 4OONA 1BLPA 5F83A 1XGJA 3MZEA 3Q7VA 1YMXA 1L2SA 3Q07A 4OQIA 3HLBA 1G68A 2XR0A 3N8RA 3GMWA 1YQSA 1E3UD 1PWDA 3SS5A 3E2KA 4EBLA 4IEDA 2I72A 4X6TA 4N92A 3RJUA 5HW3A 4ZAMA 2J8YA 4DF6A 1K56D 3SS4A 3ISGA 4XXRA 1LL5A 1YLJA 1PI4A 3BEBA 5AQAA 3UDXA 1RCJA 3FZCA 4DE3A 3G30A 4C75A 2X02A 4GDNA 1GHIA 1ES3A 5FI2A 4P87A 1FR1A 4JBFA 5GHYA 1DJAA 4S2OA 4PM5A 3NBLA 4R3BA 3VP1A 4XUXA 2IWDA 3MBZA 1H5XA 1JWZA 2HP5A 3O3VA 3VFFA 1GA9A 2Q9NA 4MLLA 2XF3A 1MBLA 1Q2PA 1VM1A 4P85A 4QD4A 3CZDA 1FCOA 4C3QA 4KZ4A 4GB7A 5HFOA 4CJNA 4YINA 4NK3A 4HEFA 3C7VA 2WAFA 1ZC2A 5FQKA 4DE1A 5EVIA 4PM6A 4EUZA 2HPBA 5HAIA 4OPYA 2V1ZA 2J7VA 5J8XA 1MWSA 4OPQA 1K55C 1LI0A 3HREA 4QJGA 4OPRA 5KSHA 4E3OA 2ZQDA 5IHVA 3O87A 4BL3A 2XK1A 5A93A 4E6WA 1IYSA 4ZTKA 4IBXA 4KZ5A 3VSKA 2Y2OA 1XPBA 5FQ9A 2VGKA 2FFYA 3AGDA 4GOGA 4QU3A 3CG5A 3ZVWA 5FAOA 3ZHHA 1J9MA 3OPRA 4LENA 4YFMA 2WYXA 4O7DA 3LY4A 1RGYA 3IWQA 2ZC3B 4S2NC 4PM9A 3V3SA 2WZXA 5E2FA 3MZFA 4KQQA 4EBNA 1NYMA 4KZAA 2JCHA 4BLMA 3MZDA 4KZ3A 3N6IA 3S1YA 4EBPA 4RX2A 1MPLA 2WGVA 2Y2JA 5F82A 2ZMAA 1CK3A 1YLPA 5DTTA 2DRWA 4WMCD 1PZOA 4LV0A 4X55A 5DTKA 3HLCA 4CPKA 1BLHA 1K25A 3M6HA 4OVDA 3UO9A 2XD5A 3BM6A 4ZBEA 3N4IA 4LV2A 3BFEA 4JF5A 3GTCA 3PBRA 1W8YA 3A3EA 1K6SA 1PIOA 2WAEA 3IXDA 3HL9A 4LCLA 3UN7A 1PWCA 5GLCA 5JYOA 4U3TA 3B3XA 2H10A 4PPRA 5CTMA 2ZM0A 3ZGAB 4MBKA 3BFFA 4A5RA 2ZQAA 3W8KA 2XH9A 5AQBA 2Y2MA 1HTZA 3C4OA 5DTSA 1WYCA 5M19A 3BECA 2XD1A 4M3KA 2XLNA 4E6XA 4WBGA 4BD0A 4GD8A 2C6WB 3QNBA 5FQQA 3EQVA 3ZDJA 3WWXA 1E25A 2ZQ9A 3IQAA 4MNRA 4R0QA 1FR6A 5TGFA 1YMSA 1KE4A 5DF7A 3VP2A 4XUZA 3FYZA 1O07A 1BSGA 4Y0UA 5EOOA 1ESIA 3HLFA 5GLAA 2Z2MB 1K57A 4E3NA 4P6BA 4Z9QA 4DRTA 1KDSA 4WZ5C 2Z2LB 4GDBA 2ZC7A 2QMIA 4FH4A 3A3JA 5CHMA 5CHJA 5DVAA 4ZDXA 4KZ6A 1M40A 5CTNA 1U60A 3W4OA 4D2OA 3Q1FA 3UPNA 4KG6A 1I5QA 3A3DA 4GN2A 4EQIA 3RXWA 5GLDA 1ESUA 4UA9A 3N7WA 1LL9A 5FSRA 4ZJ1A 2UWXA 3Q81A 3V50A 3EQUA 3NIAA 1Y54A 3AGEA 1YM1A 1IELA 1OMEA 5HX9A 3VP3A 2EFUA 3G35A 1GHMA 1LI9A 3LEZA 2EFXA 1K38A 3S22A 2WUQA 2CC1A 3IHBA 2Y55A 5M1AA 1K54C 1ERMA 1ES2A 2J9OA 3C5AA 5KZHA 2XEPA 3HUNA 1YLYA 1JWPA 3Q7VB 3SH9A 1L0FA 3UNWA 5EVLA 3E2LA 1JWVA 2QPNA 5L2FA 4R4SA 3IH9A 3IWOA 3Q82A 1K55A 2P9VB 1AXBA 4PM7A 5FQJA 1WYBA 2Y2GA 4QY6A 5GLBA 3UE1A 1SDNA 1K56A 5DF8A 2ZJ9A 3FV7A 4PM8A 3C4PA 2OSUA 1W7FA 1ZG4A 4OKPA 4WZ5A 3V3RA 3BFCA 4OQHA 4KZ8A 2EX9A 3VMAA 4UAAA 1HVBA 2XGNA 3HLDA 4X69A 4Y0TA 2BG1A 3SH7A 3MKFA 2EXBA 2WADA 4X53A 2EX2A 2OLVA 3O88A 4B4ZA 2A3UA 1PZPA 2Y2LA 3ITAA 5EOEA 4UHUA 1KGFA 1YLZA 2G2UA 5JYPA 3IT9A 1YLTA 5CHUA 5CGSA 2QZ6A 3HLWA 3DWKA 2BLSA 3OPLA 5AQ9A 3HLEA 3VP4A 5M18A 1NZOA 1SDEA 1KVMA 3MKEA 4OP5A 1K4FA 3ZNTA 1BT5A 3IF6C 4FCFA 3OZHA 2Y2KA 3FKWA 5E2EA 4HBTA 1LLBA 1XKZA 4N1XA 3JYIA 4MBHA 1H8YA 1MY8A 1PWGA 5HAPA 1SHVA 4OOLA 3A3IA 1L0EA 3G2ZA 5EECA 1WE4A 1MWTA 3W4QA 4Q8IA 1XA7A 3AGFA 1RP5A 3WS2A 3NI9A 4LV1A 5KMWA 4MEZA 2H0YA 5FASA 2Y4AA 4OQ0A 2WKHA 3BLMA 2DCFA 4UA6A 2JE5A 4KG2A 3IWIA 3LY3A 3M2KA 5CRFA 3WRTA 4UA7A 5AQ7A 3WS1A 4KG5A 3UDFA 2V20A 4NETA 3VOZA 2A49A 2IWCA 2JC7A 5EPHA 2ZC4B 4WELA 3MXRA 3IXBA 4KQRA 4HESA 2EX8A 4KZ9A 5FI6A 4JPMA 3VSLA 3ZG9B 4BQMA 2WK0A 2EXAA 4PMAA 3G31A 1ALQA 4Y7PA 1IKGA 3PBNA 3IF6A 2Y59A 5FQIA 1K6RA 2X01A 4OQGA 1LHYA 1W79A 3GRJA 1PW8A 1XXMA 3HBRA 4FSFA 4WYYA 5A92A 4ID4A 3ZCZA 2WGWA 2XQZA 3QNCA 5FQMA 3UE0A 4E3LA 1EI5A 1K57C 3S4XA 3MXSA 1CI8A 4KZBA 2GDNA 3BYDA 1TEMA 3ITBA 4GD6A 1GHPA 5BOHA 1NRFA 2HDRA 2JBFA 3HVFA 4R23A 4DXCA 5HAQA 2Y2NA 4GNUA 4LCMA 2H0TA 2J9PA 2ZQ7A 3Q7ZA 1SCWA 3RXXA 3LO7A 1YLWA 3WS4A 1HD8A 2ZD8A 3TOIA 1KDWA 3WS0A 4E3IA 1K54A 2Q9MA 4DE2A 4F94A 4ZJ2A 1JTGA 1VQQA 3DTMA 2ZC6B 2Y2IA 4KENB 1NJ4A 4RVAA 1KVLA 1XX2A 3G34A 5TFQA 3HLGA 5FAQA 5E2GA 3GV9A 1EROA 2C5WB 1PYYA 4OLGA 4Y0OA 3IF6B 3SH8A 1GCEA 4IVIA 3OC2A 2IWBA 4R1GA 4K91A 3QHYA 4N9KA 3BLSA 1FCMA 5CERA 3A3FA 3NCKA 1YT4A 4E3KA 3PAEA 4KQOA 3IF5A 1E3UA 3BFGA 4MBFA 4N1HA 5U47A 3UY6A 2P74A 1IYPA 2XFSA 3CMZA 3I7JA 5FI7A 5FAPA 3N8LA 1L0DA 3HUMA 3ZVTA 5CEDA 3WRZA 1K4EA 2RL3A 4LV3A 4OH0A 4E3MA 3NDEA 2Y2PA 4QB8A 1BZAA 1XP4A 1ZG6A 2PBYA 4JF6A 2HP9A 3G32A 3OCNA 1BTLA 4R4RA 5GHZA 1FQGA 2X71A 3UDIA 4S2JA 2ZM8A 1E4DA 4X68A 4ZJ3A 4DDSA 5EE8A 5CGXA 5HARA 4JLFA 3BRMA 4BJPA 5FDHA 4JXGA 4H8RA 2Y2QA 1ERQA 1DJCA 3GQZA 1JTDA 3VFHA 4K0XA 1IYQA 1NYYA 3NDGA 4QY5A 4S2KA 4U0TA 3VP0A 1S6RA 4OLDA 1FOFA 2V2FF 2OV5A 4S2IA 1MKIA 4K0WA 5CGWA 4DKIA 1MWUA 2PU4A 3D4FA 4BENA 1DJBA 5FATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS5 A;  3UE3 A;  4OP8 A;  2VGJ A;  1ONH A;  4GZB A;  3ZG8 B;  2B5R A;  3O86 A;  3IH8 A;  3TG9 A;  5EVI B;  5EVI D;  3GSG A;  4WEJ A;  3IXH A;  2ZC5 B;  1M6K A;  1IYO A;  1TDL A;  1N4O A;  4R3J A;  5FA7 A;  1EWZ A;  5CEB A;  5A90 A;  3VOY A;  1FSY A;  3FKV A;  5EUA A;  1ZKJ A;  4KZ7 A;  4DE0 A;  5CEC A;  1O7E A;  2DNS A;  1H8Z A;  4S2L A;  3SS3 A;  5E43 A;  4C6Y A;  1BUE A;  3ZNY A;  1NY0 A;  1XA1 A;  2Y2H A;  4FD8 A;  3M6B A;  4JXV A;  1Z6F A;  1KE3 A;  4EWF A;  1TDG A;  1I2S A;  1MWR A;  3V5M A;  3OCL A;  4IVK A;  1W8Q A;  2OLU A;  4S2P A;  1C3B A;  2EX6 A;  3BFD A;  1KE0 A;  3ZG0 A;  1ES5 A;  1QMF A;  2G2W A;  3DWZ A;  4FH2 A;  4OOY A;  1I2W A;  5KSC A;  3FWL A;  4S2M A;  3C7U A;  2RCX A;  5D3O A;  2ZLY A;  1FSW A;  5I94 A;  3CJM A;  3W4P A;  4WZ4 A;  1PI5 A;  4JF4 A;  4RA7 A;  2WGW B;  4JKT A;  2R9X A;  1HZO A;  1CEG A;  2ZQC A;  1CEF A;  3OPP A;  2ZM2 A;  1S0W A;  1W5D A;  4X56 A;  5F1G A;  3V39 A;  1Q2Q A;  1GA0 A;  1RGZ A;  5EVI C;  3TSG A;  4HBU A;  3GR2 A;  2HP6 A;  3NY4 A;  4RX3 A;  1SKF A;  1G6A A;  4DDY A;  2HDS A;  3DW0 A;  4WEK A;  3IHA A;  4IBR A;  2PU2 A;  4JXS A;  4RYE A;  1KGG A;  1NXY A;  3PBS A;  3PTE A;  3M2J A;  1XGI A;  2Y91 A;  4P0M A;  4BD1 A;  3LCE A;  3HUO A;  3SOI A;  5A91 A;  1ES4 A;  1KGE A;  4GKU A;  4S2N A;  1QME A;  1BLS A;  1FCN A;  3PAG A;  1IKI A;  2ZQ8 A;  2FFF B;  3MFD A;  5CXW A;  4EV4 A;  3G4P A;  4DXB A;  1TVF A;  5TR7 A;  2E8I A;  4E3J A;  1BUL A;  3NC8 A;  3PBT A;  4QHC A;  5G18 A;  2HDU A;  2WKE A;  4B88 A;  3UPO A;  3P09 A;  5F1F A;  1MXO A;  2WGI A;  1NZU A;  1PW1 A;  1DY6 A;  3PBO A;  3OPH A;  1ONG A;  3ZG5 A;  3PBQ A;  3UPP A;  4BL2 A;  3ZG7 B;  2WKI A;  4N9L A;  1N9B A;  3IXG A;  5DF9 A;  1BLC A;  1JVJ A;  3GVB A;  3P98 A;  5HL1 A;  2XDM A;  1CI9 A;  1L0G A;  5GHX A;  2H5S A;  4U0X A;  4WM9 A;  4JXW A;  2WZZ A;  2R9W A;  4OOM A;  2P9V A;  1IEM A;  4OPZ A;  2HDQ A;  4L0L A;  2XFT A;  5E2H A;  4B4X A;  4WMC A;  5GL9 A;  3G2Y A;  3ZFZ A;  3N8S A;  4OON A;  1BLP A;  5F83 A;  1XGJ A;  3MZE A;  3Q7V A;  1YMX A;  1L2S A;  3Q07 A;  4OQI A;  3HLB A;  1G68 A;  2XR0 A;  3N8R A;  3GMW A;  1YQS A;  1E3U D;  1PWD A;  3SS5 A;  3E2K A;  4EBL A;  4IED A;  2I72 A;  4X6T A;  4N92 A;  3RJU A;  5HW3 A;  4ZAM A;  2J8Y A;  4DF6 A;  1K56 D;  3SS4 A;  3ISG A;  4XXR A;  1LL5 A;  1YLJ A;  1PI4 A;  3BEB A;  5AQA A;  3UDX A;  1RCJ A;  3FZC A;  4DE3 A;  3G30 A;  4C75 A;  2X02 A;  4GDN A;  1GHI A;  1ES3 A;  5FI2 A;  4P87 A;  1FR1 A;  4JBF A;  5GHY A;  1DJA A;  4S2O A;  4PM5 A;  3NBL A;  4R3B A;  3VP1 A;  4XUX A;  2IWD A;  3MBZ A;  1H5X A;  1JWZ A;  2HP5 A;  3O3V A;  3VFF A;  1GA9 A;  2Q9N A;  4MLL A;  2XF3 A;  1MBL A;  1Q2P A;  1VM1 A;  4P85 A;  4QD4 A;  3CZD A;  1FCO A;  4C3Q A;  4KZ4 A;  4GB7 A;  5HFO A;  4CJN A;  4YIN A;  4NK3 A;  4HEF A;  3C7V A;  2WAF A;  1ZC2 A;  5FQK A;  4DE1 A;  5EVI A;  4PM6 A;  4EUZ A;  2HPB A;  5HAI A;  4OPY A;  2V1Z A;  2J7V A;  5J8X A;  1MWS A;  4OPQ A;  1K55 C;  1LI0 A;  3HRE A;  4QJG A;  4OPR A;  5KSH A;  4E3O A;  2ZQD A;  5IHV A;  3O87 A;  4BL3 A;  2XK1 A;  5A93 A;  4E6W A;  1IYS A;  4ZTK A;  4IBX A;  4KZ5 A;  3VSK A;  2Y2O A;  1XPB A;  5FQ9 A;  2VGK A;  2FFY A;  3AGD A;  4GOG A;  4QU3 A;  3CG5 A;  3ZVW A;  5FAO A;  3ZHH A;  1J9M A;  3OPR A;  4LEN A;  4YFM A;  2WYX A;  4O7D A;  3LY4 A;  1RGY A;  3IWQ A;  2ZC3 B;  4S2N C;  4PM9 A;  3V3S A;  2WZX A;  5E2F A;  3MZF A;  4KQQ A;  4EBN A;  1NYM A;  4KZA A;  2JCH A;  4BLM A;  3MZD A;  4KZ3 A;  3N6I A;  3S1Y A;  4EBP A;  4RX2 A;  1MPL A;  2WGV A;  2Y2J A;  5F82 A;  2ZMA A;  1CK3 A;  1YLP A;  5DTT A;  2DRW A;  4WMC D;  1PZO A;  4LV0 A;  4X55 A;  5DTK A;  3HLC A;  4CPK A;  1BLH A;  1K25 A;  3M6H A;  4OVD A;  3UO9 A;  2XD5 A;  3BM6 A;  4ZBE A;  3N4I A;  4LV2 A;  3BFE A;  4JF5 A;  3GTC A;  3PBR A;  1W8Y A;  3A3E A;  1K6S A;  1PIO A;  2WAE A;  3IXD A;  3HL9 A;  4LCL A;  3UN7 A;  1PWC A;  5GLC A;  5JYO A;  4U3T A;  3B3X A;  2H10 A;  4PPR A;  5CTM A;  2ZM0 A;  3ZGA B;  4MBK A;  3BFF A;  4A5R A;  2ZQA A;  3W8K A;  2XH9 A;  5AQB A;  2Y2M A;  1HTZ A;  3C4O A;  5DTS A;  1WYC A;  5M19 A;  3BEC A;  2XD1 A;  4M3K A;  2XLN A;  4E6X A;  4WBG A;  4BD0 A;  4GD8 A;  2C6W B;  3QNB A;  5FQQ A;  3EQV A;  3ZDJ A;  3WWX A;  1E25 A;  2ZQ9 A;  3IQA A;  4MNR A;  4R0Q A;  1FR6 A;  5TGF A;  1YMS A;  1KE4 A;  5DF7 A;  3VP2 A;  4XUZ A;  3FYZ A;  1O07 A;  1BSG A;  4Y0U A;  5EOO A;  1ESI A;  3HLF A;  5GLA A;  2Z2M B;  1K57 A;  4E3N A;  4P6B A;  4Z9Q A;  4DRT A;  1KDS A;  4WZ5 C;  2Z2L B;  4GDB A;  2ZC7 A;  2QMI A;  4FH4 A;  3A3J A;  5CHM A;  5CHJ A;  5DVA A;  4ZDX A;  4KZ6 A;  1M40 A;  5CTN A;  1U60 A;  3W4O A;  4D2O A;  3Q1F A;  3UPN A;  4KG6 A;  1I5Q A;  3A3D A;  4GN2 A;  4EQI A;  3RXW A;  5GLD A;  1ESU A;  4UA9 A;  3N7W A;  1LL9 A;  5FSR A;  4ZJ1 A;  2UWX A;  3Q81 A;  3V50 A;  3EQU A;  3NIA A;  1Y54 A;  3AGE A;  1YM1 A;  1IEL A;  1OME A;  5HX9 A;  3VP3 A;  2EFU A;  3G35 A;  1GHM A;  1LI9 A;  3LEZ A;  2EFX A;  1K38 A;  3S22 A;  2WUQ A;  2CC1 A;  3IHB A;  2Y55 A;  5M1A A;  1K54 C;  1ERM A;  1ES2 A;  2J9O A;  3C5A A;  5KZH A;  2XEP A;  3HUN A;  1YLY A;  1JWP A;  3Q7V B;  3SH9 A;  1L0F A;  3UNW A;  5EVL A;  3E2L A;  1JWV A;  2QPN A;  5L2F A;  4R4S A;  3IH9 A;  3IWO A;  3Q82 A;  1K55 A;  2P9V B;  1AXB A;  4PM7 A;  5FQJ A;  1WYB A;  2Y2G A;  4QY6 A;  5GLB A;  3UE1 A;  1SDN A;  1K56 A;  5DF8 A;  2ZJ9 A;  3FV7 A;  4PM8 A;  3C4P A;  2OSU A;  1W7F A;  1ZG4 A;  4OKP A;  4WZ5 A;  3V3R A;  3BFC A;  4OQH A;  4KZ8 A;  2EX9 A;  3VMA A;  4UAA A;  1HVB A;  2XGN A;  3HLD A;  4X69 A;  4Y0T A;  2BG1 A;  3SH7 A;  3MKF A;  2EXB A;  2WAD A;  4X53 A;  2EX2 A;  2OLV A;  3O88 A;  4B4Z A;  2A3U A;  1PZP A;  2Y2L A;  3ITA A;  5EOE A;  4UHU A;  1KGF A;  1YLZ A;  2G2U A;  5JYP A;  3IT9 A;  1YLT A;  5CHU A;  5CGS A;  2QZ6 A;  3HLW A;  3DWK A;  2BLS A;  3OPL A;  5AQ9 A;  3HLE A;  3VP4 A;  5M18 A;  1NZO A;  1SDE A;  1KVM A;  3MKE A;  4OP5 A;  1K4F A;  3ZNT A;  1BT5 A;  3IF6 C;  4FCF A;  3OZH A;  2Y2K A;  3FKW A;  5E2E A;  4HBT A;  1LLB A;  1XKZ A;  4N1X A;  3JYI A;  4MBH A;  1H8Y A;  1MY8 A;  1PWG A;  5HAP A;  1SHV A;  4OOL A;  3A3I A;  1L0E A;  3G2Z A;  5EEC A;  1WE4 A;  1MWT A;  3W4Q A;  4Q8I A;  1XA7 A;  3AGF A;  1RP5 A;  3WS2 A;  3NI9 A;  4LV1 A;  5KMW A;  4MEZ A;  2H0Y A;  5FAS A;  2Y4A A;  4OQ0 A;  2WKH A;  3BLM A;  2DCF A;  4UA6 A;  2JE5 A;  4KG2 A;  3IWI A;  3LY3 A;  3M2K A;  5CRF A;  3WRT A;  4UA7 A;  5AQ7 A;  3WS1 A;  4KG5 A;  3UDF A;  2V20 A;  4NET A;  3VOZ A;  2A49 A;  2IWC A;  2JC7 A;  5EPH A;  2ZC4 B;  4WEL A;  3MXR A;  3IXB A;  4KQR A;  4HES A;  2EX8 A;  4KZ9 A;  5FI6 A;  4JPM A;  3VSL A;  3ZG9 B;  4BQM A;  2WK0 A;  2EXA A;  4PMA A;  3G31 A;  1ALQ A;  4Y7P A;  1IKG A;  3PBN A;  3IF6 A;  2Y59 A;  5FQI A;  1K6R A;  2X01 A;  4OQG A;  1LHY A;  1W79 A;  3GRJ A;  1PW8 A;  1XXM A;  3HBR A;  4FSF A;  4WYY A;  5A92 A;  4ID4 A;  3ZCZ A;  2WGW A;  2XQZ A;  3QNC A;  5FQM A;  3UE0 A;  4E3L A;  1EI5 A;  1K57 C;  3S4X A;  3MXS A;  1CI8 A;  4KZB A;  2GDN A;  3BYD A;  1TEM A;  3ITB A;  4GD6 A;  1GHP A;  5BOH A;  1NRF A;  2HDR A;  2JBF A;  3HVF A;  4R23 A;  4DXC A;  5HAQ A;  2Y2N A;  4GNU A;  4LCM A;  2H0T A;  2J9P A;  2ZQ7 A;  3Q7Z A;  1SCW A;  3RXX A;  3LO7 A;  1YLW A;  3WS4 A;  1HD8 A;  2ZD8 A;  3TOI A;  1KDW A;  3WS0 A;  4E3I A;  1K54 A;  2Q9M A;  4DE2 A;  4F94 A;  4ZJ2 A;  1JTG A;  1VQQ A;  3DTM A;  2ZC6 B;  2Y2I A;  4KEN B;  1NJ4 A;  4RVA A;  1KVL A;  1XX2 A;  3G34 A;  5TFQ A;  3HLG A;  5FAQ A;  5E2G A;  3GV9 A;  1ERO A;  2C5W B;  1PYY A;  4OLG A;  4Y0O A;  3IF6 B;  3SH8 A;  1GCE A;  4IVI A;  3OC2 A;  2IWB A;  4R1G A;  4K91 A;  3QHY A;  4N9K A;  3BLS A;  1FCM A;  5CER A;  3A3F A;  3NCK A;  1YT4 A;  4E3K A;  3PAE A;  4KQO A;  3IF5 A;  1E3U A;  3BFG A;  4MBF A;  4N1H A;  5U47 A;  3UY6 A;  2P74 A;  1IYP A;  2XFS A;  3CMZ A;  3I7J A;  5FI7 A;  5FAP A;  3N8L A;  1L0D A;  3HUM A;  3ZVT A;  5CED A;  3WRZ A;  1K4E A;  2RL3 A;  4LV3 A;  4OH0 A;  4E3M A;  3NDE A;  2Y2P A;  4QB8 A;  1BZA A;  1XP4 A;  1ZG6 A;  2PBY A;  4JF6 A;  2HP9 A;  3G32 A;  3OCN A;  1BTL A;  4R4R A;  5GHZ A;  1FQG A;  2X71 A;  3UDI A;  4S2J A;  2ZM8 A;  1E4D A;  4X68 A;  4ZJ3 A;  4DDS A;  5EE8 A;  5CGX A;  5HAR A;  4JLF A;  3BRM A;  4BJP A;  5FDH A;  4JXG A;  4H8R A;  2Y2Q A;  1ERQ A;  1DJC A;  3GQZ A;  1JTD A;  3VFH A;  4K0X A;  1IYQ A;  1NYY A;  3NDG A;  4QY5 A;  4S2K A;  4U0T A;  3VP0 A;  1S6R A;  4OLD A;  1FOF A;  2V2F F;  2OV5 A;  4S2I A;  1MKI A;  4K0W A;  5CGW A;  4DKI A;  1MWU A;  2PU4 A;  3D4F A;  4BEN A;  1DJB A;  5FAT A; 
#chains in the Genus database with same CATH topology
 1J3W A;  3ZG8 B;  3O86 A;  5EVI D;  1XJ6 A;  3IXH A;  1DP6 A;  1P9W A;  2ZC5 B;  1IYO A;  4B93 A;  2W3E A;  5EUA A;  1ZKJ A;  4KZ7 A;  1O7E A;  1BUE A;  3ZNY A;  3JVU A;  2VX8 A;  1D06 A;  2M1C A;  4FD8 A;  1OPX A;  4EWF A;  4EEU A;  4Y5F A;  4BBV A;  4S2P A;  2EX6 A;  3ZG0 A;  3DWZ A;  1QMF A;  4FH2 A;  3FWL A;  4S2M A;  4RA7 A;  2ZMF A;  4JF4 A;  2ZQC A;  1JNU A;  2ZM2 A;  1W5D A;  2HP6 A;  1SKF A;  3IHA A;  1KGG A;  1LT0 A;  1XGI A;  4P0M A;  4BD1 A;  3LCE A;  3SOI A;  3FPV A;  3H82 B;  3MFD A;  5TR7 A;  2ZL1 A;  2FH5 A;  4B88 A;  4QHC A;  1LSV A;  3PBO A;  1DY6 A;  2O9A A;  1ONG A;  2VV6 A;  2WKI A;  1UGU A;  3IXG A;  3P98 A;  3T4S A;  2V9A A;  1MKM A;  5L10 A;  4U0X A;  4JXW A;  2PYP A;  3MMH A;  4OPZ A;  1ZTU A;  3QP6 A;  2XFT A;  5E2H A;  4B4X A;  4WMC A;  3G2Y A;  3OLO A;  2OAP 1;  1YMX A;  2QHK A;  4OQI A;  3GMW A;  1YQS A;  1PWD A;  4O8G A;  2QWS A;  4IED A;  1T18 A;  4CLC D;  2PRF A;  4ZAM A;  2J8Y A;  2W1R A;  2V0U A;  4R6L A;  4Z1W A;  1PI4 A;  3FZC A;  4JGO A;  1GHI A;  5FI2 A;  4HH3 A;  4JBF A;  2JKR I;  4R3B A;  3JVV A;  2BAS A;  2M7V A;  1Q2P A;  4QD4 A;  4C3Q A;  4KZ4 A;  4R38 A;  4WL9 A;  4HHD A;  4EEP A;  3D9Y A;  5FQK A;  1XFN A;  5HAI A;  2LB9 A;  2V1Z A;  3CUE C;  3HRE A;  2J3W A;  5A93 A;  3EEA A;  2Y2O A;  2K7S A;  3AGD A;  4EER A;  4YFM A;  2J80 A;  3IWQ A;  3MZF A;  2JCH A;  3E0Y A;  2A24 B;  1F98 A;  5EV0 A;  4X55 A;  3UB5 P;  1BLH A;  4OVD A;  2XD5 A;  4ZBE A;  3TRC A;  3T4Q A;  3UB9 A;  4GLQ A;  3LYX A;  3HL9 A;  4HQA A;  2PBD P;  1PWC A;  3E4P A;  5DKL A;  4PPR A;  2B02 A;  5CTM A;  3ZGA B;  2OAQ 1;  3BFF A;  3QP5 A;  5DTS A;  3MQ0 A;  5M19 A;  1V9Y A;  2XD1 A;  2P04 A;  1S4R A;  1E25 A;  3LID A;  1YMS A;  5HPI A;  4XUZ A;  4EET B;  2BTF P;  1BSG A;  2Z2M B;  4WZ5 C;  5CHM A;  4FH4 A;  4ZDX A;  1CQA A;  1U60 A;  3UPN A;  1I5Q A;  4EQI A;  3IBJ A;  3NIA A;  4HP9 A;  5F5Y A;  3ULF A;  2A24 A;  3VP3 A;  5HL6 A;  3LEZ A;  2EFX A;  1K38 A;  1ES2 A;  2J9O A;  2XEP A;  1YLY A;  3EOI A;  3SH9 A;  4ETZ A;  1JWV A;  2QPN A;  4R4S A;  3IH9 A;  1K55 A;  5FQJ A;  3E4O A;  5HDD A;  3FV7 A;  4PM8 A;  2OSU A;  1OT6 A;  3BFC A;  4KZ8 A;  2EX9 A;  4X69 A;  3SH7 A;  4GS9 B;  3ZQ5 A;  3E98 A;  1TF1 A;  4IUK A;  3ITA A;  4CLC C;  3IT9 A;  1YLT A;  1T1A A;  3S7N A;  2BLS A;  1DP8 A;  5AQ9 A;  2O99 A;  1H8M A;  1KVM A;  4HY8 A;  1VEU A;  1L3L A;  2Y2K A;  3PYP A;  5C5K A;  4IJG A;  4HBT A;  3QP2 A;  1VET A;  2KOI A;  4MBH A;  5HAP A;  4OOL A;  5EEC A;  1L0E A;  1MWT A;  4Q8I A;  1XA7 A;  2JHE A;  1RP5 A;  4LLO B;  3NI9 A;  2HJ9 C;  2O9B A;  4I3I A;  3BLM A;  2WKQ A;  3WRT A;  4UA7 A;  4KG5 A;  2A49 A;  2IWC A;  4NXG A;  2ZC4 B;  4WEL A;  4HES A;  4KZ9 A;  3VSL A;  4JPM A;  4PMA A;  1IKG A;  3IF6 A;  5FQI A;  3UB7 A;  1F2K A;  1W79 A;  2AVX A;  1MC0 A;  4WYY A;  1KOU A;  2XRO A;  4UQI M;  3QNC A;  3LR0 A;  1K57 C;  3PXP A;  4KUK A;  1TS8 A;  1TEM A;  1GHP A;  2JBF A;  3HVF A;  4R23 A;  1MZU A;  1SCW A;  4NXB A;  3WS4 A;  1HD8 A;  2ZD8 A;  4E3I A;  4DE2 A;  3MF0 A;  3FG8 A;  3OBF A;  4KEN B;  4L9E A;  2KX6 A;  4HP4 A;  2IA2 A;  4Y0O A;  3KO6 A;  2VJW A;  3IS2 A;  1K0K A;  2W27 A;  4R1G A;  4II7 A;  3BLS A;  3A0R A;  5IU1 A;  5CER A;  3CAX A;  3IF5 A;  2GNX A;  4MBF A;  4N1H A;  1IYP A;  5CED A;  3N8L A;  3ZVT A;  2RL3 A;  4OH0 A;  1XP4 A;  3F1N B;  4R4R A;  4JF6 A;  2HP9 A;  5GHZ A;  4X68 A;  4DDS A;  5CGX A;  5FDH A;  4JXG A;  1JTD A;  3HJK A;  2M7U A;  3KSG A;  3NOU C;  4S2I A;  4DKI A;  4WF0 A;  2B95 A;  3GEC A;  4QU3 A;  3CWF A;  4OP8 A;  4GZB A;  1PFL A;  3UMD A;  4EES A;  2LB5 A;  1M6K A;  1TDL A;  1N4O A;  1EWZ A;  4X1M A;  4M4X A;  3UE6 A;  2WKR A;  4S2L A;  5E43 A;  1XA1 A;  4IHQ A;  1KE3 A;  1TDG A;  3OCL A;  4IVK A;  4Q0H A;  1C3B A;  5FDS A;  1I2W A;  5D3O A;  3CJM A;  2VV8 A;  2Y8H A;  5CX7 A;  5L07 A;  2VV7 A;  4LPZ A;  2WGW B;  2R9X A;  1HZO A;  1CEG A;  1CEF A;  5F1G A;  3MFX A;  3V39 A;  2OWJ A;  2OOL A;  1GA0 A;  3TSG A;  5EVI C;  4HBU A;  5DJU A;  3NY4 A;  4HJ3 A;  1G6A A;  3UB8 A;  2HDS A;  4WEK A;  4IBR A;  4RYE A;  3PBS A;  3PTE A;  2KLI A;  3M2J A;  2Y91 A;  3HUO A;  5F6A A;  1KGE A;  3G6O A;  4GKU A;  4S2N A;  1BLS A;  1FCN A;  1IKI A;  2ZQ8 A;  2B18 A;  4DJ3 A;  5CXW A;  4EV4 A;  4YOF A;  3G4P A;  2E8I A;  4NG2 A;  5G18 A;  2HDU A;  2WKE A;  1NLY A;  1MXO A;  2ZBB A;  4HJ4 A;  3OPH A;  3ZG5 A;  4BL2 A;  3ZG7 B;  3NUL A;  1N9B A;  3GVB A;  3S7P A;  1L0G A;  5GHX A;  4WM9 A;  4LRX C;  2WZZ A;  1PNE A;  4L0L A;  2GZA A;  5GL9 A;  1BLP A;  4Y3I A;  3EGX C;  3Q07 A;  4KQD A;  3H82 A;  1FIK A;  1E3U D;  3SS5 A;  2XSS A;  2I72 A;  5HW3 A;  1F5M A;  1BYW A;  3SS4 A;  1YLJ A;  1XFQ A;  2VEA A;  3BEB A;  4MN6 A;  3UDX A;  1RCJ A;  1N9L A;  3G30 A;  3NOT C;  2VLG A;  3NBL A;  3VP1 A;  5AVF A;  2IWD A;  3O3V A;  2Q9N A;  2JKT M;  1DP9 A;  1MBL A;  1VM1 A;  5DKK A;  4CJN A;  5HFO A;  3CI6 A;  4NK3 A;  4HEF A;  5EVE A;  1VET B;  3C7V A;  2WAF A;  1ZC2 A;  4PM6 A;  2HPB A;  5J8X A;  4BBT A;  1K55 C;  4X1L A;  4WLA A;  4YWZ A;  5KSH A;  4E3O A;  4BL3 A;  3C2W A;  3KYQ A;  2XK1 A;  3O87 A;  3EEH A;  3VSK A;  4IBX A;  2VGK A;  3V67 A;  3ZVW A;  5FAO A;  1J9M A;  1YSQ A;  3LY4 A;  1RGY A;  3ICY A;  2ZC3 B;  2WZX A;  4KQQ A;  4BLM A;  3MZD A;  4KZ3 A;  4HH2 A;  5HD3 A;  5TBM B;  2WGV A;  5F82 A;  1CK3 A;  1YLP A;  3BY8 A;  2DRW A;  1ODV A;  3W2Z A;  1ACF A;  4BMW A;  3UO9 A;  3RTY A;  4LV2 A;  3GTC A;  3PBR A;  4I3J A;  1W8Y A;  3A3E A;  1K6S A;  2WAE A;  5GLC A;  2JKF A;  4MMN A;  3QP1 A;  4Q0I A;  2ZM0 A;  3H9W A;  4EQ1 A;  2Y2M A;  4ARZ A;  3F1O A;  1WYC A;  2ZOH A;  5LBR A;  2XLN A;  2ZQ9 A;  3IQA A;  4R0Q A;  2Z6C A;  3VP2 A;  2YKF A;  3K3C A;  5J3W A;  5GLA A;  5EOO A;  4P6B A;  4Z9Q A;  3EWK A;  2JKG A;  3RFB A;  1S1Y A;  1KDS A;  2MJ6 A;  1P0Z A;  2J3T D;  3W4O A;  4KG6 A;  3A3D A;  3RXW A;  1ESU A;  1LL9 A;  3Q81 A;  5DFY A;  1Y54 A;  3AGE A;  5L8M A;  4Q0J A;  1IEL A;  5HX9 A;  4XT2 A;  1SZV A;  1GHM A;  1LI9 A;  1TS6 A;  3EGD C;  5KZH A;  3NJA A;  3Q7V B;  2PD8 A;  2P9V B;  1AXB A;  3NOP C;  1WYB A;  3UE1 A;  1Y28 A;  5DF8 A;  4CQH A;  1IFQ A;  4EU0 A;  2ZJ9 A;  3LI9 A;  3PHY A;  1ZG4 A;  3V3R A;  2GX5 A;  1HVB A;  1P97 A;  2XGN A;  5IT5 A;  3MXQ A;  4X53 A;  2A2L A;  3O88 A;  4B4Z A;  2A3U A;  2Y2L A;  4LFU A;  5I5L A;  5EOE A;  4MCW A;  1KGF A;  1YLZ A;  1XJ4 A;  1OT9 A;  3DWK A;  3HLW A;  4OP5 A;  3MKE A;  1K4F A;  4FCF A;  3S7Q A;  3OZH A;  5E2E A;  1LLB A;  3F1N A;  1XKZ A;  1SHV A;  5FEG A;  1T19 A;  4LRZ E;  3HJI A;  5KMW A;  4MEZ A;  2H0Y A;  4OQ0 A;  4O01 A;  3D72 A;  3BJN A;  4UA6 A;  2JE5 A;  5CRF A;  4PAU A;  2V20 A;  3VOZ A;  5EPH A;  4KQR A;  2Y79 A;  2EX8 A;  3ZG9 B;  2WK0 A;  3UME A;  2KDK A;  2Y59 A;  2X01 A;  3LR4 A;  5A92 A;  3ZCZ A;  1TS7 A;  4PKY G;  3UE0 A;  4E3L A;  3ITB A;  1NRF A;  2HDR A;  5HAQ A;  2Y2N A;  3WS0 A;  4F94 A;  1VQQ A;  3T1R A;  2Y2I A;  4F3L B;  1KVL A;  1XX2 A;  3G34 A;  5TFQ A;  5HWT A;  2C5W B;  1PYY A;  4OLG A;  3LFV A;  4IVI A;  4K91 A;  2VGL M;  1SKO B;  3A3F A;  1YT4 A;  3PAE A;  2NUT C;  2P74 A;  3I7J A;  5FI7 A;  3CLO A;  4GHI A;  4JGP A;  5G4Z A;  4EUV A;  3CHW P;  1BZA A;  4FTX A;  1CJF A;  5J4E A;  4LGW A;  3OCN A;  1FQG A;  2X71 A;  3UDI A;  4ZJ3 A;  4ESP A;  1S67 L;  1ERQ A;  2PDR A;  1DJC A;  3VFH A;  1IYQ A;  4OLD A;  1FOF A;  3BWL A;  1AWI A;  2OV5 A;  3MS6 A;  5AJG A;  1MWU A;  3VE4 A;  1OJ5 A;  2H28 A;  3D4F A;  2OWH A;  4EBN A;  1ONH A;  2HGV A;  4F3L A;  3GSG A;  4I5S A;  3LIC A;  2VKS A;  3VOY A;  1FSY A;  4DE0 A;  5CEC A;  3SS3 A;  4Y15 A;  3T4L A;  4GW9 A;  1NY0 A;  3M6B A;  1Z6F A;  1I2S A;  1MWR A;  1W8Q A;  2HZ5 A;  2OLU A;  1ES5 A;  2L4R A;  4HNB A;  1VEU B;  3W4P A;  3A0S A;  4WZ4 A;  4JKT A;  1S0W A;  5HWW A;  1Q2Q A;  1V9Z A;  3GR2 A;  4RX3 A;  5EM1 A;  3A0V A;  3DW0 A;  1D7E A;  2PU2 A;  4PKY A;  3IX4 A;  5MC7 A;  3T4T A;  3KSH A;  4Y13 A;  3IX3 A;  3C38 A;  3PAG A;  2FFF B;  4R70 A;  5A8B A;  1BUL A;  3PBT A;  1IOU A;  2O0Y A;  5DFX A;  1NZU A;  1PW1 A;  3PBQ A;  4G3V A;  1XJ2 A;  4N9L A;  5DF9 A;  1BLC A;  1JVJ A;  5HL1 A;  3IX8 A;  5EM0 A;  1CI9 A;  3BQ8 A;  2H5S A;  4ZRR A;  1NRJ A;  2R9W A;  2P9V A;  2JKR M;  2QKP A;  2HDQ A;  3ZFZ A;  1N9O A;  1XGJ A;  3MZE A;  3Q7V A;  3RH8 B;  5FAT A;  2YKH A;  1G68 A;  3N8R A;  3BW6 A;  3VOL A;  4P6Z M;  4X6T A;  4ARZ B;  3RJU A;  5HD5 A;  1OTI A;  2P08 A;  2QYB A;  4DF6 A;  4D60 A;  1K56 D;  4XXR A;  1LL5 A;  2K2N A;  4DE3 A;  4C75 A;  3MQQ A;  4GDN A;  1Z09 A;  1ES3 A;  4JGQ A;  4P87 A;  1FR1 A;  1DJA A;  2V8F A;  4PM5 A;  1H5X A;  3KSI A;  1GA9 A;  3SZT A;  3LIB A;  1GSX A;  2XF3 A;  4P85 A;  4YIN A;  4FUW A;  3LR5 A;  3T1Q B;  4EUZ A;  2W3D A;  4OPQ A;  3GDI A;  1Y4O A;  4QJG A;  4OPR A;  2ZQD A;  1IYS A;  3ZHH A;  2WYX A;  4O7D A;  4PM9 A;  3V3S A;  5E2F A;  3FPW A;  3N6I A;  4EBP A;  4DJ2 A;  4RX2 A;  1MPL A;  5G4Y A;  3IBR A;  1PZO A;  4LV0 A;  3T50 A;  3HLC A;  4CPK A;  3BM6 A;  4L9F A;  3N4I A;  2HV1 A;  3BFE A;  4JF5 A;  1PIO A;  2W3H A;  3IXD A;  4LCL A;  3UN7 A;  4CLC A;  4U3T A;  2ZMV A;  3B3X A;  2H10 A;  3LI8 A;  5TJJ A;  4MN5 A;  4A5R A;  2ZQA A;  4GJ4 A;  2XH9 A;  1G5U A;  1HTZ A;  3T1S A;  2I9V A;  3L9K A;  1OTE A;  4E6X A;  4BD0 A;  2PR6 A;  3LEQ A;  3EQV A;  3ZDJ A;  3WWX A;  1HLU P;  4HOI A;  2FZ0 A;  4MNR A;  5TGF A;  1FR6 A;  1KE4 A;  4JGR A;  3SW1 A;  1ESI A;  1K57 A;  4P6Z S;  5HZH A;  3CPT B;  4GDB A;  5DVA A;  2JN7 A;  5CHJ A;  5CTN A;  1NWZ A;  4D2O A;  3Q1F A;  3OOV A;  4CLC E;  4GN2 A;  1GSW A;  4UA9 A;  1LL8 A;  3N7W A;  5FSR A;  4ZJ1 A;  3BY9 A;  3T1X A;  1YM1 A;  1OME A;  2Q0O A;  2EFU A;  3G35 A;  3K3D A;  2V0W A;  2WUQ A;  2CC1 A;  3IHB A;  2Y55 A;  3VV4 A;  1ERM A;  3C5A A;  3HUN A;  1JWP A;  3UNW A;  3E2L A;  3LIE A;  1S1Z A;  5L2F A;  3IWO A;  3Q82 A;  3TW8 A;  1SDN A;  1K56 A;  4K08 A;  3C4P A;  1W7F A;  2EA9 A;  2L0W A;  3B47 A;  3DTK A;  3VMA A;  4UAA A;  3HLD A;  4Y0T A;  3MKF A;  4MN7 A;  2EXB A;  2WAD A;  3L7H A;  2EX2 A;  2OLV A;  3P01 A;  2G2U A;  2QZ6 A;  1SKO A;  3T4K A;  1NZO A;  3ZNT A;  1BT5 A;  3IF6 C;  4NKP A;  3FKW A;  3DTE A;  4N1X A;  3JYI A;  1H8Y A;  1MY8 A;  3A3I A;  4ETX A;  1WE4 A;  3AGF A;  3MR0 A;  2NUP C;  4LV1 A;  2PHY A;  5FAS A;  2WKH A;  2XA7 S;  4KG2 A;  3IWI A;  3LY3 A;  3WS1 A;  4EW7 A;  4NET A;  2JC7 A;  2VZW A;  4X25 A;  3T12 B;  4BQM A;  2EXA A;  2PYR A;  4Y7P A;  2XA7 M;  3PBN A;  3H7W A;  5HPF A;  1K6R A;  2P7J A;  1LHY A;  1PW8 A;  3HBR A;  3DBA A;  4MDZ A;  2R78 A;  2XQZ A;  4H6J B;  1EI5 A;  3S4X A;  2Z6D A;  4UEY A;  1CI8 A;  2GDN A;  4GD6 A;  1STZ A;  4GNU A;  2ZQ7 A;  3RXX A;  1YLW A;  4E04 A;  1KDW A;  1K54 A;  2Q9M A;  1XJ3 A;  2WKP A;  3F1P B;  1NJ4 A;  1YPR A;  3HLG A;  3GV9 A;  3CPT A;  3PR6 A;  3F1P A;  3SH8 A;  1GCE A;  1TS0 A;  3C8C A;  5HDS A;  4N9K A;  3NCK A;  2VA0 A;  2PT7 A;  1E3U A;  3BFG A;  3S7O A;  3R7W A;  2W1T B;  3D3O A;  3LUQ A;  4QPR A;  5FAP A;  3MSH A;  3WRZ A;  1K4E A;  4G3W A;  4LV3 A;  4E3M A;  1YSP A;  3NDE A;  2Y2P A;  1ZG6 A;  1T1B A;  3G32 A;  4CLC B;  4S2J A;  1E4D A;  3BRM A;  4BJP A;  4H8R A;  2Y2Q A;  1NYY A;  4QY5 A;  4S2K A;  1S6R A;  2K31 A;  4HI4 A;  2V2F F;  5CGW A;  1MKI A;  5F68 A;  5FEF A;  2PU4 A;  4RQ9 A;  5HSQ A;  1DJB A;  3WS5 A;  1G28 A;  3UE3 A;  2VGJ A;  2B5R A;  3P7N A;  3IH8 A;  3TG9 A;  4WN5 A;  5EVI B;  4BWI A;  4WEJ A;  1NLZ A;  4R3J A;  5FA7 A;  5CEB A;  5A90 A;  3FKV A;  2DNS A;  1H8Z A;  4C6Y A;  2Y2H A;  4JXV A;  3V5M A;  5KIZ A;  5EFW A;  2PAV P;  3BFD A;  1KE0 A;  2G2W A;  4OOY A;  5KSC A;  2UV0 E;  3LIF A;  3KSF A;  3C7U A;  2RCX A;  2ZLY A;  1D1J A;  1FSW A;  4I38 A;  5I94 A;  1PI5 A;  1OTA A;  3OPP A;  4BBU A;  4X56 A;  2CMN A;  3UB6 A;  2PR5 A;  4PHT A;  1RGZ A;  4DDY A;  1YKD A;  1X0O A;  4JXS A;  1NXY A;  1DRM A;  3QP4 A;  2ACG A;  5A91 A;  1ES4 A;  4FOF A;  2W0N A;  1QME A;  4DXB A;  1TVF A;  4XT2 B;  4E3J A;  3NC8 A;  2D02 A;  2GJ3 A;  3UPO A;  3P09 A;  5F1F A;  5AVE A;  1PRQ A;  2WGI A;  4HJ6 A;  3UPP A;  3MQO A;  1W63 M;  1LSX A;  1GSV A;  2XDM A;  2J3T C;  4WUJ A;  2QJ7 A;  4OOM A;  1F9I A;  1IEM A;  4NXE A;  3N8S A;  4OON A;  5F83 A;  1L2S A;  3HLB A;  2XR0 A;  1N9N A;  3E2K A;  4EBL A;  2VGL S;  4N92 A;  1A0K A;  4IUH A;  3ISG A;  3QP8 A;  3TE8 A;  5AQA A;  5HWV A;  2O9C A;  2X02 A;  1EW0 A;  5GHY A;  4I39 A;  3B42 A;  4S2O A;  4XUX A;  3MBZ A;  1JWZ A;  2HP5 A;  3VFF A;  4MLL A;  2W3F A;  3CZD A;  3DTI A;  1FCO A;  4GB7 A;  1H0M A;  5J7E A;  4DE1 A;  5EVI A;  4OPY A;  4UQI S;  2J7V A;  5IS1 A;  1MWS A;  4KUO A;  1LI0 A;  2G7U A;  4ME4 A;  3F1O B;  5IHV A;  4E6W A;  4ZTK A;  4KZ5 A;  1XPB A;  2INW A;  5FQ9 A;  2FFY A;  5FL3 A;  4GOG A;  3FC7 A;  3CG5 A;  4Y17 A;  3OPR A;  4LEN A;  1OTB A;  3T4O A;  4S2N C;  1NYM A;  2XRN A;  4KZA A;  3S1Y A;  3VE3 A;  2Y2J A;  2ZMA A;  5DTT A;  4WMC D;  3NEC A;  5DTK A;  1K25 A;  3M6H A;  3R4K A;  2VK3 A;  1T1C A;  4I3A A;  3TJZ C;  5JYO A;  4MBK A;  3NHQ A;  3W8K A;  5AQB A;  5HDC A;  3C4O A;  3LIA A;  3BEC A;  1UWN X;  4M3K A;  3CIT A;  4WBG A;  4GD8 A;  2C6W B;  3QNB A;  5FQQ A;  5DF7 A;  3LGO A;  3FYZ A;  1O07 A;  2D01 A;  4Y0U A;  3HLF A;  4E3N A;  2EWW A;  4DRT A;  3O5Y A;  2Z2L B;  2ZC7 A;  2QMI A;  3A3J A;  3DAV A;  4KZ6 A;  1M40 A;  3JPU A;  1FIL A;  5GLD A;  2UWX A;  4GCZ A;  3LR3 A;  3EQU A;  3V50 A;  3U2A A;  3KX0 X;  5TBM A;  1P9R A;  5DJT A;  3S22 A;  4QWO A;  5M1A A;  1K54 C;  4R3A A;  4Y2F A;  1L0F A;  5EVL A;  3K2N A;  4PM7 A;  2Y2G A;  4QY6 A;  2QJ5 A;  3ZYT A;  4OKP A;  4WZ5 A;  4OQH A;  1S4S A;  2BG1 A;  2V1A A;  1PZP A;  4DN0 A;  3E4Q A;  4UHU A;  5JYP A;  5CHU A;  5CGS A;  1G6O A;  3OPL A;  3HLE A;  5F69 A;  3R7W B;  3VP4 A;  5M18 A;  2EWV A;  1SDE A;  2ZL1 B;  1WA9 A;  3H7W B;  2PD7 A;  2JKT I;  1H3Q A;  2L1M A;  3C30 A;  1UWP X;  1PWG A;  3G2Z A;  2HF6 A;  3W4Q A;  5K5B A;  3WS2 A;  1S66 L;  1VB6 A;  2Y4A A;  2DCF A;  1ZHH B;  3M2K A;  5AQ7 A;  1OTD A;  3UDF A;  3T4J A;  4AFI A;  2DMW A;  3MXR A;  4EXO A;  3IXB A;  2W1T A;  3BQA A;  1W63 Q;  5FI6 A;  3MJQ A;  3G31 A;  1ALQ A;  4YNR A;  3IS2 B;  3KYE A;  3HCY A;  4HIA A;  3KYZ A;  4OQG A;  3GRJ A;  1XXM A;  4FSF A;  4NXF A;  2V8C A;  4ID4 A;  2WGW A;  5FQM A;  3MXS A;  4KZB A;  3BYD A;  5BOH A;  4H6J A;  4B9O A;  4DXC A;  4LCM A;  2H0T A;  2J9P A;  3Q7Z A;  3LO7 A;  2W3G A;  3TOI A;  1YAX A;  4DMZ A;  4ZJ2 A;  1JTG A;  3DTM A;  2ZC6 B;  4RVA A;  4O0P A;  5FAQ A;  5E2G A;  2V1B A;  1ERO A;  4G3K A;  4NEE D;  2ZOI A;  3U4L P;  3IF6 B;  3OC2 A;  2IWB A;  3QHY A;  4LRY C;  1FCM A;  4GHI B;  4E3K A;  4KQO A;  5U47 A;  3UY6 A;  3CMZ A;  2XFS A;  1OJG A;  1L0D A;  3HUM A;  2HJE A;  4GS9 A;  4QB8 A;  5L09 A;  2PBY A;  1BTL A;  2E8J A;  2ZM8 A;  3B33 A;  5EE8 A;  5HAR A;  4JLF A;  1CF0 A;  1VHM A;  3CUE A;  1LSW A;  3GQZ A;  4K0X A;  3NDG A;  3VP0 A;  4U0T A;  1TD5 A;  4L9G A;  4K0W A;  4BEN A;  5GLB A; 
#chains in the Genus database with same CATH homology
 3WS5 A;  3UE3 A;  4OP8 A;  2VGJ A;  1ONH A;  4GZB A;  3ZG8 B;  2B5R A;  3O86 A;  3IH8 A;  3TG9 A;  5EVI B;  5EVI D;  3GSG A;  4WEJ A;  3IXH A;  2ZC5 B;  1M6K A;  1IYO A;  1TDL A;  1N4O A;  4R3J A;  5FA7 A;  1EWZ A;  5CEB A;  5A90 A;  3VOY A;  1FSY A;  3FKV A;  5EUA A;  1ZKJ A;  4KZ7 A;  4DE0 A;  5CEC A;  1O7E A;  2DNS A;  1H8Z A;  4S2L A;  3SS3 A;  5E43 A;  4C6Y A;  1BUE A;  3ZNY A;  1NY0 A;  1XA1 A;  2Y2H A;  4FD8 A;  3M6B A;  4JXV A;  1Z6F A;  1KE3 A;  4EWF A;  1TDG A;  1I2S A;  1MWR A;  3V5M A;  3OCL A;  4IVK A;  1W8Q A;  2OLU A;  4S2P A;  1C3B A;  2EX6 A;  3BFD A;  1KE0 A;  3ZG0 A;  1ES5 A;  1QMF A;  2G2W A;  3DWZ A;  4FH2 A;  4OOY A;  1I2W A;  5KSC A;  3FWL A;  4S2M A;  3C7U A;  2RCX A;  5D3O A;  2ZLY A;  1FSW A;  5I94 A;  3CJM A;  3W4P A;  4WZ4 A;  1PI5 A;  4JF4 A;  4RA7 A;  2WGW B;  4JKT A;  2R9X A;  1HZO A;  1CEG A;  2ZQC A;  1CEF A;  3OPP A;  2ZM2 A;  1S0W A;  1W5D A;  4X56 A;  5F1G A;  3V39 A;  1Q2Q A;  1GA0 A;  1RGZ A;  5EVI C;  3TSG A;  4HBU A;  3GR2 A;  2HP6 A;  3NY4 A;  4RX3 A;  1SKF A;  1G6A A;  4DDY A;  2HDS A;  3DW0 A;  4WEK A;  3IHA A;  4IBR A;  2PU2 A;  4JXS A;  4RYE A;  1KGG A;  1NXY A;  3PBS A;  3PTE A;  3M2J A;  1XGI A;  2Y91 A;  4P0M A;  4BD1 A;  3LCE A;  3HUO A;  3SOI A;  5A91 A;  1ES4 A;  1KGE A;  4GKU A;  4S2N A;  1QME A;  1BLS A;  1FCN A;  3PAG A;  1IKI A;  2ZQ8 A;  2FFF B;  3MFD A;  5CXW A;  4EV4 A;  3G4P A;  4DXB A;  1TVF A;  5TR7 A;  2E8I A;  4E3J A;  1BUL A;  3NC8 A;  3PBT A;  4QHC A;  5G18 A;  2HDU A;  2WKE A;  4B88 A;  3UPO A;  3P09 A;  5F1F A;  1MXO A;  2WGI A;  1NZU A;  1PW1 A;  1DY6 A;  3PBO A;  3OPH A;  1ONG A;  3ZG5 A;  3PBQ A;  3UPP A;  4BL2 A;  3ZG7 B;  2WKI A;  4N9L A;  1N9B A;  3IXG A;  5DF9 A;  1BLC A;  1JVJ A;  3GVB A;  3P98 A;  5HL1 A;  2XDM A;  1CI9 A;  1L0G A;  5GHX A;  2H5S A;  4U0X A;  4WM9 A;  4JXW A;  2WZZ A;  2R9W A;  4OOM A;  2P9V A;  1IEM A;  4OPZ A;  2HDQ A;  4L0L A;  2XFT A;  5E2H A;  4B4X A;  4WMC A;  5GL9 A;  3G2Y A;  3ZFZ A;  3N8S A;  4OON A;  1BLP A;  5F83 A;  1XGJ A;  3MZE A;  3Q7V A;  1YMX A;  1L2S A;  3Q07 A;  4OQI A;  3HLB A;  1G68 A;  2XR0 A;  3N8R A;  3GMW A;  1YQS A;  1E3U D;  1PWD A;  3SS5 A;  3E2K A;  4EBL A;  4IED A;  2I72 A;  4X6T A;  4N92 A;  3RJU A;  5HW3 A;  4ZAM A;  2J8Y A;  4DF6 A;  1K56 D;  3SS4 A;  3ISG A;  4XXR A;  1LL5 A;  1YLJ A;  1PI4 A;  3BEB A;  5AQA A;  3UDX A;  1RCJ A;  3FZC A;  4DE3 A;  3G30 A;  4C75 A;  2X02 A;  4GDN A;  1GHI A;  1ES3 A;  5FI2 A;  4P87 A;  1FR1 A;  4JBF A;  5GHY A;  1DJA A;  4S2O A;  4PM5 A;  3NBL A;  4R3B A;  3VP1 A;  4XUX A;  2IWD A;  3MBZ A;  1H5X A;  1JWZ A;  2HP5 A;  3O3V A;  3VFF A;  1GA9 A;  2Q9N A;  4MLL A;  2XF3 A;  1MBL A;  1Q2P A;  1VM1 A;  4P85 A;  4QD4 A;  3CZD A;  1FCO A;  4C3Q A;  4KZ4 A;  4GB7 A;  5HFO A;  4CJN A;  4YIN A;  4NK3 A;  4HEF A;  3C7V A;  2WAF A;  1ZC2 A;  5FQK A;  4DE1 A;  5EVI A;  4PM6 A;  4EUZ A;  2HPB A;  5HAI A;  4OPY A;  2V1Z A;  2J7V A;  5J8X A;  1MWS A;  4OPQ A;  1K55 C;  1LI0 A;  3HRE A;  4QJG A;  4OPR A;  5KSH A;  4E3O A;  2ZQD A;  5IHV A;  3O87 A;  4BL3 A;  2XK1 A;  5A93 A;  4E6W A;  1IYS A;  4ZTK A;  4IBX A;  4KZ5 A;  3VSK A;  2Y2O A;  1XPB A;  5FQ9 A;  2VGK A;  2FFY A;  3AGD A;  4GOG A;  4QU3 A;  3CG5 A;  3ZVW A;  5FAO A;  3ZHH A;  1J9M A;  3OPR A;  4LEN A;  4YFM A;  2WYX A;  4O7D A;  3LY4 A;  1RGY A;  3IWQ A;  2ZC3 B;  4S2N C;  4PM9 A;  3V3S A;  2WZX A;  5E2F A;  3MZF A;  4KQQ A;  4EBN A;  1NYM A;  4KZA A;  2JCH A;  4BLM A;  3MZD A;  4KZ3 A;  3N6I A;  3S1Y A;  4EBP A;  4RX2 A;  1MPL A;  2WGV A;  2Y2J A;  5F82 A;  2ZMA A;  1CK3 A;  1YLP A;  5DTT A;  2DRW A;  4WMC D;  1PZO A;  4LV0 A;  4X55 A;  5DTK A;  3HLC A;  4CPK A;  1BLH A;  1K25 A;  3M6H A;  4OVD A;  3UO9 A;  2XD5 A;  3BM6 A;  4ZBE A;  3N4I A;  4LV2 A;  3BFE A;  4JF5 A;  3GTC A;  3PBR A;  1W8Y A;  3A3E A;  1K6S A;  1PIO A;  2WAE A;  3IXD A;  3HL9 A;  4LCL A;  3UN7 A;  1PWC A;  5GLC A;  5JYO A;  4U3T A;  3B3X A;  2H10 A;  4PPR A;  5CTM A;  2ZM0 A;  3ZGA B;  4MBK A;  3BFF A;  4A5R A;  2ZQA A;  3W8K A;  2XH9 A;  5AQB A;  2Y2M A;  1HTZ A;  3C4O A;  5DTS A;  1WYC A;  5M19 A;  3BEC A;  2XD1 A;  4M3K A;  2XLN A;  4E6X A;  4WBG A;  4BD0 A;  4GD8 A;  2C6W B;  3QNB A;  5FQQ A;  3EQV A;  3ZDJ A;  3WWX A;  1E25 A;  2ZQ9 A;  3IQA A;  4MNR A;  4R0Q A;  1FR6 A;  5TGF A;  1YMS A;  1KE4 A;  5DF7 A;  3VP2 A;  4XUZ A;  3FYZ A;  1O07 A;  1BSG A;  4Y0U A;  5EOO A;  1ESI A;  3HLF A;  5GLA A;  2Z2M B;  1K57 A;  4E3N A;  4P6B A;  4Z9Q A;  4DRT A;  1KDS A;  4WZ5 C;  2Z2L B;  4GDB A;  2ZC7 A;  2QMI A;  4FH4 A;  3A3J A;  5CHM A;  5CHJ A;  5DVA A;  4ZDX A;  4KZ6 A;  1M40 A;  5CTN A;  1U60 A;  3W4O A;  4D2O A;  3Q1F A;  3UPN A;  4KG6 A;  1I5Q A;  3A3D A;  4GN2 A;  4EQI A;  3RXW A;  5GLD A;  1ESU A;  4UA9 A;  3N7W A;  1LL9 A;  5FSR A;  4ZJ1 A;  2UWX A;  3Q81 A;  3V50 A;  3EQU A;  3NIA A;  1Y54 A;  3AGE A;  1YM1 A;  1IEL A;  1OME A;  5HX9 A;  3VP3 A;  2EFU A;  3G35 A;  1GHM A;  1LI9 A;  3LEZ A;  2EFX A;  1K38 A;  3S22 A;  2WUQ A;  2CC1 A;  3IHB A;  2Y55 A;  5M1A A;  1K54 C;  1ERM A;  1ES2 A;  2J9O A;  3C5A A;  5KZH A;  2XEP A;  3HUN A;  1YLY A;  1JWP A;  3Q7V B;  3SH9 A;  1L0F A;  3UNW A;  5EVL A;  3E2L A;  1JWV A;  2QPN A;  5L2F A;  4R4S A;  3IH9 A;  3IWO A;  3Q82 A;  1K55 A;  2P9V B;  1AXB A;  4PM7 A;  5FQJ A;  1WYB A;  2Y2G A;  4QY6 A;  5GLB A;  3UE1 A;  1SDN A;  1K56 A;  5DF8 A;  2ZJ9 A;  3FV7 A;  4PM8 A;  3C4P A;  2OSU A;  1W7F A;  1ZG4 A;  4OKP A;  4WZ5 A;  3V3R A;  3BFC A;  4OQH A;  4KZ8 A;  2EX9 A;  3VMA A;  4UAA A;  1HVB A;  2XGN A;  3HLD A;  4X69 A;  4Y0T A;  2BG1 A;  3SH7 A;  3MKF A;  2EXB A;  2WAD A;  4X53 A;  2EX2 A;  2OLV A;  3O88 A;  4B4Z A;  2A3U A;  1PZP A;  2Y2L A;  3ITA A;  5EOE A;  4UHU A;  1KGF A;  1YLZ A;  2G2U A;  5JYP A;  3IT9 A;  1YLT A;  5CHU A;  5CGS A;  2QZ6 A;  3HLW A;  3DWK A;  2BLS A;  3OPL A;  5AQ9 A;  3HLE A;  3VP4 A;  5M18 A;  1NZO A;  1SDE A;  1KVM A;  3MKE A;  4OP5 A;  1K4F A;  3ZNT A;  1BT5 A;  3IF6 C;  4FCF A;  3OZH A;  2Y2K A;  3FKW A;  5E2E A;  4HBT A;  1LLB A;  1XKZ A;  4N1X A;  3JYI A;  4MBH A;  1H8Y A;  1MY8 A;  1PWG A;  5HAP A;  1SHV A;  4OOL A;  3A3I A;  1L0E A;  3G2Z A;  5EEC A;  1WE4 A;  1MWT A;  3W4Q A;  4Q8I A;  1XA7 A;  3AGF A;  1RP5 A;  3WS2 A;  3NI9 A;  4LV1 A;  5KMW A;  4MEZ A;  2H0Y A;  5FAS A;  2Y4A A;  4OQ0 A;  2WKH A;  3BLM A;  2DCF A;  4UA6 A;  2JE5 A;  4KG2 A;  3IWI A;  3LY3 A;  3M2K A;  5CRF A;  3WRT A;  4UA7 A;  5AQ7 A;  3WS1 A;  4KG5 A;  3UDF A;  2V20 A;  4NET A;  3VOZ A;  2A49 A;  2IWC A;  2JC7 A;  5EPH A;  2ZC4 B;  4WEL A;  3MXR A;  3IXB A;  4KQR A;  4HES A;  2EX8 A;  4KZ9 A;  5FI6 A;  4JPM A;  3VSL A;  3ZG9 B;  4BQM A;  2WK0 A;  2EXA A;  4PMA A;  3G31 A;  1ALQ A;  4Y7P A;  1IKG A;  3PBN A;  3IF6 A;  2Y59 A;  5FQI A;  1K6R A;  2X01 A;  4OQG A;  1LHY A;  1W79 A;  3GRJ A;  1PW8 A;  1XXM A;  3HBR A;  4FSF A;  4WYY A;  5A92 A;  4ID4 A;  3ZCZ A;  2WGW A;  2XQZ A;  3QNC A;  5FQM A;  3UE0 A;  4E3L A;  1EI5 A;  1K57 C;  3S4X A;  3MXS A;  1CI8 A;  4KZB A;  2GDN A;  3BYD A;  1TEM A;  3ITB A;  4GD6 A;  1GHP A;  5BOH A;  1NRF A;  2HDR A;  2JBF A;  3HVF A;  4R23 A;  4DXC A;  5HAQ A;  2Y2N A;  4GNU A;  4LCM A;  2H0T A;  2J9P A;  2ZQ7 A;  3Q7Z A;  1SCW A;  3RXX A;  3LO7 A;  1YLW A;  3WS4 A;  1HD8 A;  2ZD8 A;  3TOI A;  1KDW A;  3WS0 A;  4E3I A;  1K54 A;  2Q9M A;  4DE2 A;  4F94 A;  4ZJ2 A;  1JTG A;  1VQQ A;  3DTM A;  2ZC6 B;  2Y2I A;  4KEN B;  1NJ4 A;  4RVA A;  1KVL A;  1XX2 A;  3G34 A;  5TFQ A;  3HLG A;  5FAQ A;  5E2G A;  3GV9 A;  1ERO A;  2C5W B;  1PYY A;  4OLG A;  4Y0O A;  3IF6 B;  3SH8 A;  1GCE A;  4IVI A;  3OC2 A;  2IWB A;  4R1G A;  4K91 A;  3QHY A;  4N9K A;  3BLS A;  1FCM A;  5CER A;  3A3F A;  3NCK A;  1YT4 A;  4E3K A;  3PAE A;  4KQO A;  3IF5 A;  1E3U A;  3BFG A;  4MBF A;  4N1H A;  5U47 A;  3UY6 A;  2P74 A;  1IYP A;  2XFS A;  3CMZ A;  3I7J A;  5FI7 A;  5FAP A;  3N8L A;  1L0D A;  3HUM A;  3ZVT A;  5CED A;  3WRZ A;  1K4E A;  2RL3 A;  4LV3 A;  4OH0 A;  4E3M A;  3NDE A;  2Y2P A;  4QB8 A;  1BZA A;  1XP4 A;  1ZG6 A;  2PBY A;  4JF6 A;  2HP9 A;  3G32 A;  3OCN A;  1BTL A;  4R4R A;  5GHZ A;  1FQG A;  2X71 A;  3UDI A;  4S2J A;  2ZM8 A;  1E4D A;  4X68 A;  4ZJ3 A;  4DDS A;  5EE8 A;  5CGX A;  5HAR A;  4JLF A;  3BRM A;  4BJP A;  5FDH A;  4JXG A;  4H8R A;  2Y2Q A;  1ERQ A;  1DJC A;  3GQZ A;  1JTD A;  3VFH A;  4K0X A;  1IYQ A;  1NYY A;  3NDG A;  4QY5 A;  4S2K A;  4U0T A;  3VP0 A;  1S6R A;  4OLD A;  1FOF A;  2V2F F;  2OV5 A;  4S2I A;  1MKI A;  4K0W A;  5CGW A;  4DKI A;  1MWU A;  2PU4 A;  3D4F A;  4BEN A;  1DJB A;  5FAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...