4P6BA

Crystal structure of est-y29,a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
390
structure length
386
Chain Sequence
SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Est-Y29
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
total genus 119
structure length 386
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p6bA00
1CK3A 3PBSA 1QMFA 3S4XA 4OOLA 3MFDA 4MNRA 4GN2A 4N9KA 5CECA 4HESA 4P6BA 1K54A 1FSWA 1QMEA 3UE0A 4LENA 3Q82A 4KZAA 4BL3A 2XR0A 1LI9A 1IEMA 1KGFA 2EX6A 3IF6B 2R9XA 1Q2QA 4R0QA 4XUZA 5HFOA 3ZG7B 4S2LA 2XLNA 4IEDA 1W8QA 5EPHA 3V3SA 2WKHA 1DJAA 4OP5A 2IWCA 1KE4A 5CGWA 1Y54A 3HLFA 3VP4A 4CJNA 2WADA 3HREA 2WK0A 3G2ZA 5G18A 3UDXA 3IWIA 2X71A 4RX3A 1SCWA 4S2PA 4MBKA 4UA9A 1JTDA 2IWBA 2Y2JA 3UY6A 1YQSA 3M2JA 2ZLYA 1U60A 3IXHA 1HVBA 4R4RA 3UDFA 4R3JA 3Q7ZA 1IYOA 4Z9QA 4DE3A 4RVAA 3IT9A 3FWLA 4QB8A 2G2WA 3DTMA 1BULA 4Y0OA 1FR6A 5CXWA 4B4XA 2XQZA 4PM9A 1LL9A 3PBOA 3MXSA 3LEZA 4MLLA 4DDSA 1ES5A 5FASA 1GA0A 3BEBA 4N9LA 1BTLA 3VFFA 1DJBA 3OZHA 4LCMA 4MBHA 4R4SA 4X53A 5KSHA 4OPYA 5EE8A 3PAGA 2EXBA 3WS4A 1NZUA 2ZC3B 3E2LA 2EX8A 3SH7A 2G2UA 2H0TA 2ZC5B 3QNCA 3V5MA 1Z6FA 3FKVA 1PZOA 4KZ8A 4GZBA 3C7VA 5DTKA 3WS1A 3VP2A 1L0FA 4L0LA 1LLBA 4PMAA 3AGEA 4WZ4A 3ZNTA 4JPMA 2WKEA 5I94A 5EOOA 5FQJA 5DVAA 2Z2LB 4U0XA 5EVIB 3GV9A 3IF6C 4Y0UA 1PW8A 3HUOA 1EWZA 3LCEA 4UAAA 3N4IA 4RX2A 1S6RA 1NXYA 1IYSA 3W4QA 3N6IA 2B5RA 4LV3A 1ONGA 4S2KA 5GLCA 3RJUA 1CEGA 3FKWA 3Q7VB 1YLYA 4WZ5A 4KZBA 1GA9A 1MWUA 3OCLA 4LV0A 4GDBA 3RXWA 2Y2PA 2WYXA 3G31A 3MXRA 4JF6A 4KZ9A 5DF7A 2HDSA 3LO7A 3DW0A 2XD5A 4U3TA 4DE2A 1KDSA 2OLVA 1MY8A 1IKGA 1KVMA 4X68A 1NZOA 4DRTA 5M18A 3ZDJA 4IVIA 1E3UD 1H5XA 1KVLA 3QHYA 3NIAA 5CHUA 5TR7A 1K6SA 1FOFA 3N7WA 4N92A 1K55A 1DJCA 4QD4A 4PM6A 5CRFA 4OQHA 3ZG5A 4B4ZA 2WAFA 3ZVWA 5F1FA 5CHMA 2Y2OA 3IXDA 5DF9A 2EXAA 4N1HA 2VGJA 5TFQA 1SKFA 3OPLA 3NDGA 4KQOA 1PYYA 2XEPA 3IF5A 4PM8A 4HEFA 5JYPA 1N9BA 4H8RA 3BLMA 4RYEA 2HP6A 3S1YA 3HLCA 4UA6A 4GD6A 3BYDA 3PBRA 2Y2GA 2ZC6B 2H0YA 1K6RA 1IKIA 3NCKA 5FQKA 1J9MA 5BOHA 5AQ7A 2ZC4B 4S2NA 2WKIA 3VP0A 3GTCA 3HUNA 4JF5A 4OQ0A 1BLCA 1M6KA 5AQBA 4YINA 2V1ZA 1GHPA 1L0DA 1S0WA 3GSGA 2WGWA 1PW1A 1RGZA 5EVIC 1JWVA 4GNUA 2ZM2A 3HLBA 4HBTA 2XFSA 2V20A 1K57A 3CMZA 5KSCA 4MBFA 2Y4AA 3PBTA 3FV7A 1ERQA 4P85A 3MBZA 1RCJA 4X56A 4XUXA 2C6WB 4FSFA 4OKPA 1WYCA 1K25A 3G2YA 3IXBA 3LY4A 5A93A 3NY4A 2ZJ9A 4OQIA 4S2MA 1M40A 4BL2A 1E25A 5HW3A 3W8KA 3DWZA 4XXRA 1H8YA 2P9VA 5E2GA 3A3EA 3VMAA 1ALQA 1SDNA 4E3OA 4WMCA 3O3VA 1YLJA 1NYMA 4EWFA 3UE1A 3PBQA 3UE3A 4ZDXA 4WMCD 3OCNA 3S22A 4WEJA 3UPPA 3UNWA 5CERA 2JBFA 1MWSA 3ZHHA 4ZBEA 1I2SA 3VSKA 4GDNA 4BLMA 4ZJ2A 4GOGA 4WM9A 1OMEA 1VM1A 5FQ9A 4DDYA 2WUQA 2CC1A 1L2SA 4JKTA 2QMIA 5HL1A 5L2FA 3VP1A 3ZG0A 3A3FA 5M19A 4QU3A 4R23A 4PM7A 1BSGA 3CG5A 1WYBA 5FA7A 5HAPA 4JLFA 5EUAA 3GVBA 4OVDA 4ZJ1A 1L0GA 4K91A 4BJPA 1VQQA 2E8IA 4NETA 2RCXA 3HBRA 4JXVA 3WS2A 2A49A 2J7VA 2XH9A 5HX9A 1FR1A 4WEKA 1MKIA 1KE3A 3BFDA 3W4OA 2A3UA 3N8LA 4E3JA 1CEFA 4E3NA 5D3OA 1LI0A 4OPZA 4MEZA 2ZC7A 3SS3A 2J8YA 4ID4A 3UDIA 5F1GA 4S2JA 3O87A 4KQRA 4E3LA 1K56A 3M6HA 1ESIA 4CPKA 2WGWB 4P0MA 4EUZA 1C3BA 5GL9A 3OC2A 2WAEA 1YM1A 2RL3A 3EQUA 1H8ZA 2FFFB 5U47A 3WWXA 1FCOA 1K56D 3NC8A 3OPRA 1XA7A 4S2OA 2ZQ8A 5FSRA 2ZM0A 3B3XA 3MKFA 5A91A 1RGYA 4PM5A 1FQGA 5FAOA 4ZAMA 1I2WA 3G4PA 2Z2MB 1ESUA 1K4EA 3WS0A 2ZM8A 3G35A 2HDQA 1YMSA 4JXGA 5GLBA 3N8RA 2BG1A 1E3UA 3QNBA 4FH2A 1K4FA 1YLTA 4IBXA 4EBLA 4QJGA 3PBNA 3UN7A 1AXBA 4JXSA 5A90A 2P9VB 4A5RA 2FFYA 3D4FA 1YLWA 1Q2PA 2DNSA 4N1XA 3IXGA 1ES4A 4LV2A 4Y0TA 3AGFA 1BLPA 3HL9A 4S2IA 2OSUA 3DWKA 3ZG8B 2ZD8A 1W79A 2X02A 5CGXA 3RXXA 1BLHA 2Y2QA 5E2EA 1XXMA 3NDEA 4O7DA 3WRZA 3ZG9B 4D2OA 1MXOA 3ZCZA 1TDGA 4BD0A 1KDWA 2Y2IA 4BD1A 3GMWA 5DTTA 3P09A 4E3KA 3BFGA 3C4OA 1GHIA 1FCNA 3EQVA 1HD8A 1PWDA 2JE5A 4OOMA 1YLZA 1RP5A 1PZPA 2HPBA 3BFEA 4S2NC 3TSGA 4EV4A 4JBFA 1TEMA 4E6WA 3P98A 1O7EA 1MWTA 2JC7A 3AGDA 2P74A 1JTGA 4IVKA 3A3JA 5GLAA 3C7UA 4DXBA 4EQIA 4NK3A 1PWGA 4PPRA 3ZVTA 1K57C 4C3QA 3OPPA 4K0XA 4LV1A 4UHUA 3MZFA 1HTZA 1PI4A 3GR2A 3BFCA 3Q81A 5FATA 5GHXA 5FDHA 1GHMA 3VSLA 1YLPA 4X69A 1EI5A 3WRTA 2BLSA 2WZXA 1W7FA 5FQIA 1CI9A 5A92A 1K54C 5EVIA 3I7JA 2Q9NA 3IQAA 3MKEA 3N8SA 1JWZA 4ZTKA 3M2KA 3VFHA 2IWDA 2XGNA 5AQAA 3C5AA 4X55A 1GCEA 3HLDA 5GHZA 4DE0A 5EVID 1XA1A 2XD1A 1MBLA 4OPRA 1K38A 1XPBA 1IELA 5CTMA 4K0WA 5CTNA 2Y2LA 3ITAA 4F94A 3Q07A 3CZDA 1FSYA 2HDRA 4RA7A 1ZC2A 5HAQA 2WGVA 1YMXA 4QHCA 4E6XA 5GHYA 5AQ9A 3G32A 2Y2MA 1ZKJA 4KZ6A 1DY6A 1G6AA 2HP5A 4R1GA 1O07A 3IWQA 4KZ4A 4B88A 3HUMA 4KG2A 2C5WB 2ZQAA 5CEBA 3VP3A 4DXCA 3SH8A 3CJMA 3FZCA 5E43A 3UPOA 1TDLA 4Y7PA 1I5QA 4DF6A 4KENB 4OPQA 3V3RA 4QY5A 2J9PA 5TGFA 3HLWA 5FQMA 1LHYA 5GLDA 5E2FA 3M6BA 2WZZA 2GDNA 1ZG6A 4EBNA 1XGJA 2R9WA 1HZOA 3Q1FA 3ITBA 4GB7A 4BENA 3GQZA 4KZ7A 2J9OA 2QZ6A 5FAPA 3TG9A 4DE1A 4E3MA 3PTEA 5EOEA 3BFFA 2Y59A 3IWOA 3UPNA 3V39A 2I72A 2EX9A 2ZQ9A 3ZNYA 1IYQA 3FYZA 4BQMA 2VGKA 1NY0A 2HP9A 2JCHA 4WBGA 3SH9A 2XK1A 2OLUA 1SHVA 3G34A 5FI2A 5CGSA 3JYIA 3MZEA 1BZAA 1KGEA 1XX2A 3LY3A 5EECA 1ONHA 3HVFA 3OPHA 3G30A 2ZQDA 1KGGA 1PWCA 3BRMA 5FI7A 4WZ5C 4KQQA 3W4PA 4C75A 4R3BA 4EBPA 3E2KA 3SS4A 1CI8A 5JYOA 2EFXA 3IF6A 3ZFZA 1LL5A 3HLGA 3UO9A 3V50A 1ERMA 2WGIA 4U0TA 5HAIA 4E3IA 2H10A 4LCLA 1ES3A 1BLSA 1XKZA 4OQGA 1NYYA 2QPNA 4Q8IA 1K55C 1SDEA 4ZJ3A 4KG5A 4WYYA 5IHVA 3HLEA 1JWPA 2EFUA 1PIOA 1N4OA 2EX2A 3SS5A 1NJ4A 2ZQCA 4UA7A 4FD8A 3O88A 5KZHA 1KE0A 2XFTA 5F83A 4KZ3A 3PAEA 2XF3A 4GKUA 1ZG4A 3A3DA 4DKIA 3TOIA 3VOYA 1WE4A 4YFMA 3GRJA 4X6TA 2ZQ7A 3IH9A 3O86A 4OLGA 2DCFA 1BT5A 3BM6A 5CEDA 1EROA 3BLSA 4WELA 1MWRA 2Y91A 5FI6A 5FQQA 2H5SA 3NI9A 3MZDA 2DRWA 1JVJA 4M3KA 3IHAA 4JF4A 1W5DA 4P87A 2Y55A 5EVLA 5M1AA 3NBLA 2PU2A 2V2FF 4OLDA 2XDMA 4GD8A 5E2HA 3IHBA 5F82A 2OV5A 4FCFA 5DF8A 2Y2HA 4FH4A 4JXWA 2HDUA 2Q9MA 1BUEA 1W8YA 1L0EA 1PI5A 3WS5A 1ES2A 2PBYA 4QY6A 2UWXA 4OOYA 1E4DA 5DTSA 5FAQA 3VOZA 5HARA 4KG6A 2ZMAA 3A3IA 1FCMA 1YT4A 4OONA 5J8XA 5KMWA 2X01A 2PU4A 3C4PA 4OH0A 3IH8A 1G68A 2Y2KA 3BECA 4KZ5A 3ZGAB 4OP8A 1NRFA 4HBUA 1TVFA 3ISGA 4IBRA 3SOIA 4C6YA 5CHJA 3Q7VA 2Y2NA 1IYPA 1XGIA 1MPLA 1XP4A
chains in the Genus database with same CATH superfamily
3PBSA 4MN7A 4GN2A 4HESA 5FL3A 2XR0A 1LI9A 2EX6A 4S2LA 4IEDA 3V3SA 2WKHA 4OP5A 2IWCA 1KE4A 1Y54A 2HF6A 1GSXA 3HREA 2WK0A 3G2ZA 1STZA 2PR5A 4MBKA 4UA9A 4L9FA 1JTDA 2IWBA 2VZWA 1IYOA 5HDDA 3FWLA 4QB8A 4Y0OA 1FR6A 5CXWA 4B4XA 4MLLA 1ES5A 1S66L 3ZQ5A 1GA0A 4N9LA 1BTLA 3OZHA 5DJTA 3WS4A 3IS2A 3SH7A 2G2UA 2H0TA 1F2KA 3MXQA 3FKVA 4JPMA 5I94A 5FQJA 4G3VA 2Z2LB 3ZYTA 4UAAA 2Y8HA 1IYSA 3W4QA 4LV3A 2B5RA 1ONGA 4HQAA 1GA9A 1LL8A 2WKPA 2WYXA 3B42A 4NG2A 3MQ0A 1KDSA 1KVMA 3LEQA 1H5XA 4GHIA 3KO6A 1KVLA 4EUVA 5TJJA 5J3WA 4Y2FA 1K6SA 1OJ5A 1K55A 4QD4A 4PM6A 2VGLS 4B4ZA 2PYRA 3IXDA 4N1HA 4KQOA 2J3TD 2XEPA 4HEFA 2GX5A 3UB6A 1LSXA 5JYPA 2ZBBA 2HP6A 3HLCA 4UA6A 1PNEA 5I5LA 1K6RA 4NXGA 5FQKA 1ZHHB 4ARZA 1M6KA 3T1XA 1S0WA 3GSGA 3EWKA 1PW1A 2D02A 1K57A 2Y4AA 3FV7A 1Y28A 4P85A 3MBZA 1TS0A 1RCJA 3T4KA 4FSFA 1PRQA 3MQQA 1K25A 2E8JA 2ZJ9A 4OQIA 4NKPA 1S1ZA 1M40A 4BL2A 3E4PA 3DWZA 4R6LA 2G7UA 5E2GA 2W3GA 1N9LA 2H28A 4WMCD 4I3JA 5HZHA 4WEJA 3UNWA 2ZOIA 3F1NB 4ZBEA 1OMEA 3LIDA 1L2SA 3NHQA 3A3FA 4QU3A 4R23A 5HAPA 4ZJ1A 4DMZA 4BJPA 2RCXA 3HBRA 3WS2A 5DKLA 2XH9A 1FR1A 3IX8A 2A3UA 4E3NA 1LI0A 4MEZA 3SS3A 4ID4A 1SKOB 5F1GA 2V1BA 4KQRA 5GL9A 5U47A 1FCOA 3MKFA 1RGYA 5FEFA 2Z2MB 3G35A 3B47A 1XJ2A 3LR3A 4EBLA 4QJGA 3PBNA 1AXBA 4JXSA 3D4FA 3IXGA 4LV2A 2O9AA 4PAUA 4S2IA 3HL9A 5EM0A 2YKFA 2M1CA 3ZG8B 3UMEA 1W79A 2X02A 4G3KA 1BLHA 2Y2QA 4O7DA 1MXOA 3LFVA 2O0YA 1F5MA 1OTDA 4EW7A 5DTTA 1DP9A 2VEAA 3C4OA 1FCNA 2Y79A 4CLCC 4CLCE 1YAXA 4PKYG 2XSSA 1YLZA 1PZPA 3BFEA 3NECA 4S2NC 3T4TA 2B18A 3P98A 1O7EA 4WUJA 3C7UA 4P6ZS 4K0XA 4UHUA 3MZFA 1HTZA 3GR2A 5FATA 1GHMA 1V9ZA 3MS6A 4MMNA 3WRTA 5FQIA 2LB9A 4GS9B 5EVIA 3IQAA 1GSWA 3LIFA 2B02A 2IWDA 2W0NA 1G28A 2XD1A 3V67A 3HJKA 5CTMA 2J80A 3Q07A 2BASA 1FSYA 2HDRA 4E6XA 4HH3A 2P08A 4EEPA 4Q0HA 3CHWP 3G32A 2Y2MA 1ZKJA 1G6AA 4R1GA 3KSGA 4GLQA 3VP3A 1OPXA 3FZCA 3UPOA 3LUQA 5HWWA 3BW6A 4OPQA 5TGFA 3HLWA 2OWJA 5GLDA 2V9AA 4D60A 1DP8A 5E2FA 3M6BA 2WZZA 4EBNA 4HI4A 1V9YA 4PKYA 2J9OA 4I3IA 2VGKA 1NY0A 2HP9A 2JCHA 2XK1A 2OLUA 3IBRA 3MZEA 4QPRA 4NXBA 3BRMA 3JVUA 3KX0X 4EBPA 3SS4A 2PDRA 3T4OA 3V50A 2PBDP 1ERMA 5HAIA 4LCLA 4EESA 4Q8IA 1K55C 1SDEA 4WYYA 4YWZA 1JWPA 1PIOA 1N4OA 5F68A 1NJ4A 3SS5A 4FD8A 4UQIM 5KZHA 4EETB 2XFTA 2XF3A 3A3DA 4DKIA 1WE4A 4YFMA 4Y3IA 3O86A 5HD3A 3BM6A 4WELA 5FQQA 1S1YA 1LT0A 3MZDA 2DRWA 4WN5A 1IFQA 5EVLA 2V2FF 2XDMA 2ZL1B 2OV5A 5DF8A 2Y2HA 4FH4A 2VA0A 2HDUA 1DP6A 1F98A 1L0EA 4OOYA 3VOZA 5HARA 4KG6A 3A3IA 2VJWA 1G68A 1YSQA 5CHJA 2Y2NA 1MPLA 3D3OA 1XP4A 1TS8A 3PXPA 4AFIA 3S4XA 4N9KA 3BY8A 3T50A 3UE0A 2XA7S 4LENA 4KZAA 2A24A 1DJAA 4ME4A 1ZTUA 3K2NA 5CGWA 4EQ1A 2ZMFA 4CJNA 1H3QA 2INWA 3IWIA 3E0YA 3MJQA 1HVBA 3UDFA 4DE3A 3IT9A 3DTMA 1BULA 2JKRM 2QHKA 4PM9A 1LL9A 3PBOA 2PD7A 3BY9A 3U2AA 3VFFA 3BEBA 5HPFA 4LCMA 4OPYA 4LRXC 2PYPA 3E2LA 2EX8A 2ZC5B 3WS1A 1PZOA 4CLCB 4PMAA 1LLBA 3CITA 5EOOA 3LIAA 1YKDA 3IF6C 4HP4A 3H82A 3LCEA 5IS1A 3NULA 4RX2A 4O0PA 1T1AA 3N6IA 4FTXA 3Q7VB 4WZ5A 1YLYA 2QJ7A 3OCLA 4GDBA 3MXRA 4BWIA 3DW0A 4U3TA 3ZDJA 4IVIA 3TRCA 3QHYA 4JGPA 5LBRA 4JGRA 4N92A 4ETZA 5CRFA 4MCWA 4OQHA 2WAFA 5CHMA 5DF9A 2OWHA 5TFQA 1SKFA 3OBFA 3EEHA 4EEUA 1CQAA 2ZC6B 2H0YA 3NCKA 3GECA 5AQ7A 4S2NA 4OQ0A 2L4RA 2V1ZA 2HZ5A 3OOVA 1GHPA 1L0DA 3VV4A 5EVIC 2V8FA 4GNUA 2V20A 3E98A 3PBTA 3ICYA 3IS2B 4IUKA 3T4LA 4ESPA 2W1RA 4XUXA 3LY4A 3W8KA 1CF0A 4Y17A 2P9VA 3A3EA 1MZUA 5F6AA 4WL9A 4GW9A 1YLJA 2EWWA 4EWFA 3PBQA 5HD5A 3UPPA 3ZHHA 3VSKA 5TBMA 4GOGA 4DDYA 4JKTA 5HL1A 5AVFA 1BSGA 5EFWA 4JLFA 2EWVA 1L0GA 2E8IA 4X25A 4NETA 2A49A 1P9WA 4WEKA 4Q0IA 4E3JA 2ZC7A 2J8YA 4ARZB 4HOIA 4IHQA 2W3FA 4E3LA 1K56A 3M6HA 1ESIA 4CPKA 1XA7A 1UWPX 3B3XA 1XFNA 2UV0E 5FAOA 3G4PA 4I5SA 3K3CA 3UN7A 3CLOA 5A90A 1S4RA 4A5RA 5EM1A 4HJ6A 1JNUA 1TS7A 4Y0TA 2ZD8A 3CPTA 3WRZA 4D2OA 3ZCZA 1TDGA 4BD0A 3MFXA 3QP2A 1KDWA 5G4YA 1P9RA 3GMWA 4DJ2A 1GHIA 4ETXA 2JE5A 4OOMA 1RP5A 1OTAA 3TSGA 1TEMA 1VEUA 3AGDA 5A8BA 1JTGA 2VV8A 4DXBA 4NK3A 1PWGA 3ZVTA 3DAVA 4LV1A 2MJ6A 1ODVA 5GHXA 5FDHA 4GCZA 1YLPA 4X69A 1CI9A 3G6OA 3RH8B 2XGNA 5AQAA 3C5AA 1GCEA 3HLDA 1XA1A 1LSWA 1K38A 4K0WA 4X1LA 2Y2LA 3ITAA 4F94A 3CZDA 1OJGA 4RA7A 1ZC2A 2WGVA 5HWTA 3LGOA 1YMXA 4MN6A 2QWSA 5AQ9A 4KZ6A 4B88A 3VOLA 4KG2A 5CEBA 3CJMA 1I5QA 2K2NA 4QY5A 5AVEA 1G5UA 3S7PA 1PFLA 1ZG6A 4NXFA 4YNRA 1HZOA 3Q1FA 4CQHA 3SW1A 4MN5A 3GQZA 3C30A 2Z6DA 2NUPC 2HGVA 3BFFA 1ACFA 2VX8A 2EX9A 4WBGA 3CWFA 1SHVA 1KGEA 1ONHA 2Q0OA 4HH2A 1FIKA 2ZQDA 1PWCA 4WZ5C 3W4PA 4FOFA 3LR0A 2XRNA 3IF6A 3ZFZA 1LL5A 1T18A 3P01A 5L10A 2K7SA 4RQ9A 2H10A 1BLSA 1NYYA 1VETB 2W1TA 4KG5A 3T4SA 3A0RA 3E4QA 3KSHA 4L9EA 5IT5A 4KZ3A 5FDSA 3DTEA 3VOYA 4DN0A 4B9OA 3S7QA 4HHDA 3T4QA 4LRZE 4OLGA 5EV0A 3O5YA 1KOUA 2PU2A 1TF1A 4OLDA 4GD8A 3IHBA 2VK3A 2Q9MA 3WS5A 3T4JA 2PBYA 4CLCD 1WA9A 2PRFA 4HIAA 2ZMAA 3L9KA 1NLYA 1YT4A 2X01A 3C4PA 4OH0A 3IH8A 3BECA 1LSVA 2W27A 3SOIA 4IUHA 4JGQA 1S67L 2JKGA 1CK3A 1DRMA 1QMFA 3C38A 3MFDA 4BMWA 1K54A 1FSWA 1QMEA 2VKSA 4Z1WA 1W63Q 1IEMA 1KGFA 4XUZA 5HFOA 3ZG7B 2XLNA 5EPHA 3HLFA 4Q0JA 3P7NA 5G18A 3U4LP 4RX3A 5L07A 1T1BA 2JKRI 1YQSA 3M2JA 3IXHA 1BYWA 4O8GA 4R3JA 4F3LA 3Q7ZA 4Z9QA 3LI8A 2XQZA 3KYQA 1GSVA 3MXSA 4DDSA 1G6OA 4MBHA 5KSHA 2EXBA 4R70A 1MKMA 2ZC3B 3OLOA 3ZVWA 1Z6FA 4KZ8A 3C7VA 3VP2A 2WKEA 5KIZA 1T19A 5DVAA 3GV9A 4Y0UA 4X1MA 3S7OA 3NOTC 3N4IA 1S6RA 3UMDA 3A0VA 3F1OA 5GLCA 4S2KA 1CEGA 3BJNA 3CUEA 1MWUA 4LV0A 5DKKA 3H7WA 1AWIA 2GNXA 3RXWA 4LLOB 4KZ9A 5DF7A 2HDSA 2KX6A 4DE2A 2XD5A 2OLVA 1MY8A 2L1MA 1IKGA 3W2ZA 4DRTA 5M18A 2A24B 2VGLM 3NIAA 5TR7A 3L7HA 2ZOHA 1XJ3A 2Y2OA 4XT2A 2EXAA 2VGJA 4MDZA 1PYYA 3IF5A 4PM8A 1N9BA 1Z09A 4H8RA 4RYEA 4GD6A 3BYDA 3PBRA 5F5YA 1IKIA 2V1AA 3C2WA 4B93A 1J9MA 2ZC4B 2ACGA 2PD8A 3GTCA 4JF5A 4JGOA 3VP0A 1BLCA 5AQBA 4Y13A 2WGWA 1JWVA 3NJAA 2XFSA 4HBTA 2R78A 2OOLA 3IXBA 4L9GA 2M7VA 4S2MA 1MC0A 5HW3A 1H8YA 2VLGA 3IX4A 3QP4A 3H82B 4H6JA 4E3OA 4WMCA 3O3VA 5FEGA 3S22A 3DTKA 5IU1A 3F1PA 2JBFA 1MWSA 3FC7A 1VM1A 5FQ9A 2WUQA 2QMIA 3VP1A 3CG5A 5EUAA 3GVBA 4OVDA 2KDKA 1VQQA 3EGXC 5HX9A 1MKIA 3BFDA 5MC7A 4I39A 3N8LA 5K5BA 1CEFA 5D3OA 3IX3A 3UDIA 2PAVP 4QWOA 3BQ8A 4EUZA 1C3BA 3OC2A 2RL3A 3GDIA 2FFFB 3ZG5A 3WWXA 2ZQ8A 1FQGA 4ZAMA 3WS0A 2ZM8A 4LFUA 5GLBA 4JXGA 3SZTA 1E3UA 3QNBA 4FH2A 1K4FA 1YLTA 4IBXA 2P9VB 5C5KA 1Q2PA 2OSUA 3DWKA 5CGXA 3RXXA 2JN7A 5J7EA 5E2EA 1XXMA 3NDEA 2Z6CA 3ZG9B 5TBMB 3BWLA 3T12B 3C8CA 4BD1A 3MQOA 3EQVA 1HD8A 5HSQA 2HPBA 4EV4A 4JBFA 1MWTA 4P6ZM 2L0WA 3BQAA 4IVKA 3A3JA 3UB9A 2KLIA 1S4SA 3QP5A 4EQIA 3OPPA 4BBUA 1PI4A 3Q81A 3R7WA 1EI5A 2BLSA 2KOIA 1W7FA 5A92A 1K54C 3MKEA 3LIBA 4ZTKA 1JWZA 5J4EA 5GHZA 3MR0A 5EVID 1MBLA 4OPRA 1IELA 4O01A 5CX7A 4QHCA 5GHYA 1DY6A 2HP5A 4GHIB 3HUMA 1OTIA 2C5WB 2ZQAA 4DXCA 2XROA 5E43A 1TDLA 4Y7PA 4DF6A 4KENB 3CPTB 5FQMA 1LHYA 1XGJA 3ITBA 4GB7A 4BENA 5FAPA 2K31A 4DE1A 1VEUB 1D1JA 2Y59A 4KQDA 2ZQ9A 4DJ3A 3ZNYA 1IYQA 4BQMA 3G34A 5FI2A 5CGSA 1XX2A 3LY3A 5EECA 3OPHA 3G30A 1KGGA 2VV7A 1NWZA 4KQQA 3CUEC 4R3BA 3E2KA 2O9BA 5JYOA 2EFXA 2DMWA 2GJ3A 1T1CA 3UO9A 4FUWA 4U0TA 4E3IA 1ES3A 4OQGA 5IHVA 3HLEA 2EFUA 5HDSA 2J3TC 2EX2A 4WLAA 4UA7A 5HDCA 3O88A 1KE0A 4Y15A 5F83A 3PAEA 1ZG4A 4IJGA 3TOIA 3GRJA 2ZQ7A 4I3AA 4UQIS 3IH9A 1A0KA 1EROA 3BLSA 1N9NA 3NI9A 1JVJA 1W5DA 4P87A 2Y55A 1VHMA 5M1AA 3NBLA 4GJ4A 4FCFA 4JXWA 1BUEA 4HNBA 1ES2A 3LYXA 1OT6A 3TW8A 2B95A 1FCMA 4OONA 3T1QB 5J8XA 2PU4A 4KUOA 2Y2KA 4OP8A 1NRFA 3ISGA 5L09A 1XGIA 2XA7M 4OOLA 4MNRA 5CECA 4P6BA 3D72A 3Q82A 4BL3A 5HWVA 3IF6B 4R0QA 2R9XA 1Q2QA 5HL6A 1W8QA 3TE8A 3VP4A 2WADA 3UDXA 2X71A 1SCWA 3LR5A 4S2PA 2W1TB 2Y2JA 3UY6A 2ZLYA 1U60A 4R4RA 1H0MA 3FG8A 4RVAA 1L3LA 2G2WA 4HY8A 1XJ4A 2JKFA 3LEZA 5FASA 1DJBA 4R4SA 4LRYC 4X53A 5EE8A 1OT9A 3PAGA 3T1SA 1NZUA 2PR6A 1VB6A 3V5MA 3QNCA 5DTKA 4ZRRA 4GZBA 5L8MA 3MSHA 1L0FA 4L0LA 4WZ4A 3AGEA 3ZNTA 1YSPA 4I38A 4M4XA 4U0XA 5EVIB 4Y5FA 1PW8A 3HUOA 2P04A 1EWZA 2JHEA 2WKRA 1NXYA 3RJUA 3FKWA 3TJZC 4KZBA 2M7UA 1P0ZA 3LICA 2Y2PA 2I9VA 3A0SA 1Y4OA 3G31A 3F1NA 4JF6A 3LO7A 4X68A 1NZOA 1E3UD 4II7A 5CHUA 3HCYA 3JPUA 1FOFA 3N7WA 5G4ZA 1DJCA 3ULFA 5F1FA 4R3AA 1J3WA 4HJ4A 1EW0A 3OPLA 3NDGA 3LR4A 4F3LB 1UGUA 1H8MA 5DJUA 3BLMA 3S1YA 4KUKA 2Y2GA 2P7JA 1SKOA 5BOHA 2WKIA 3HUNA 4YINA 3NOPC 3NOUC 2IA2A 1RGZA 3VE4A 3S7NA 1N9OA 3QP1A 2OAQ1 2ZM2A 1TS6A 3HLBA 5AJGA 5KSCA 3CMZA 4MBFA 2LB5A 3CAXA 2QJ5A 3FPWA 1ERQA 4X56A 2C6WB 4OKPA 1WYCA 3G2YA 5A93A 3NY4A 3IBJA 1E25A 4NEED 4XXRA 2V8CA 3VMAA 1OTEA 1ALQA 1SDNA 5HPIA 1NYMA 3F1OB 4WF0A 1VETA 1K0KA 2CMNA 2O9CA 3UE1A 3UE3A 4ZDXA 2GZAA 3H7WB 1P97A 5CERA 1I2SA 4GDNA 4BLMA 4ZJ2A 4WM9A 2CC1A 5L2FA 3ZG0A 5M19A 4PM7A 5FA7A 1WYBA 3LIEA 4HJ3A 2BTFP 3KSFA 4K91A 2AVXA 4XT2B 3MF0A 4JXVA 4HP9A 2J7VA 2JKTI 3H9WA 1KE3A 1CJFA 2YKHA 3W4OA 4OPZA 4S2JA 4YOFA 3O87A 4GS9A 2WGWB 4P0MA 2WAEA 1YM1A 3EQUA 1H8ZA 4LPZA 1K56D 3NC8A 3OPRA 4S2OA 5FSRA 2ZM0A 4PM5A 5A91A 2HJ9C 3UB7A 1I2WA 2V0UA 2QYBA 1ESUA 1K4EA 1NRJA 2HDQA 1YMSA 3N8RA 2BG1A 2D01A 4R38A 2FFYA 1YLWA 2DNSA 4H6JB 4N1XA 1ES4A 2W3HA 3AGFA 1BLPA 2J3WA 3KYEA 3EOIA 3CI6A 3T1RA 3F1PB 2W3EA 2Y2IA 3PHYA 3P09A 4E3KA 3BFGA 1YPRA 1PWDA 4E6WA 2JC7A 1X0OA 3DBAA 1NLZA 2P74A 5GLAA 5F69A 3D9YA 4PPRA 1K57C 4C3QA 2EA9A 3BFCA 3VSLA 2A2LA 2WZXA 3KYZA 3QP8A 4UEYA 3UE6A 4E04A 3N8SA 3I7JA 2Q9NA 3UB5P 3VFHA 3M2KA 4X55A 4DE0A 1D06A 3LI9A 4PHTA 1XPBA 5CTNA 2WKQA 2PT7A 3QP6A 3PYPA 5HAQA 4EXOA 2FZ0A 2W3DA 4EU0A 3MMHA 5DFYA 3RFBA 3VE3A 1O07A 3IWQA 4KZ4A 1HLUP 3SH8A 1OTBA 3V3RA 2J9PA 1UWNX 2GDNA 2ZL1A 2R9WA 3EEAA 4K08A 4KZ7A 2QZ6A 3TG9A 1XFQA 2FH5A 4E3MA 2JKTM 3PTEA 5EOEA 2V0WA 1XJ6A 3IWOA 3UPNA 2NUTC 3V39A 2I72A 3FYZA 3UB8A 3SH9A 1FILA 3DTIA 3JYIA 1BZAA 3E4OA 3R4KA 3RTYA 3HVFA 5FI7A 2ZMVA 4C75A 1IOUA 1CI8A 3R7WB 2QKPA 3HJIA 3HLGA 4G3WA 2WGIA 1XKZA 2QPNA 1TD5A 4ZJ3A 4BBVA 2HV1A 5DFXA 2O99A 1F9IA 2ZQCA 4BBTA 5EVEA 1W63M 4GKUA 4EERA 2VV6A 3JVVA 4X6TA 1D7EA 4LGWA 2DCFA 1BT5A 1SZVA 5CEDA 5FI6A 1MWRA 2Y91A 3B33A 2H5SA 3PR6A 4M3KA 3IHAA 4JF4A 3FPVA 5E2HA 4NXEA 3EGDC 5F82A 4CLCA 3KSIA 1W8YA 1PI5A 2OAP1 5DTSA 4QY6A 2UWXA 5FAQA 1E4DA 3K3DA 5KMWA 2PHYA 3ZGAB 4KZ5A 4HBUA 1TVFA 2HJEA 4IBRA 4C6YA 3Q7VA 1IYPA 3OCNA
chains in the Genus database with same CATH topology
1CK3A 3PBSA 1QMFA 3S4XA 4OOLA 3MFDA 4MNRA 4GN2A 4N9KA 5CECA 4HESA 4P6BA 1K54A 1FSWA 1QMEA 3UE0A 4LENA 3Q82A 4KZAA 4BL3A 2XR0A 1LI9A 1IEMA 1KGFA 2EX6A 3IF6B 2R9XA 1Q2QA 4R0QA 4XUZA 5HFOA 3ZG7B 4S2LA 2XLNA 4IEDA 1W8QA 5EPHA 3V3SA 2WKHA 1DJAA 4OP5A 2IWCA 1KE4A 5CGWA 1Y54A 3HLFA 3VP4A 4CJNA 2WADA 3HREA 2WK0A 3G2ZA 5G18A 3UDXA 3IWIA 2X71A 4RX3A 1SCWA 4S2PA 4MBKA 4UA9A 1JTDA 2IWBA 2Y2JA 3UY6A 1YQSA 3M2JA 2ZLYA 1U60A 3IXHA 1HVBA 4R4RA 3UDFA 4R3JA 3Q7ZA 1IYOA 4Z9QA 4DE3A 4RVAA 3IT9A 3FWLA 4QB8A 2G2WA 3DTMA 1BULA 4Y0OA 1FR6A 5CXWA 4B4XA 2XQZA 4PM9A 1LL9A 3PBOA 3MXSA 3LEZA 4MLLA 4DDSA 1ES5A 5FASA 1GA0A 3BEBA 4N9LA 1BTLA 3VFFA 1DJBA 3OZHA 4LCMA 4MBHA 4R4SA 4X53A 5KSHA 4OPYA 5EE8A 3PAGA 2EXBA 3WS4A 1NZUA 2ZC3B 3E2LA 2EX8A 3SH7A 2G2UA 2H0TA 2ZC5B 3QNCA 3V5MA 1Z6FA 3FKVA 1PZOA 4KZ8A 4GZBA 3C7VA 5DTKA 3WS1A 3VP2A 1L0FA 4L0LA 1LLBA 4PMAA 3AGEA 4WZ4A 3ZNTA 4JPMA 2WKEA 5I94A 5EOOA 5FQJA 5DVAA 2Z2LB 4U0XA 5EVIB 3GV9A 3IF6C 4Y0UA 1PW8A 3HUOA 1EWZA 3LCEA 4UAAA 3N4IA 4RX2A 1S6RA 1NXYA 1IYSA 3W4QA 3N6IA 2B5RA 4LV3A 1ONGA 4S2KA 5GLCA 3RJUA 1CEGA 3FKWA 3Q7VB 1YLYA 4WZ5A 4KZBA 1GA9A 1MWUA 3OCLA 4LV0A 4GDBA 3RXWA 2Y2PA 2WYXA 3G31A 3MXRA 4JF6A 4KZ9A 5DF7A 2HDSA 3LO7A 3DW0A 2XD5A 4U3TA 4DE2A 1KDSA 2OLVA 1MY8A 1IKGA 1KVMA 4X68A 1NZOA 4DRTA 5M18A 3ZDJA 4IVIA 1E3UD 1H5XA 1KVLA 3QHYA 3NIAA 5CHUA 5TR7A 1K6SA 1FOFA 3N7WA 4N92A 1K55A 1DJCA 4QD4A 4PM6A 5CRFA 4OQHA 3ZG5A 4B4ZA 2WAFA 3ZVWA 5F1FA 5CHMA 2Y2OA 3IXDA 5DF9A 2EXAA 4N1HA 2VGJA 5TFQA 1SKFA 3OPLA 3NDGA 4KQOA 1PYYA 2XEPA 3IF5A 4PM8A 4HEFA 5JYPA 1N9BA 4H8RA 3BLMA 4RYEA 2HP6A 3S1YA 3HLCA 4UA6A 4GD6A 3BYDA 3PBRA 2Y2GA 2ZC6B 2H0YA 1K6RA 1IKIA 3NCKA 5FQKA 1J9MA 5BOHA 5AQ7A 2ZC4B 4S2NA 2WKIA 3VP0A 3GTCA 3HUNA 4JF5A 4OQ0A 1BLCA 1M6KA 5AQBA 4YINA 2V1ZA 1GHPA 1L0DA 1S0WA 3GSGA 2WGWA 1PW1A 1RGZA 5EVIC 1JWVA 4GNUA 2ZM2A 3HLBA 4HBTA 2XFSA 2V20A 1K57A 3CMZA 5KSCA 4MBFA 2Y4AA 3PBTA 3FV7A 1ERQA 4P85A 3MBZA 1RCJA 4X56A 4XUXA 2C6WB 4FSFA 4OKPA 1WYCA 1K25A 3G2YA 3IXBA 3LY4A 5A93A 3NY4A 2ZJ9A 4OQIA 4S2MA 1M40A 4BL2A 1E25A 5HW3A 3W8KA 3DWZA 4XXRA 1H8YA 2P9VA 5E2GA 3A3EA 3VMAA 1ALQA 1SDNA 4E3OA 4WMCA 3O3VA 1YLJA 1NYMA 4EWFA 3UE1A 3PBQA 3UE3A 4ZDXA 4WMCD 3OCNA 3S22A 4WEJA 3UPPA 3UNWA 5CERA 2JBFA 1MWSA 3ZHHA 4ZBEA 1I2SA 3VSKA 4GDNA 4BLMA 4ZJ2A 4GOGA 4WM9A 1OMEA 1VM1A 5FQ9A 4DDYA 2WUQA 2CC1A 1L2SA 4JKTA 2QMIA 5HL1A 5L2FA 3VP1A 3ZG0A 3A3FA 5M19A 4QU3A 4R23A 4PM7A 1BSGA 3CG5A 1WYBA 5FA7A 5HAPA 4JLFA 5EUAA 3GVBA 4OVDA 4ZJ1A 1L0GA 4K91A 4BJPA 1VQQA 2E8IA 4NETA 2RCXA 3HBRA 4JXVA 3WS2A 2A49A 2J7VA 2XH9A 5HX9A 1FR1A 4WEKA 1MKIA 1KE3A 3BFDA 3W4OA 2A3UA 3N8LA 4E3JA 1CEFA 4E3NA 5D3OA 1LI0A 4OPZA 4MEZA 2ZC7A 3SS3A 2J8YA 4ID4A 3UDIA 5F1GA 4S2JA 3O87A 4KQRA 4E3LA 1K56A 3M6HA 1ESIA 4CPKA 2WGWB 4P0MA 4EUZA 1C3BA 5GL9A 3OC2A 2WAEA 1YM1A 2RL3A 3EQUA 1H8ZA 2FFFB 5U47A 3WWXA 1FCOA 1K56D 3NC8A 3OPRA 1XA7A 4S2OA 2ZQ8A 5FSRA 2ZM0A 3B3XA 3MKFA 5A91A 1RGYA 4PM5A 1FQGA 5FAOA 4ZAMA 1I2WA 3G4PA 2Z2MB 1ESUA 1K4EA 3WS0A 2ZM8A 3G35A 2HDQA 1YMSA 4JXGA 5GLBA 3N8RA 2BG1A 1E3UA 3QNBA 4FH2A 1K4FA 1YLTA 4IBXA 4EBLA 4QJGA 3PBNA 3UN7A 1AXBA 4JXSA 5A90A 2P9VB 4A5RA 2FFYA 3D4FA 1YLWA 1Q2PA 2DNSA 4N1XA 3IXGA 1ES4A 4LV2A 4Y0TA 3AGFA 1BLPA 3HL9A 4S2IA 2OSUA 3DWKA 3ZG8B 2ZD8A 1W79A 2X02A 5CGXA 3RXXA 1BLHA 2Y2QA 5E2EA 1XXMA 3NDEA 4O7DA 3WRZA 3ZG9B 4D2OA 1MXOA 3ZCZA 1TDGA 4BD0A 1KDWA 2Y2IA 4BD1A 3GMWA 5DTTA 3P09A 4E3KA 3BFGA 3C4OA 1GHIA 1FCNA 3EQVA 1HD8A 1PWDA 2JE5A 4OOMA 1YLZA 1RP5A 1PZPA 2HPBA 3BFEA 4S2NC 3TSGA 4EV4A 4JBFA 1TEMA 4E6WA 3P98A 1O7EA 1MWTA 2JC7A 3AGDA 2P74A 1JTGA 4IVKA 3A3JA 5GLAA 3C7UA 4DXBA 4EQIA 4NK3A 1PWGA 4PPRA 3ZVTA 1K57C 4C3QA 3OPPA 4K0XA 4LV1A 4UHUA 3MZFA 1HTZA 1PI4A 3GR2A 3BFCA 3Q81A 5FATA 5GHXA 5FDHA 1GHMA 3VSLA 1YLPA 4X69A 1EI5A 3WRTA 2BLSA 2WZXA 1W7FA 5FQIA 1CI9A 5A92A 1K54C 5EVIA 3I7JA 2Q9NA 3IQAA 3MKEA 3N8SA 1JWZA 4ZTKA 3M2KA 3VFHA 2IWDA 2XGNA 5AQAA 3C5AA 4X55A 1GCEA 3HLDA 5GHZA 4DE0A 5EVID 1XA1A 2XD1A 1MBLA 4OPRA 1K38A 1XPBA 1IELA 5CTMA 4K0WA 5CTNA 2Y2LA 3ITAA 4F94A 3Q07A 3CZDA 1FSYA 2HDRA 4RA7A 1ZC2A 5HAQA 2WGVA 1YMXA 4QHCA 4E6XA 5GHYA 5AQ9A 3G32A 2Y2MA 1ZKJA 4KZ6A 1DY6A 1G6AA 2HP5A 4R1GA 1O07A 3IWQA 4KZ4A 4B88A 3HUMA 4KG2A 2C5WB 2ZQAA 5CEBA 3VP3A 4DXCA 3SH8A 3CJMA 3FZCA 5E43A 3UPOA 1TDLA 4Y7PA 1I5QA 4DF6A 4KENB 4OPQA 3V3RA 4QY5A 2J9PA 5TGFA 3HLWA 5FQMA 1LHYA 5GLDA 5E2FA 3M6BA 2WZZA 2GDNA 1ZG6A 4EBNA 1XGJA 2R9WA 1HZOA 3Q1FA 3ITBA 4GB7A 4BENA 3GQZA 4KZ7A 2J9OA 2QZ6A 5FAPA 3TG9A 4DE1A 4E3MA 3PTEA 5EOEA 3BFFA 2Y59A 3IWOA 3UPNA 3V39A 2I72A 2EX9A 2ZQ9A 3ZNYA 1IYQA 3FYZA 4BQMA 2VGKA 1NY0A 2HP9A 2JCHA 4WBGA 3SH9A 2XK1A 2OLUA 1SHVA 3G34A 5FI2A 5CGSA 3JYIA 3MZEA 1BZAA 1KGEA 1XX2A 3LY3A 5EECA 1ONHA 3HVFA 3OPHA 3G30A 2ZQDA 1KGGA 1PWCA 3BRMA 5FI7A 4WZ5C 4KQQA 3W4PA 4C75A 4R3BA 4EBPA 3E2KA 3SS4A 1CI8A 5JYOA 2EFXA 3IF6A 3ZFZA 1LL5A 3HLGA 3UO9A 3V50A 1ERMA 2WGIA 4U0TA 5HAIA 4E3IA 2H10A 4LCLA 1ES3A 1BLSA 1XKZA 4OQGA 1NYYA 2QPNA 4Q8IA 1K55C 1SDEA 4ZJ3A 4KG5A 4WYYA 5IHVA 3HLEA 1JWPA 2EFUA 1PIOA 1N4OA 2EX2A 3SS5A 1NJ4A 2ZQCA 4UA7A 4FD8A 3O88A 5KZHA 1KE0A 2XFTA 5F83A 4KZ3A 3PAEA 2XF3A 4GKUA 1ZG4A 3A3DA 4DKIA 3TOIA 3VOYA 1WE4A 4YFMA 3GRJA 4X6TA 2ZQ7A 3IH9A 3O86A 4OLGA 2DCFA 1BT5A 3BM6A 5CEDA 1EROA 3BLSA 4WELA 1MWRA 2Y91A 5FI6A 5FQQA 2H5SA 3NI9A 3MZDA 2DRWA 1JVJA 4M3KA 3IHAA 4JF4A 1W5DA 4P87A 2Y55A 5EVLA 5M1AA 3NBLA 2PU2A 2V2FF 4OLDA 2XDMA 4GD8A 5E2HA 3IHBA 5F82A 2OV5A 4FCFA 5DF8A 2Y2HA 4FH4A 4JXWA 2HDUA 2Q9MA 1BUEA 1W8YA 1L0EA 1PI5A 3WS5A 1ES2A 2PBYA 4QY6A 2UWXA 4OOYA 1E4DA 5DTSA 5FAQA 3VOZA 5HARA 4KG6A 2ZMAA 3A3IA 1FCMA 1YT4A 4OONA 5J8XA 5KMWA 2X01A 2PU4A 3C4PA 4OH0A 3IH8A 1G68A 2Y2KA 3BECA 4KZ5A 3ZGAB 4OP8A 1NRFA 4HBUA 1TVFA 3ISGA 4IBRA 3SOIA 4C6YA 5CHJA 3Q7VA 2Y2NA 1IYPA 1XGIA 1MPLA 1XP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK3 A;  3PBS A;  1QMF A;  3S4X A;  4OOL A;  3MFD A;  4MNR A;  4GN2 A;  4N9K A;  5CEC A;  4HES A;  4P6B A;  1K54 A;  1FSW A;  1QME A;  3UE0 A;  4LEN A;  3Q82 A;  4KZA A;  4BL3 A;  2XR0 A;  1LI9 A;  1IEM A;  1KGF A;  2EX6 A;  3IF6 B;  2R9X A;  1Q2Q A;  4R0Q A;  4XUZ A;  5HFO A;  3ZG7 B;  4S2L A;  2XLN A;  4IED A;  1W8Q A;  5EPH A;  3V3S A;  2WKH A;  1DJA A;  4OP5 A;  2IWC A;  1KE4 A;  5CGW A;  1Y54 A;  3HLF A;  3VP4 A;  4CJN A;  2WAD A;  3HRE A;  2WK0 A;  3G2Z A;  5G18 A;  3UDX A;  3IWI A;  2X71 A;  4RX3 A;  1SCW A;  4S2P A;  4MBK A;  4UA9 A;  1JTD A;  2IWB A;  2Y2J A;  3UY6 A;  1YQS A;  3M2J A;  2ZLY A;  1U60 A;  3IXH A;  1HVB A;  4R4R A;  3UDF A;  4R3J A;  3Q7Z A;  1IYO A;  4Z9Q A;  4DE3 A;  4RVA A;  3IT9 A;  3FWL A;  4QB8 A;  2G2W A;  3DTM A;  1BUL A;  4Y0O A;  1FR6 A;  5CXW A;  4B4X A;  2XQZ A;  4PM9 A;  1LL9 A;  3PBO A;  3MXS A;  3LEZ A;  4MLL A;  4DDS A;  1ES5 A;  5FAS A;  1GA0 A;  3BEB A;  4N9L A;  1BTL A;  3VFF A;  1DJB A;  3OZH A;  4LCM A;  4MBH A;  4R4S A;  4X53 A;  5KSH A;  4OPY A;  5EE8 A;  3PAG A;  2EXB A;  3WS4 A;  1NZU A;  2ZC3 B;  3E2L A;  2EX8 A;  3SH7 A;  2G2U A;  2H0T A;  2ZC5 B;  3QNC A;  3V5M A;  1Z6F A;  3FKV A;  1PZO A;  4KZ8 A;  4GZB A;  3C7V A;  5DTK A;  3WS1 A;  3VP2 A;  1L0F A;  4L0L A;  1LLB A;  4PMA A;  3AGE A;  4WZ4 A;  3ZNT A;  4JPM A;  2WKE A;  5I94 A;  5EOO A;  5FQJ A;  5DVA A;  2Z2L B;  4U0X A;  5EVI B;  3GV9 A;  3IF6 C;  4Y0U A;  1PW8 A;  3HUO A;  1EWZ A;  3LCE A;  4UAA A;  3N4I A;  4RX2 A;  1S6R A;  1NXY A;  1IYS A;  3W4Q A;  3N6I A;  2B5R A;  4LV3 A;  1ONG A;  4S2K A;  5GLC A;  3RJU A;  1CEG A;  3FKW A;  3Q7V B;  1YLY A;  4WZ5 A;  4KZB A;  1GA9 A;  1MWU A;  3OCL A;  4LV0 A;  4GDB A;  3RXW A;  2Y2P A;  2WYX A;  3G31 A;  3MXR A;  4JF6 A;  4KZ9 A;  5DF7 A;  2HDS A;  3LO7 A;  3DW0 A;  2XD5 A;  4U3T A;  4DE2 A;  1KDS A;  2OLV A;  1MY8 A;  1IKG A;  1KVM A;  4X68 A;  1NZO A;  4DRT A;  5M18 A;  3ZDJ A;  4IVI A;  1E3U D;  1H5X A;  1KVL A;  3QHY A;  3NIA A;  5CHU A;  5TR7 A;  1K6S A;  1FOF A;  3N7W A;  4N92 A;  1K55 A;  1DJC A;  4QD4 A;  4PM6 A;  5CRF A;  4OQH A;  3ZG5 A;  4B4Z A;  2WAF A;  3ZVW A;  5F1F A;  5CHM A;  2Y2O A;  3IXD A;  5DF9 A;  2EXA A;  4N1H A;  2VGJ A;  5TFQ A;  1SKF A;  3OPL A;  3NDG A;  4KQO A;  1PYY A;  2XEP A;  3IF5 A;  4PM8 A;  4HEF A;  5JYP A;  1N9B A;  4H8R A;  3BLM A;  4RYE A;  2HP6 A;  3S1Y A;  3HLC A;  4UA6 A;  4GD6 A;  3BYD A;  3PBR A;  2Y2G A;  2ZC6 B;  2H0Y A;  1K6R A;  1IKI A;  3NCK A;  5FQK A;  1J9M A;  5BOH A;  5AQ7 A;  2ZC4 B;  4S2N A;  2WKI A;  3VP0 A;  3GTC A;  3HUN A;  4JF5 A;  4OQ0 A;  1BLC A;  1M6K A;  5AQB A;  4YIN A;  2V1Z A;  1GHP A;  1L0D A;  1S0W A;  3GSG A;  2WGW A;  1PW1 A;  1RGZ A;  5EVI C;  1JWV A;  4GNU A;  2ZM2 A;  3HLB A;  4HBT A;  2XFS A;  2V20 A;  1K57 A;  3CMZ A;  5KSC A;  4MBF A;  2Y4A A;  3PBT A;  3FV7 A;  1ERQ A;  4P85 A;  3MBZ A;  1RCJ A;  4X56 A;  4XUX A;  2C6W B;  4FSF A;  4OKP A;  1WYC A;  1K25 A;  3G2Y A;  3IXB A;  3LY4 A;  5A93 A;  3NY4 A;  2ZJ9 A;  4OQI A;  4S2M A;  1M40 A;  4BL2 A;  1E25 A;  5HW3 A;  3W8K A;  3DWZ A;  4XXR A;  1H8Y A;  2P9V A;  5E2G A;  3A3E A;  3VMA A;  1ALQ A;  1SDN A;  4E3O A;  4WMC A;  3O3V A;  1YLJ A;  1NYM A;  4EWF A;  3UE1 A;  3PBQ A;  3UE3 A;  4ZDX A;  4WMC D;  3OCN A;  3S22 A;  4WEJ A;  3UPP A;  3UNW A;  5CER A;  2JBF A;  1MWS A;  3ZHH A;  4ZBE A;  1I2S A;  3VSK A;  4GDN A;  4BLM A;  4ZJ2 A;  4GOG A;  4WM9 A;  1OME A;  1VM1 A;  5FQ9 A;  4DDY A;  2WUQ A;  2CC1 A;  1L2S A;  4JKT A;  2QMI A;  5HL1 A;  5L2F A;  3VP1 A;  3ZG0 A;  3A3F A;  5M19 A;  4QU3 A;  4R23 A;  4PM7 A;  1BSG A;  3CG5 A;  1WYB A;  5FA7 A;  5HAP A;  4JLF A;  5EUA A;  3GVB A;  4OVD A;  4ZJ1 A;  1L0G A;  4K91 A;  4BJP A;  1VQQ A;  2E8I A;  4NET A;  2RCX A;  3HBR A;  4JXV A;  3WS2 A;  2A49 A;  2J7V A;  2XH9 A;  5HX9 A;  1FR1 A;  4WEK A;  1MKI A;  1KE3 A;  3BFD A;  3W4O A;  2A3U A;  3N8L A;  4E3J A;  1CEF A;  4E3N A;  5D3O A;  1LI0 A;  4OPZ A;  4MEZ A;  2ZC7 A;  3SS3 A;  2J8Y A;  4ID4 A;  3UDI A;  5F1G A;  4S2J A;  3O87 A;  4KQR A;  4E3L A;  1K56 A;  3M6H A;  1ESI A;  4CPK A;  2WGW B;  4P0M A;  4EUZ A;  1C3B A;  5GL9 A;  3OC2 A;  2WAE A;  1YM1 A;  2RL3 A;  3EQU A;  1H8Z A;  2FFF B;  5U47 A;  3WWX A;  1FCO A;  1K56 D;  3NC8 A;  3OPR A;  1XA7 A;  4S2O A;  2ZQ8 A;  5FSR A;  2ZM0 A;  3B3X A;  3MKF A;  5A91 A;  1RGY A;  4PM5 A;  1FQG A;  5FAO A;  4ZAM A;  1I2W A;  3G4P A;  2Z2M B;  1ESU A;  1K4E A;  3WS0 A;  2ZM8 A;  3G35 A;  2HDQ A;  1YMS A;  4JXG A;  5GLB A;  3N8R A;  2BG1 A;  1E3U A;  3QNB A;  4FH2 A;  1K4F A;  1YLT A;  4IBX A;  4EBL A;  4QJG A;  3PBN A;  3UN7 A;  1AXB A;  4JXS A;  5A90 A;  2P9V B;  4A5R A;  2FFY A;  3D4F A;  1YLW A;  1Q2P A;  2DNS A;  4N1X A;  3IXG A;  1ES4 A;  4LV2 A;  4Y0T A;  3AGF A;  1BLP A;  3HL9 A;  4S2I A;  2OSU A;  3DWK A;  3ZG8 B;  2ZD8 A;  1W79 A;  2X02 A;  5CGX A;  3RXX A;  1BLH A;  2Y2Q A;  5E2E A;  1XXM A;  3NDE A;  4O7D A;  3WRZ A;  3ZG9 B;  4D2O A;  1MXO A;  3ZCZ A;  1TDG A;  4BD0 A;  1KDW A;  2Y2I A;  4BD1 A;  3GMW A;  5DTT A;  3P09 A;  4E3K A;  3BFG A;  3C4O A;  1GHI A;  1FCN A;  3EQV A;  1HD8 A;  1PWD A;  2JE5 A;  4OOM A;  1YLZ A;  1RP5 A;  1PZP A;  2HPB A;  3BFE A;  4S2N C;  3TSG A;  4EV4 A;  4JBF A;  1TEM A;  4E6W A;  3P98 A;  1O7E A;  1MWT A;  2JC7 A;  3AGD A;  2P74 A;  1JTG A;  4IVK A;  3A3J A;  5GLA A;  3C7U A;  4DXB A;  4EQI A;  4NK3 A;  1PWG A;  4PPR A;  3ZVT A;  1K57 C;  4C3Q A;  3OPP A;  4K0X A;  4LV1 A;  4UHU A;  3MZF A;  1HTZ A;  1PI4 A;  3GR2 A;  3BFC A;  3Q81 A;  5FAT A;  5GHX A;  5FDH A;  1GHM A;  3VSL A;  1YLP A;  4X69 A;  1EI5 A;  3WRT A;  2BLS A;  2WZX A;  1W7F A;  5FQI A;  1CI9 A;  5A92 A;  1K54 C;  5EVI A;  3I7J A;  2Q9N A;  3IQA A;  3MKE A;  3N8S A;  1JWZ A;  4ZTK A;  3M2K A;  3VFH A;  2IWD A;  2XGN A;  5AQA A;  3C5A A;  4X55 A;  1GCE A;  3HLD A;  5GHZ A;  4DE0 A;  5EVI D;  1XA1 A;  2XD1 A;  1MBL A;  4OPR A;  1K38 A;  1XPB A;  1IEL A;  5CTM A;  4K0W A;  5CTN A;  2Y2L A;  3ITA A;  4F94 A;  3Q07 A;  3CZD A;  1FSY A;  2HDR A;  4RA7 A;  1ZC2 A;  5HAQ A;  2WGV A;  1YMX A;  4QHC A;  4E6X A;  5GHY A;  5AQ9 A;  3G32 A;  2Y2M A;  1ZKJ A;  4KZ6 A;  1DY6 A;  1G6A A;  2HP5 A;  4R1G A;  1O07 A;  3IWQ A;  4KZ4 A;  4B88 A;  3HUM A;  4KG2 A;  2C5W B;  2ZQA A;  5CEB A;  3VP3 A;  4DXC A;  3SH8 A;  3CJM A;  3FZC A;  5E43 A;  3UPO A;  1TDL A;  4Y7P A;  1I5Q A;  4DF6 A;  4KEN B;  4OPQ A;  3V3R A;  4QY5 A;  2J9P A;  5TGF A;  3HLW A;  5FQM A;  1LHY A;  5GLD A;  5E2F A;  3M6B A;  2WZZ A;  2GDN A;  1ZG6 A;  4EBN A;  1XGJ A;  2R9W A;  1HZO A;  3Q1F A;  3ITB A;  4GB7 A;  4BEN A;  3GQZ A;  4KZ7 A;  2J9O A;  2QZ6 A;  5FAP A;  3TG9 A;  4DE1 A;  4E3M A;  3PTE A;  5EOE A;  3BFF A;  2Y59 A;  3IWO A;  3UPN A;  3V39 A;  2I72 A;  2EX9 A;  2ZQ9 A;  3ZNY A;  1IYQ A;  3FYZ A;  4BQM A;  2VGK A;  1NY0 A;  2HP9 A;  2JCH A;  4WBG A;  3SH9 A;  2XK1 A;  2OLU A;  1SHV A;  3G34 A;  5FI2 A;  5CGS A;  3JYI A;  3MZE A;  1BZA A;  1KGE A;  1XX2 A;  3LY3 A;  5EEC A;  1ONH A;  3HVF A;  3OPH A;  3G30 A;  2ZQD A;  1KGG A;  1PWC A;  3BRM A;  5FI7 A;  4WZ5 C;  4KQQ A;  3W4P A;  4C75 A;  4R3B A;  4EBP A;  3E2K A;  3SS4 A;  1CI8 A;  5JYO A;  2EFX A;  3IF6 A;  3ZFZ A;  1LL5 A;  3HLG A;  3UO9 A;  3V50 A;  1ERM A;  2WGI A;  4U0T A;  5HAI A;  4E3I A;  2H10 A;  4LCL A;  1ES3 A;  1BLS A;  1XKZ A;  4OQG A;  1NYY A;  2QPN A;  4Q8I A;  1K55 C;  1SDE A;  4ZJ3 A;  4KG5 A;  4WYY A;  5IHV A;  3HLE A;  1JWP A;  2EFU A;  1PIO A;  1N4O A;  2EX2 A;  3SS5 A;  1NJ4 A;  2ZQC A;  4UA7 A;  4FD8 A;  3O88 A;  5KZH A;  1KE0 A;  2XFT A;  5F83 A;  4KZ3 A;  3PAE A;  2XF3 A;  4GKU A;  1ZG4 A;  3A3D A;  4DKI A;  3TOI A;  3VOY A;  1WE4 A;  4YFM A;  3GRJ A;  4X6T A;  2ZQ7 A;  3IH9 A;  3O86 A;  4OLG A;  2DCF A;  1BT5 A;  3BM6 A;  5CED A;  1ERO A;  3BLS A;  4WEL A;  1MWR A;  2Y91 A;  5FI6 A;  5FQQ A;  2H5S A;  3NI9 A;  3MZD A;  2DRW A;  1JVJ A;  4M3K A;  3IHA A;  4JF4 A;  1W5D A;  4P87 A;  2Y55 A;  5EVL A;  5M1A A;  3NBL A;  2PU2 A;  2V2F F;  4OLD A;  2XDM A;  4GD8 A;  5E2H A;  3IHB A;  5F82 A;  2OV5 A;  4FCF A;  5DF8 A;  2Y2H A;  4FH4 A;  4JXW A;  2HDU A;  2Q9M A;  1BUE A;  1W8Y A;  1L0E A;  1PI5 A;  3WS5 A;  1ES2 A;  2PBY A;  4QY6 A;  2UWX A;  4OOY A;  1E4D A;  5DTS A;  5FAQ A;  3VOZ A;  5HAR A;  4KG6 A;  2ZMA A;  3A3I A;  1FCM A;  1YT4 A;  4OON A;  5J8X A;  5KMW A;  2X01 A;  2PU4 A;  3C4P A;  4OH0 A;  3IH8 A;  1G68 A;  2Y2K A;  3BEC A;  4KZ5 A;  3ZGA B;  4OP8 A;  1NRF A;  4HBU A;  1TVF A;  3ISG A;  4IBR A;  3SOI A;  4C6Y A;  5CHJ A;  3Q7V A;  2Y2N A;  1IYP A;  1XGI A;  1MPL A;  1XP4 A; 
#chains in the Genus database with same CATH topology
 3PBS A;  4MN7 A;  4GN2 A;  4HES A;  5FL3 A;  2XR0 A;  1LI9 A;  2EX6 A;  4S2L A;  4IED A;  3V3S A;  2WKH A;  4OP5 A;  2IWC A;  1KE4 A;  1Y54 A;  2HF6 A;  1GSX A;  3HRE A;  2WK0 A;  3G2Z A;  1STZ A;  2PR5 A;  4MBK A;  4UA9 A;  4L9F A;  1JTD A;  2IWB A;  2VZW A;  1IYO A;  5HDD A;  3FWL A;  4QB8 A;  4Y0O A;  1FR6 A;  5CXW A;  4B4X A;  4MLL A;  1ES5 A;  1S66 L;  3ZQ5 A;  1GA0 A;  4N9L A;  1BTL A;  3OZH A;  5DJT A;  3WS4 A;  3IS2 A;  3SH7 A;  2G2U A;  2H0T A;  1F2K A;  3MXQ A;  3FKV A;  4JPM A;  5I94 A;  5FQJ A;  4G3V A;  2Z2L B;  3ZYT A;  4UAA A;  2Y8H A;  1IYS A;  3W4Q A;  4LV3 A;  2B5R A;  1ONG A;  4HQA A;  1GA9 A;  1LL8 A;  2WKP A;  2WYX A;  3B42 A;  4NG2 A;  3MQ0 A;  1KDS A;  1KVM A;  3LEQ A;  1H5X A;  4GHI A;  3KO6 A;  1KVL A;  4EUV A;  5TJJ A;  5J3W A;  4Y2F A;  1K6S A;  1OJ5 A;  1K55 A;  4QD4 A;  4PM6 A;  2VGL S;  4B4Z A;  2PYR A;  3IXD A;  4N1H A;  4KQO A;  2J3T D;  2XEP A;  4HEF A;  2GX5 A;  3UB6 A;  1LSX A;  5JYP A;  2ZBB A;  2HP6 A;  3HLC A;  4UA6 A;  1PNE A;  5I5L A;  1K6R A;  4NXG A;  5FQK A;  1ZHH B;  4ARZ A;  1M6K A;  3T1X A;  1S0W A;  3GSG A;  3EWK A;  1PW1 A;  2D02 A;  1K57 A;  2Y4A A;  3FV7 A;  1Y28 A;  4P85 A;  3MBZ A;  1TS0 A;  1RCJ A;  3T4K A;  4FSF A;  1PRQ A;  3MQQ A;  1K25 A;  2E8J A;  2ZJ9 A;  4OQI A;  4NKP A;  1S1Z A;  1M40 A;  4BL2 A;  3E4P A;  3DWZ A;  4R6L A;  2G7U A;  5E2G A;  2W3G A;  1N9L A;  2H28 A;  4WMC D;  4I3J A;  5HZH A;  4WEJ A;  3UNW A;  2ZOI A;  3F1N B;  4ZBE A;  1OME A;  3LID A;  1L2S A;  3NHQ A;  3A3F A;  4QU3 A;  4R23 A;  5HAP A;  4ZJ1 A;  4DMZ A;  4BJP A;  2RCX A;  3HBR A;  3WS2 A;  5DKL A;  2XH9 A;  1FR1 A;  3IX8 A;  2A3U A;  4E3N A;  1LI0 A;  4MEZ A;  3SS3 A;  4ID4 A;  1SKO B;  5F1G A;  2V1B A;  4KQR A;  5GL9 A;  5U47 A;  1FCO A;  3MKF A;  1RGY A;  5FEF A;  2Z2M B;  3G35 A;  3B47 A;  1XJ2 A;  3LR3 A;  4EBL A;  4QJG A;  3PBN A;  1AXB A;  4JXS A;  3D4F A;  3IXG A;  4LV2 A;  2O9A A;  4PAU A;  4S2I A;  3HL9 A;  5EM0 A;  2YKF A;  2M1C A;  3ZG8 B;  3UME A;  1W79 A;  2X02 A;  4G3K A;  1BLH A;  2Y2Q A;  4O7D A;  1MXO A;  3LFV A;  2O0Y A;  1F5M A;  1OTD A;  4EW7 A;  5DTT A;  1DP9 A;  2VEA A;  3C4O A;  1FCN A;  2Y79 A;  4CLC C;  4CLC E;  1YAX A;  4PKY G;  2XSS A;  1YLZ A;  1PZP A;  3BFE A;  3NEC A;  4S2N C;  3T4T A;  2B18 A;  3P98 A;  1O7E A;  4WUJ A;  3C7U A;  4P6Z S;  4K0X A;  4UHU A;  3MZF A;  1HTZ A;  3GR2 A;  5FAT A;  1GHM A;  1V9Z A;  3MS6 A;  4MMN A;  3WRT A;  5FQI A;  2LB9 A;  4GS9 B;  5EVI A;  3IQA A;  1GSW A;  3LIF A;  2B02 A;  2IWD A;  2W0N A;  1G28 A;  2XD1 A;  3V67 A;  3HJK A;  5CTM A;  2J80 A;  3Q07 A;  2BAS A;  1FSY A;  2HDR A;  4E6X A;  4HH3 A;  2P08 A;  4EEP A;  4Q0H A;  3CHW P;  3G32 A;  2Y2M A;  1ZKJ A;  1G6A A;  4R1G A;  3KSG A;  4GLQ A;  3VP3 A;  1OPX A;  3FZC A;  3UPO A;  3LUQ A;  5HWW A;  3BW6 A;  4OPQ A;  5TGF A;  3HLW A;  2OWJ A;  5GLD A;  2V9A A;  4D60 A;  1DP8 A;  5E2F A;  3M6B A;  2WZZ A;  4EBN A;  4HI4 A;  1V9Y A;  4PKY A;  2J9O A;  4I3I A;  2VGK A;  1NY0 A;  2HP9 A;  2JCH A;  2XK1 A;  2OLU A;  3IBR A;  3MZE A;  4QPR A;  4NXB A;  3BRM A;  3JVU A;  3KX0 X;  4EBP A;  3SS4 A;  2PDR A;  3T4O A;  3V50 A;  2PBD P;  1ERM A;  5HAI A;  4LCL A;  4EES A;  4Q8I A;  1K55 C;  1SDE A;  4WYY A;  4YWZ A;  1JWP A;  1PIO A;  1N4O A;  5F68 A;  1NJ4 A;  3SS5 A;  4FD8 A;  4UQI M;  5KZH A;  4EET B;  2XFT A;  2XF3 A;  3A3D A;  4DKI A;  1WE4 A;  4YFM A;  4Y3I A;  3O86 A;  5HD3 A;  3BM6 A;  4WEL A;  5FQQ A;  1S1Y A;  1LT0 A;  3MZD A;  2DRW A;  4WN5 A;  1IFQ A;  5EVL A;  2V2F F;  2XDM A;  2ZL1 B;  2OV5 A;  5DF8 A;  2Y2H A;  4FH4 A;  2VA0 A;  2HDU A;  1DP6 A;  1F98 A;  1L0E A;  4OOY A;  3VOZ A;  5HAR A;  4KG6 A;  3A3I A;  2VJW A;  1G68 A;  1YSQ A;  5CHJ A;  2Y2N A;  1MPL A;  3D3O A;  1XP4 A;  1TS8 A;  3PXP A;  4AFI A;  3S4X A;  4N9K A;  3BY8 A;  3T50 A;  3UE0 A;  2XA7 S;  4LEN A;  4KZA A;  2A24 A;  1DJA A;  4ME4 A;  1ZTU A;  3K2N A;  5CGW A;  4EQ1 A;  2ZMF A;  4CJN A;  1H3Q A;  2INW A;  3IWI A;  3E0Y A;  3MJQ A;  1HVB A;  3UDF A;  4DE3 A;  3IT9 A;  3DTM A;  1BUL A;  2JKR M;  2QHK A;  4PM9 A;  1LL9 A;  3PBO A;  2PD7 A;  3BY9 A;  3U2A A;  3VFF A;  3BEB A;  5HPF A;  4LCM A;  4OPY A;  4LRX C;  2PYP A;  3E2L A;  2EX8 A;  2ZC5 B;  3WS1 A;  1PZO A;  4CLC B;  4PMA A;  1LLB A;  3CIT A;  5EOO A;  3LIA A;  1YKD A;  3IF6 C;  4HP4 A;  3H82 A;  3LCE A;  5IS1 A;  3NUL A;  4RX2 A;  4O0P A;  1T1A A;  3N6I A;  4FTX A;  3Q7V B;  4WZ5 A;  1YLY A;  2QJ7 A;  3OCL A;  4GDB A;  3MXR A;  4BWI A;  3DW0 A;  4U3T A;  3ZDJ A;  4IVI A;  3TRC A;  3QHY A;  4JGP A;  5LBR A;  4JGR A;  4N92 A;  4ETZ A;  5CRF A;  4MCW A;  4OQH A;  2WAF A;  5CHM A;  5DF9 A;  2OWH A;  5TFQ A;  1SKF A;  3OBF A;  3EEH A;  4EEU A;  1CQA A;  2ZC6 B;  2H0Y A;  3NCK A;  3GEC A;  5AQ7 A;  4S2N A;  4OQ0 A;  2L4R A;  2V1Z A;  2HZ5 A;  3OOV A;  1GHP A;  1L0D A;  3VV4 A;  5EVI C;  2V8F A;  4GNU A;  2V20 A;  3E98 A;  3PBT A;  3ICY A;  3IS2 B;  4IUK A;  3T4L A;  4ESP A;  2W1R A;  4XUX A;  3LY4 A;  3W8K A;  1CF0 A;  4Y17 A;  2P9V A;  3A3E A;  1MZU A;  5F6A A;  4WL9 A;  4GW9 A;  1YLJ A;  2EWW A;  4EWF A;  3PBQ A;  5HD5 A;  3UPP A;  3ZHH A;  3VSK A;  5TBM A;  4GOG A;  4DDY A;  4JKT A;  5HL1 A;  5AVF A;  1BSG A;  5EFW A;  4JLF A;  2EWV A;  1L0G A;  2E8I A;  4X25 A;  4NET A;  2A49 A;  1P9W A;  4WEK A;  4Q0I A;  4E3J A;  2ZC7 A;  2J8Y A;  4ARZ B;  4HOI A;  4IHQ A;  2W3F A;  4E3L A;  1K56 A;  3M6H A;  1ESI A;  4CPK A;  1XA7 A;  1UWP X;  3B3X A;  1XFN A;  2UV0 E;  5FAO A;  3G4P A;  4I5S A;  3K3C A;  3UN7 A;  3CLO A;  5A90 A;  1S4R A;  4A5R A;  5EM1 A;  4HJ6 A;  1JNU A;  1TS7 A;  4Y0T A;  2ZD8 A;  3CPT A;  3WRZ A;  4D2O A;  3ZCZ A;  1TDG A;  4BD0 A;  3MFX A;  3QP2 A;  1KDW A;  5G4Y A;  1P9R A;  3GMW A;  4DJ2 A;  1GHI A;  4ETX A;  2JE5 A;  4OOM A;  1RP5 A;  1OTA A;  3TSG A;  1TEM A;  1VEU A;  3AGD A;  5A8B A;  1JTG A;  2VV8 A;  4DXB A;  4NK3 A;  1PWG A;  3ZVT A;  3DAV A;  4LV1 A;  2MJ6 A;  1ODV A;  5GHX A;  5FDH A;  4GCZ A;  1YLP A;  4X69 A;  1CI9 A;  3G6O A;  3RH8 B;  2XGN A;  5AQA A;  3C5A A;  1GCE A;  3HLD A;  1XA1 A;  1LSW A;  1K38 A;  4K0W A;  4X1L A;  2Y2L A;  3ITA A;  4F94 A;  3CZD A;  1OJG A;  4RA7 A;  1ZC2 A;  2WGV A;  5HWT A;  3LGO A;  1YMX A;  4MN6 A;  2QWS A;  5AQ9 A;  4KZ6 A;  4B88 A;  3VOL A;  4KG2 A;  5CEB A;  3CJM A;  1I5Q A;  2K2N A;  4QY5 A;  5AVE A;  1G5U A;  3S7P A;  1PFL A;  1ZG6 A;  4NXF A;  4YNR A;  1HZO A;  3Q1F A;  4CQH A;  3SW1 A;  4MN5 A;  3GQZ A;  3C30 A;  2Z6D A;  2NUP C;  2HGV A;  3BFF A;  1ACF A;  2VX8 A;  2EX9 A;  4WBG A;  3CWF A;  1SHV A;  1KGE A;  1ONH A;  2Q0O A;  4HH2 A;  1FIK A;  2ZQD A;  1PWC A;  4WZ5 C;  3W4P A;  4FOF A;  3LR0 A;  2XRN A;  3IF6 A;  3ZFZ A;  1LL5 A;  1T18 A;  3P01 A;  5L10 A;  2K7S A;  4RQ9 A;  2H10 A;  1BLS A;  1NYY A;  1VET B;  2W1T A;  4KG5 A;  3T4S A;  3A0R A;  3E4Q A;  3KSH A;  4L9E A;  5IT5 A;  4KZ3 A;  5FDS A;  3DTE A;  3VOY A;  4DN0 A;  4B9O A;  3S7Q A;  4HHD A;  3T4Q A;  4LRZ E;  4OLG A;  5EV0 A;  3O5Y A;  1KOU A;  2PU2 A;  1TF1 A;  4OLD A;  4GD8 A;  3IHB A;  2VK3 A;  2Q9M A;  3WS5 A;  3T4J A;  2PBY A;  4CLC D;  1WA9 A;  2PRF A;  4HIA A;  2ZMA A;  3L9K A;  1NLY A;  1YT4 A;  2X01 A;  3C4P A;  4OH0 A;  3IH8 A;  3BEC A;  1LSV A;  2W27 A;  3SOI A;  4IUH A;  4JGQ A;  1S67 L;  2JKG A;  1CK3 A;  1DRM A;  1QMF A;  3C38 A;  3MFD A;  4BMW A;  1K54 A;  1FSW A;  1QME A;  2VKS A;  4Z1W A;  1W63 Q;  1IEM A;  1KGF A;  4XUZ A;  5HFO A;  3ZG7 B;  2XLN A;  5EPH A;  3HLF A;  4Q0J A;  3P7N A;  5G18 A;  3U4L P;  4RX3 A;  5L07 A;  1T1B A;  2JKR I;  1YQS A;  3M2J A;  3IXH A;  1BYW A;  4O8G A;  4R3J A;  4F3L A;  3Q7Z A;  4Z9Q A;  3LI8 A;  2XQZ A;  3KYQ A;  1GSV A;  3MXS A;  4DDS A;  1G6O A;  4MBH A;  5KSH A;  2EXB A;  4R70 A;  1MKM A;  2ZC3 B;  3OLO A;  3ZVW A;  1Z6F A;  4KZ8 A;  3C7V A;  3VP2 A;  2WKE A;  5KIZ A;  1T19 A;  5DVA A;  3GV9 A;  4Y0U A;  4X1M A;  3S7O A;  3NOT C;  3N4I A;  1S6R A;  3UMD A;  3A0V A;  3F1O A;  5GLC A;  4S2K A;  1CEG A;  3BJN A;  3CUE A;  1MWU A;  4LV0 A;  5DKK A;  3H7W A;  1AWI A;  2GNX A;  3RXW A;  4LLO B;  4KZ9 A;  5DF7 A;  2HDS A;  2KX6 A;  4DE2 A;  2XD5 A;  2OLV A;  1MY8 A;  2L1M A;  1IKG A;  3W2Z A;  4DRT A;  5M18 A;  2A24 B;  2VGL M;  3NIA A;  5TR7 A;  3L7H A;  2ZOH A;  1XJ3 A;  2Y2O A;  4XT2 A;  2EXA A;  2VGJ A;  4MDZ A;  1PYY A;  3IF5 A;  4PM8 A;  1N9B A;  1Z09 A;  4H8R A;  4RYE A;  4GD6 A;  3BYD A;  3PBR A;  5F5Y A;  1IKI A;  2V1A A;  3C2W A;  4B93 A;  1J9M A;  2ZC4 B;  2ACG A;  2PD8 A;  3GTC A;  4JF5 A;  4JGO A;  3VP0 A;  1BLC A;  5AQB A;  4Y13 A;  2WGW A;  1JWV A;  3NJA A;  2XFS A;  4HBT A;  2R78 A;  2OOL A;  3IXB A;  4L9G A;  2M7V A;  4S2M A;  1MC0 A;  5HW3 A;  1H8Y A;  2VLG A;  3IX4 A;  3QP4 A;  3H82 B;  4H6J A;  4E3O A;  4WMC A;  3O3V A;  5FEG A;  3S22 A;  3DTK A;  5IU1 A;  3F1P A;  2JBF A;  1MWS A;  3FC7 A;  1VM1 A;  5FQ9 A;  2WUQ A;  2QMI A;  3VP1 A;  3CG5 A;  5EUA A;  3GVB A;  4OVD A;  2KDK A;  1VQQ A;  3EGX C;  5HX9 A;  1MKI A;  3BFD A;  5MC7 A;  4I39 A;  3N8L A;  5K5B A;  1CEF A;  5D3O A;  3IX3 A;  3UDI A;  2PAV P;  4QWO A;  3BQ8 A;  4EUZ A;  1C3B A;  3OC2 A;  2RL3 A;  3GDI A;  2FFF B;  3ZG5 A;  3WWX A;  2ZQ8 A;  1FQG A;  4ZAM A;  3WS0 A;  2ZM8 A;  4LFU A;  5GLB A;  4JXG A;  3SZT A;  1E3U A;  3QNB A;  4FH2 A;  1K4F A;  1YLT A;  4IBX A;  2P9V B;  5C5K A;  1Q2P A;  2OSU A;  3DWK A;  5CGX A;  3RXX A;  2JN7 A;  5J7E A;  5E2E A;  1XXM A;  3NDE A;  2Z6C A;  3ZG9 B;  5TBM B;  3BWL A;  3T12 B;  3C8C A;  4BD1 A;  3MQO A;  3EQV A;  1HD8 A;  5HSQ A;  2HPB A;  4EV4 A;  4JBF A;  1MWT A;  4P6Z M;  2L0W A;  3BQA A;  4IVK A;  3A3J A;  3UB9 A;  2KLI A;  1S4S A;  3QP5 A;  4EQI A;  3OPP A;  4BBU A;  1PI4 A;  3Q81 A;  3R7W A;  1EI5 A;  2BLS A;  2KOI A;  1W7F A;  5A92 A;  1K54 C;  3MKE A;  3LIB A;  4ZTK A;  1JWZ A;  5J4E A;  5GHZ A;  3MR0 A;  5EVI D;  1MBL A;  4OPR A;  1IEL A;  4O01 A;  5CX7 A;  4QHC A;  5GHY A;  1DY6 A;  2HP5 A;  4GHI B;  3HUM A;  1OTI A;  2C5W B;  2ZQA A;  4DXC A;  2XRO A;  5E43 A;  1TDL A;  4Y7P A;  4DF6 A;  4KEN B;  3CPT B;  5FQM A;  1LHY A;  1XGJ A;  3ITB A;  4GB7 A;  4BEN A;  5FAP A;  2K31 A;  4DE1 A;  1VEU B;  1D1J A;  2Y59 A;  4KQD A;  2ZQ9 A;  4DJ3 A;  3ZNY A;  1IYQ A;  4BQM A;  3G34 A;  5FI2 A;  5CGS A;  1XX2 A;  3LY3 A;  5EEC A;  3OPH A;  3G30 A;  1KGG A;  2VV7 A;  1NWZ A;  4KQQ A;  3CUE C;  4R3B A;  3E2K A;  2O9B A;  5JYO A;  2EFX A;  2DMW A;  2GJ3 A;  1T1C A;  3UO9 A;  4FUW A;  4U0T A;  4E3I A;  1ES3 A;  4OQG A;  5IHV A;  3HLE A;  2EFU A;  5HDS A;  2J3T C;  2EX2 A;  4WLA A;  4UA7 A;  5HDC A;  3O88 A;  1KE0 A;  4Y15 A;  5F83 A;  3PAE A;  1ZG4 A;  4IJG A;  3TOI A;  3GRJ A;  2ZQ7 A;  4I3A A;  4UQI S;  3IH9 A;  1A0K A;  1ERO A;  3BLS A;  1N9N A;  3NI9 A;  1JVJ A;  1W5D A;  4P87 A;  2Y55 A;  1VHM A;  5M1A A;  3NBL A;  4GJ4 A;  4FCF A;  4JXW A;  1BUE A;  4HNB A;  1ES2 A;  3LYX A;  1OT6 A;  3TW8 A;  2B95 A;  1FCM A;  4OON A;  3T1Q B;  5J8X A;  2PU4 A;  4KUO A;  2Y2K A;  4OP8 A;  1NRF A;  3ISG A;  5L09 A;  1XGI A;  2XA7 M;  4OOL A;  4MNR A;  5CEC A;  4P6B A;  3D72 A;  3Q82 A;  4BL3 A;  5HWV A;  3IF6 B;  4R0Q A;  2R9X A;  1Q2Q A;  5HL6 A;  1W8Q A;  3TE8 A;  3VP4 A;  2WAD A;  3UDX A;  2X71 A;  1SCW A;  3LR5 A;  4S2P A;  2W1T B;  2Y2J A;  3UY6 A;  2ZLY A;  1U60 A;  4R4R A;  1H0M A;  3FG8 A;  4RVA A;  1L3L A;  2G2W A;  4HY8 A;  1XJ4 A;  2JKF A;  3LEZ A;  5FAS A;  1DJB A;  4R4S A;  4LRY C;  4X53 A;  5EE8 A;  1OT9 A;  3PAG A;  3T1S A;  1NZU A;  2PR6 A;  1VB6 A;  3V5M A;  3QNC A;  5DTK A;  4ZRR A;  4GZB A;  5L8M A;  3MSH A;  1L0F A;  4L0L A;  4WZ4 A;  3AGE A;  3ZNT A;  1YSP A;  4I38 A;  4M4X A;  4U0X A;  5EVI B;  4Y5F A;  1PW8 A;  3HUO A;  2P04 A;  1EWZ A;  2JHE A;  2WKR A;  1NXY A;  3RJU A;  3FKW A;  3TJZ C;  4KZB A;  2M7U A;  1P0Z A;  3LIC A;  2Y2P A;  2I9V A;  3A0S A;  1Y4O A;  3G31 A;  3F1N A;  4JF6 A;  3LO7 A;  4X68 A;  1NZO A;  1E3U D;  4II7 A;  5CHU A;  3HCY A;  3JPU A;  1FOF A;  3N7W A;  5G4Z A;  1DJC A;  3ULF A;  5F1F A;  4R3A A;  1J3W A;  4HJ4 A;  1EW0 A;  3OPL A;  3NDG A;  3LR4 A;  4F3L B;  1UGU A;  1H8M A;  5DJU A;  3BLM A;  3S1Y A;  4KUK A;  2Y2G A;  2P7J A;  1SKO A;  5BOH A;  2WKI A;  3HUN A;  4YIN A;  3NOP C;  3NOU C;  2IA2 A;  1RGZ A;  3VE4 A;  3S7N A;  1N9O A;  3QP1 A;  2OAQ 1;  2ZM2 A;  1TS6 A;  3HLB A;  5AJG A;  5KSC A;  3CMZ A;  4MBF A;  2LB5 A;  3CAX A;  2QJ5 A;  3FPW A;  1ERQ A;  4X56 A;  2C6W B;  4OKP A;  1WYC A;  3G2Y A;  5A93 A;  3NY4 A;  3IBJ A;  1E25 A;  4NEE D;  4XXR A;  2V8C A;  3VMA A;  1OTE A;  1ALQ A;  1SDN A;  5HPI A;  1NYM A;  3F1O B;  4WF0 A;  1VET A;  1K0K A;  2CMN A;  2O9C A;  3UE1 A;  3UE3 A;  4ZDX A;  2GZA A;  3H7W B;  1P97 A;  5CER A;  1I2S A;  4GDN A;  4BLM A;  4ZJ2 A;  4WM9 A;  2CC1 A;  5L2F A;  3ZG0 A;  5M19 A;  4PM7 A;  5FA7 A;  1WYB A;  3LIE A;  4HJ3 A;  2BTF P;  3KSF A;  4K91 A;  2AVX A;  4XT2 B;  3MF0 A;  4JXV A;  4HP9 A;  2J7V A;  2JKT I;  3H9W A;  1KE3 A;  1CJF A;  2YKH A;  3W4O A;  4OPZ A;  4S2J A;  4YOF A;  3O87 A;  4GS9 A;  2WGW B;  4P0M A;  2WAE A;  1YM1 A;  3EQU A;  1H8Z A;  4LPZ A;  1K56 D;  3NC8 A;  3OPR A;  4S2O A;  5FSR A;  2ZM0 A;  4PM5 A;  5A91 A;  2HJ9 C;  3UB7 A;  1I2W A;  2V0U A;  2QYB A;  1ESU A;  1K4E A;  1NRJ A;  2HDQ A;  1YMS A;  3N8R A;  2BG1 A;  2D01 A;  4R38 A;  2FFY A;  1YLW A;  2DNS A;  4H6J B;  4N1X A;  1ES4 A;  2W3H A;  3AGF A;  1BLP A;  2J3W A;  3KYE A;  3EOI A;  3CI6 A;  3T1R A;  3F1P B;  2W3E A;  2Y2I A;  3PHY A;  3P09 A;  4E3K A;  3BFG A;  1YPR A;  1PWD A;  4E6W A;  2JC7 A;  1X0O A;  3DBA A;  1NLZ A;  2P74 A;  5GLA A;  5F69 A;  3D9Y A;  4PPR A;  1K57 C;  4C3Q A;  2EA9 A;  3BFC A;  3VSL A;  2A2L A;  2WZX A;  3KYZ A;  3QP8 A;  4UEY A;  3UE6 A;  4E04 A;  3N8S A;  3I7J A;  2Q9N A;  3UB5 P;  3VFH A;  3M2K A;  4X55 A;  4DE0 A;  1D06 A;  3LI9 A;  4PHT A;  1XPB A;  5CTN A;  2WKQ A;  2PT7 A;  3QP6 A;  3PYP A;  5HAQ A;  4EXO A;  2FZ0 A;  2W3D A;  4EU0 A;  3MMH A;  5DFY A;  3RFB A;  3VE3 A;  1O07 A;  3IWQ A;  4KZ4 A;  1HLU P;  3SH8 A;  1OTB A;  3V3R A;  2J9P A;  1UWN X;  2GDN A;  2ZL1 A;  2R9W A;  3EEA A;  4K08 A;  4KZ7 A;  2QZ6 A;  3TG9 A;  1XFQ A;  2FH5 A;  4E3M A;  2JKT M;  3PTE A;  5EOE A;  2V0W A;  1XJ6 A;  3IWO A;  3UPN A;  2NUT C;  3V39 A;  2I72 A;  3FYZ A;  3UB8 A;  3SH9 A;  1FIL A;  3DTI A;  3JYI A;  1BZA A;  3E4O A;  3R4K A;  3RTY A;  3HVF A;  5FI7 A;  2ZMV A;  4C75 A;  1IOU A;  1CI8 A;  3R7W B;  2QKP A;  3HJI A;  3HLG A;  4G3W A;  2WGI A;  1XKZ A;  2QPN A;  1TD5 A;  4ZJ3 A;  4BBV A;  2HV1 A;  5DFX A;  2O99 A;  1F9I A;  2ZQC A;  4BBT A;  5EVE A;  1W63 M;  4GKU A;  4EER A;  2VV6 A;  3JVV A;  4X6T A;  1D7E A;  4LGW A;  2DCF A;  1BT5 A;  1SZV A;  5CED A;  5FI6 A;  1MWR A;  2Y91 A;  3B33 A;  2H5S A;  3PR6 A;  4M3K A;  3IHA A;  4JF4 A;  3FPV A;  5E2H A;  4NXE A;  3EGD C;  5F82 A;  4CLC A;  3KSI A;  1W8Y A;  1PI5 A;  2OAP 1;  5DTS A;  4QY6 A;  2UWX A;  5FAQ A;  1E4D A;  3K3D A;  5KMW A;  2PHY A;  3ZGA B;  4KZ5 A;  4HBU A;  1TVF A;  2HJE A;  4IBR A;  4C6Y A;  3Q7V A;  1IYP A;  3OCN A; 
#chains in the Genus database with same CATH homology
 1CK3 A;  3PBS A;  1QMF A;  3S4X A;  4OOL A;  3MFD A;  4MNR A;  4GN2 A;  4N9K A;  5CEC A;  4HES A;  4P6B A;  1K54 A;  1FSW A;  1QME A;  3UE0 A;  4LEN A;  3Q82 A;  4KZA A;  4BL3 A;  2XR0 A;  1LI9 A;  1IEM A;  1KGF A;  2EX6 A;  3IF6 B;  2R9X A;  1Q2Q A;  4R0Q A;  4XUZ A;  5HFO A;  3ZG7 B;  4S2L A;  2XLN A;  4IED A;  1W8Q A;  5EPH A;  3V3S A;  2WKH A;  1DJA A;  4OP5 A;  2IWC A;  1KE4 A;  5CGW A;  1Y54 A;  3HLF A;  3VP4 A;  4CJN A;  2WAD A;  3HRE A;  2WK0 A;  3G2Z A;  5G18 A;  3UDX A;  3IWI A;  2X71 A;  4RX3 A;  1SCW A;  4S2P A;  4MBK A;  4UA9 A;  1JTD A;  2IWB A;  2Y2J A;  3UY6 A;  1YQS A;  3M2J A;  2ZLY A;  1U60 A;  3IXH A;  1HVB A;  4R4R A;  3UDF A;  4R3J A;  3Q7Z A;  1IYO A;  4Z9Q A;  4DE3 A;  4RVA A;  3IT9 A;  3FWL A;  4QB8 A;  2G2W A;  3DTM A;  1BUL A;  4Y0O A;  1FR6 A;  5CXW A;  4B4X A;  2XQZ A;  4PM9 A;  1LL9 A;  3PBO A;  3MXS A;  3LEZ A;  4MLL A;  4DDS A;  1ES5 A;  5FAS A;  1GA0 A;  3BEB A;  4N9L A;  1BTL A;  3VFF A;  1DJB A;  3OZH A;  4LCM A;  4MBH A;  4R4S A;  4X53 A;  5KSH A;  4OPY A;  5EE8 A;  3PAG A;  2EXB A;  3WS4 A;  1NZU A;  2ZC3 B;  3E2L A;  2EX8 A;  3SH7 A;  2G2U A;  2H0T A;  2ZC5 B;  3QNC A;  3V5M A;  1Z6F A;  3FKV A;  1PZO A;  4KZ8 A;  4GZB A;  3C7V A;  5DTK A;  3WS1 A;  3VP2 A;  1L0F A;  4L0L A;  1LLB A;  4PMA A;  3AGE A;  4WZ4 A;  3ZNT A;  4JPM A;  2WKE A;  5I94 A;  5EOO A;  5FQJ A;  5DVA A;  2Z2L B;  4U0X A;  5EVI B;  3GV9 A;  3IF6 C;  4Y0U A;  1PW8 A;  3HUO A;  1EWZ A;  3LCE A;  4UAA A;  3N4I A;  4RX2 A;  1S6R A;  1NXY A;  1IYS A;  3W4Q A;  3N6I A;  2B5R A;  4LV3 A;  1ONG A;  4S2K A;  5GLC A;  3RJU A;  1CEG A;  3FKW A;  3Q7V B;  1YLY A;  4WZ5 A;  4KZB A;  1GA9 A;  1MWU A;  3OCL A;  4LV0 A;  4GDB A;  3RXW A;  2Y2P A;  2WYX A;  3G31 A;  3MXR A;  4JF6 A;  4KZ9 A;  5DF7 A;  2HDS A;  3LO7 A;  3DW0 A;  2XD5 A;  4U3T A;  4DE2 A;  1KDS A;  2OLV A;  1MY8 A;  1IKG A;  1KVM A;  4X68 A;  1NZO A;  4DRT A;  5M18 A;  3ZDJ A;  4IVI A;  1E3U D;  1H5X A;  1KVL A;  3QHY A;  3NIA A;  5CHU A;  5TR7 A;  1K6S A;  1FOF A;  3N7W A;  4N92 A;  1K55 A;  1DJC A;  4QD4 A;  4PM6 A;  5CRF A;  4OQH A;  3ZG5 A;  4B4Z A;  2WAF A;  3ZVW A;  5F1F A;  5CHM A;  2Y2O A;  3IXD A;  5DF9 A;  2EXA A;  4N1H A;  2VGJ A;  5TFQ A;  1SKF A;  3OPL A;  3NDG A;  4KQO A;  1PYY A;  2XEP A;  3IF5 A;  4PM8 A;  4HEF A;  5JYP A;  1N9B A;  4H8R A;  3BLM A;  4RYE A;  2HP6 A;  3S1Y A;  3HLC A;  4UA6 A;  4GD6 A;  3BYD A;  3PBR A;  2Y2G A;  2ZC6 B;  2H0Y A;  1K6R A;  1IKI A;  3NCK A;  5FQK A;  1J9M A;  5BOH A;  5AQ7 A;  2ZC4 B;  4S2N A;  2WKI A;  3VP0 A;  3GTC A;  3HUN A;  4JF5 A;  4OQ0 A;  1BLC A;  1M6K A;  5AQB A;  4YIN A;  2V1Z A;  1GHP A;  1L0D A;  1S0W A;  3GSG A;  2WGW A;  1PW1 A;  1RGZ A;  5EVI C;  1JWV A;  4GNU A;  2ZM2 A;  3HLB A;  4HBT A;  2XFS A;  2V20 A;  1K57 A;  3CMZ A;  5KSC A;  4MBF A;  2Y4A A;  3PBT A;  3FV7 A;  1ERQ A;  4P85 A;  3MBZ A;  1RCJ A;  4X56 A;  4XUX A;  2C6W B;  4FSF A;  4OKP A;  1WYC A;  1K25 A;  3G2Y A;  3IXB A;  3LY4 A;  5A93 A;  3NY4 A;  2ZJ9 A;  4OQI A;  4S2M A;  1M40 A;  4BL2 A;  1E25 A;  5HW3 A;  3W8K A;  3DWZ A;  4XXR A;  1H8Y A;  2P9V A;  5E2G A;  3A3E A;  3VMA A;  1ALQ A;  1SDN A;  4E3O A;  4WMC A;  3O3V A;  1YLJ A;  1NYM A;  4EWF A;  3UE1 A;  3PBQ A;  3UE3 A;  4ZDX A;  4WMC D;  3OCN A;  3S22 A;  4WEJ A;  3UPP A;  3UNW A;  5CER A;  2JBF A;  1MWS A;  3ZHH A;  4ZBE A;  1I2S A;  3VSK A;  4GDN A;  4BLM A;  4ZJ2 A;  4GOG A;  4WM9 A;  1OME A;  1VM1 A;  5FQ9 A;  4DDY A;  2WUQ A;  2CC1 A;  1L2S A;  4JKT A;  2QMI A;  5HL1 A;  5L2F A;  3VP1 A;  3ZG0 A;  3A3F A;  5M19 A;  4QU3 A;  4R23 A;  4PM7 A;  1BSG A;  3CG5 A;  1WYB A;  5FA7 A;  5HAP A;  4JLF A;  5EUA A;  3GVB A;  4OVD A;  4ZJ1 A;  1L0G A;  4K91 A;  4BJP A;  1VQQ A;  2E8I A;  4NET A;  2RCX A;  3HBR A;  4JXV A;  3WS2 A;  2A49 A;  2J7V A;  2XH9 A;  5HX9 A;  1FR1 A;  4WEK A;  1MKI A;  1KE3 A;  3BFD A;  3W4O A;  2A3U A;  3N8L A;  4E3J A;  1CEF A;  4E3N A;  5D3O A;  1LI0 A;  4OPZ A;  4MEZ A;  2ZC7 A;  3SS3 A;  2J8Y A;  4ID4 A;  3UDI A;  5F1G A;  4S2J A;  3O87 A;  4KQR A;  4E3L A;  1K56 A;  3M6H A;  1ESI A;  4CPK A;  2WGW B;  4P0M A;  4EUZ A;  1C3B A;  5GL9 A;  3OC2 A;  2WAE A;  1YM1 A;  2RL3 A;  3EQU A;  1H8Z A;  2FFF B;  5U47 A;  3WWX A;  1FCO A;  1K56 D;  3NC8 A;  3OPR A;  1XA7 A;  4S2O A;  2ZQ8 A;  5FSR A;  2ZM0 A;  3B3X A;  3MKF A;  5A91 A;  1RGY A;  4PM5 A;  1FQG A;  5FAO A;  4ZAM A;  1I2W A;  3G4P A;  2Z2M B;  1ESU A;  1K4E A;  3WS0 A;  2ZM8 A;  3G35 A;  2HDQ A;  1YMS A;  4JXG A;  5GLB A;  3N8R A;  2BG1 A;  1E3U A;  3QNB A;  4FH2 A;  1K4F A;  1YLT A;  4IBX A;  4EBL A;  4QJG A;  3PBN A;  3UN7 A;  1AXB A;  4JXS A;  5A90 A;  2P9V B;  4A5R A;  2FFY A;  3D4F A;  1YLW A;  1Q2P A;  2DNS A;  4N1X A;  3IXG A;  1ES4 A;  4LV2 A;  4Y0T A;  3AGF A;  1BLP A;  3HL9 A;  4S2I A;  2OSU A;  3DWK A;  3ZG8 B;  2ZD8 A;  1W79 A;  2X02 A;  5CGX A;  3RXX A;  1BLH A;  2Y2Q A;  5E2E A;  1XXM A;  3NDE A;  4O7D A;  3WRZ A;  3ZG9 B;  4D2O A;  1MXO A;  3ZCZ A;  1TDG A;  4BD0 A;  1KDW A;  2Y2I A;  4BD1 A;  3GMW A;  5DTT A;  3P09 A;  4E3K A;  3BFG A;  3C4O A;  1GHI A;  1FCN A;  3EQV A;  1HD8 A;  1PWD A;  2JE5 A;  4OOM A;  1YLZ A;  1RP5 A;  1PZP A;  2HPB A;  3BFE A;  4S2N C;  3TSG A;  4EV4 A;  4JBF A;  1TEM A;  4E6W A;  3P98 A;  1O7E A;  1MWT A;  2JC7 A;  3AGD A;  2P74 A;  1JTG A;  4IVK A;  3A3J A;  5GLA A;  3C7U A;  4DXB A;  4EQI A;  4NK3 A;  1PWG A;  4PPR A;  3ZVT A;  1K57 C;  4C3Q A;  3OPP A;  4K0X A;  4LV1 A;  4UHU A;  3MZF A;  1HTZ A;  1PI4 A;  3GR2 A;  3BFC A;  3Q81 A;  5FAT A;  5GHX A;  5FDH A;  1GHM A;  3VSL A;  1YLP A;  4X69 A;  1EI5 A;  3WRT A;  2BLS A;  2WZX A;  1W7F A;  5FQI A;  1CI9 A;  5A92 A;  1K54 C;  5EVI A;  3I7J A;  2Q9N A;  3IQA A;  3MKE A;  3N8S A;  1JWZ A;  4ZTK A;  3M2K A;  3VFH A;  2IWD A;  2XGN A;  5AQA A;  3C5A A;  4X55 A;  1GCE A;  3HLD A;  5GHZ A;  4DE0 A;  5EVI D;  1XA1 A;  2XD1 A;  1MBL A;  4OPR A;  1K38 A;  1XPB A;  1IEL A;  5CTM A;  4K0W A;  5CTN A;  2Y2L A;  3ITA A;  4F94 A;  3Q07 A;  3CZD A;  1FSY A;  2HDR A;  4RA7 A;  1ZC2 A;  5HAQ A;  2WGV A;  1YMX A;  4QHC A;  4E6X A;  5GHY A;  5AQ9 A;  3G32 A;  2Y2M A;  1ZKJ A;  4KZ6 A;  1DY6 A;  1G6A A;  2HP5 A;  4R1G A;  1O07 A;  3IWQ A;  4KZ4 A;  4B88 A;  3HUM A;  4KG2 A;  2C5W B;  2ZQA A;  5CEB A;  3VP3 A;  4DXC A;  3SH8 A;  3CJM A;  3FZC A;  5E43 A;  3UPO A;  1TDL A;  4Y7P A;  1I5Q A;  4DF6 A;  4KEN B;  4OPQ A;  3V3R A;  4QY5 A;  2J9P A;  5TGF A;  3HLW A;  5FQM A;  1LHY A;  5GLD A;  5E2F A;  3M6B A;  2WZZ A;  2GDN A;  1ZG6 A;  4EBN A;  1XGJ A;  2R9W A;  1HZO A;  3Q1F A;  3ITB A;  4GB7 A;  4BEN A;  3GQZ A;  4KZ7 A;  2J9O A;  2QZ6 A;  5FAP A;  3TG9 A;  4DE1 A;  4E3M A;  3PTE A;  5EOE A;  3BFF A;  2Y59 A;  3IWO A;  3UPN A;  3V39 A;  2I72 A;  2EX9 A;  2ZQ9 A;  3ZNY A;  1IYQ A;  3FYZ A;  4BQM A;  2VGK A;  1NY0 A;  2HP9 A;  2JCH A;  4WBG A;  3SH9 A;  2XK1 A;  2OLU A;  1SHV A;  3G34 A;  5FI2 A;  5CGS A;  3JYI A;  3MZE A;  1BZA A;  1KGE A;  1XX2 A;  3LY3 A;  5EEC A;  1ONH A;  3HVF A;  3OPH A;  3G30 A;  2ZQD A;  1KGG A;  1PWC A;  3BRM A;  5FI7 A;  4WZ5 C;  4KQQ A;  3W4P A;  4C75 A;  4R3B A;  4EBP A;  3E2K A;  3SS4 A;  1CI8 A;  5JYO A;  2EFX A;  3IF6 A;  3ZFZ A;  1LL5 A;  3HLG A;  3UO9 A;  3V50 A;  1ERM A;  2WGI A;  4U0T A;  5HAI A;  4E3I A;  2H10 A;  4LCL A;  1ES3 A;  1BLS A;  1XKZ A;  4OQG A;  1NYY A;  2QPN A;  4Q8I A;  1K55 C;  1SDE A;  4ZJ3 A;  4KG5 A;  4WYY A;  5IHV A;  3HLE A;  1JWP A;  2EFU A;  1PIO A;  1N4O A;  2EX2 A;  3SS5 A;  1NJ4 A;  2ZQC A;  4UA7 A;  4FD8 A;  3O88 A;  5KZH A;  1KE0 A;  2XFT A;  5F83 A;  4KZ3 A;  3PAE A;  2XF3 A;  4GKU A;  1ZG4 A;  3A3D A;  4DKI A;  3TOI A;  3VOY A;  1WE4 A;  4YFM A;  3GRJ A;  4X6T A;  2ZQ7 A;  3IH9 A;  3O86 A;  4OLG A;  2DCF A;  1BT5 A;  3BM6 A;  5CED A;  1ERO A;  3BLS A;  4WEL A;  1MWR A;  2Y91 A;  5FI6 A;  5FQQ A;  2H5S A;  3NI9 A;  3MZD A;  2DRW A;  1JVJ A;  4M3K A;  3IHA A;  4JF4 A;  1W5D A;  4P87 A;  2Y55 A;  5EVL A;  5M1A A;  3NBL A;  2PU2 A;  2V2F F;  4OLD A;  2XDM A;  4GD8 A;  5E2H A;  3IHB A;  5F82 A;  2OV5 A;  4FCF A;  5DF8 A;  2Y2H A;  4FH4 A;  4JXW A;  2HDU A;  2Q9M A;  1BUE A;  1W8Y A;  1L0E A;  1PI5 A;  3WS5 A;  1ES2 A;  2PBY A;  4QY6 A;  2UWX A;  4OOY A;  1E4D A;  5DTS A;  5FAQ A;  3VOZ A;  5HAR A;  4KG6 A;  2ZMA A;  3A3I A;  1FCM A;  1YT4 A;  4OON A;  5J8X A;  5KMW A;  2X01 A;  2PU4 A;  3C4P A;  4OH0 A;  3IH8 A;  1G68 A;  2Y2K A;  3BEC A;  4KZ5 A;  3ZGA B;  4OP8 A;  1NRF A;  4HBU A;  1TVF A;  3ISG A;  4IBR A;  3SOI A;  4C6Y A;  5CHJ A;  3Q7V A;  2Y2N A;  1IYP A;  1XGI A;  1MPL A;  1XP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...