4P6BA

Crystal structure of est-y29,a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
390
structure length
386
Chain Sequence
SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Est-Y29
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
total genus 119
structure length 386
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p6bA00
4X55A 4XUZA 3MBZA 4P0MA 1C3BA 2A3UA 1SDNA 5E43A 4GZBA 3VSLA 4PPRA 4IVIA 4UAAA 5HAIA 3IQAA 5GLDA 2XFSA 1ES5A 2XQZA 3ITBA 1DY6A 2XEPA 3C5AA 3M2JA 1ONHA 1JVJA 2ZC4B 1LHYA 3A3EA 4KQQA 3WWXA 4E3OA 3W4QA 1ESIA 5F1FA 2A49A 2ZM8A 4Q8IA 3TG9A 1L0EA 4QY5A 5HFOA 2WKEA 4LCMA 1K57A 1MWSA 1CK3A 1NJ4A 2X71A 2WYXA 3VOZA 4BQMA 3N4IA 3ITAA 2ZC3B 4Y0OA 4ID4A 2WAEA 3G35A 4B88A 3ZG8B 4JXGA 3BEBA 3I7JA 3WRTA 4WYYA 1L0DA 1IYSA 5FDHA 1JTDA 1PW8A 1CI9A 3MFDA 4DRTA 1XPBA 4RYEA 4O7DA 1SDEA 3BLMA 5CRFA 3ZVWA 1JTGA 3IF6B 1KGFA 3PBNA 1ONGA 3VP3A 3N7WA 4IBRA 5DF9A 3Q82A 3ZG0A 3ZG5A 4KG6A 4JF6A 3GSGA 2WGVA 1YLTA 3HUOA 3PTEA 2Y2PA 4UA6A 4WMCA 3C4PA 1VQQA 3IF6C 3IXHA 2Q9NA 2DRWA 3OPRA 3ZDJA 2HDQA 1YT4A 1XXMA 3UPOA 4BJPA 1W79A 4R3BA 4WM9A 1MWTA 2JCHA 2Y2LA 4N1HA 1BLCA 4FSFA 2ZM0A 4HBTA 1K25A 1YLYA 5AQAA 2P9VB 3BFFA 5CTNA 4E3JA 3OCLA 2XF3A 3DW0A 3UY6A 3HUMA 4CJNA 1I2SA 4ZTKA 2Y55A 5CERA 4YFMA 1ZG4A 3VSKA 5FQ9A 1G6AA 3VMAA 1L0GA 1XA1A 3EQUA 5FA7A 1KGGA 1YQSA 4GN2A 2Z2LB 4PMAA 3VP4A 1KDSA 3GR2A 3V3SA 5JYPA 5GHXA 1WYBA 1DJCA 4E3IA 3HREA 3O86A 3HVFA 5FAPA 4UA7A 5HAQA 3S4XA 3NDEA 5GL9A 2WADA 1K55A 1K4FA 2ZLYA 1EROA 4WZ4A 5HW3A 4DKIA 2H0TA 4LENA 2IWCA 4LCLA 4MBFA 3E2KA 2H0YA 3FV7A 3NY4A 3MKEA 4EUZA 3UNWA 5CEDA 2J9PA 2XH9A 3O88A 4GKUA 4K0WA 4KZ4A 1K57C 3MZFA 4KZ8A 4JXSA 5FQKA 3UE1A 2G2WA 4B4ZA 5KZHA 4IVKA 3C7UA 2XGNA 1ERQA 1XGJA 5A93A 3VP2A 4N92A 4P87A 5CHMA 1YLPA 2Y2KA 5M1AA 3ZG9B 4OP8A 5CEBA 4E3MA 1H8YA 1KDWA 1U60A 4OPYA 4JLFA 4M3KA 3LY4A 2ZQ7A 4UHUA 1Y54A 2B5RA 2WKIA 3OCNA 1H8ZA 5DVAA 3GVBA 2IWBA 1GA0A 5GLAA 2JE5A 4L0LA 1PZPA 5CGXA 2EX9A 3WS4A 3PBRA 5CGWA 2X01A 4OLGA 1BULA 4S2KA 1BLHA 1YM1A 3ZNYA 3IH8A 3UDFA 3G32A 1QMEA 3NI9A 3Q7VA 3QNCA 5F83A 2WZZA 1SKFA 1IYPA 2Y4AA 3PBOA 1BLSA 4E3KA 3HUNA 2EXBA 2HPBA 4RVAA 2ZQ9A 1MBLA 2J9OA 2HDSA 2WGWA 4ZBEA 3UE0A 4E6WA 1IKIA 1YLZA 4E3NA 4JKTA 1BZAA 1Z6FA 5AQBA 4R1GA 4GB7A 4QB8A 3ZGAB 5D3OA 3VP1A 1XKZA 2G2UA 4PM8A 5U47A 1PYYA 4QD4A 3IXBA 1QMFA 1IKGA 1GCEA 3BFGA 3RXXA 3DTMA 4KZBA 1K6RA 1FR1A 1WE4A 1RGYA 2V20A 1KVMA 1K55C 2WUQA 3M2KA 4NK3A 5CTMA 2HDUA 3D4FA 1KE0A 1E3UD 3MZDA 4GD6A 1LI9A 5EVIA 2HP5A 2FFFB 3IWOA 1GHIA 4F94A 3HLFA 3NBLA 3S22A 1PI5A 4EV4A 3CZDA 3N6IA 2P74A 4ZJ1A 3GQZA 4KQOA 2ZJ9A 3JYIA 4XUXA 1PIOA 3M6BA 5E2EA 1PWCA 3VOYA 2ZC6B 1ALQA 3NIAA 3BRMA 3IHBA 1WYCA 1J9MA 2I72A 2XD1A 4B4XA 3OC2A 5CECA 1ES2A 3IF5A 3W4OA 5M18A 1K54A 1MXOA 4KZ5A 1S6RA 3UDIA 2XLNA 1O07A 5AQ7A 4QJGA 4OPZA 4HEFA 4X53A 4P85A 3HLDA 4S2NA 1W5DA 3BFCA 4MBKA 4RX2A 4Y0TA 4DXBA 5HAPA 4OPRA 1JWZA 4S2IA 3Q1FA 1L2SA 1SCWA 3G30A 4LV0A 3FKVA 3W8KA 4DE3A 1W7FA 5A90A 3HBRA 5FAQA 4ZJ3A 1O7EA 1Q2PA 2H5SA 2Y59A 5CGSA 2RL3A 4Y7PA 4FD8A 3FZCA 5DTSA 3Q7VB 1BT5A 2EX8A 4KZ9A 1K56A 3CG5A 1FCNA 2WGIA 3E2LA 1FQGA 3IWIA 3NCKA 3OPPA 3Q81A 5EECA 5TR7A 4BD1A 3W4PA 4ZAMA 1NXYA 2EX2A 3MZEA 4R23A 1GHMA 2EXAA 3SH7A 4OVDA 3DWKA 5E2HA 4OOLA 3UPNA 2DNSA 1I5QA 3PBSA 2ZC5B 3IXGA 4H8RA 4LV1A 3GTCA 4BD0A 5DF7A 2OV5A 3PBTA 1PWDA 5GLCA 4DE1A 4A5RA 1S0WA 1MKIA 4S2LA 1BSGA 1XX2A 3A3FA 4E3LA 3HLGA 4MLLA 2IWDA 2V1ZA 2EX6A 4PM6A 5A92A 1HD8A 3AGEA 2E8IA 2OLUA 4KG5A 4U3TA 4DF6A 3O3VA 3RJUA 4UA9A 5AQ9A 2JBFA 2Z2MB 2Y2NA 1FCOA 4IBXA 2RCXA 1PZOA 3ZVTA 4PM7A 5I94A 2HDRA 1ERMA 1OMEA 5EVIC 4WMCD 5DTKA 2XR0A 1RGZA 3RXWA 3OZHA 5J8XA 1NYYA 3ZHHA 2J8YA 5FQQA 1G68A 3EQVA 3G2YA 1M6KA 1I2WA 5FSRA 3WS5A 3BM6A 3BECA 3AGFA 3PBQA 4JXWA 3CJMA 2GDNA 4C75A 4DE0A 4R3JA 1K54C 2XK1A 3LO7A 4GD8A 4MEZA 1K56D 2Y2GA 4U0TA 1KE3A 4WELA 1KE4A 1NZOA 3TSGA 4S2NC 1TDGA 5TGFA 1FCMA 1ESUA 3IT9A 2CC1A 3NDGA 1KGEA 3ZFZA 3FWLA 3V50A 3ZCZA 4ZJ2A 1ES4A 3SH9A 4C3QA 3WS1A 3OPLA 4OPQA 3LEZA 2C6WB 4OONA 2XD5A 1N4OA 2C5WB 3HLBA 4OKPA 2ZC7A 5FATA 2X02A 2EFUA 2R9WA 4JF4A 1XA7A 2QPNA 1JWPA 4KZ3A 5FAOA 4NETA 4C6YA 4FH4A 1YMSA 4OLDA 4GNUA 5E2FA 5GHZA 5BOHA 3HL9A 2Y2IA 2Y2OA 2ZQAA 3G2ZA 3S1YA 1FR6A 1CEFA 3TOIA 4KQRA 3SS4A 4QY6A 2ZMAA 4WEKA 1GA9A 4BL2A 4U0XA 5A91A 1NYMA 5TFQA 3VFFA 4S2PA 4X69A 2OSUA 3FKWA 5CHUA 1SHVA 2P9VA 1HTZA 4X68A 4LV3A 4BL3A 3NC8A 3BLSA 2BLSA 4DXCA 1PWGA 5HARA 3N8SA 1HZOA 4OQGA 5F1GA 5EE8A 1VM1A 3DWZA 4KG2A 3BYDA 1PI4A 4KZ7A 4EBPA 3A3DA 3SOIA 3UE3A 4WZ5A 3WRZA 3OPHA 1ZC2A 1BLPA 4N1XA 1TEMA 4OH0A 2VGKA 1K4EA 3LCEA 4PM9A 4GDBA 5JYOA 4PM5A 1BUEA 1NY0A 5DF8A 1FOFA 5HX9A 5L2FA 4JF5A 1EWZA 1IELA 5IHVA 3G31A 5EVLA 1LL9A 3V39A 1YMXA 1FSYA 1E4DA 1FSWA 3ZG7B 2EFXA 3CMZA 4P6BA 1CEGA 4BLMA 4GOGA 2Q9MA 4N9LA 1Q2QA 5G18A 3IXDA 3UDXA 1ZG6A 4KZAA 2WK0A 5CXWA 5E2GA 5KMWA 2ZM2A 1GHPA 1CI8A 2XFTA 1YLJA 4E6XA 1PW1A 3FYZA 3GV9A 1MWRA 2ZQDA 1EI5A 1LI0A 3C7VA 2H10A 5GLBA 2FFYA 2WGWB 3GMWA 4R0QA 3O87A 1MY8A 4IEDA 3VP0A 3UPPA 3IH9A 4WEJA 3HLCA 2R9XA 3Q07A 4K91A 1LLBA 3AGDA 3WS2A 3PAGA 2XDMA 5EVID 4RX3A 2PU4A 3V3RA 1K6SA 2BG1A 3HLEA 1HVBA 4OOYA 1BTLA 5KSCA 1XGIA 4Y0UA 3M6HA 5GHYA 5EVIB 2Y2MA 2V2FF 3SH8A 3ISGA 2PBYA 4OP5A 3MXRA 1ES3A 4S2JA 1N9BA 5M19A 2JC7A 4ZDXA 5KSHA 1TDLA 1IYQA 1DJBA 5FQMA 4JBFA 3A3IA 2QMIA 4MNRA 3C4OA 4GDNA 4OQHA 1RCJA 4QU3A 1NRFA 4R4SA 2Y91A 4WZ5C 3SS5A 3QHYA 4CPKA 1MWUA 2HP9A 3Q7ZA 3WS0A 2Y2JA 2WKHA 1H5XA 3HLWA 4KENB 2J7VA 4S2OA 1MPLA 4RA7A 3P09A 5EOEA 1KVLA 3QNBA 3G4PA 3UO9A 2ZD8A 4OQ0A 2ZQ8A 3VFHA 3BFEA 4DE2A 3IWQA 2DCFA 4EBLA 2VGJA 4FH2A 5HL1A 3IHAA 4LV2A 4JXVA 2PU2A 5CHJA 5DTTA 4R4RA 1IEMA 4EBNA 2UWXA 2HP6A 1W8YA 3MKFA 3G34A 3A3JA 5FI6A 1W8QA 1DJAA 4X56A 4YINA 4HBUA 1E3UA 4EQIA 1M40A 4JPMA 5FI2A 1K38A 3V5MA 4HESA 4N9KA 1ZKJA 3IF6A 3SS3A 4DDSA 3N8RA 1XP4A 3N8LA 4K0XA 4MBHA 4S2MA 5EUAA 3LY3A 5F82A 4D2OA 3B3XA 3ZNTA 2Y2HA 4DDYA 3P98A 4EWFA 1AXBA 5FQJA 5EPHA 3MXSA 4OOMA 2ZQCA 2WAFA 4XXRA 4X6TA 4KZ6A 1IYOA 1JWVA 1RP5A 2Y2QA 4Z9QA 3BFDA 3PAEA 4WBGA 1NZUA 1E25A 5FASA 4BENA 1TVFA 4FCFA 5FI7A 3UN7A 5FQIA 1L0FA 2WZXA 2QZ6A 3GRJA 4OQIA 4QHCA 1YLWA 1LL5A 2OLVA 5EOOA
chains in the Genus database with same CATH superfamily
1C3BA 4GZBA 5HAIA 3IQAA 4R38A 4XT2A 1VHMA 4Z1WA 4PKYG 3QP1A 3C5AA 1ZTUA 4E3OA 3W4QA 4H6JB 3LGOA 3R4KA 1V9ZA 4QY5A 4L9EA 1S1ZA 1K57A 5HDCA 1CK3A 4BQMA 3N4IA 4Y0OA 2ZC3B 3D72A 4MCWA 4UQIS 1P9RA 3BEBA 3R7WB 4I39A 3WRTA 1IYSA 4DRTA 1PW8A 1XPBA 3BLMA 5CRFA 1KGFA 3F1OB 4WF0A 5DKLA 3KSHA 2HZ5A 2EA9A 3N7WA 5DF9A 1F5MA 5F5YA 3ZG5A 4KG6A 4WMCA 1YLTA 3HUOA 2Y2PA 3C4PA 3IXHA 2VV7A 1PNEA 5F69A 4WM9A 1MWTA 4FSFA 5AQAA 1S67L 5CTNA 3OCLA 2BTFP 5J3WA 3HUMA 2LB5A 3OBFA 5FQ9A 2D01A 5HWVA 3VMAA 3A0VA 4GN2A 1DJCA 3O86A 2WADA 2PHYA 4DKIA 4LCLA 3FV7A 1EW0A 2QJ7A 4GKUA 4K0WA 4KZ4A 3MZFA 5FQKA 2DMWA 4NKPA 3NJAA 4IVKA 4EETB 3TE8A 1XGJA 2PDRA 1T1AA 2HJEA 2Y2KA 2XA7S 2QJ5A 1U60A 5EV0A 4JLFA 5MC7A 3LY4A 5EVEA 2WKIA 2I9VA 4EEUA 5GLAA 2JE5A 4L0LA 1TS7A 3PBRA 1BULA 3LEQA 4HP4A 3NULA 3QNCA 1LL8A 1IYPA 1BLSA 2J9OA 1YLZA 4E3NA 4JKTA 4R1GA 4GB7A 4QB8A 3ZGAB 1XKZA 2G2UA 4HH3A 4PM8A 1QMFA 1Z09A 1GCEA 3BFGA 3O5YA 4KZBA 1KVMA 3UMEA 2HDUA 4Y17A 4GD6A 5EVIA 2HP5A 3BWLA 5EM0A 3NBLA 1ODVA 3IX3A 4HY8A 2O9BA 3M6BA 1PWCA 3IHBA 4EUVA 1WYCA 5L10A 4D60A 5AJGA 1MXOA 1S6RA 1O07A 2PD8A 4OPZA 4BWIA 4P85A 4Y0TA 4MBKA 4OPRA 3Q1FA 1VETA 2V9AA 2ZL1B 2GJ3A 3VE3A 1W7FA 3HBRA 5CGSA 5EFWA 2RL3A 4Y7PA 5HPIA 3FZCA 3Q7VB 1BT5A 2EX8A 2WGIA 3E2LA 1FQGA 3NCKA 4GS9A 5EECA 3W4PA 1NXYA 5L8MA 1ACFA 2VV8A 5G4YA 3UPNA 5IT5A 3PBSA 3IXGA 5DF7A 4UQIM 3KYQA 1MKIA 4S2LA 2Z6DA 1NWZA 2IWDA 2V1ZA 3AGEA 2K31A 2E8IA 2OLUA 4KG5A 4DF6A 3LR4A 3O3VA 5AQ9A 2Y2NA 3LI9A 4ARZB 2RCXA 1PZOA 5I94A 3T1XA 1ERMA 1NLZA 5DTKA 2XR0A 2BASA 3OZHA 5J8XA 4BMWA 4G3KA 1CJFA 3BECA 2CMNA 3PBQA 2HGVA 1S4RA 4KUKA 5F6AA 5AVFA 1TDGA 3NDGA 4C3QA 4OPQA 2C5WB 5EM1A 4JF4A 1XA7A 1JWPA 4GNUA 4MN7A 2ZQAA 1LSWA 1CEFA 4QY6A 2WKPA 1P0ZA 1SZVA 4U0XA 5A91A 3IBRA 5TFQA 3T4KA 3FKWA 5CHUA 4LV3A 2ZBBA 1HZOA 1VM1A 2XA7M 3BYDA 4ZRRA 3E4QA 3A3DA 4JGOA 4WZ5A 2P04A 4BBTA 4N1XA 2P08A 2JKRM 3PYPA 5JYOA 4FUWA 1NY0A 1FOFA 2V1AA 1EWZA 1IELA 1LL9A 3V39A 1YMXA 1E4DA 2PD7A 2EFXA 3CMZA 1CEGA 4KZAA 3H82A 5E2GA 1OTAA 2XFTA 4ESPA 4E6XA 1OTIA 3H7WB 2ZOHA 3LICA 3GMWA 4R0QA 3UPPA 4WEJA 3Q07A 3KO6A 1LLBA 3MF0A 1G5UA 3MR0A 1OJGA 1K6SA 3ZQ5A 1BTLA 2V2FF 1N9BA 2M7UA 5M19A 1NRJA 4ZDXA 5KSHA 1TDLA 1DJBA 5TBMA 4MNRA 4EESA 4OQHA 1NRFA 2KOIA 2Y91A 4BBVA 4CPKA 2HP9A 2B02A 3Q7ZA 2INWA 4KENB 1MPLA 2ZMFA 4RA7A 3P09A 3UO9A 2ZD8A 3EGXC 4DE2A 5DKKA 1BYWA 4EBLA 2VGJA 4FH2A 5DJUA 2PU2A 1W8YA 1DJAA 4X56A 4EQIA 3CPTB 1K38A 3V5MA 4HESA 1ZKJA 3IF6A 3SS3A 2W3GA 4DDSA 4S2MA 5EUAA 2Y2HA 1AXBA 3OLOA 3E4PA 2ZQCA 2WAFA 3BJNA 4KZ6A 2Y2QA 1JWVA 1RP5A 4Z9QA 3BFDA 1NZUA 1STZA 2O9CA 4BENA 1FIKA 4FCFA 5FQIA 4QHCA 1YLWA 1L3LA 2OLVA 2A3UA 1SDNA 3T1QB 4PPRA 4IVIA 5GLDA 2XQZA 3ITBA 2XEPA 1ESIA 2ZM8A 2Z6CA 1UWNX 4Q8IA 2AVXA 5HFOA 2WKEA 4LCMA 2D02A 1P9WA 3MXQA 2X71A 2WKRA 2WAEA 3G35A 3ZG8B 3PR6A 3MFDA 1SDEA 3ZVWA 3VP3A 3ZG0A 3P01A 4BBUA 2WGVA 2K2NA 1VQQA 3MQ0A 1OT9A 2OWJA 2DRWA 2Q9NA 2HDQA 3EGDC 3UPOA 4BJPA 4R3BA 2Y2LA 3VOLA 2ZM0A 1K25A 2V8FA 2P9VB 3BFFA 4QPRA 4E3JA 3DW0A 1I2SA 2Y55A 4YFMA 1ZG4A 2W1RA 1G6AA 5FA7A 1YQSA 3FPVA 3MQQA 2Z2LB 5JYPA 3L7HA 3HREA 5FAPA 2VJWA 1K55A 3IS2A 5HW3A 2W1TA 3UE6A 3E2KA 4EUZA 3UNWA 4CLCA 2XH9A 2G2WA 5KZHA 3P7NA 5A93A 4N92A 3C8CA 5CHMA 3D3OA 1NLYA 5CEBA 4EERA 4E3MA 1H8YA 4OPYA 4UHUA 3EEAA 3FC7A 3OCNA 5DVAA 4EU0A 1TD5A 3GVBA 3LUQA 5CGXA 4GCZA 2X01A 1BLHA 3ZNYA 3G32A 2WZZA 3MMHA 2Y4AA 1OTDA 2EWVA 2WGWA 4ZBEA 2HV1A 3UE0A 3QP5A 3F1PA 5D3OA 2XROA 3VP1A 2V0UA 3RXXA 1IKGA 5HPFA 1KOUA 3RH8B 4HOIA 1KE0A 1E3UD 3MZDA 4JGRA 2JKTM 1PI5A 4EV4A 3N6IA 4ZJ1A 3MFXA 3GQZA 2ZJ9A 3JYIA 1PIOA 3NIAA 2GNXA 4R3AA 2I72A 3KSGA 1ES2A 3W4OA 1K54A 2EWWA 2XLNA 4HHDA 5AQ7A 4HEFA 5FDSA 1W5DA 3ICYA 1JWZA 2ACGA 3E4OA 1L2SA 3LYXA 4LV0A 3G30A 4Y15A 1J3WA 4DJ3A 2JHEA 4EEPA 2B95A 5FAQA 2PBDP 1FCNA 3IWIA 3NECA 3OPPA 3Q81A 4BD1A 3MSHA 2H28A 2EX2A 3MZEA 4L9GA 2EXAA 3DWKA 4OOLA 1I5QA 3GECA 1TS0A 2ZC5B 5GLCA 3T50A 4DE1A 2W3EA 1S0WA 4YNRA 3S7QA 5HZHA 1XX2A 4E3LA 2VGLS 1VB6A 3RJUA 5LBRA 3DTIA 1FCOA 5HD3A 4NG2A 3ZVTA 2GX5A 4KQDA 3E98A 1XFNA 1OMEA 1TS8A 5A8BA 3ZHHA 1G68A 3EQVA 3G2YA 1M6KA 2J3TC 4JXWA 4I5SA 2HJ9C 2Q0OA 4C75A 4DE0A 3TJZC 3QP2A 3TW8A 1K56D 1MKMA 4S2NC 5TGFA 1PRQA 3QP4A 3S7PA 1KGEA 4GS9B 3FWLA 3V50A 1ES4A 3WS1A 2XD5A 4G3VA 2X02A 2EFUA 4KZ3A 2QPNA 2YKHA 3A0RA 3VE4A 1YMSA 5E2FA 2XSSA 5GHZA 5L09A 4HP9A 2GZAA 4HNBA 3SS4A 3CAXA 3G6OA 2OSUA 4X69A 2FH5A 4X68A 2BLSA 1F98A 5F1GA 1T1CA 1T19A 4JGQA 2WKQA 4P6ZS 3OPHA 3JVVA 1VEUB 4ETZA 4PM9A 2A24A 4GDBA 4PM5A 4HI4A 3G31A 5EVLA 1FSYA 4DJ2A 4GOGA 4WUJA 5HDSA 5TJJA 3PHYA 5HDDA 3UDXA 1TS6A 4LRYC 5KMWA 2ZM2A 1GHPA 1D1JA 1DP9A 3LI8A 1CI8A 1PW1A 2ZQDA 2H10A 2W3FA 3NOTC 5GLBA 2FZ0A 1OJ5A 3VP0A 1XFQA 3LIFA 2KX6A 2OAQ1 3IH9A 4K91A 2R9XA 4Y3IA 3EWKA 3V3RA 1HVBA 3CUEC 1XGIA 4Y0UA 5GHYA 3ISGA 2PBYA 4OP5A 2G7UA 5HL6A 1IYQA 3A3IA 3C4OA 3SZTA 3SS5A 3QHYA 4S2OA 1HLUP 2JKGA 5EOEA 1K0KA 4OQ0A 3VFHA 4WL9A 2OOLA 3IWQA 3H82B 5HL1A 3IHAA 5CHJA 1XJ3A 1GSXA 4EBNA 5FI6A 4HBUA 2O9AA 1E3UA 1H3QA 1GSWA 3N8RA 2VGLM 4K0XA 4DDYA 4EWFA 5FQJA 1XJ6A 4GHIB 2W27A 3NHQA 4WBGA 1E25A 5FASA 1TVFA 3UN7A 1UWPX 1L0FA 1N9OA 2WZXA 5HD5A 4X55A 4XUZA 5TBMB 3MBZA 4P0MA 2VA0A 3WWXA 1ONHA 1JVJA 3A3EA 1LHYA 4KQQA 3S7NA 2V8CA 1OT6A 2A49A 3TG9A 1L0EA 4LPZA 1MWSA 1NJ4A 1S4SA 2VLGA 3VOZA 2A2LA 3EOIA 4B88A 4JXGA 2PR6A 4WYYA 1L0DA 5FDHA 3ZYTA 4RYEA 2PT7A 3IF6B 3PBNA 2JKFA 3Q82A 1G28A 4UA6A 3QP6A 3OPRA 4PHTA 3ZDJA 2JCHA 4N1HA 4P6ZM 4HBTA 3BY8A 1TF1A 3IX8A 4CJNA 4LFUA 4R6LA 1L0GA 1XA1A 2JKRI 3EQUA 3KYEA 5FEFA 4PMAA 3VP4A 3GR2A 5GHXA 1WYBA 5L07A 3BQ8A 4UA7A 3T4QA 5HAQA 3NDEA 1K4FA 3LR3A 4MN5A 1V9YA 4WZ4A 2H0TA 1IOUA 4MBFA 1GSVA 2H0YA 2Y8HA 3MKEA 2OWHA 2J9PA 3O88A 4KZ8A 1K57C 4B4ZA 4JXSA 3UE1A 4RQ9A 3C7UA 4CLCE 3BQAA 2QKPA 4P87A 3C38A 3ZG9B 1KDWA 5FEGA 2PYRA 1H8ZA 4X25A 1YSPA 1GA0A 2IWBA 4YWZA 3MQOA 4G3WA 1PZPA 4L9FA 5CGWA 4S2KA 4Y5FA 4EQ1A 2XRNA 4B9OA 4O0PA 1JNUA 3IH8A 1QMEA 2PR5A 3NI9A 5F83A 3A0SA 3H7WA 1H0MA 3PBOA 4E3KA 3HUNA 4HIAA 2HPBA 4RVAA 2ZQ9A 2O99A 4GW9A 1IKIA 3IS2B 3MJQA 1BZAA 2OAP1 5U47A 1PYYA 4QD4A 3IXBA 3DTMA 1FR1A 1LT0A 2WUQA 4CLCB 4NK3A 5CTMA 2KLIA 3D4FA 1LI9A 2FFFB 4EW7A 1GHIA 1OTBA 4F94A 3HLFA 1F9IA 2P74A 2M7VA 4XUXA 2YKFA 2ZC6B 3BRMA 1J9MA 4O8GA 2XD1A 4B4XA 5CECA 4I38A 3TRCA 4QJGA 3HLDA 3BFCA 4RX2A 3K3CA 2NUPC 3FKVA 4I3JA 4ZJ3A 1Q2PA 2H5SA 2Y59A 4FD8A 4WLAA 4I3AA 4XT2B 4ZAMA 3LIEA 4R23A 4K08A 3F1PB 3FPWA 4H8RA 4LV1A 3GTCA 2OV5A 4A5RA 1P97A 4HH2A 1DP6A 3A3FA 1YPRA 2EX6A 4PM6A 3W2ZA 5A92A 2JBFA 4PM7A 2UV0E 2HDRA 4F3LA 5EVIC 3RXWA 2J8YA 4DMZA 3RTYA 1I2WA 3WS5A 3AGFA 4R3JA 5J7EA 3LIDA 3LIAA 2Y2GA 2NUTC 4WELA 4DN0A 1NZOA 3TSGA 1PFLA 1FCMA 3IT9A 2CC1A 3UMDA 4WN5A 3ZCZA 4ZJ2A 3OPLA 2C6WB 4OONA 1N4OA 3HLBA 4OKPA 5FATA 4IUHA 2R9WA 5FAOA 4C6YA 4NETA 4FH4A 1MZUA 1W63Q 3HCYA 2Y2OA 3G2ZA 3KX0X 2V1BA 1GA9A 1NYMA 3VFFA 4S2PA 2P9VA 1HTZA 3NC8A 4DXCA 3HJKA 1FILA 2KDKA 1N9LA 5EE8A 1PI4A 1N9NA 3T12B 3F1NA 3LCEA 1K4EA 1BUEA 2Y79A 5DF8A 5L2FA 4JF5A 5IHVA 3LR5A 1FSWA 3ZG7B 4BLMA 1Q2QA 5G18A 3IXDA 2L0WA 5CXWA 3T1RA 5HWWA 1LI0A 4KUOA 3O87A 3HLCA 3PAGA 3HLEA 5KSCA 2JKTI 3M6HA 5EVIB 1SKOA 2J3TD 3SH8A 3MXRA 4S2JA 3B33A 2JC7A 4CQHA 2W3DA 4HJ3A 2VZWA 2A24B 4GDNA 4WZ5C 2M1CA 1MWUA 2Y2JA 2WKHA 3HLWA 2J7VA 1KVLA 3QNBA 3G4PA 4H6JA 3BFEA 1VETB 2QWSA 2J80A 5DTTA 4R4RA 2UWXA 1D7EA 3G34A 5HSQA 3R7WA 5FI2A 5DJTA 1T1BA 3F1OA 3D9YA 4Q0JA 1XP4A 3LFVA 3LY3A 4D2OA 3B3XA 2L4RA 5EPHA 4OOMA 4XXRA 1IYOA 1YKDA 3PAEA 4B93A 2ZMVA 5FI7A 3GRJA 2QZ6A 4OQIA 3S7OA 4HJ4A 5E43A 3VSLA 4AFIA 4UAAA 5J4EA 2XFSA 1ES5A 1DY6A 3M2JA 2ZC4B 2R78A 2K7SA 5F1FA 3EEHA 3FG8A 5DFXA 2P7JA 2WYXA 3JPUA 3UB9A 3ITAA 2W3HA 4ID4A 3IX4A 3V67A 2PAVP 3I7JA 1JTDA 3KSFA 1CI9A 3LIBA 2L1MA 1S66L 1XJ2A 4O7DA 4Q0HA 1JTGA 1Y28A 1ONGA 4HJ6A 1WA9A 3T4SA 4IBRA 3CWFA 2ZOIA 1DRMA 1AWIA 4JF6A 3GSGA 3PTEA 1LSVA 4X1LA 3IF6C 2VK3A 4O01A 1YT4A 1XXMA 3T4OA 1W79A 1BLCA 3T4TA 5DFYA 1YLYA 2LB9A 2HF6A 2XF3A 3UY6A 4ZTKA 5CERA 2QHKA 3VSKA 1KGGA 3CI6A 3DAVA 4MMNA 1KDSA 3V3SA 4E3IA 3HVFA 2V0WA 3B47A 3S4XA 5GL9A 5I5LA 1X0OA 2ZLYA 4Y13A 1EROA 4LENA 2IWCA 3NY4A 2VEAA 5FL3A 3DTEA 4M4XA 5CEDA 2XGNA 1ERQA 1MC0A 3VP2A 3C2WA 1YLPA 1VEUA 5M1AA 4OP8A 4M3KA 2ZQ7A 1Y54A 2B5RA 4JGPA 4PKYA 1H8MA 2EX9A 3WS4A 4OLGA 4HQAA 2ZL1A 2MJ6A 1YM1A 3UDFA 2PRFA 3C30A 3Q7VA 3ULFA 1SKFA 3OOVA 2EXBA 3VV4A 3DTKA 1MBLA 4NXFA 2HDSA 4E6WA 1Z6FA 5AQBA 3RFBA 3BW6A 2VX8A 4UEYA 4CLCD 1OTEA 1K6RA 1IFQA 3DBAA 1WE4A 1RGYA 2V20A 3KSIA 1K55C 4IHQA 3M2KA 3T4JA 4R70A 3IWOA 3S22A 3CZDA 4ARZA 4KQOA 3VOYA 5E2EA 1CF0A 3IBJA 4CLCC 1ALQA 4LGWA 5C5KA 3OC2A 3IF5A 5M18A 2QYBA 4KZ5A 3UDIA 4X53A 3UB5P 4S2NA 2B18A 4DXBA 5HAPA 4S2IA 1XJ4A 1SCWA 3W8KA 4DE3A 5A90A 1O7EA 5DTSA 1G6OA 5G4ZA 4KZ9A 1K56A 3CG5A 1YSQA 5TR7A 4LLOB 3PXPA 5IS1A 1GHMA 3SH7A 4OVDA 5E2HA 4NXGA 3NOUC 4II7A 3BY9A 3L9KA 2DNSA 1YAXA 2E8JA 4GJ4A 4BD0A 3PBTA 1PWDA 2O0YA 4GHIA 1A0KA 4Y2FA 4X1MA 1BSGA 1D06A 4ME4A 3HLGA 4MLLA 1HD8A 4U3TA 4UA9A 2Z2MB 4IBXA 1S1YA 2VKSA 4WMCD 1RGZA 1UGUA 1NYYA 3CLOA 5FQQA 5FSRA 3NOPC 3BM6A 3CJMA 2GDNA 4Q0IA 1K54C 2XK1A 3LO7A 4GD8A 4MEZA 4U0TA 1KE3A 5K5BA 1KE4A 3UB6A 3MS6A 4I3IA 5AVEA 1ESUA 3ZFZA 3SH9A 3LEZA 2ZC7A 4OLDA 4FTXA 4IUKA 5BOHA 1ZHHB 3GDIA 3KYZA 3HL9A 2Y2IA 3SW1A 3CUEA 3S1YA 1FR6A 3TOIA 4KQRA 4WEKA 2ZMAA 4BL2A 2W1TB 5KIZA 1SHVA 4BL3A 3BLSA 1PWGA 5HARA 3N8SA 4OQGA 4EXOA 3QP8A 4F3LB 3DWZA 4KG2A 4PAUA 4ETXA 4EBPA 4KZ7A 3SOIA 3UE3A 3U2AA 3WRZA 3T1SA 1ZC2A 1BLPA 1TEMA 4OH0A 2VGKA 2W0NA 5HX9A 4LRZE 4P6BA 1Y4OA 2Q9MA 4N9LA 1ZG6A 2WK0A 1YLJA 1W63M 3FYZA 3GV9A 1MWRA 1EI5A 3C7VA 3B42A 3CITA 2FFYA 2WGWB 4IJGA 5HWTA 3CPTA 4FOFA 1MY8A 4IEDA 4GLQA 3AGDA 3WS2A 2IA2A 2XDMA 4MDZA 5EVID 4RX3A 2PU4A 5CX7A 5IU1A 3UB7A 2BG1A 4OOYA 3HJIA 4NEED 2Y2MA 4YOFA 4MN6A 1ES3A 5F68A 3F1NB 2VV6A 5FQMA 4JBFA 2PYPA 2QMIA 1RCJA 4QU3A 4R4SA 3E0YA 3WS0A 4E04A 3U4LP 1H5XA 1LSXA 2ZQ8A 3K2NA 1OPXA 2DCFA 1CQAA 4LV2A 4JXVA 1IEMA 2HP6A 3MKFA 3A3JA 1W8QA 4YINA 1M40A 3CHWP 4JPMA 4N9KA 3UB8A 4QWOA 3N8LA 4MBHA 3H9WA 1T18A 2JN7A 5F82A 3ZNTA 3P98A 4NXBA 1F2KA 4NXEA 3MXSA 3LR0A 4X6TA 4LRXC 1SKOB 1DP8A 3T4LA 3K3DA 2J3WA 1LL5A 3JVUA 5EOOA
chains in the Genus database with same CATH topology
4X55A 4XUZA 3MBZA 4P0MA 1C3BA 2A3UA 1SDNA 5E43A 4GZBA 3VSLA 4PPRA 4IVIA 4UAAA 5HAIA 3IQAA 5GLDA 2XFSA 1ES5A 2XQZA 3ITBA 1DY6A 2XEPA 3C5AA 3M2JA 1ONHA 1JVJA 2ZC4B 1LHYA 3A3EA 4KQQA 3WWXA 4E3OA 3W4QA 1ESIA 5F1FA 2A49A 2ZM8A 4Q8IA 3TG9A 1L0EA 4QY5A 5HFOA 2WKEA 4LCMA 1K57A 1MWSA 1CK3A 1NJ4A 2X71A 2WYXA 3VOZA 4BQMA 3N4IA 3ITAA 2ZC3B 4Y0OA 4ID4A 2WAEA 3G35A 4B88A 3ZG8B 4JXGA 3BEBA 3I7JA 3WRTA 4WYYA 1L0DA 1IYSA 5FDHA 1JTDA 1PW8A 1CI9A 3MFDA 4DRTA 1XPBA 4RYEA 4O7DA 1SDEA 3BLMA 5CRFA 3ZVWA 1JTGA 3IF6B 1KGFA 3PBNA 1ONGA 3VP3A 3N7WA 4IBRA 5DF9A 3Q82A 3ZG0A 3ZG5A 4KG6A 4JF6A 3GSGA 2WGVA 1YLTA 3HUOA 3PTEA 2Y2PA 4UA6A 4WMCA 3C4PA 1VQQA 3IF6C 3IXHA 2Q9NA 2DRWA 3OPRA 3ZDJA 2HDQA 1YT4A 1XXMA 3UPOA 4BJPA 1W79A 4R3BA 4WM9A 1MWTA 2JCHA 2Y2LA 4N1HA 1BLCA 4FSFA 2ZM0A 4HBTA 1K25A 1YLYA 5AQAA 2P9VB 3BFFA 5CTNA 4E3JA 3OCLA 2XF3A 3DW0A 3UY6A 3HUMA 4CJNA 1I2SA 4ZTKA 2Y55A 5CERA 4YFMA 1ZG4A 3VSKA 5FQ9A 1G6AA 3VMAA 1L0GA 1XA1A 3EQUA 5FA7A 1KGGA 1YQSA 4GN2A 2Z2LB 4PMAA 3VP4A 1KDSA 3GR2A 3V3SA 5JYPA 5GHXA 1WYBA 1DJCA 4E3IA 3HREA 3O86A 3HVFA 5FAPA 4UA7A 5HAQA 3S4XA 3NDEA 5GL9A 2WADA 1K55A 1K4FA 2ZLYA 1EROA 4WZ4A 5HW3A 4DKIA 2H0TA 4LENA 2IWCA 4LCLA 4MBFA 3E2KA 2H0YA 3FV7A 3NY4A 3MKEA 4EUZA 3UNWA 5CEDA 2J9PA 2XH9A 3O88A 4GKUA 4K0WA 4KZ4A 1K57C 3MZFA 4KZ8A 4JXSA 5FQKA 3UE1A 2G2WA 4B4ZA 5KZHA 4IVKA 3C7UA 2XGNA 1ERQA 1XGJA 5A93A 3VP2A 4N92A 4P87A 5CHMA 1YLPA 2Y2KA 5M1AA 3ZG9B 4OP8A 5CEBA 4E3MA 1H8YA 1KDWA 1U60A 4OPYA 4JLFA 4M3KA 3LY4A 2ZQ7A 4UHUA 1Y54A 2B5RA 2WKIA 3OCNA 1H8ZA 5DVAA 3GVBA 2IWBA 1GA0A 5GLAA 2JE5A 4L0LA 1PZPA 5CGXA 2EX9A 3WS4A 3PBRA 5CGWA 2X01A 4OLGA 1BULA 4S2KA 1BLHA 1YM1A 3ZNYA 3IH8A 3UDFA 3G32A 1QMEA 3NI9A 3Q7VA 3QNCA 5F83A 2WZZA 1SKFA 1IYPA 2Y4AA 3PBOA 1BLSA 4E3KA 3HUNA 2EXBA 2HPBA 4RVAA 2ZQ9A 1MBLA 2J9OA 2HDSA 2WGWA 4ZBEA 3UE0A 4E6WA 1IKIA 1YLZA 4E3NA 4JKTA 1BZAA 1Z6FA 5AQBA 4R1GA 4GB7A 4QB8A 3ZGAB 5D3OA 3VP1A 1XKZA 2G2UA 4PM8A 5U47A 1PYYA 4QD4A 3IXBA 1QMFA 1IKGA 1GCEA 3BFGA 3RXXA 3DTMA 4KZBA 1K6RA 1FR1A 1WE4A 1RGYA 2V20A 1KVMA 1K55C 2WUQA 3M2KA 4NK3A 5CTMA 2HDUA 3D4FA 1KE0A 1E3UD 3MZDA 4GD6A 1LI9A 5EVIA 2HP5A 2FFFB 3IWOA 1GHIA 4F94A 3HLFA 3NBLA 3S22A 1PI5A 4EV4A 3CZDA 3N6IA 2P74A 4ZJ1A 3GQZA 4KQOA 2ZJ9A 3JYIA 4XUXA 1PIOA 3M6BA 5E2EA 1PWCA 3VOYA 2ZC6B 1ALQA 3NIAA 3BRMA 3IHBA 1WYCA 1J9MA 2I72A 2XD1A 4B4XA 3OC2A 5CECA 1ES2A 3IF5A 3W4OA 5M18A 1K54A 1MXOA 4KZ5A 1S6RA 3UDIA 2XLNA 1O07A 5AQ7A 4QJGA 4OPZA 4HEFA 4X53A 4P85A 3HLDA 4S2NA 1W5DA 3BFCA 4MBKA 4RX2A 4Y0TA 4DXBA 5HAPA 4OPRA 1JWZA 4S2IA 3Q1FA 1L2SA 1SCWA 3G30A 4LV0A 3FKVA 3W8KA 4DE3A 1W7FA 5A90A 3HBRA 5FAQA 4ZJ3A 1O7EA 1Q2PA 2H5SA 2Y59A 5CGSA 2RL3A 4Y7PA 4FD8A 3FZCA 5DTSA 3Q7VB 1BT5A 2EX8A 4KZ9A 1K56A 3CG5A 1FCNA 2WGIA 3E2LA 1FQGA 3IWIA 3NCKA 3OPPA 3Q81A 5EECA 5TR7A 4BD1A 3W4PA 4ZAMA 1NXYA 2EX2A 3MZEA 4R23A 1GHMA 2EXAA 3SH7A 4OVDA 3DWKA 5E2HA 4OOLA 3UPNA 2DNSA 1I5QA 3PBSA 2ZC5B 3IXGA 4H8RA 4LV1A 3GTCA 4BD0A 5DF7A 2OV5A 3PBTA 1PWDA 5GLCA 4DE1A 4A5RA 1S0WA 1MKIA 4S2LA 1BSGA 1XX2A 3A3FA 4E3LA 3HLGA 4MLLA 2IWDA 2V1ZA 2EX6A 4PM6A 5A92A 1HD8A 3AGEA 2E8IA 2OLUA 4KG5A 4U3TA 4DF6A 3O3VA 3RJUA 4UA9A 5AQ9A 2JBFA 2Z2MB 2Y2NA 1FCOA 4IBXA 2RCXA 1PZOA 3ZVTA 4PM7A 5I94A 2HDRA 1ERMA 1OMEA 5EVIC 4WMCD 5DTKA 2XR0A 1RGZA 3RXWA 3OZHA 5J8XA 1NYYA 3ZHHA 2J8YA 5FQQA 1G68A 3EQVA 3G2YA 1M6KA 1I2WA 5FSRA 3WS5A 3BM6A 3BECA 3AGFA 3PBQA 4JXWA 3CJMA 2GDNA 4C75A 4DE0A 4R3JA 1K54C 2XK1A 3LO7A 4GD8A 4MEZA 1K56D 2Y2GA 4U0TA 1KE3A 4WELA 1KE4A 1NZOA 3TSGA 4S2NC 1TDGA 5TGFA 1FCMA 1ESUA 3IT9A 2CC1A 3NDGA 1KGEA 3ZFZA 3FWLA 3V50A 3ZCZA 4ZJ2A 1ES4A 3SH9A 4C3QA 3WS1A 3OPLA 4OPQA 3LEZA 2C6WB 4OONA 2XD5A 1N4OA 2C5WB 3HLBA 4OKPA 2ZC7A 5FATA 2X02A 2EFUA 2R9WA 4JF4A 1XA7A 2QPNA 1JWPA 4KZ3A 5FAOA 4NETA 4C6YA 4FH4A 1YMSA 4OLDA 4GNUA 5E2FA 5GHZA 5BOHA 3HL9A 2Y2IA 2Y2OA 2ZQAA 3G2ZA 3S1YA 1FR6A 1CEFA 3TOIA 4KQRA 3SS4A 4QY6A 2ZMAA 4WEKA 1GA9A 4BL2A 4U0XA 5A91A 1NYMA 5TFQA 3VFFA 4S2PA 4X69A 2OSUA 3FKWA 5CHUA 1SHVA 2P9VA 1HTZA 4X68A 4LV3A 4BL3A 3NC8A 3BLSA 2BLSA 4DXCA 1PWGA 5HARA 3N8SA 1HZOA 4OQGA 5F1GA 5EE8A 1VM1A 3DWZA 4KG2A 3BYDA 1PI4A 4KZ7A 4EBPA 3A3DA 3SOIA 3UE3A 4WZ5A 3WRZA 3OPHA 1ZC2A 1BLPA 4N1XA 1TEMA 4OH0A 2VGKA 1K4EA 3LCEA 4PM9A 4GDBA 5JYOA 4PM5A 1BUEA 1NY0A 5DF8A 1FOFA 5HX9A 5L2FA 4JF5A 1EWZA 1IELA 5IHVA 3G31A 5EVLA 1LL9A 3V39A 1YMXA 1FSYA 1E4DA 1FSWA 3ZG7B 2EFXA 3CMZA 4P6BA 1CEGA 4BLMA 4GOGA 2Q9MA 4N9LA 1Q2QA 5G18A 3IXDA 3UDXA 1ZG6A 4KZAA 2WK0A 5CXWA 5E2GA 5KMWA 2ZM2A 1GHPA 1CI8A 2XFTA 1YLJA 4E6XA 1PW1A 3FYZA 3GV9A 1MWRA 2ZQDA 1EI5A 1LI0A 3C7VA 2H10A 5GLBA 2FFYA 2WGWB 3GMWA 4R0QA 3O87A 1MY8A 4IEDA 3VP0A 3UPPA 3IH9A 4WEJA 3HLCA 2R9XA 3Q07A 4K91A 1LLBA 3AGDA 3WS2A 3PAGA 2XDMA 5EVID 4RX3A 2PU4A 3V3RA 1K6SA 2BG1A 3HLEA 1HVBA 4OOYA 1BTLA 5KSCA 1XGIA 4Y0UA 3M6HA 5GHYA 5EVIB 2Y2MA 2V2FF 3SH8A 3ISGA 2PBYA 4OP5A 3MXRA 1ES3A 4S2JA 1N9BA 5M19A 2JC7A 4ZDXA 5KSHA 1TDLA 1IYQA 1DJBA 5FQMA 4JBFA 3A3IA 2QMIA 4MNRA 3C4OA 4GDNA 4OQHA 1RCJA 4QU3A 1NRFA 4R4SA 2Y91A 4WZ5C 3SS5A 3QHYA 4CPKA 1MWUA 2HP9A 3Q7ZA 3WS0A 2Y2JA 2WKHA 1H5XA 3HLWA 4KENB 2J7VA 4S2OA 1MPLA 4RA7A 3P09A 5EOEA 1KVLA 3QNBA 3G4PA 3UO9A 2ZD8A 4OQ0A 2ZQ8A 3VFHA 3BFEA 4DE2A 3IWQA 2DCFA 4EBLA 2VGJA 4FH2A 5HL1A 3IHAA 4LV2A 4JXVA 2PU2A 5CHJA 5DTTA 4R4RA 1IEMA 4EBNA 2UWXA 2HP6A 1W8YA 3MKFA 3G34A 3A3JA 5FI6A 1W8QA 1DJAA 4X56A 4YINA 4HBUA 1E3UA 4EQIA 1M40A 4JPMA 5FI2A 1K38A 3V5MA 4HESA 4N9KA 1ZKJA 3IF6A 3SS3A 4DDSA 3N8RA 1XP4A 3N8LA 4K0XA 4MBHA 4S2MA 5EUAA 3LY3A 5F82A 4D2OA 3B3XA 3ZNTA 2Y2HA 4DDYA 3P98A 4EWFA 1AXBA 5FQJA 5EPHA 3MXSA 4OOMA 2ZQCA 2WAFA 4XXRA 4X6TA 4KZ6A 1IYOA 1JWVA 1RP5A 2Y2QA 4Z9QA 3BFDA 3PAEA 4WBGA 1NZUA 1E25A 5FASA 4BENA 1TVFA 4FCFA 5FI7A 3UN7A 5FQIA 1L0FA 2WZXA 2QZ6A 3GRJA 4OQIA 4QHCA 1YLWA 1LL5A 2OLVA 5EOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X55 A;  4XUZ A;  3MBZ A;  4P0M A;  1C3B A;  2A3U A;  1SDN A;  5E43 A;  4GZB A;  3VSL A;  4PPR A;  4IVI A;  4UAA A;  5HAI A;  3IQA A;  5GLD A;  2XFS A;  1ES5 A;  2XQZ A;  3ITB A;  1DY6 A;  2XEP A;  3C5A A;  3M2J A;  1ONH A;  1JVJ A;  2ZC4 B;  1LHY A;  3A3E A;  4KQQ A;  3WWX A;  4E3O A;  3W4Q A;  1ESI A;  5F1F A;  2A49 A;  2ZM8 A;  4Q8I A;  3TG9 A;  1L0E A;  4QY5 A;  5HFO A;  2WKE A;  4LCM A;  1K57 A;  1MWS A;  1CK3 A;  1NJ4 A;  2X71 A;  2WYX A;  3VOZ A;  4BQM A;  3N4I A;  3ITA A;  2ZC3 B;  4Y0O A;  4ID4 A;  2WAE A;  3G35 A;  4B88 A;  3ZG8 B;  4JXG A;  3BEB A;  3I7J A;  3WRT A;  4WYY A;  1L0D A;  1IYS A;  5FDH A;  1JTD A;  1PW8 A;  1CI9 A;  3MFD A;  4DRT A;  1XPB A;  4RYE A;  4O7D A;  1SDE A;  3BLM A;  5CRF A;  3ZVW A;  1JTG A;  3IF6 B;  1KGF A;  3PBN A;  1ONG A;  3VP3 A;  3N7W A;  4IBR A;  5DF9 A;  3Q82 A;  3ZG0 A;  3ZG5 A;  4KG6 A;  4JF6 A;  3GSG A;  2WGV A;  1YLT A;  3HUO A;  3PTE A;  2Y2P A;  4UA6 A;  4WMC A;  3C4P A;  1VQQ A;  3IF6 C;  3IXH A;  2Q9N A;  2DRW A;  3OPR A;  3ZDJ A;  2HDQ A;  1YT4 A;  1XXM A;  3UPO A;  4BJP A;  1W79 A;  4R3B A;  4WM9 A;  1MWT A;  2JCH A;  2Y2L A;  4N1H A;  1BLC A;  4FSF A;  2ZM0 A;  4HBT A;  1K25 A;  1YLY A;  5AQA A;  2P9V B;  3BFF A;  5CTN A;  4E3J A;  3OCL A;  2XF3 A;  3DW0 A;  3UY6 A;  3HUM A;  4CJN A;  1I2S A;  4ZTK A;  2Y55 A;  5CER A;  4YFM A;  1ZG4 A;  3VSK A;  5FQ9 A;  1G6A A;  3VMA A;  1L0G A;  1XA1 A;  3EQU A;  5FA7 A;  1KGG A;  1YQS A;  4GN2 A;  2Z2L B;  4PMA A;  3VP4 A;  1KDS A;  3GR2 A;  3V3S A;  5JYP A;  5GHX A;  1WYB A;  1DJC A;  4E3I A;  3HRE A;  3O86 A;  3HVF A;  5FAP A;  4UA7 A;  5HAQ A;  3S4X A;  3NDE A;  5GL9 A;  2WAD A;  1K55 A;  1K4F A;  2ZLY A;  1ERO A;  4WZ4 A;  5HW3 A;  4DKI A;  2H0T A;  4LEN A;  2IWC A;  4LCL A;  4MBF A;  3E2K A;  2H0Y A;  3FV7 A;  3NY4 A;  3MKE A;  4EUZ A;  3UNW A;  5CED A;  2J9P A;  2XH9 A;  3O88 A;  4GKU A;  4K0W A;  4KZ4 A;  1K57 C;  3MZF A;  4KZ8 A;  4JXS A;  5FQK A;  3UE1 A;  2G2W A;  4B4Z A;  5KZH A;  4IVK A;  3C7U A;  2XGN A;  1ERQ A;  1XGJ A;  5A93 A;  3VP2 A;  4N92 A;  4P87 A;  5CHM A;  1YLP A;  2Y2K A;  5M1A A;  3ZG9 B;  4OP8 A;  5CEB A;  4E3M A;  1H8Y A;  1KDW A;  1U60 A;  4OPY A;  4JLF A;  4M3K A;  3LY4 A;  2ZQ7 A;  4UHU A;  1Y54 A;  2B5R A;  2WKI A;  3OCN A;  1H8Z A;  5DVA A;  3GVB A;  2IWB A;  1GA0 A;  5GLA A;  2JE5 A;  4L0L A;  1PZP A;  5CGX A;  2EX9 A;  3WS4 A;  3PBR A;  5CGW A;  2X01 A;  4OLG A;  1BUL A;  4S2K A;  1BLH A;  1YM1 A;  3ZNY A;  3IH8 A;  3UDF A;  3G32 A;  1QME A;  3NI9 A;  3Q7V A;  3QNC A;  5F83 A;  2WZZ A;  1SKF A;  1IYP A;  2Y4A A;  3PBO A;  1BLS A;  4E3K A;  3HUN A;  2EXB A;  2HPB A;  4RVA A;  2ZQ9 A;  1MBL A;  2J9O A;  2HDS A;  2WGW A;  4ZBE A;  3UE0 A;  4E6W A;  1IKI A;  1YLZ A;  4E3N A;  4JKT A;  1BZA A;  1Z6F A;  5AQB A;  4R1G A;  4GB7 A;  4QB8 A;  3ZGA B;  5D3O A;  3VP1 A;  1XKZ A;  2G2U A;  4PM8 A;  5U47 A;  1PYY A;  4QD4 A;  3IXB A;  1QMF A;  1IKG A;  1GCE A;  3BFG A;  3RXX A;  3DTM A;  4KZB A;  1K6R A;  1FR1 A;  1WE4 A;  1RGY A;  2V20 A;  1KVM A;  1K55 C;  2WUQ A;  3M2K A;  4NK3 A;  5CTM A;  2HDU A;  3D4F A;  1KE0 A;  1E3U D;  3MZD A;  4GD6 A;  1LI9 A;  5EVI A;  2HP5 A;  2FFF B;  3IWO A;  1GHI A;  4F94 A;  3HLF A;  3NBL A;  3S22 A;  1PI5 A;  4EV4 A;  3CZD A;  3N6I A;  2P74 A;  4ZJ1 A;  3GQZ A;  4KQO A;  2ZJ9 A;  3JYI A;  4XUX A;  1PIO A;  3M6B A;  5E2E A;  1PWC A;  3VOY A;  2ZC6 B;  1ALQ A;  3NIA A;  3BRM A;  3IHB A;  1WYC A;  1J9M A;  2I72 A;  2XD1 A;  4B4X A;  3OC2 A;  5CEC A;  1ES2 A;  3IF5 A;  3W4O A;  5M18 A;  1K54 A;  1MXO A;  4KZ5 A;  1S6R A;  3UDI A;  2XLN A;  1O07 A;  5AQ7 A;  4QJG A;  4OPZ A;  4HEF A;  4X53 A;  4P85 A;  3HLD A;  4S2N A;  1W5D A;  3BFC A;  4MBK A;  4RX2 A;  4Y0T A;  4DXB A;  5HAP A;  4OPR A;  1JWZ A;  4S2I A;  3Q1F A;  1L2S A;  1SCW A;  3G30 A;  4LV0 A;  3FKV A;  3W8K A;  4DE3 A;  1W7F A;  5A90 A;  3HBR A;  5FAQ A;  4ZJ3 A;  1O7E A;  1Q2P A;  2H5S A;  2Y59 A;  5CGS A;  2RL3 A;  4Y7P A;  4FD8 A;  3FZC A;  5DTS A;  3Q7V B;  1BT5 A;  2EX8 A;  4KZ9 A;  1K56 A;  3CG5 A;  1FCN A;  2WGI A;  3E2L A;  1FQG A;  3IWI A;  3NCK A;  3OPP A;  3Q81 A;  5EEC A;  5TR7 A;  4BD1 A;  3W4P A;  4ZAM A;  1NXY A;  2EX2 A;  3MZE A;  4R23 A;  1GHM A;  2EXA A;  3SH7 A;  4OVD A;  3DWK A;  5E2H A;  4OOL A;  3UPN A;  2DNS A;  1I5Q A;  3PBS A;  2ZC5 B;  3IXG A;  4H8R A;  4LV1 A;  3GTC A;  4BD0 A;  5DF7 A;  2OV5 A;  3PBT A;  1PWD A;  5GLC A;  4DE1 A;  4A5R A;  1S0W A;  1MKI A;  4S2L A;  1BSG A;  1XX2 A;  3A3F A;  4E3L A;  3HLG A;  4MLL A;  2IWD A;  2V1Z A;  2EX6 A;  4PM6 A;  5A92 A;  1HD8 A;  3AGE A;  2E8I A;  2OLU A;  4KG5 A;  4U3T A;  4DF6 A;  3O3V A;  3RJU A;  4UA9 A;  5AQ9 A;  2JBF A;  2Z2M B;  2Y2N A;  1FCO A;  4IBX A;  2RCX A;  1PZO A;  3ZVT A;  4PM7 A;  5I94 A;  2HDR A;  1ERM A;  1OME A;  5EVI C;  4WMC D;  5DTK A;  2XR0 A;  1RGZ A;  3RXW A;  3OZH A;  5J8X A;  1NYY A;  3ZHH A;  2J8Y A;  5FQQ A;  1G68 A;  3EQV A;  3G2Y A;  1M6K A;  1I2W A;  5FSR A;  3WS5 A;  3BM6 A;  3BEC A;  3AGF A;  3PBQ A;  4JXW A;  3CJM A;  2GDN A;  4C75 A;  4DE0 A;  4R3J A;  1K54 C;  2XK1 A;  3LO7 A;  4GD8 A;  4MEZ A;  1K56 D;  2Y2G A;  4U0T A;  1KE3 A;  4WEL A;  1KE4 A;  1NZO A;  3TSG A;  4S2N C;  1TDG A;  5TGF A;  1FCM A;  1ESU A;  3IT9 A;  2CC1 A;  3NDG A;  1KGE A;  3ZFZ A;  3FWL A;  3V50 A;  3ZCZ A;  4ZJ2 A;  1ES4 A;  3SH9 A;  4C3Q A;  3WS1 A;  3OPL A;  4OPQ A;  3LEZ A;  2C6W B;  4OON A;  2XD5 A;  1N4O A;  2C5W B;  3HLB A;  4OKP A;  2ZC7 A;  5FAT A;  2X02 A;  2EFU A;  2R9W A;  4JF4 A;  1XA7 A;  2QPN A;  1JWP A;  4KZ3 A;  5FAO A;  4NET A;  4C6Y A;  4FH4 A;  1YMS A;  4OLD A;  4GNU A;  5E2F A;  5GHZ A;  5BOH A;  3HL9 A;  2Y2I A;  2Y2O A;  2ZQA A;  3G2Z A;  3S1Y A;  1FR6 A;  1CEF A;  3TOI A;  4KQR A;  3SS4 A;  4QY6 A;  2ZMA A;  4WEK A;  1GA9 A;  4BL2 A;  4U0X A;  5A91 A;  1NYM A;  5TFQ A;  3VFF A;  4S2P A;  4X69 A;  2OSU A;  3FKW A;  5CHU A;  1SHV A;  2P9V A;  1HTZ A;  4X68 A;  4LV3 A;  4BL3 A;  3NC8 A;  3BLS A;  2BLS A;  4DXC A;  1PWG A;  5HAR A;  3N8S A;  1HZO A;  4OQG A;  5F1G A;  5EE8 A;  1VM1 A;  3DWZ A;  4KG2 A;  3BYD A;  1PI4 A;  4KZ7 A;  4EBP A;  3A3D A;  3SOI A;  3UE3 A;  4WZ5 A;  3WRZ A;  3OPH A;  1ZC2 A;  1BLP A;  4N1X A;  1TEM A;  4OH0 A;  2VGK A;  1K4E A;  3LCE A;  4PM9 A;  4GDB A;  5JYO A;  4PM5 A;  1BUE A;  1NY0 A;  5DF8 A;  1FOF A;  5HX9 A;  5L2F A;  4JF5 A;  1EWZ A;  1IEL A;  5IHV A;  3G31 A;  5EVL A;  1LL9 A;  3V39 A;  1YMX A;  1FSY A;  1E4D A;  1FSW A;  3ZG7 B;  2EFX A;  3CMZ A;  4P6B A;  1CEG A;  4BLM A;  4GOG A;  2Q9M A;  4N9L A;  1Q2Q A;  5G18 A;  3IXD A;  3UDX A;  1ZG6 A;  4KZA A;  2WK0 A;  5CXW A;  5E2G A;  5KMW A;  2ZM2 A;  1GHP A;  1CI8 A;  2XFT A;  1YLJ A;  4E6X A;  1PW1 A;  3FYZ A;  3GV9 A;  1MWR A;  2ZQD A;  1EI5 A;  1LI0 A;  3C7V A;  2H10 A;  5GLB A;  2FFY A;  2WGW B;  3GMW A;  4R0Q A;  3O87 A;  1MY8 A;  4IED A;  3VP0 A;  3UPP A;  3IH9 A;  4WEJ A;  3HLC A;  2R9X A;  3Q07 A;  4K91 A;  1LLB A;  3AGD A;  3WS2 A;  3PAG A;  2XDM A;  5EVI D;  4RX3 A;  2PU4 A;  3V3R A;  1K6S A;  2BG1 A;  3HLE A;  1HVB A;  4OOY A;  1BTL A;  5KSC A;  1XGI A;  4Y0U A;  3M6H A;  5GHY A;  5EVI B;  2Y2M A;  2V2F F;  3SH8 A;  3ISG A;  2PBY A;  4OP5 A;  3MXR A;  1ES3 A;  4S2J A;  1N9B A;  5M19 A;  2JC7 A;  4ZDX A;  5KSH A;  1TDL A;  1IYQ A;  1DJB A;  5FQM A;  4JBF A;  3A3I A;  2QMI A;  4MNR A;  3C4O A;  4GDN A;  4OQH A;  1RCJ A;  4QU3 A;  1NRF A;  4R4S A;  2Y91 A;  4WZ5 C;  3SS5 A;  3QHY A;  4CPK A;  1MWU A;  2HP9 A;  3Q7Z A;  3WS0 A;  2Y2J A;  2WKH A;  1H5X A;  3HLW A;  4KEN B;  2J7V A;  4S2O A;  1MPL A;  4RA7 A;  3P09 A;  5EOE A;  1KVL A;  3QNB A;  3G4P A;  3UO9 A;  2ZD8 A;  4OQ0 A;  2ZQ8 A;  3VFH A;  3BFE A;  4DE2 A;  3IWQ A;  2DCF A;  4EBL A;  2VGJ A;  4FH2 A;  5HL1 A;  3IHA A;  4LV2 A;  4JXV A;  2PU2 A;  5CHJ A;  5DTT A;  4R4R A;  1IEM A;  4EBN A;  2UWX A;  2HP6 A;  1W8Y A;  3MKF A;  3G34 A;  3A3J A;  5FI6 A;  1W8Q A;  1DJA A;  4X56 A;  4YIN A;  4HBU A;  1E3U A;  4EQI A;  1M40 A;  4JPM A;  5FI2 A;  1K38 A;  3V5M A;  4HES A;  4N9K A;  1ZKJ A;  3IF6 A;  3SS3 A;  4DDS A;  3N8R A;  1XP4 A;  3N8L A;  4K0X A;  4MBH A;  4S2M A;  5EUA A;  3LY3 A;  5F82 A;  4D2O A;  3B3X A;  3ZNT A;  2Y2H A;  4DDY A;  3P98 A;  4EWF A;  1AXB A;  5FQJ A;  5EPH A;  3MXS A;  4OOM A;  2ZQC A;  2WAF A;  4XXR A;  4X6T A;  4KZ6 A;  1IYO A;  1JWV A;  1RP5 A;  2Y2Q A;  4Z9Q A;  3BFD A;  3PAE A;  4WBG A;  1NZU A;  1E25 A;  5FAS A;  4BEN A;  1TVF A;  4FCF A;  5FI7 A;  3UN7 A;  5FQI A;  1L0F A;  2WZX A;  2QZ6 A;  3GRJ A;  4OQI A;  4QHC A;  1YLW A;  1LL5 A;  2OLV A;  5EOO A; 
#chains in the Genus database with same CATH topology
 1C3B A;  4GZB A;  5HAI A;  3IQA A;  4R38 A;  4XT2 A;  1VHM A;  4Z1W A;  4PKY G;  3QP1 A;  3C5A A;  1ZTU A;  4E3O A;  3W4Q A;  4H6J B;  3LGO A;  3R4K A;  1V9Z A;  4QY5 A;  4L9E A;  1S1Z A;  1K57 A;  5HDC A;  1CK3 A;  4BQM A;  3N4I A;  4Y0O A;  2ZC3 B;  3D72 A;  4MCW A;  4UQI S;  1P9R A;  3BEB A;  3R7W B;  4I39 A;  3WRT A;  1IYS A;  4DRT A;  1PW8 A;  1XPB A;  3BLM A;  5CRF A;  1KGF A;  3F1O B;  4WF0 A;  5DKL A;  3KSH A;  2HZ5 A;  2EA9 A;  3N7W A;  5DF9 A;  1F5M A;  5F5Y A;  3ZG5 A;  4KG6 A;  4WMC A;  1YLT A;  3HUO A;  2Y2P A;  3C4P A;  3IXH A;  2VV7 A;  1PNE A;  5F69 A;  4WM9 A;  1MWT A;  4FSF A;  5AQA A;  1S67 L;  5CTN A;  3OCL A;  2BTF P;  5J3W A;  3HUM A;  2LB5 A;  3OBF A;  5FQ9 A;  2D01 A;  5HWV A;  3VMA A;  3A0V A;  4GN2 A;  1DJC A;  3O86 A;  2WAD A;  2PHY A;  4DKI A;  4LCL A;  3FV7 A;  1EW0 A;  2QJ7 A;  4GKU A;  4K0W A;  4KZ4 A;  3MZF A;  5FQK A;  2DMW A;  4NKP A;  3NJA A;  4IVK A;  4EET B;  3TE8 A;  1XGJ A;  2PDR A;  1T1A A;  2HJE A;  2Y2K A;  2XA7 S;  2QJ5 A;  1U60 A;  5EV0 A;  4JLF A;  5MC7 A;  3LY4 A;  5EVE A;  2WKI A;  2I9V A;  4EEU A;  5GLA A;  2JE5 A;  4L0L A;  1TS7 A;  3PBR A;  1BUL A;  3LEQ A;  4HP4 A;  3NUL A;  3QNC A;  1LL8 A;  1IYP A;  1BLS A;  2J9O A;  1YLZ A;  4E3N A;  4JKT A;  4R1G A;  4GB7 A;  4QB8 A;  3ZGA B;  1XKZ A;  2G2U A;  4HH3 A;  4PM8 A;  1QMF A;  1Z09 A;  1GCE A;  3BFG A;  3O5Y A;  4KZB A;  1KVM A;  3UME A;  2HDU A;  4Y17 A;  4GD6 A;  5EVI A;  2HP5 A;  3BWL A;  5EM0 A;  3NBL A;  1ODV A;  3IX3 A;  4HY8 A;  2O9B A;  3M6B A;  1PWC A;  3IHB A;  4EUV A;  1WYC A;  5L10 A;  4D60 A;  5AJG A;  1MXO A;  1S6R A;  1O07 A;  2PD8 A;  4OPZ A;  4BWI A;  4P85 A;  4Y0T A;  4MBK A;  4OPR A;  3Q1F A;  1VET A;  2V9A A;  2ZL1 B;  2GJ3 A;  3VE3 A;  1W7F A;  3HBR A;  5CGS A;  5EFW A;  2RL3 A;  4Y7P A;  5HPI A;  3FZC A;  3Q7V B;  1BT5 A;  2EX8 A;  2WGI A;  3E2L A;  1FQG A;  3NCK A;  4GS9 A;  5EEC A;  3W4P A;  1NXY A;  5L8M A;  1ACF A;  2VV8 A;  5G4Y A;  3UPN A;  5IT5 A;  3PBS A;  3IXG A;  5DF7 A;  4UQI M;  3KYQ A;  1MKI A;  4S2L A;  2Z6D A;  1NWZ A;  2IWD A;  2V1Z A;  3AGE A;  2K31 A;  2E8I A;  2OLU A;  4KG5 A;  4DF6 A;  3LR4 A;  3O3V A;  5AQ9 A;  2Y2N A;  3LI9 A;  4ARZ B;  2RCX A;  1PZO A;  5I94 A;  3T1X A;  1ERM A;  1NLZ A;  5DTK A;  2XR0 A;  2BAS A;  3OZH A;  5J8X A;  4BMW A;  4G3K A;  1CJF A;  3BEC A;  2CMN A;  3PBQ A;  2HGV A;  1S4R A;  4KUK A;  5F6A A;  5AVF A;  1TDG A;  3NDG A;  4C3Q A;  4OPQ A;  2C5W B;  5EM1 A;  4JF4 A;  1XA7 A;  1JWP A;  4GNU A;  4MN7 A;  2ZQA A;  1LSW A;  1CEF A;  4QY6 A;  2WKP A;  1P0Z A;  1SZV A;  4U0X A;  5A91 A;  3IBR A;  5TFQ A;  3T4K A;  3FKW A;  5CHU A;  4LV3 A;  2ZBB A;  1HZO A;  1VM1 A;  2XA7 M;  3BYD A;  4ZRR A;  3E4Q A;  3A3D A;  4JGO A;  4WZ5 A;  2P04 A;  4BBT A;  4N1X A;  2P08 A;  2JKR M;  3PYP A;  5JYO A;  4FUW A;  1NY0 A;  1FOF A;  2V1A A;  1EWZ A;  1IEL A;  1LL9 A;  3V39 A;  1YMX A;  1E4D A;  2PD7 A;  2EFX A;  3CMZ A;  1CEG A;  4KZA A;  3H82 A;  5E2G A;  1OTA A;  2XFT A;  4ESP A;  4E6X A;  1OTI A;  3H7W B;  2ZOH A;  3LIC A;  3GMW A;  4R0Q A;  3UPP A;  4WEJ A;  3Q07 A;  3KO6 A;  1LLB A;  3MF0 A;  1G5U A;  3MR0 A;  1OJG A;  1K6S A;  3ZQ5 A;  1BTL A;  2V2F F;  1N9B A;  2M7U A;  5M19 A;  1NRJ A;  4ZDX A;  5KSH A;  1TDL A;  1DJB A;  5TBM A;  4MNR A;  4EES A;  4OQH A;  1NRF A;  2KOI A;  2Y91 A;  4BBV A;  4CPK A;  2HP9 A;  2B02 A;  3Q7Z A;  2INW A;  4KEN B;  1MPL A;  2ZMF A;  4RA7 A;  3P09 A;  3UO9 A;  2ZD8 A;  3EGX C;  4DE2 A;  5DKK A;  1BYW A;  4EBL A;  2VGJ A;  4FH2 A;  5DJU A;  2PU2 A;  1W8Y A;  1DJA A;  4X56 A;  4EQI A;  3CPT B;  1K38 A;  3V5M A;  4HES A;  1ZKJ A;  3IF6 A;  3SS3 A;  2W3G A;  4DDS A;  4S2M A;  5EUA A;  2Y2H A;  1AXB A;  3OLO A;  3E4P A;  2ZQC A;  2WAF A;  3BJN A;  4KZ6 A;  2Y2Q A;  1JWV A;  1RP5 A;  4Z9Q A;  3BFD A;  1NZU A;  1STZ A;  2O9C A;  4BEN A;  1FIK A;  4FCF A;  5FQI A;  4QHC A;  1YLW A;  1L3L A;  2OLV A;  2A3U A;  1SDN A;  3T1Q B;  4PPR A;  4IVI A;  5GLD A;  2XQZ A;  3ITB A;  2XEP A;  1ESI A;  2ZM8 A;  2Z6C A;  1UWN X;  4Q8I A;  2AVX A;  5HFO A;  2WKE A;  4LCM A;  2D02 A;  1P9W A;  3MXQ A;  2X71 A;  2WKR A;  2WAE A;  3G35 A;  3ZG8 B;  3PR6 A;  3MFD A;  1SDE A;  3ZVW A;  3VP3 A;  3ZG0 A;  3P01 A;  4BBU A;  2WGV A;  2K2N A;  1VQQ A;  3MQ0 A;  1OT9 A;  2OWJ A;  2DRW A;  2Q9N A;  2HDQ A;  3EGD C;  3UPO A;  4BJP A;  4R3B A;  2Y2L A;  3VOL A;  2ZM0 A;  1K25 A;  2V8F A;  2P9V B;  3BFF A;  4QPR A;  4E3J A;  3DW0 A;  1I2S A;  2Y55 A;  4YFM A;  1ZG4 A;  2W1R A;  1G6A A;  5FA7 A;  1YQS A;  3FPV A;  3MQQ A;  2Z2L B;  5JYP A;  3L7H A;  3HRE A;  5FAP A;  2VJW A;  1K55 A;  3IS2 A;  5HW3 A;  2W1T A;  3UE6 A;  3E2K A;  4EUZ A;  3UNW A;  4CLC A;  2XH9 A;  2G2W A;  5KZH A;  3P7N A;  5A93 A;  4N92 A;  3C8C A;  5CHM A;  3D3O A;  1NLY A;  5CEB A;  4EER A;  4E3M A;  1H8Y A;  4OPY A;  4UHU A;  3EEA A;  3FC7 A;  3OCN A;  5DVA A;  4EU0 A;  1TD5 A;  3GVB A;  3LUQ A;  5CGX A;  4GCZ A;  2X01 A;  1BLH A;  3ZNY A;  3G32 A;  2WZZ A;  3MMH A;  2Y4A A;  1OTD A;  2EWV A;  2WGW A;  4ZBE A;  2HV1 A;  3UE0 A;  3QP5 A;  3F1P A;  5D3O A;  2XRO A;  3VP1 A;  2V0U A;  3RXX A;  1IKG A;  5HPF A;  1KOU A;  3RH8 B;  4HOI A;  1KE0 A;  1E3U D;  3MZD A;  4JGR A;  2JKT M;  1PI5 A;  4EV4 A;  3N6I A;  4ZJ1 A;  3MFX A;  3GQZ A;  2ZJ9 A;  3JYI A;  1PIO A;  3NIA A;  2GNX A;  4R3A A;  2I72 A;  3KSG A;  1ES2 A;  3W4O A;  1K54 A;  2EWW A;  2XLN A;  4HHD A;  5AQ7 A;  4HEF A;  5FDS A;  1W5D A;  3ICY A;  1JWZ A;  2ACG A;  3E4O A;  1L2S A;  3LYX A;  4LV0 A;  3G30 A;  4Y15 A;  1J3W A;  4DJ3 A;  2JHE A;  4EEP A;  2B95 A;  5FAQ A;  2PBD P;  1FCN A;  3IWI A;  3NEC A;  3OPP A;  3Q81 A;  4BD1 A;  3MSH A;  2H28 A;  2EX2 A;  3MZE A;  4L9G A;  2EXA A;  3DWK A;  4OOL A;  1I5Q A;  3GEC A;  1TS0 A;  2ZC5 B;  5GLC A;  3T50 A;  4DE1 A;  2W3E A;  1S0W A;  4YNR A;  3S7Q A;  5HZH A;  1XX2 A;  4E3L A;  2VGL S;  1VB6 A;  3RJU A;  5LBR A;  3DTI A;  1FCO A;  5HD3 A;  4NG2 A;  3ZVT A;  2GX5 A;  4KQD A;  3E98 A;  1XFN A;  1OME A;  1TS8 A;  5A8B A;  3ZHH A;  1G68 A;  3EQV A;  3G2Y A;  1M6K A;  2J3T C;  4JXW A;  4I5S A;  2HJ9 C;  2Q0O A;  4C75 A;  4DE0 A;  3TJZ C;  3QP2 A;  3TW8 A;  1K56 D;  1MKM A;  4S2N C;  5TGF A;  1PRQ A;  3QP4 A;  3S7P A;  1KGE A;  4GS9 B;  3FWL A;  3V50 A;  1ES4 A;  3WS1 A;  2XD5 A;  4G3V A;  2X02 A;  2EFU A;  4KZ3 A;  2QPN A;  2YKH A;  3A0R A;  3VE4 A;  1YMS A;  5E2F A;  2XSS A;  5GHZ A;  5L09 A;  4HP9 A;  2GZA A;  4HNB A;  3SS4 A;  3CAX A;  3G6O A;  2OSU A;  4X69 A;  2FH5 A;  4X68 A;  2BLS A;  1F98 A;  5F1G A;  1T1C A;  1T19 A;  4JGQ A;  2WKQ A;  4P6Z S;  3OPH A;  3JVV A;  1VEU B;  4ETZ A;  4PM9 A;  2A24 A;  4GDB A;  4PM5 A;  4HI4 A;  3G31 A;  5EVL A;  1FSY A;  4DJ2 A;  4GOG A;  4WUJ A;  5HDS A;  5TJJ A;  3PHY A;  5HDD A;  3UDX A;  1TS6 A;  4LRY C;  5KMW A;  2ZM2 A;  1GHP A;  1D1J A;  1DP9 A;  3LI8 A;  1CI8 A;  1PW1 A;  2ZQD A;  2H10 A;  2W3F A;  3NOT C;  5GLB A;  2FZ0 A;  1OJ5 A;  3VP0 A;  1XFQ A;  3LIF A;  2KX6 A;  2OAQ 1;  3IH9 A;  4K91 A;  2R9X A;  4Y3I A;  3EWK A;  3V3R A;  1HVB A;  3CUE C;  1XGI A;  4Y0U A;  5GHY A;  3ISG A;  2PBY A;  4OP5 A;  2G7U A;  5HL6 A;  1IYQ A;  3A3I A;  3C4O A;  3SZT A;  3SS5 A;  3QHY A;  4S2O A;  1HLU P;  2JKG A;  5EOE A;  1K0K A;  4OQ0 A;  3VFH A;  4WL9 A;  2OOL A;  3IWQ A;  3H82 B;  5HL1 A;  3IHA A;  5CHJ A;  1XJ3 A;  1GSX A;  4EBN A;  5FI6 A;  4HBU A;  2O9A A;  1E3U A;  1H3Q A;  1GSW A;  3N8R A;  2VGL M;  4K0X A;  4DDY A;  4EWF A;  5FQJ A;  1XJ6 A;  4GHI B;  2W27 A;  3NHQ A;  4WBG A;  1E25 A;  5FAS A;  1TVF A;  3UN7 A;  1UWP X;  1L0F A;  1N9O A;  2WZX A;  5HD5 A;  4X55 A;  4XUZ A;  5TBM B;  3MBZ A;  4P0M A;  2VA0 A;  3WWX A;  1ONH A;  1JVJ A;  3A3E A;  1LHY A;  4KQQ A;  3S7N A;  2V8C A;  1OT6 A;  2A49 A;  3TG9 A;  1L0E A;  4LPZ A;  1MWS A;  1NJ4 A;  1S4S A;  2VLG A;  3VOZ A;  2A2L A;  3EOI A;  4B88 A;  4JXG A;  2PR6 A;  4WYY A;  1L0D A;  5FDH A;  3ZYT A;  4RYE A;  2PT7 A;  3IF6 B;  3PBN A;  2JKF A;  3Q82 A;  1G28 A;  4UA6 A;  3QP6 A;  3OPR A;  4PHT A;  3ZDJ A;  2JCH A;  4N1H A;  4P6Z M;  4HBT A;  3BY8 A;  1TF1 A;  3IX8 A;  4CJN A;  4LFU A;  4R6L A;  1L0G A;  1XA1 A;  2JKR I;  3EQU A;  3KYE A;  5FEF A;  4PMA A;  3VP4 A;  3GR2 A;  5GHX A;  1WYB A;  5L07 A;  3BQ8 A;  4UA7 A;  3T4Q A;  5HAQ A;  3NDE A;  1K4F A;  3LR3 A;  4MN5 A;  1V9Y A;  4WZ4 A;  2H0T A;  1IOU A;  4MBF A;  1GSV A;  2H0Y A;  2Y8H A;  3MKE A;  2OWH A;  2J9P A;  3O88 A;  4KZ8 A;  1K57 C;  4B4Z A;  4JXS A;  3UE1 A;  4RQ9 A;  3C7U A;  4CLC E;  3BQA A;  2QKP A;  4P87 A;  3C38 A;  3ZG9 B;  1KDW A;  5FEG A;  2PYR A;  1H8Z A;  4X25 A;  1YSP A;  1GA0 A;  2IWB A;  4YWZ A;  3MQO A;  4G3W A;  1PZP A;  4L9F A;  5CGW A;  4S2K A;  4Y5F A;  4EQ1 A;  2XRN A;  4B9O A;  4O0P A;  1JNU A;  3IH8 A;  1QME A;  2PR5 A;  3NI9 A;  5F83 A;  3A0S A;  3H7W A;  1H0M A;  3PBO A;  4E3K A;  3HUN A;  4HIA A;  2HPB A;  4RVA A;  2ZQ9 A;  2O99 A;  4GW9 A;  1IKI A;  3IS2 B;  3MJQ A;  1BZA A;  2OAP 1;  5U47 A;  1PYY A;  4QD4 A;  3IXB A;  3DTM A;  1FR1 A;  1LT0 A;  2WUQ A;  4CLC B;  4NK3 A;  5CTM A;  2KLI A;  3D4F A;  1LI9 A;  2FFF B;  4EW7 A;  1GHI A;  1OTB A;  4F94 A;  3HLF A;  1F9I A;  2P74 A;  2M7V A;  4XUX A;  2YKF A;  2ZC6 B;  3BRM A;  1J9M A;  4O8G A;  2XD1 A;  4B4X A;  5CEC A;  4I38 A;  3TRC A;  4QJG A;  3HLD A;  3BFC A;  4RX2 A;  3K3C A;  2NUP C;  3FKV A;  4I3J A;  4ZJ3 A;  1Q2P A;  2H5S A;  2Y59 A;  4FD8 A;  4WLA A;  4I3A A;  4XT2 B;  4ZAM A;  3LIE A;  4R23 A;  4K08 A;  3F1P B;  3FPW A;  4H8R A;  4LV1 A;  3GTC A;  2OV5 A;  4A5R A;  1P97 A;  4HH2 A;  1DP6 A;  3A3F A;  1YPR A;  2EX6 A;  4PM6 A;  3W2Z A;  5A92 A;  2JBF A;  4PM7 A;  2UV0 E;  2HDR A;  4F3L A;  5EVI C;  3RXW A;  2J8Y A;  4DMZ A;  3RTY A;  1I2W A;  3WS5 A;  3AGF A;  4R3J A;  5J7E A;  3LID A;  3LIA A;  2Y2G A;  2NUT C;  4WEL A;  4DN0 A;  1NZO A;  3TSG A;  1PFL A;  1FCM A;  3IT9 A;  2CC1 A;  3UMD A;  4WN5 A;  3ZCZ A;  4ZJ2 A;  3OPL A;  2C6W B;  4OON A;  1N4O A;  3HLB A;  4OKP A;  5FAT A;  4IUH A;  2R9W A;  5FAO A;  4C6Y A;  4NET A;  4FH4 A;  1MZU A;  1W63 Q;  3HCY A;  2Y2O A;  3G2Z A;  3KX0 X;  2V1B A;  1GA9 A;  1NYM A;  3VFF A;  4S2P A;  2P9V A;  1HTZ A;  3NC8 A;  4DXC A;  3HJK A;  1FIL A;  2KDK A;  1N9L A;  5EE8 A;  1PI4 A;  1N9N A;  3T12 B;  3F1N A;  3LCE A;  1K4E A;  1BUE A;  2Y79 A;  5DF8 A;  5L2F A;  4JF5 A;  5IHV A;  3LR5 A;  1FSW A;  3ZG7 B;  4BLM A;  1Q2Q A;  5G18 A;  3IXD A;  2L0W A;  5CXW A;  3T1R A;  5HWW A;  1LI0 A;  4KUO A;  3O87 A;  3HLC A;  3PAG A;  3HLE A;  5KSC A;  2JKT I;  3M6H A;  5EVI B;  1SKO A;  2J3T D;  3SH8 A;  3MXR A;  4S2J A;  3B33 A;  2JC7 A;  4CQH A;  2W3D A;  4HJ3 A;  2VZW A;  2A24 B;  4GDN A;  4WZ5 C;  2M1C A;  1MWU A;  2Y2J A;  2WKH A;  3HLW A;  2J7V A;  1KVL A;  3QNB A;  3G4P A;  4H6J A;  3BFE A;  1VET B;  2QWS A;  2J80 A;  5DTT A;  4R4R A;  2UWX A;  1D7E A;  3G34 A;  5HSQ A;  3R7W A;  5FI2 A;  5DJT A;  1T1B A;  3F1O A;  3D9Y A;  4Q0J A;  1XP4 A;  3LFV A;  3LY3 A;  4D2O A;  3B3X A;  2L4R A;  5EPH A;  4OOM A;  4XXR A;  1IYO A;  1YKD A;  3PAE A;  4B93 A;  2ZMV A;  5FI7 A;  3GRJ A;  2QZ6 A;  4OQI A;  3S7O A;  4HJ4 A;  5E43 A;  3VSL A;  4AFI A;  4UAA A;  5J4E A;  2XFS A;  1ES5 A;  1DY6 A;  3M2J A;  2ZC4 B;  2R78 A;  2K7S A;  5F1F A;  3EEH A;  3FG8 A;  5DFX A;  2P7J A;  2WYX A;  3JPU A;  3UB9 A;  3ITA A;  2W3H A;  4ID4 A;  3IX4 A;  3V67 A;  2PAV P;  3I7J A;  1JTD A;  3KSF A;  1CI9 A;  3LIB A;  2L1M A;  1S66 L;  1XJ2 A;  4O7D A;  4Q0H A;  1JTG A;  1Y28 A;  1ONG A;  4HJ6 A;  1WA9 A;  3T4S A;  4IBR A;  3CWF A;  2ZOI A;  1DRM A;  1AWI A;  4JF6 A;  3GSG A;  3PTE A;  1LSV A;  4X1L A;  3IF6 C;  2VK3 A;  4O01 A;  1YT4 A;  1XXM A;  3T4O A;  1W79 A;  1BLC A;  3T4T A;  5DFY A;  1YLY A;  2LB9 A;  2HF6 A;  2XF3 A;  3UY6 A;  4ZTK A;  5CER A;  2QHK A;  3VSK A;  1KGG A;  3CI6 A;  3DAV A;  4MMN A;  1KDS A;  3V3S A;  4E3I A;  3HVF A;  2V0W A;  3B47 A;  3S4X A;  5GL9 A;  5I5L A;  1X0O A;  2ZLY A;  4Y13 A;  1ERO A;  4LEN A;  2IWC A;  3NY4 A;  2VEA A;  5FL3 A;  3DTE A;  4M4X A;  5CED A;  2XGN A;  1ERQ A;  1MC0 A;  3VP2 A;  3C2W A;  1YLP A;  1VEU A;  5M1A A;  4OP8 A;  4M3K A;  2ZQ7 A;  1Y54 A;  2B5R A;  4JGP A;  4PKY A;  1H8M A;  2EX9 A;  3WS4 A;  4OLG A;  4HQA A;  2ZL1 A;  2MJ6 A;  1YM1 A;  3UDF A;  2PRF A;  3C30 A;  3Q7V A;  3ULF A;  1SKF A;  3OOV A;  2EXB A;  3VV4 A;  3DTK A;  1MBL A;  4NXF A;  2HDS A;  4E6W A;  1Z6F A;  5AQB A;  3RFB A;  3BW6 A;  2VX8 A;  4UEY A;  4CLC D;  1OTE A;  1K6R A;  1IFQ A;  3DBA A;  1WE4 A;  1RGY A;  2V20 A;  3KSI A;  1K55 C;  4IHQ A;  3M2K A;  3T4J A;  4R70 A;  3IWO A;  3S22 A;  3CZD A;  4ARZ A;  4KQO A;  3VOY A;  5E2E A;  1CF0 A;  3IBJ A;  4CLC C;  1ALQ A;  4LGW A;  5C5K A;  3OC2 A;  3IF5 A;  5M18 A;  2QYB A;  4KZ5 A;  3UDI A;  4X53 A;  3UB5 P;  4S2N A;  2B18 A;  4DXB A;  5HAP A;  4S2I A;  1XJ4 A;  1SCW A;  3W8K A;  4DE3 A;  5A90 A;  1O7E A;  5DTS A;  1G6O A;  5G4Z A;  4KZ9 A;  1K56 A;  3CG5 A;  1YSQ A;  5TR7 A;  4LLO B;  3PXP A;  5IS1 A;  1GHM A;  3SH7 A;  4OVD A;  5E2H A;  4NXG A;  3NOU C;  4II7 A;  3BY9 A;  3L9K A;  2DNS A;  1YAX A;  2E8J A;  4GJ4 A;  4BD0 A;  3PBT A;  1PWD A;  2O0Y A;  4GHI A;  1A0K A;  4Y2F A;  4X1M A;  1BSG A;  1D06 A;  4ME4 A;  3HLG A;  4MLL A;  1HD8 A;  4U3T A;  4UA9 A;  2Z2M B;  4IBX A;  1S1Y A;  2VKS A;  4WMC D;  1RGZ A;  1UGU A;  1NYY A;  3CLO A;  5FQQ A;  5FSR A;  3NOP C;  3BM6 A;  3CJM A;  2GDN A;  4Q0I A;  1K54 C;  2XK1 A;  3LO7 A;  4GD8 A;  4MEZ A;  4U0T A;  1KE3 A;  5K5B A;  1KE4 A;  3UB6 A;  3MS6 A;  4I3I A;  5AVE A;  1ESU A;  3ZFZ A;  3SH9 A;  3LEZ A;  2ZC7 A;  4OLD A;  4FTX A;  4IUK A;  5BOH A;  1ZHH B;  3GDI A;  3KYZ A;  3HL9 A;  2Y2I A;  3SW1 A;  3CUE A;  3S1Y A;  1FR6 A;  3TOI A;  4KQR A;  4WEK A;  2ZMA A;  4BL2 A;  2W1T B;  5KIZ A;  1SHV A;  4BL3 A;  3BLS A;  1PWG A;  5HAR A;  3N8S A;  4OQG A;  4EXO A;  3QP8 A;  4F3L B;  3DWZ A;  4KG2 A;  4PAU A;  4ETX A;  4EBP A;  4KZ7 A;  3SOI A;  3UE3 A;  3U2A A;  3WRZ A;  3T1S A;  1ZC2 A;  1BLP A;  1TEM A;  4OH0 A;  2VGK A;  2W0N A;  5HX9 A;  4LRZ E;  4P6B A;  1Y4O A;  2Q9M A;  4N9L A;  1ZG6 A;  2WK0 A;  1YLJ A;  1W63 M;  3FYZ A;  3GV9 A;  1MWR A;  1EI5 A;  3C7V A;  3B42 A;  3CIT A;  2FFY A;  2WGW B;  4IJG A;  5HWT A;  3CPT A;  4FOF A;  1MY8 A;  4IED A;  4GLQ A;  3AGD A;  3WS2 A;  2IA2 A;  2XDM A;  4MDZ A;  5EVI D;  4RX3 A;  2PU4 A;  5CX7 A;  5IU1 A;  3UB7 A;  2BG1 A;  4OOY A;  3HJI A;  4NEE D;  2Y2M A;  4YOF A;  4MN6 A;  1ES3 A;  5F68 A;  3F1N B;  2VV6 A;  5FQM A;  4JBF A;  2PYP A;  2QMI A;  1RCJ A;  4QU3 A;  4R4S A;  3E0Y A;  3WS0 A;  4E04 A;  3U4L P;  1H5X A;  1LSX A;  2ZQ8 A;  3K2N A;  1OPX A;  2DCF A;  1CQA A;  4LV2 A;  4JXV A;  1IEM A;  2HP6 A;  3MKF A;  3A3J A;  1W8Q A;  4YIN A;  1M40 A;  3CHW P;  4JPM A;  4N9K A;  3UB8 A;  4QWO A;  3N8L A;  4MBH A;  3H9W A;  1T18 A;  2JN7 A;  5F82 A;  3ZNT A;  3P98 A;  4NXB A;  1F2K A;  4NXE A;  3MXS A;  3LR0 A;  4X6T A;  4LRX C;  1SKO B;  1DP8 A;  3T4L A;  3K3D A;  2J3W A;  1LL5 A;  3JVU A;  5EOO A; 
#chains in the Genus database with same CATH homology
 4X55 A;  4XUZ A;  3MBZ A;  4P0M A;  1C3B A;  2A3U A;  1SDN A;  5E43 A;  4GZB A;  3VSL A;  4PPR A;  4IVI A;  4UAA A;  5HAI A;  3IQA A;  5GLD A;  2XFS A;  1ES5 A;  2XQZ A;  3ITB A;  1DY6 A;  2XEP A;  3C5A A;  3M2J A;  1ONH A;  1JVJ A;  2ZC4 B;  1LHY A;  3A3E A;  4KQQ A;  3WWX A;  4E3O A;  3W4Q A;  1ESI A;  5F1F A;  2A49 A;  2ZM8 A;  4Q8I A;  3TG9 A;  1L0E A;  4QY5 A;  5HFO A;  2WKE A;  4LCM A;  1K57 A;  1MWS A;  1CK3 A;  1NJ4 A;  2X71 A;  2WYX A;  3VOZ A;  4BQM A;  3N4I A;  3ITA A;  2ZC3 B;  4Y0O A;  4ID4 A;  2WAE A;  3G35 A;  4B88 A;  3ZG8 B;  4JXG A;  3BEB A;  3I7J A;  3WRT A;  4WYY A;  1L0D A;  1IYS A;  5FDH A;  1JTD A;  1PW8 A;  1CI9 A;  3MFD A;  4DRT A;  1XPB A;  4RYE A;  4O7D A;  1SDE A;  3BLM A;  5CRF A;  3ZVW A;  1JTG A;  3IF6 B;  1KGF A;  3PBN A;  1ONG A;  3VP3 A;  3N7W A;  4IBR A;  5DF9 A;  3Q82 A;  3ZG0 A;  3ZG5 A;  4KG6 A;  4JF6 A;  3GSG A;  2WGV A;  1YLT A;  3HUO A;  3PTE A;  2Y2P A;  4UA6 A;  4WMC A;  3C4P A;  1VQQ A;  3IF6 C;  3IXH A;  2Q9N A;  2DRW A;  3OPR A;  3ZDJ A;  2HDQ A;  1YT4 A;  1XXM A;  3UPO A;  4BJP A;  1W79 A;  4R3B A;  4WM9 A;  1MWT A;  2JCH A;  2Y2L A;  4N1H A;  1BLC A;  4FSF A;  2ZM0 A;  4HBT A;  1K25 A;  1YLY A;  5AQA A;  2P9V B;  3BFF A;  5CTN A;  4E3J A;  3OCL A;  2XF3 A;  3DW0 A;  3UY6 A;  3HUM A;  4CJN A;  1I2S A;  4ZTK A;  2Y55 A;  5CER A;  4YFM A;  1ZG4 A;  3VSK A;  5FQ9 A;  1G6A A;  3VMA A;  1L0G A;  1XA1 A;  3EQU A;  5FA7 A;  1KGG A;  1YQS A;  4GN2 A;  2Z2L B;  4PMA A;  3VP4 A;  1KDS A;  3GR2 A;  3V3S A;  5JYP A;  5GHX A;  1WYB A;  1DJC A;  4E3I A;  3HRE A;  3O86 A;  3HVF A;  5FAP A;  4UA7 A;  5HAQ A;  3S4X A;  3NDE A;  5GL9 A;  2WAD A;  1K55 A;  1K4F A;  2ZLY A;  1ERO A;  4WZ4 A;  5HW3 A;  4DKI A;  2H0T A;  4LEN A;  2IWC A;  4LCL A;  4MBF A;  3E2K A;  2H0Y A;  3FV7 A;  3NY4 A;  3MKE A;  4EUZ A;  3UNW A;  5CED A;  2J9P A;  2XH9 A;  3O88 A;  4GKU A;  4K0W A;  4KZ4 A;  1K57 C;  3MZF A;  4KZ8 A;  4JXS A;  5FQK A;  3UE1 A;  2G2W A;  4B4Z A;  5KZH A;  4IVK A;  3C7U A;  2XGN A;  1ERQ A;  1XGJ A;  5A93 A;  3VP2 A;  4N92 A;  4P87 A;  5CHM A;  1YLP A;  2Y2K A;  5M1A A;  3ZG9 B;  4OP8 A;  5CEB A;  4E3M A;  1H8Y A;  1KDW A;  1U60 A;  4OPY A;  4JLF A;  4M3K A;  3LY4 A;  2ZQ7 A;  4UHU A;  1Y54 A;  2B5R A;  2WKI A;  3OCN A;  1H8Z A;  5DVA A;  3GVB A;  2IWB A;  1GA0 A;  5GLA A;  2JE5 A;  4L0L A;  1PZP A;  5CGX A;  2EX9 A;  3WS4 A;  3PBR A;  5CGW A;  2X01 A;  4OLG A;  1BUL A;  4S2K A;  1BLH A;  1YM1 A;  3ZNY A;  3IH8 A;  3UDF A;  3G32 A;  1QME A;  3NI9 A;  3Q7V A;  3QNC A;  5F83 A;  2WZZ A;  1SKF A;  1IYP A;  2Y4A A;  3PBO A;  1BLS A;  4E3K A;  3HUN A;  2EXB A;  2HPB A;  4RVA A;  2ZQ9 A;  1MBL A;  2J9O A;  2HDS A;  2WGW A;  4ZBE A;  3UE0 A;  4E6W A;  1IKI A;  1YLZ A;  4E3N A;  4JKT A;  1BZA A;  1Z6F A;  5AQB A;  4R1G A;  4GB7 A;  4QB8 A;  3ZGA B;  5D3O A;  3VP1 A;  1XKZ A;  2G2U A;  4PM8 A;  5U47 A;  1PYY A;  4QD4 A;  3IXB A;  1QMF A;  1IKG A;  1GCE A;  3BFG A;  3RXX A;  3DTM A;  4KZB A;  1K6R A;  1FR1 A;  1WE4 A;  1RGY A;  2V20 A;  1KVM A;  1K55 C;  2WUQ A;  3M2K A;  4NK3 A;  5CTM A;  2HDU A;  3D4F A;  1KE0 A;  1E3U D;  3MZD A;  4GD6 A;  1LI9 A;  5EVI A;  2HP5 A;  2FFF B;  3IWO A;  1GHI A;  4F94 A;  3HLF A;  3NBL A;  3S22 A;  1PI5 A;  4EV4 A;  3CZD A;  3N6I A;  2P74 A;  4ZJ1 A;  3GQZ A;  4KQO A;  2ZJ9 A;  3JYI A;  4XUX A;  1PIO A;  3M6B A;  5E2E A;  1PWC A;  3VOY A;  2ZC6 B;  1ALQ A;  3NIA A;  3BRM A;  3IHB A;  1WYC A;  1J9M A;  2I72 A;  2XD1 A;  4B4X A;  3OC2 A;  5CEC A;  1ES2 A;  3IF5 A;  3W4O A;  5M18 A;  1K54 A;  1MXO A;  4KZ5 A;  1S6R A;  3UDI A;  2XLN A;  1O07 A;  5AQ7 A;  4QJG A;  4OPZ A;  4HEF A;  4X53 A;  4P85 A;  3HLD A;  4S2N A;  1W5D A;  3BFC A;  4MBK A;  4RX2 A;  4Y0T A;  4DXB A;  5HAP A;  4OPR A;  1JWZ A;  4S2I A;  3Q1F A;  1L2S A;  1SCW A;  3G30 A;  4LV0 A;  3FKV A;  3W8K A;  4DE3 A;  1W7F A;  5A90 A;  3HBR A;  5FAQ A;  4ZJ3 A;  1O7E A;  1Q2P A;  2H5S A;  2Y59 A;  5CGS A;  2RL3 A;  4Y7P A;  4FD8 A;  3FZC A;  5DTS A;  3Q7V B;  1BT5 A;  2EX8 A;  4KZ9 A;  1K56 A;  3CG5 A;  1FCN A;  2WGI A;  3E2L A;  1FQG A;  3IWI A;  3NCK A;  3OPP A;  3Q81 A;  5EEC A;  5TR7 A;  4BD1 A;  3W4P A;  4ZAM A;  1NXY A;  2EX2 A;  3MZE A;  4R23 A;  1GHM A;  2EXA A;  3SH7 A;  4OVD A;  3DWK A;  5E2H A;  4OOL A;  3UPN A;  2DNS A;  1I5Q A;  3PBS A;  2ZC5 B;  3IXG A;  4H8R A;  4LV1 A;  3GTC A;  4BD0 A;  5DF7 A;  2OV5 A;  3PBT A;  1PWD A;  5GLC A;  4DE1 A;  4A5R A;  1S0W A;  1MKI A;  4S2L A;  1BSG A;  1XX2 A;  3A3F A;  4E3L A;  3HLG A;  4MLL A;  2IWD A;  2V1Z A;  2EX6 A;  4PM6 A;  5A92 A;  1HD8 A;  3AGE A;  2E8I A;  2OLU A;  4KG5 A;  4U3T A;  4DF6 A;  3O3V A;  3RJU A;  4UA9 A;  5AQ9 A;  2JBF A;  2Z2M B;  2Y2N A;  1FCO A;  4IBX A;  2RCX A;  1PZO A;  3ZVT A;  4PM7 A;  5I94 A;  2HDR A;  1ERM A;  1OME A;  5EVI C;  4WMC D;  5DTK A;  2XR0 A;  1RGZ A;  3RXW A;  3OZH A;  5J8X A;  1NYY A;  3ZHH A;  2J8Y A;  5FQQ A;  1G68 A;  3EQV A;  3G2Y A;  1M6K A;  1I2W A;  5FSR A;  3WS5 A;  3BM6 A;  3BEC A;  3AGF A;  3PBQ A;  4JXW A;  3CJM A;  2GDN A;  4C75 A;  4DE0 A;  4R3J A;  1K54 C;  2XK1 A;  3LO7 A;  4GD8 A;  4MEZ A;  1K56 D;  2Y2G A;  4U0T A;  1KE3 A;  4WEL A;  1KE4 A;  1NZO A;  3TSG A;  4S2N C;  1TDG A;  5TGF A;  1FCM A;  1ESU A;  3IT9 A;  2CC1 A;  3NDG A;  1KGE A;  3ZFZ A;  3FWL A;  3V50 A;  3ZCZ A;  4ZJ2 A;  1ES4 A;  3SH9 A;  4C3Q A;  3WS1 A;  3OPL A;  4OPQ A;  3LEZ A;  2C6W B;  4OON A;  2XD5 A;  1N4O A;  2C5W B;  3HLB A;  4OKP A;  2ZC7 A;  5FAT A;  2X02 A;  2EFU A;  2R9W A;  4JF4 A;  1XA7 A;  2QPN A;  1JWP A;  4KZ3 A;  5FAO A;  4NET A;  4C6Y A;  4FH4 A;  1YMS A;  4OLD A;  4GNU A;  5E2F A;  5GHZ A;  5BOH A;  3HL9 A;  2Y2I A;  2Y2O A;  2ZQA A;  3G2Z A;  3S1Y A;  1FR6 A;  1CEF A;  3TOI A;  4KQR A;  3SS4 A;  4QY6 A;  2ZMA A;  4WEK A;  1GA9 A;  4BL2 A;  4U0X A;  5A91 A;  1NYM A;  5TFQ A;  3VFF A;  4S2P A;  4X69 A;  2OSU A;  3FKW A;  5CHU A;  1SHV A;  2P9V A;  1HTZ A;  4X68 A;  4LV3 A;  4BL3 A;  3NC8 A;  3BLS A;  2BLS A;  4DXC A;  1PWG A;  5HAR A;  3N8S A;  1HZO A;  4OQG A;  5F1G A;  5EE8 A;  1VM1 A;  3DWZ A;  4KG2 A;  3BYD A;  1PI4 A;  4KZ7 A;  4EBP A;  3A3D A;  3SOI A;  3UE3 A;  4WZ5 A;  3WRZ A;  3OPH A;  1ZC2 A;  1BLP A;  4N1X A;  1TEM A;  4OH0 A;  2VGK A;  1K4E A;  3LCE A;  4PM9 A;  4GDB A;  5JYO A;  4PM5 A;  1BUE A;  1NY0 A;  5DF8 A;  1FOF A;  5HX9 A;  5L2F A;  4JF5 A;  1EWZ A;  1IEL A;  5IHV A;  3G31 A;  5EVL A;  1LL9 A;  3V39 A;  1YMX A;  1FSY A;  1E4D A;  1FSW A;  3ZG7 B;  2EFX A;  3CMZ A;  4P6B A;  1CEG A;  4BLM A;  4GOG A;  2Q9M A;  4N9L A;  1Q2Q A;  5G18 A;  3IXD A;  3UDX A;  1ZG6 A;  4KZA A;  2WK0 A;  5CXW A;  5E2G A;  5KMW A;  2ZM2 A;  1GHP A;  1CI8 A;  2XFT A;  1YLJ A;  4E6X A;  1PW1 A;  3FYZ A;  3GV9 A;  1MWR A;  2ZQD A;  1EI5 A;  1LI0 A;  3C7V A;  2H10 A;  5GLB A;  2FFY A;  2WGW B;  3GMW A;  4R0Q A;  3O87 A;  1MY8 A;  4IED A;  3VP0 A;  3UPP A;  3IH9 A;  4WEJ A;  3HLC A;  2R9X A;  3Q07 A;  4K91 A;  1LLB A;  3AGD A;  3WS2 A;  3PAG A;  2XDM A;  5EVI D;  4RX3 A;  2PU4 A;  3V3R A;  1K6S A;  2BG1 A;  3HLE A;  1HVB A;  4OOY A;  1BTL A;  5KSC A;  1XGI A;  4Y0U A;  3M6H A;  5GHY A;  5EVI B;  2Y2M A;  2V2F F;  3SH8 A;  3ISG A;  2PBY A;  4OP5 A;  3MXR A;  1ES3 A;  4S2J A;  1N9B A;  5M19 A;  2JC7 A;  4ZDX A;  5KSH A;  1TDL A;  1IYQ A;  1DJB A;  5FQM A;  4JBF A;  3A3I A;  2QMI A;  4MNR A;  3C4O A;  4GDN A;  4OQH A;  1RCJ A;  4QU3 A;  1NRF A;  4R4S A;  2Y91 A;  4WZ5 C;  3SS5 A;  3QHY A;  4CPK A;  1MWU A;  2HP9 A;  3Q7Z A;  3WS0 A;  2Y2J A;  2WKH A;  1H5X A;  3HLW A;  4KEN B;  2J7V A;  4S2O A;  1MPL A;  4RA7 A;  3P09 A;  5EOE A;  1KVL A;  3QNB A;  3G4P A;  3UO9 A;  2ZD8 A;  4OQ0 A;  2ZQ8 A;  3VFH A;  3BFE A;  4DE2 A;  3IWQ A;  2DCF A;  4EBL A;  2VGJ A;  4FH2 A;  5HL1 A;  3IHA A;  4LV2 A;  4JXV A;  2PU2 A;  5CHJ A;  5DTT A;  4R4R A;  1IEM A;  4EBN A;  2UWX A;  2HP6 A;  1W8Y A;  3MKF A;  3G34 A;  3A3J A;  5FI6 A;  1W8Q A;  1DJA A;  4X56 A;  4YIN A;  4HBU A;  1E3U A;  4EQI A;  1M40 A;  4JPM A;  5FI2 A;  1K38 A;  3V5M A;  4HES A;  4N9K A;  1ZKJ A;  3IF6 A;  3SS3 A;  4DDS A;  3N8R A;  1XP4 A;  3N8L A;  4K0X A;  4MBH A;  4S2M A;  5EUA A;  3LY3 A;  5F82 A;  4D2O A;  3B3X A;  3ZNT A;  2Y2H A;  4DDY A;  3P98 A;  4EWF A;  1AXB A;  5FQJ A;  5EPH A;  3MXS A;  4OOM A;  2ZQC A;  2WAF A;  4XXR A;  4X6T A;  4KZ6 A;  1IYO A;  1JWV A;  1RP5 A;  2Y2Q A;  4Z9Q A;  3BFD A;  3PAE A;  4WBG A;  1NZU A;  1E25 A;  5FAS A;  4BEN A;  1TVF A;  4FCF A;  5FI7 A;  3UN7 A;  5FQI A;  1L0F A;  2WZX A;  2QZ6 A;  3GRJ A;  4OQI A;  4QHC A;  1YLW A;  1LL5 A;  2OLV A;  5EOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...