4P6BA

Crystal structure of est-y29,a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
390
structure length
386
Chain Sequence
SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
molecule keywords Est-Y29
total genus 119
structure length 386
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p6bA00
4M3KA 1ALQA 1ES4A 1H8ZA 3G4PA 4LV3A 4S2OA 2XF3A 1BLCA 5TGFA 1SDNA 2H0TA 1KGEA 2XDMA 5AQBA 4B4ZA 3VP3A 4DE2A 3MXSA 2X01A 3HLGA 4X68A 1NYYA 3HVFA 1KGGA 2Y2HA 4EWFA 4WELA 3CG5A 4P85A 3FZCA 2ZQDA 4PM8A 2XQZA 4PM5A 3UN7A 1N4OA 2WGWB 2EXBA 4MBHA 3UPOA 2XLNA 1QMEA 4ZBEA 4JXSA 3O86A 3W4OA 4Q8IA 4QB8A 1XX2A 4KZAA 4UA6A 3MZFA 4E3OA 3IF6C 1JWPA 5KMWA 3PBSA 3ITBA 4JPMA 5A93A 1MWUA 1CEFA 1VM1A 3ZFZA 2ZMAA 5FQKA 4PM6A 5GHXA 4N9KA 1K57A 1G6AA 1ERMA 4OONA 4GN2A 1PI5A 3VFFA 3ITAA 3DTMA 1ONGA 4X6TA 3V3RA 1H5XA 4RX3A 1TVFA 5F1GA 3IHBA 3N8SA 5FI7A 4YFMA 2WGWA 3EQUA 1LHYA 2BG1A 5HX9A 3C7UA 5CGSA 2CC1A 5FATA 3PBOA 5KZHA 1XP4A 1W79A 4P6BA 2Y2MA 3WS4A 3GRJA 3HLFA 5D3OA 4X55A 2ZQAA 3BFDA 3NC8A 1LI0A 4U0XA 4MEZA 3M2KA 3IF5A 3N8LA 2R9XA 1Q2QA 3WS0A 4DXCA 2WADA 3UPNA 2WGIA 3PBRA 4IBXA 2WZXA 1K55A 4DXBA 3BFFA 3ZG9B 2HDQA 2WK0A 3BLSA 1PW1A 2WYXA 4FH2A 4R3JA 3HLEA 5CTMA 5BOHA 3HUNA 2EFXA 3W4PA 4KZ8A 1KVLA 2HP9A 1SCWA 3MFDA 1YMXA 3HLCA 1XKZA 4MLLA 3TG9A 4C3QA 3C5AA 1K56D 1KE3A 1EROA 3VSLA 3G31A 4OP8A 2J8YA 1K6RA 5HAQA 4RVAA 3HUMA 3W8KA 5J8XA 4Z9QA 1KE0A 2HPBA 2XR0A 2ZM0A 4WEKA 4OP5A 4S2NC 5CHMA 1JVJA 5EOEA 2PU2A 3SS4A 3HREA 1NJ4A 2ZC4B 4DE1A 4KQOA 4FCFA 1TEMA 2Y2KA 4ZAMA 1K57C 4KZ5A 4S2IA 1SKFA 1N9BA 2G2WA 1K38A 3V3SA 3NIAA 3C4OA 3IQAA 3Q7ZA 3BRMA 5DF7A 3LEZA 4N1XA 3M6BA 4KQQA 5E2HA 1BLPA 4ZJ1A 3Q1FA 4MNRA 3NI9A 4X56A 3SH9A 4ZJ2A 3CZDA 2HP6A 1ES2A 3HLWA 4WEJA 4WMCD 5E43A 5AQ7A 4CJNA 5GLDA 3IH8A 1IYOA 3MKEA 1PWDA 3UDXA 1XGIA 4U3TA 4ZTKA 4OPQA 1ZKJA 4K0XA 5A90A 5M19A 1MBLA 1O7EA 3ZG0A 4DE3A 2Y2NA 1IYQA 3ZG8B 5FASA 5GLAA 1MWSA 4JLFA 4JXWA 4ID4A 4WMCA 1PYYA 5HARA 3S1YA 4BLMA 1HD8A 4LV1A 3QNBA 3NDGA 2FFFB 1QMFA 4QD4A 1G68A 1Z6FA 1MKIA 4KQRA 3IWOA 4MBKA 1ES3A 3DW0A 5EPHA 3MKFA 1IKGA 2ZLYA 5DF8A 2IWDA 5M1AA 1L0DA 5CGWA 1BLHA 3MXRA 5A92A 3IH9A 5FA7A 4LV0A 1GHPA 4H8RA 4PM9A 4KZ4A 1XA7A 4R4SA 4S2NA 1H8YA 2XD1A 5KSHA 1YLZA 2Y59A 2E8IA 4EBNA 3HL9A 3BFCA 1LL9A 4E3LA 3V39A 2Y2QA 1YT4A 2JE5A 1KGFA 4OH0A 4KENB 1W8YA 2H5SA 4GD6A 5FQJA 2WZZA 1S6RA 1ESUA 4WZ4A 3N8RA 2Y2PA 4KZ9A 4KZ3A 4BQMA 4L0LA 3WRZA 3M2JA 5CTNA 1IELA 1K54A 5CGXA 2Y2GA 2ZQ9A 4EUZA 1MWRA 3O88A 4S2LA 4R3BA 3PBNA 2A49A 3UNWA 1Y54A 4P87A 5DF9A 3IHAA 1MWTA 3N4IA 1K4FA 3NY4A 5JYOA 5GHZA 4FH4A 3O87A 3WS2A 1FR1A 5G18A 3HUOA 1L0GA 3VP0A 4KG6A 3N7WA 1FCOA 5CECA 2XGNA 2Y2OA 1BSGA 2RL3A 3A3DA 4QJGA 4QU3A 4UAAA 5TR7A 1KDSA 2P9VB 1ERQA 2OSUA 2WAEA 5FAQA 4E3JA 4BL3A 3W4QA 5EOOA 4E3MA 2XK1A 1NYMA 3I7JA 3Q82A 2ZJ9A 4WYYA 3OC2A 3PAEA 2ZC6B 4OQGA 5HW3A 1Q2PA 3BEBA 4KZBA 3SH8A 4DRTA 4BD0A 1YQSA 1S0WA 3D4FA 3FKWA 4HEFA 4GD8A 2ZD8A 1XXMA 3V5MA 1M6KA 2JC7A 3IWQA 1JTDA 3AGDA 1FR6A 1ZG6A 5CXWA 3A3FA 3GTCA 4XUXA 4FSFA 5HL1A 3E2KA 3O3VA 2EX8A 3UO9A 4EBPA 2QPNA 3VP2A 5HAPA 1PW8A 2XH9A 1HZOA 1YMSA 4R1GA 2DRWA 1RP5A 2VGKA 4HESA 1YLJA 3B3XA 4QY6A 1FQGA 2C6WB 2IWCA 1DJCA 2X71A 3QNCA 4YINA 2V1ZA 1W8QA 4JBFA 1YLTA 3S22A 3G32A 4LV2A 4DDSA 1W7FA 3GMWA 5M18A 4OLGA 1YLYA 5FQMA 4WBGA 5EVIA 5CERA 4GDNA 3UE3A 4B4XA 1BLSA 1LI9A 3DWKA 4DE0A 4Y0UA 1YM1A 2BLSA 2EXAA 2P74A 3OPHA 5FQQA 5U47A 4LCMA 4GB7A 2Y2LA 2WUQA 3FYZA 2UWXA 4UA9A 4IBRA 1ONHA 1TDLA 1BULA 4JKTA 1E3UD 2WKIA 2FFYA 2V2FF 1BTLA 2EX2A 4N9LA 5IHVA 2Y2JA 4X69A 2I72A 4E3NA 2OLUA 4K0WA 4WM9A 5FI2A 4IVKA 2XFTA 3PTEA 4DF6A 4HBUA 1FCMA 4S2JA 4ZJ3A 2QZ6A 1KVMA 3FV7A 5AQ9A 5JYPA 3VFHA 5E2EA 3JYIA 3BLMA 1PI4A 3CMZA 3G34A 2DNSA 3MZEA 3N6IA 5CEBA 1BZAA 3C4PA 1CI9A 4UHUA 3ISGA 5FQIA 1HTZA 4BD1A 4GZBA 3AGFA 2OLVA 2JBFA 1XGJA 3PAGA 1WYCA 3ZG5A 5EVLA 3OPRA 4NETA 4OQ0A 3ZVTA 3SOIA 1TDGA 1CEGA 4UA7A 3BFEA 2XEPA 3OPLA 4KZ7A 4XUZA 2ZM8A 5EECA 3G35A 5HAIA 4LCLA 2ZQCA 3A3EA 2ZC5B 3IF6A 4EQIA 3ZG7B 3UDIA 4KG2A 1KE4A 4O7DA 4DKIA 3G2YA 4JXVA 3OPPA 3VP4A 3TOIA 2WGVA 3IXDA 5GLCA 4KG5A 3UE0A 1O07A 3GQZA 4GNUA 3GV9A 2HDRA 2Y4AA 5TFQA 5DTTA 2B5RA 3NDEA 4EV4A 1NXYA 2ZC7A 3UE1A 5F82A 1CI8A 1JWZA 4OOLA 1CK3A 4Y0OA 3RJUA 4WZ5C 3WS5A 2Y91A 2ZQ8A 1SDEA 1MXOA 2A3UA 3EQVA 5DTSA 1DY6A 5CEDA 3GSGA 4BJPA 4IEDA 3V50A 1XA1A 3WS1A 3NBLA 3IXGA 1I2SA 1DJAA 1YLWA 3FKVA 4Y7PA 4C75A 5EVIB 5DTKA 1PZPA 2H0YA 2J9PA 3Q07A 2X02A 5E2FA 2HDUA 1IEMA 1BUEA 3Q7VA 3G2ZA 1NY0A 1PZOA 2V20A 2EFUA 4GDBA 3ZHHA 1JTGA 1C3BA 2HDSA 2Q9MA 2GDNA 5EUAA 3A3IA 5AQAA 2ZQ7A 2PU4A 3MZDA 2WAFA 4OOMA 3RXWA 2Z2LB 1RCJA 3GR2A 4PPRA 3SS3A 3GVBA 4A5RA 2Y55A 1ZC2A 3CJMA 5EVIC 1SHVA 2ZM2A 5F83A 3LY3A 5A91A 5CRFA 3WRTA 4JF5A 4NK3A 3IXBA 1WYBA 5L2FA 2P9VA 2QMIA 2C5WB 4R23A 3UY6A 1IYSA 4K91A 2OV5A 3VSKA 3OCLA 2RCXA 4F94A 1FSWA 2XD5A 4FD8A 3WWXA 3E2LA 4E6XA 3BECA 4S2MA 2VGJA 4IVIA 4BL2A 5CHUA 4GKUA 5I94A 1I5QA 4QHCA 1E4DA 1RGYA 1WE4A 1K6SA 1GA0A 4MBFA 4RA7A 1XPBA 3TSGA 3SH7A 1MY8A 3HBRA 3LCEA 4P0MA 4EBLA 5KSCA 3PBQA 1JWVA 4LENA 4E3IA 4DDYA 4JF4A 3IXHA 1E25A 1OMEA 3VOYA 3ZNTA 4R4RA 4HBTA 5E2GA 3SS5A 3BM6A 1L0EA 3IF6B 3PBTA 3OCNA 4OLDA 5EE8A 1L0FA 4PMAA 3Q7VB 5CHJA 5GL9A 2WKHA 3S4XA 2Y2IA 4E6WA 3C7VA 3M6HA 1K4EA 5FAOA 4C6YA 4OPYA 2Q9NA 4S2KA 5HFOA 4JXGA 4N92A 2PBYA 5FAPA 5F1FA 1ESIA 4U0TA 1YLPA 3RXXA 1PIOA 4RX2A 4XXRA 1K56A 3P09A 1MPLA 3LO7A 2DCFA 4JF6A 1M40A 1FOFA 2Z2MB 3MBZA 3Q81A 1BT5A 4B88A 2HP5A 1E3UA 4RYEA 3ZCZA 4OVDA 1K55C 3IT9A 1K25A 2EX9A 4S2PA 1GHMA 4PM7A 2EX6A 5FQ9A 1KDWA 1LL5A 1AXBA 1L2SA 1IYPA 2R9WA 5FSRA 1J9MA 5GLBA 3BYDA 3LY4A 2ZC3B 3IWIA 3ZNYA 3AGEA 1GCEA 1NZUA 1EI5A 1PWCA 3OZHA 4N1HA 4QY5A 1ZG4A 4X53A 3A3JA 2WKEA 1I2WA 4OKPA 4R0QA 3VMAA 1PWGA 4WZ5A 3HLBA 3UDFA 1FCNA 2J9OA 1HVBA 2H10A 4KZ6A 4Y0TA 4ZDXA 2XFSA 5FI6A 3DWZA 3VP1A 3VOZA 2JCHA 1NZOA 4OPZA 4OPRA 1ES5A 1LLBA 1W5DA 4BENA 1EWZA 4CPKA 1VQQA 1GHIA 4GOGA 3ZDJA 1GA9A 3FWLA 5DVAA 3HLDA 4OOYA 3P98A 1K54C 3G30A 2IWBA 5GHYA 3ZGAB 5EVID 4E3KA 3NCKA 1DJBA 1FSYA 1RGZA 2J7VA 3BFGA 4OQHA 1U60A 4D2OA 3UPPA 4OQIA 1IKIA 3ZVWA 5FDHA 1NRFA 3QHYA 2G2UA
chains in the Genus database with same CATH superfamily
4LV3A 3EOIA 1SDNA 1X0OA 2Y2HA 3QP8A 5KIZA 2ZQDA 1TS7A 2WGWB 2EXBA 2L1MA 4ZBEA 3B42A 1XX2A 4KZAA 4UA6A 3PBSA 4ARZB 4MN5A 3T4JA 2L4RA 3ITBA 5F6AA 1G6AA 4PAUA 2VGLS 4X6TA 3V3RA 2NUTC 4HQAA 4I38A 3EQUA 2HF6A 5HX9A 3C7UA 5CGSA 5FATA 1XP4A 1W79A 3WS4A 3QP1A 5D3OA 3BFDA 1VETB 4U0XA 4MEZA 3N8LA 4DXCA 3UPNA 2O99A 1F5MA 2O0YA 4FH2A 5CTMA 4D60A 3W4PA 4YOFA 4Y2FA 2JN7A 2HP9A 1ZTUA 4Y17A 2EA9A 4C3QA 4EXOA 1T19A 5FDSA 3VSLA 4RVAA 3HUMA 4XT2B 5AJGA 3S7NA 5CHMA 2XR0A 5LBRA 4OP5A 2HV1A 3HREA 3F1OA 1NJ4A 4NEED 2OWHA 2FH5A 1K57C 1SKFA 3UB9A 2PRFA 3LEZA 3M6BA 4KQQA 2ZL1B 4IHQA 5F69A 2OAP1 3NI9A 4GHIB 4ZJ2A 1H3QA 3CZDA 1ES2A 5GLDA 1IYOA 3MKEA 2OWJA 2Q0OA 1ZKJA 3ZG0A 1F9IA 3T1QB 2PD8A 5GLAA 1LSXA 4JLFA 3S1YA 1PYYA 5FL3A 4BLMA 1HD8A 3QNBA 4HI4A 2FFFB 1QMFA 4KUKA 5DJUA 4XT2A 5EPHA 5DF8A 2IWDA 4G3VA 1SKOB 4PM9A 2Y59A 4GS9B 3BFCA 4E3LA 1YT4A 3UB6A 5J3WA 2WZZA 4WZ4A 2Y2PA 4KZ3A 4BQMA 4EUZA 3ULFA 2B18A 4O8GA 1Y54A 3IHAA 3N4IA 1K4FA 3UB5P 4HJ6A 2PYRA 3A3DA 3IS2A 1BYWA 2WAEA 4E3JA 3TE8A 5TJJA 2XK1A 1NYMA 2ZJ9A 1P97A 2W27A 4G3KA 1YQSA 3FKWA 1XXMA 3KYQA 3IWQA 4FTXA 1JTDA 3E4PA 3A3FA 5HL1A 2QPNA 3KSHA 3VP2A 5HAPA 1PW8A 2W1TB 2G7UA 2DRWA 3B3XA 1FQGA 2ZMFA 2V1ZA 1W8QA 1YLTA 2M7VA 3GMWA 3UE3A 1LI9A 3DWKA 2V8FA 3KYZA 4Y0UA 2BLSA 4MCWA 4WUJA 3S7PA 2UWXA 3NHQA 3T1SA 4AFIA 4JKTA 3MSHA 4HOIA 2LB5A 1UWPX 4E3NA 5FI2A 1YSQA 4LLOB 5IS1A 2Y8HA 1KVMA 5AQ9A 5E2EA 3N6IA 1CI9A 4BD1A 4GZBA 2JBFA 1XGJA 3PAGA 3B47A 3ZG5A 4OQ0A 4UA7A 1CEGA 5HAIA 2ZQCA 3ZG7B 4BBVA 1OTEA 1PNEA 4K08A 4O7DA 1T1AA 4JGRA 3VV4A 4ARZA 1XJ4A 3UE0A 3V67A 5DTTA 4HJ3A 1A0KA 1CI8A 3RTYA 4PKYA 1CK3A 2I9VA 3W2ZA 1MXOA 3EQVA 5DTSA 4BJPA 1YPRA 3V50A 3EGDC 1YLWA 3FKVA 1N9NA 5EM1A 4B9OA 5DTKA 2H0YA 5E2FA 2X02A 4ETZA 5HDSA 5HD5A 1PZOA 2EFUA 4GDBA 1C3BA 3GECA 2D01A 2HDSA 1IOUA 3T1XA 3GVBA 4A5RA 2Y55A 3CJMA 3K3DA 4Y3IA 3IXBA 1WYBA 5L2FA 4R23A 1SKOA 4E6XA 3WWXA 3E2LA 2L0WA 5I94A 1NWZA 4GS9A 4MBFA 1XPBA 2VX8A 1MY8A 4IJGA 5L07A 3PBQA 4LENA 4R4RA 4HJ4A 1L0EA 4L9EA 5HDCA 3NULA 3SZTA 5CHJA 1SZVA 4E6WA 3C7VA 5HFOA 3TRCA 1PIOA 1MPLA 3LO7A 2Z2MB 1E3UA 2QJ5A 4FOFA 4S2PA 3F1NB 4PM7A 5FQ9A 1KDWA 1LL5A 3LY4A 3K3CA 1EI5A 2IA2A 4QY5A 1DP9A 1ZG4A 1D06A 4OKPA 3HLBA 3UDFA 1FCNA 2J9OA 2H10A 4ZDXA 3KSIA 4BENA 4CPKA 1VQQA 4GOGA 2WKQA 3FWLA 3G30A 5GHYA 5EVID 4E3KA 1RGZA 4OQHA 3R4KA 4D2OA 4OQIA 5FDHA 4F3LB 4Y5FA 2G2UA 4M3KA 4S2OA 2XF3A 4B4ZA 2XDMA 3MXSA 4X68A 1NYYA 1KGGA 3VE3A 2J3TD 4CLCE 4PM8A 3C30A 4PM5A 4MBHA 4Q8IA 3O86A 3C8CA 5J7EA 4E3OA 5KMWA 5A93A 2UV0E 1J3WA 2KX6A 3D72A 3CLOA 4R70A 3NOPC 5F1GA 3IHBA 4YFMA 4DJ3A 2WGWA 2Z6CA 2BG1A 2CC1A 1TS6A 4JGOA 3GRJA 3C2WA 3H7WB 3WS0A 4IBXA 2WZXA 3BFFA 2WK0A 3HLEA 3CPTA 3HUNA 3E0YA 2EFXA 4EEPA 1T18A 1YMXA 5A8BA 2PD7A 1K6RA 5HAQA 3QP2A 4KQOA 4FCFA 2Y2KA 3B33A 2PT7A 2G2WA 1N9BA 3V3SA 3HJKA 3BRMA 5E2HA 1BLPA 3ICYA 3Q1FA 4MNRA 2K31A 4WMCD 3IH8A 1PWDA 3LIFA 3UDXA 4U3TA 4ZTKA 1MBLA 3T50A 4Q0IA 4LV1A 1N9OA 3NDGA 4DMZA 2BTFP 1G68A 1Z6FA 4KQRA 1MZUA 3MKFA 5I5LA 1LSVA 5CGWA 1BLHA 5A92A 5FA7A 1H8MA 1P9WA 4KZ4A 1XA7A 4R4SA 5C5KA 2W3DA 2XD1A 3CITA 3LIDA 1UGUA 2E8IA 4EBNA 3HL9A 1LL9A 3EGXC 3D3OA 4LRXC 2QYBA 3LFVA 4HNBA 4KZ9A 1FILA 4L0LA 2V9AA 1IELA 5FEFA 2ZQ9A 3O88A 4NXBA 4R3BA 5GHZA 2EWVA 1L0GA 3TJZC 3VP0A 1BSGA 3OOVA 4QU3A 4R3AA 5TR7A 4QWOA 2W3FA 2DMWA 4EETB 5EOOA 5DKKA 4E3MA 4MN7A 3I7JA 4WYYA 5HW3A 1Q2PA 3BEBA 4DRTA 4GCZA 2JKRM 4HEFA 3V5MA 2JC7A 2QKPA 2FZ0A 3IS2B 1ZG6A 3SW1A 4XUXA 4FSFA 3E2KA 4EBPA 3FG8A 3CWFA 2XH9A 2VGKA 1YLJA 2X71A 1DJCA 4YINA 3S22A 4EW7A 1Y28A 5M18A 5FQMA 5EV0A 5EVIA 4B4XA 1BLSA 2Y79A 3MS6A 2B02A 5U47A 2HJ9C 2YKHA 2Y2LA 2WUQA 4UA9A 4IBRA 1TDLA 3LIAA 3A0VA 4QPRA 4NXFA 2EX2A 4N9LA 4X69A 2I72A 2OLUA 4K0WA 4WM9A 1OT9A 3D9YA 1V9YA 1FCMA 4HBUA 4S2JA 3UMDA 2BASA 4ZJ3A 4PKYG 5JYPA 3VFHA 3CMZA 3G34A 3MZEA 3MFXA 3T12B 3ISGA 3AGFA 3JVVA 3CPTB 3OPRA 3SOIA 3BFEA 3DAVA 3IF6A 1OJGA 1TS8A 4KG2A 1KE4A 4LFUA 3KO6A 3T4QA 2V1AA 3TOIA 1S4RA 2O9AA 3GQZA 4GNUA 3GV9A 2HDRA 4EV4A 1NXYA 5F82A 4OOLA 1DY6A 4YNRA 4WLAA 1DJAA 3EWKA 1K0KA 1PZPA 3Q07A 5G4YA 2HDUA 1IEMA 4NKPA 1NY0A 1TF1A 2V20A 5L09A 3ZHHA 3A3IA 5AQAA 3MZDA 3PXPA 5DFXA 4UQIM 3GR2A 3SS3A 2CMNA 3A0RA 1ZC2A 5A91A 4JF5A 3LUQA 2P9VA 2QMIA 2V1BA 3BQ8A 3BECA 2QJ7A 2VGJA 4IVIA 4BL2A 3BY9A 3L9KA 1Y4OA 1MKMA 1E4DA 1WE4A 4RA7A 1P9RA 3KYEA 4X25A 1S67L 3LCEA 2XRNA 2K2NA 5KSCA 2M1CA 1JWVA 3IXHA 1E25A 3VOYA 5G4ZA 5E2GA 3SS5A 4JGPA 4PMAA 5GL9A 2WKHA 3BJNA 3M6HA 4C6YA 4KQDA 2Q9NA 4S2KA 1TS0A 4N92A 5F1FA 2EWWA 4GLQA 2A24A 4RX2A 4XXRA 1K56A 1FOFA 3CHWP 3Q81A 1BT5A 4B88A 2HP5A 3ZCZA 4OVDA 1K55C 3IT9A 3U2AA 2EX9A 2EX6A 3LYXA 1ACFA 4R6LA 4ZRRA 2R9WA 2W1RA 5GLBA 3ZNYA 4MN6A 3AGEA 1LT0A 3OZHA 1PWCA 3A3JA 1T1BA 1I2WA 1F98A 1PWGA 2J80A 3VOZA 4KUOA 1GHIA 3EEHA 2VKSA 5DVAA 4OOYA 5HWVA 3NCKA 1DJBA 1FSYA 1GSWA 1IKIA 2ZMVA 1NRFA 3NJAA 5FQQA 3KX0X 1ALQA 1ES4A 1H8ZA 1BLCA 2H0TA 5AQBA 2PR6A 3VP3A 4DE2A 2X01A 5F5YA 2P04A 3HVFA 4WELA 3K2NA 4P85A 3FZCA 3UN7A 1N4OA 2ZL1A 2PBDP 2XLNA 1QMEA 3T4OA 4JXSA 2LB9A 1XJ2A 3MZFA 3F1PB 1S1ZA 1MWUA 1CEFA 1VM1A 2PHYA 3IX4A 4EQ1A 4PM6A 5GHXA 1LL8A 1K57A 4R38A 4OONA 3VFFA 2XROA 3ITAA 4RX3A 1TVFA 3N8SA 2KLIA 3P01A 5IU1A 3R7WA 5HDDA 4P6BA 2PAVP 3HLFA 4HP4A 2ZQAA 3NC8A 3M2KA 3IF5A 2R9XA 3QP4A 2WGIA 4E04A 3PBRA 1K55A 4DXBA 3ZG9B 2A24B 3BLSA 2WYXA 5BOHA 4KZ8A 2W0NA 3E4OA 4MLLA 5HPFA 1KE3A 1EROA 4OP8A 3H7WA 2J8YA 5J8XA 2HPBA 2ZM0A 4S2NC 5EOEA 1JVJA 2PU2A 3SS4A 1STZA 4DE1A 1TEMA 1DP8A 4KZ5A 2ZOIA 3DTKA 1K38A 3C4OA 3IQAA 1T1CA 5AVEA 3OBFA 1L3LA 4Q0HA 4ZJ1A 3S7QA 3FC7A 4CJNA 5E43A 5AQ7A 4BMWA 2O9CA 2XSSA 4OPQA 3TW8A 4K0XA 5A90A 5M19A 4DE3A 1O7EA 3LI9A 2Y2NA 3ZG8B 5FASA 1W63M 4JXWA 4ID4A 5AVFA 1G28A 1ES3A 1VHMA 2ZLYA 5M1AA 2GX5A 4LV0A 1GHPA 4S2NA 5KSHA 1YLZA 2JKTM 3V39A 1KGFA 3U4LP 1W8YA 3A0SA 3O5YA 2JKTI 4GD6A 1S1YA 1S6RA 5MC7A 3M2JA 4NXEA 2VV7A 1K54A 5CGXA 2Y2GA 5DFYA 2XA7M 3DTIA 3PBNA 2A49A 3UNWA 5DF9A 1MWTA 5F68A 4X1MA 3O87A 1FR1A 5G18A 3HUOA 4KG6A 3N7WA 1FCOA 2XGNA 2RL3A 4QJGA 1PRQA 2KDKA 1KDSA 2P9VB 4GHIA 4ESPA 1MC0A 2OSUA 3JPUA 3CUEA 4MDZA 4L9FA 3OC2A 4OQGA 3SH8A 4BD0A 3IX3A 4GD8A 2ZD8A 1M6KA 3AGDA 2WKRA 2H28A 4LGWA 2Z6DA 2EX8A 1GSVA 1HZOA 3PHYA 4HESA 4QY6A 2IWCA 3QNCA 4O01A 3G32A 1G5UA 4DDSA 1JNUA 2OAQ1 3MQ0A 4OLGA 4GDNA 1YM1A 2EXAA 2P74A 3OPHA 4LCMA 4GB7A 3FYZA 2HGVA 3ZYTA 1ONHA 4EESA 4YWZA 1BULA 3CUEC 4IUKA 1E3UD 1CF0A 2WKIA 2NUPC 2V2FF 5IHVA 2XFTA 3PTEA 4DF6A 1H0MA 4DN0A 2QZ6A 3FV7A 2DNSA 1S66L 5CEBA 3C4PA 4B93A 3LI8A 2OLVA 2V8CA 1WYCA 2PR5A 5EVLA 3ZVTA 2INWA 2ZM8A 3G35A 1NLZA 2VJWA 4EUVA 3A3EA 4BWIA 3KSFA 3FPWA 3L7HA 5EVEA 3T4SA 2ZOHA 3MR0A 4JXVA 3OPPA 2WGVA 3IXDA 2QWSA 4KG5A 1O07A 2Y4AA 5TFQA 2B5RA 3NDEA 3T4KA 3NOTC 1JWZA 4WZ5C 3WS5A 2A3UA 2Y91A 3F1NA 3IX8A 2W3EA 4IEDA 3WS1A 4UQIS 3IXGA 4Y7PA 1FIKA 4C75A 3IBRA 2JHEA 3G2ZA 1JTGA 3RH8B 2P08A 2Q9MA 2V0WA 5EUAA 4CLCC 2ZQ7A 2WAFA 4NXGA 3RXWA 2Z2LB 1RCJA 4PPRA 3T4TA 2R78A 3UE6A 1OTDA 4HIAA 5F83A 1SHVA 2ZM2A 4NK3A 3BY8A 2C5WB 3UY6A 1IYSA 4MMNA 2OV5A 3LEQA 3OCLA 4F94A 1FSWA 2XD5A 4FD8A 4CLCD 4GKUA 3P7NA 4F3LA 1GA0A 3TSGA 3SH7A 3HBRA 3NECA 2KOIA 4DDYA 1OMEA 1OTIA 3ZNTA 1YSPA 4HBTA 5HL6A 3BM6A 4OLDA 5EE8A 1L0FA 3S4XA 3VOLA 2Y2IA 1W63Q 1KOUA 5FAPA 1ESIA 1YLPA 5HD3A 4DJ2A 5HWTA 3P09A 4JF6A 3MBZA 2JKGA 3HCYA 2B95A 1AXBA 2VEAA 2VLGA 2ZC3B 3NOUC 1ODVA 2VV8A 1N9LA 4R0QA 4WZ5A 4KZ6A 4P6ZM 2XFSA 3VP1A 4NG2A 1NZOA 3CAXA 4OPRA 1W5DA 3ZDJA 4HH2A 1DP6A 3HLDA 4H6JB 1K54C 3ZGAB 1G6OA 3UPPA 2AVXA 3ZVWA 3G4PA 5TGFA 1KGEA 3HLGA 4CQHA 4BBTA 4EWFA 3CG5A 2XQZA 3UPOA 3W4OA 4QB8A 2PYPA 3IF6C 1JWPA 4BBUA 1VB6A 2WKPA 4JPMA 2OOLA 3ZFZA 2ZMAA 5FQKA 3BQAA 3MJQA 4N9KA 1ERMA 3MMHA 4GN2A 1PI5A 4I3AA 3DTMA 1ONGA 5K5BA 1VEUA 4RQ9A 1H5XA 2XA7S 5FI7A 1LHYA 2VZWA 3LIEA 3PBOA 5KZHA 2Y2MA 4X55A 4ETXA 1LI0A 4ME4A 3UB7A 3MXQA 5HWWA 1Q2QA 2VV6A 3KSGA 2WADA 4EEUA 3JVUA 2W3HA 2D02A 2HDQA 1AWIA 1PW1A 1UWNX 4R3JA 5L10A 1KVLA 1SCWA 3MFDA 3HLCA 1XKZA 3TG9A 3C5AA 1K56D 4HH3A 3G31A 3W8KA 4LRZE 4Z9QA 1KE0A 4WEKA 2ZC4B 1OJ5A 4ZAMA 4S2IA 4WF0A 4LRYC 3NIAA 3Q7ZA 5DF7A 4N1XA 3LR3A 1ZHHB 2M7UA 4X56A 3SH9A 4H6JA 1XJ3A 2HP6A 3HLWA 4WEJA 4CLCB 1XGIA 2E8JA 3S7OA 1IYQA 1MWSA 4WMCA 5HARA 2GNXA 4PHTA 4QD4A 1MKIA 3IWOA 4MBKA 2GJ3A 3BW6A 5DJTA 3DW0A 1IFQA 1IKGA 1L0DA 3UB8A 1Z09A 3MXRA 3IH9A 3T4LA 1S4SA 4H8RA 4I3JA 1H8YA 3OLOA 2J3WA 2Y2QA 3VE4A 2JE5A 4O0PA 4OH0A 4KENB 2H5SA 2VK3A 1GSXA 1CQAA 1WA9A 5FQJA 1ESUA 3N8RA 5TBMA 3WRZA 5CTNA 1LSWA 1P0ZA 4CLCA 1MWRA 1YAXA 4S2LA 4P87A 1D1JA 5JYOA 3NY4A 2K7SA 4I39A 4FH4A 3ZQ5A 1OTBA 3WS2A 1DRMA 5J4EA 3LR0A 3MQQA 5CECA 2Y2OA 3LR4A 3PR6A 4UAAA 3LR5A 1ERQA 5FAQA 4BL3A 3W4QA 2HJEA 3Q82A 4Z1WA 3PAEA 2ZC6B 1XFNA 4KZBA 3D4FA 1S0WA 1HLUP 5TBMB 5EFWA 1FR6A 5CXWA 3GTCA 3QP6A 4G3WA 3O3VA 3UO9A 1YMSA 3E98A 4R1GA 1RP5A 2C6WB 1PFLA 4JBFA 2ACGA 4LV2A 1W7FA 3R7WB 4UEYA 4GW9A 1D7EA 1YLYA 4II7A 4WBGA 5CERA 1TD5A 4DE0A 1XJ6A 2GZAA 3BWLA 1NLYA 3QP5A 2FFYA 1BTLA 3LIBA 2Y2JA 3CI6A 4IVKA 2O9BA 4IUHA 4WN5A 1CJFA 3G6OA 4M4XA 3JYIA 3BLMA 1PI4A 2JKFA 2MJ6A 1BZAA 4HY8A 3DBAA 1VETA 4UHUA 5FQIA 1HTZA 4LPZA 5L8MA 5HZHA 4Q0JA 4NETA 1TDGA 2XEPA 3OPLA 4KZ7A 4XUZA 5EECA 4LCLA 2ZC5B 4EQIA 4I3IA 3UDIA 5HSQA 3IBJA 4HP9A 3H82B 5EM0A 4DKIA 3G2YA 1YKDA 2PDRA 3VP4A 4I5SA 5GLCA 2VGLM 2V0UA 2ZC7A 3UE1A 3RJUA 4Y0OA 4P6ZS 2ZQ8A 1VEUB 1SDEA 5CEDA 3GSGA 1XA1A 3NBLA 1I2SA 1OT6A 3E4QA 5EVIB 2J9PA 1BUEA 3Q7VA 2J3TC 4EERA 4HHDA 1OTAA 2GDNA 2PU4A 4OOMA 1F2KA 5EVIC 3WRTA 3LY3A 5CRFA 3RFBA 3H82A 4K91A 3VSKA 2RCXA 3H9WA 4GJ4A 3LICA 2A2LA 2YKFA 4S2MA 5CHUA 1I5QA 4QHCA 2HZ5A 3T1RA 4Y13A 1RGYA 4WL9A 1K6SA 5DKLA 3MF0A 4P0MA 4EBLA 5FEGA 1XFQA 4E3IA 5IT5A 4JF4A 5HPIA 1V9ZA 3IF6B 3PBTA 3OCNA 3F1PA 3Q7VB 1K4EA 5FAOA 2W1TA 4OPYA 4JXGA 2PBYA 3FPVA 4U0TA 1EW0A 3RXXA 2DCFA 1M40A 4JGQA 4X1LA 4RYEA 1K25A 1GHMA 4L9GA 1OPXA 3GDIA 3LGOA 2W3GA 4FUWA 1L2SA 3C38A 3HJIA 1IYPA 3UMEA 5FSRA 3MQOA 1J9MA 3BYDA 3IWIA 3F1OB 1GCEA 1NZUA 4N1HA 4X53A 2WKEA 3VMAA 3DTEA 1HVBA 4Y0TA 5FI6A 3DWZA 4EU0A 4OPZA 2JCHA 1ES5A 1LLBA 2P7JA 1EWZA 1NRJA 2JKRI 2VA0A 5CX7A 1GA9A 2ZBBA 3EEAA 3P98A 4Y15A 2IWBA 3PYPA 2J7VA 3BFGA 2QHKA 1U60A 3QHYA
chains in the Genus database with same CATH topology
4M3KA 1ALQA 1ES4A 1H8ZA 3G4PA 4LV3A 4S2OA 2XF3A 1BLCA 5TGFA 1SDNA 2H0TA 1KGEA 2XDMA 5AQBA 4B4ZA 3VP3A 4DE2A 3MXSA 2X01A 3HLGA 4X68A 1NYYA 3HVFA 1KGGA 2Y2HA 4EWFA 4WELA 3CG5A 4P85A 3FZCA 2ZQDA 4PM8A 2XQZA 4PM5A 3UN7A 1N4OA 2WGWB 2EXBA 4MBHA 3UPOA 2XLNA 1QMEA 4ZBEA 4JXSA 3O86A 3W4OA 4Q8IA 4QB8A 1XX2A 4KZAA 4UA6A 3MZFA 4E3OA 3IF6C 1JWPA 5KMWA 3PBSA 3ITBA 4JPMA 5A93A 1MWUA 1CEFA 1VM1A 3ZFZA 2ZMAA 5FQKA 4PM6A 5GHXA 4N9KA 1K57A 1G6AA 1ERMA 4OONA 4GN2A 1PI5A 3VFFA 3ITAA 3DTMA 1ONGA 4X6TA 3V3RA 1H5XA 4RX3A 1TVFA 5F1GA 3IHBA 3N8SA 5FI7A 4YFMA 2WGWA 3EQUA 1LHYA 2BG1A 5HX9A 3C7UA 5CGSA 2CC1A 5FATA 3PBOA 5KZHA 1XP4A 1W79A 4P6BA 2Y2MA 3WS4A 3GRJA 3HLFA 5D3OA 4X55A 2ZQAA 3BFDA 3NC8A 1LI0A 4U0XA 4MEZA 3M2KA 3IF5A 3N8LA 2R9XA 1Q2QA 3WS0A 4DXCA 2WADA 3UPNA 2WGIA 3PBRA 4IBXA 2WZXA 1K55A 4DXBA 3BFFA 3ZG9B 2HDQA 2WK0A 3BLSA 1PW1A 2WYXA 4FH2A 4R3JA 3HLEA 5CTMA 5BOHA 3HUNA 2EFXA 3W4PA 4KZ8A 1KVLA 2HP9A 1SCWA 3MFDA 1YMXA 3HLCA 1XKZA 4MLLA 3TG9A 4C3QA 3C5AA 1K56D 1KE3A 1EROA 3VSLA 3G31A 4OP8A 2J8YA 1K6RA 5HAQA 4RVAA 3HUMA 3W8KA 5J8XA 4Z9QA 1KE0A 2HPBA 2XR0A 2ZM0A 4WEKA 4OP5A 4S2NC 5CHMA 1JVJA 5EOEA 2PU2A 3SS4A 3HREA 1NJ4A 2ZC4B 4DE1A 4KQOA 4FCFA 1TEMA 2Y2KA 4ZAMA 1K57C 4KZ5A 4S2IA 1SKFA 1N9BA 2G2WA 1K38A 3V3SA 3NIAA 3C4OA 3IQAA 3Q7ZA 3BRMA 5DF7A 3LEZA 4N1XA 3M6BA 4KQQA 5E2HA 1BLPA 4ZJ1A 3Q1FA 4MNRA 3NI9A 4X56A 3SH9A 4ZJ2A 3CZDA 2HP6A 1ES2A 3HLWA 4WEJA 4WMCD 5E43A 5AQ7A 4CJNA 5GLDA 3IH8A 1IYOA 3MKEA 1PWDA 3UDXA 1XGIA 4U3TA 4ZTKA 4OPQA 1ZKJA 4K0XA 5A90A 5M19A 1MBLA 1O7EA 3ZG0A 4DE3A 2Y2NA 1IYQA 3ZG8B 5FASA 5GLAA 1MWSA 4JLFA 4JXWA 4ID4A 4WMCA 1PYYA 5HARA 3S1YA 4BLMA 1HD8A 4LV1A 3QNBA 3NDGA 2FFFB 1QMFA 4QD4A 1G68A 1Z6FA 1MKIA 4KQRA 3IWOA 4MBKA 1ES3A 3DW0A 5EPHA 3MKFA 1IKGA 2ZLYA 5DF8A 2IWDA 5M1AA 1L0DA 5CGWA 1BLHA 3MXRA 5A92A 3IH9A 5FA7A 4LV0A 1GHPA 4H8RA 4PM9A 4KZ4A 1XA7A 4R4SA 4S2NA 1H8YA 2XD1A 5KSHA 1YLZA 2Y59A 2E8IA 4EBNA 3HL9A 3BFCA 1LL9A 4E3LA 3V39A 2Y2QA 1YT4A 2JE5A 1KGFA 4OH0A 4KENB 1W8YA 2H5SA 4GD6A 5FQJA 2WZZA 1S6RA 1ESUA 4WZ4A 3N8RA 2Y2PA 4KZ9A 4KZ3A 4BQMA 4L0LA 3WRZA 3M2JA 5CTNA 1IELA 1K54A 5CGXA 2Y2GA 2ZQ9A 4EUZA 1MWRA 3O88A 4S2LA 4R3BA 3PBNA 2A49A 3UNWA 1Y54A 4P87A 5DF9A 3IHAA 1MWTA 3N4IA 1K4FA 3NY4A 5JYOA 5GHZA 4FH4A 3O87A 3WS2A 1FR1A 5G18A 3HUOA 1L0GA 3VP0A 4KG6A 3N7WA 1FCOA 5CECA 2XGNA 2Y2OA 1BSGA 2RL3A 3A3DA 4QJGA 4QU3A 4UAAA 5TR7A 1KDSA 2P9VB 1ERQA 2OSUA 2WAEA 5FAQA 4E3JA 4BL3A 3W4QA 5EOOA 4E3MA 2XK1A 1NYMA 3I7JA 3Q82A 2ZJ9A 4WYYA 3OC2A 3PAEA 2ZC6B 4OQGA 5HW3A 1Q2PA 3BEBA 4KZBA 3SH8A 4DRTA 4BD0A 1YQSA 1S0WA 3D4FA 3FKWA 4HEFA 4GD8A 2ZD8A 1XXMA 3V5MA 1M6KA 2JC7A 3IWQA 1JTDA 3AGDA 1FR6A 1ZG6A 5CXWA 3A3FA 3GTCA 4XUXA 4FSFA 5HL1A 3E2KA 3O3VA 2EX8A 3UO9A 4EBPA 2QPNA 3VP2A 5HAPA 1PW8A 2XH9A 1HZOA 1YMSA 4R1GA 2DRWA 1RP5A 2VGKA 4HESA 1YLJA 3B3XA 4QY6A 1FQGA 2C6WB 2IWCA 1DJCA 2X71A 3QNCA 4YINA 2V1ZA 1W8QA 4JBFA 1YLTA 3S22A 3G32A 4LV2A 4DDSA 1W7FA 3GMWA 5M18A 4OLGA 1YLYA 5FQMA 4WBGA 5EVIA 5CERA 4GDNA 3UE3A 4B4XA 1BLSA 1LI9A 3DWKA 4DE0A 4Y0UA 1YM1A 2BLSA 2EXAA 2P74A 3OPHA 5FQQA 5U47A 4LCMA 4GB7A 2Y2LA 2WUQA 3FYZA 2UWXA 4UA9A 4IBRA 1ONHA 1TDLA 1BULA 4JKTA 1E3UD 2WKIA 2FFYA 2V2FF 1BTLA 2EX2A 4N9LA 5IHVA 2Y2JA 4X69A 2I72A 4E3NA 2OLUA 4K0WA 4WM9A 5FI2A 4IVKA 2XFTA 3PTEA 4DF6A 4HBUA 1FCMA 4S2JA 4ZJ3A 2QZ6A 1KVMA 3FV7A 5AQ9A 5JYPA 3VFHA 5E2EA 3JYIA 3BLMA 1PI4A 3CMZA 3G34A 2DNSA 3MZEA 3N6IA 5CEBA 1BZAA 3C4PA 1CI9A 4UHUA 3ISGA 5FQIA 1HTZA 4BD1A 4GZBA 3AGFA 2OLVA 2JBFA 1XGJA 3PAGA 1WYCA 3ZG5A 5EVLA 3OPRA 4NETA 4OQ0A 3ZVTA 3SOIA 1TDGA 1CEGA 4UA7A 3BFEA 2XEPA 3OPLA 4KZ7A 4XUZA 2ZM8A 5EECA 3G35A 5HAIA 4LCLA 2ZQCA 3A3EA 2ZC5B 3IF6A 4EQIA 3ZG7B 3UDIA 4KG2A 1KE4A 4O7DA 4DKIA 3G2YA 4JXVA 3OPPA 3VP4A 3TOIA 2WGVA 3IXDA 5GLCA 4KG5A 3UE0A 1O07A 3GQZA 4GNUA 3GV9A 2HDRA 2Y4AA 5TFQA 5DTTA 2B5RA 3NDEA 4EV4A 1NXYA 2ZC7A 3UE1A 5F82A 1CI8A 1JWZA 4OOLA 1CK3A 4Y0OA 3RJUA 4WZ5C 3WS5A 2Y91A 2ZQ8A 1SDEA 1MXOA 2A3UA 3EQVA 5DTSA 1DY6A 5CEDA 3GSGA 4BJPA 4IEDA 3V50A 1XA1A 3WS1A 3NBLA 3IXGA 1I2SA 1DJAA 1YLWA 3FKVA 4Y7PA 4C75A 5EVIB 5DTKA 1PZPA 2H0YA 2J9PA 3Q07A 2X02A 5E2FA 2HDUA 1IEMA 1BUEA 3Q7VA 3G2ZA 1NY0A 1PZOA 2V20A 2EFUA 4GDBA 3ZHHA 1JTGA 1C3BA 2HDSA 2Q9MA 2GDNA 5EUAA 3A3IA 5AQAA 2ZQ7A 2PU4A 3MZDA 2WAFA 4OOMA 3RXWA 2Z2LB 1RCJA 3GR2A 4PPRA 3SS3A 3GVBA 4A5RA 2Y55A 1ZC2A 3CJMA 5EVIC 1SHVA 2ZM2A 5F83A 3LY3A 5A91A 5CRFA 3WRTA 4JF5A 4NK3A 3IXBA 1WYBA 5L2FA 2P9VA 2QMIA 2C5WB 4R23A 3UY6A 1IYSA 4K91A 2OV5A 3VSKA 3OCLA 2RCXA 4F94A 1FSWA 2XD5A 4FD8A 3WWXA 3E2LA 4E6XA 3BECA 4S2MA 2VGJA 4IVIA 4BL2A 5CHUA 4GKUA 5I94A 1I5QA 4QHCA 1E4DA 1RGYA 1WE4A 1K6SA 1GA0A 4MBFA 4RA7A 1XPBA 3TSGA 3SH7A 1MY8A 3HBRA 3LCEA 4P0MA 4EBLA 5KSCA 3PBQA 1JWVA 4LENA 4E3IA 4DDYA 4JF4A 3IXHA 1E25A 1OMEA 3VOYA 3ZNTA 4R4RA 4HBTA 5E2GA 3SS5A 3BM6A 1L0EA 3IF6B 3PBTA 3OCNA 4OLDA 5EE8A 1L0FA 4PMAA 3Q7VB 5CHJA 5GL9A 2WKHA 3S4XA 2Y2IA 4E6WA 3C7VA 3M6HA 1K4EA 5FAOA 4C6YA 4OPYA 2Q9NA 4S2KA 5HFOA 4JXGA 4N92A 2PBYA 5FAPA 5F1FA 1ESIA 4U0TA 1YLPA 3RXXA 1PIOA 4RX2A 4XXRA 1K56A 3P09A 1MPLA 3LO7A 2DCFA 4JF6A 1M40A 1FOFA 2Z2MB 3MBZA 3Q81A 1BT5A 4B88A 2HP5A 1E3UA 4RYEA 3ZCZA 4OVDA 1K55C 3IT9A 1K25A 2EX9A 4S2PA 1GHMA 4PM7A 2EX6A 5FQ9A 1KDWA 1LL5A 1AXBA 1L2SA 1IYPA 2R9WA 5FSRA 1J9MA 5GLBA 3BYDA 3LY4A 2ZC3B 3IWIA 3ZNYA 3AGEA 1GCEA 1NZUA 1EI5A 1PWCA 3OZHA 4N1HA 4QY5A 1ZG4A 4X53A 3A3JA 2WKEA 1I2WA 4OKPA 4R0QA 3VMAA 1PWGA 4WZ5A 3HLBA 3UDFA 1FCNA 2J9OA 1HVBA 2H10A 4KZ6A 4Y0TA 4ZDXA 2XFSA 5FI6A 3DWZA 3VP1A 3VOZA 2JCHA 1NZOA 4OPZA 4OPRA 1ES5A 1LLBA 1W5DA 4BENA 1EWZA 4CPKA 1VQQA 1GHIA 4GOGA 3ZDJA 1GA9A 3FWLA 5DVAA 3HLDA 4OOYA 3P98A 1K54C 3G30A 2IWBA 5GHYA 3ZGAB 5EVID 4E3KA 3NCKA 1DJBA 1FSYA 1RGZA 2J7VA 3BFGA 4OQHA 1U60A 4D2OA 3UPPA 4OQIA 1IKIA 3ZVWA 5FDHA 1NRFA 3QHYA 2G2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3K A;  1ALQ A;  1ES4 A;  1H8Z A;  3G4P A;  4LV3 A;  4S2O A;  2XF3 A;  1BLC A;  5TGF A;  1SDN A;  2H0T A;  1KGE A;  2XDM A;  5AQB A;  4B4Z A;  3VP3 A;  4DE2 A;  3MXS A;  2X01 A;  3HLG A;  4X68 A;  1NYY A;  3HVF A;  1KGG A;  2Y2H A;  4EWF A;  4WEL A;  3CG5 A;  4P85 A;  3FZC A;  2ZQD A;  4PM8 A;  2XQZ A;  4PM5 A;  3UN7 A;  1N4O A;  2WGW B;  2EXB A;  4MBH A;  3UPO A;  2XLN A;  1QME A;  4ZBE A;  4JXS A;  3O86 A;  3W4O A;  4Q8I A;  4QB8 A;  1XX2 A;  4KZA A;  4UA6 A;  3MZF A;  4E3O A;  3IF6 C;  1JWP A;  5KMW A;  3PBS A;  3ITB A;  4JPM A;  5A93 A;  1MWU A;  1CEF A;  1VM1 A;  3ZFZ A;  2ZMA A;  5FQK A;  4PM6 A;  5GHX A;  4N9K A;  1K57 A;  1G6A A;  1ERM A;  4OON A;  4GN2 A;  1PI5 A;  3VFF A;  3ITA A;  3DTM A;  1ONG A;  4X6T A;  3V3R A;  1H5X A;  4RX3 A;  1TVF A;  5F1G A;  3IHB A;  3N8S A;  5FI7 A;  4YFM A;  2WGW A;  3EQU A;  1LHY A;  2BG1 A;  5HX9 A;  3C7U A;  5CGS A;  2CC1 A;  5FAT A;  3PBO A;  5KZH A;  1XP4 A;  1W79 A;  4P6B A;  2Y2M A;  3WS4 A;  3GRJ A;  3HLF A;  5D3O A;  4X55 A;  2ZQA A;  3BFD A;  3NC8 A;  1LI0 A;  4U0X A;  4MEZ A;  3M2K A;  3IF5 A;  3N8L A;  2R9X A;  1Q2Q A;  3WS0 A;  4DXC A;  2WAD A;  3UPN A;  2WGI A;  3PBR A;  4IBX A;  2WZX A;  1K55 A;  4DXB A;  3BFF A;  3ZG9 B;  2HDQ A;  2WK0 A;  3BLS A;  1PW1 A;  2WYX A;  4FH2 A;  4R3J A;  3HLE A;  5CTM A;  5BOH A;  3HUN A;  2EFX A;  3W4P A;  4KZ8 A;  1KVL A;  2HP9 A;  1SCW A;  3MFD A;  1YMX A;  3HLC A;  1XKZ A;  4MLL A;  3TG9 A;  4C3Q A;  3C5A A;  1K56 D;  1KE3 A;  1ERO A;  3VSL A;  3G31 A;  4OP8 A;  2J8Y A;  1K6R A;  5HAQ A;  4RVA A;  3HUM A;  3W8K A;  5J8X A;  4Z9Q A;  1KE0 A;  2HPB A;  2XR0 A;  2ZM0 A;  4WEK A;  4OP5 A;  4S2N C;  5CHM A;  1JVJ A;  5EOE A;  2PU2 A;  3SS4 A;  3HRE A;  1NJ4 A;  2ZC4 B;  4DE1 A;  4KQO A;  4FCF A;  1TEM A;  2Y2K A;  4ZAM A;  1K57 C;  4KZ5 A;  4S2I A;  1SKF A;  1N9B A;  2G2W A;  1K38 A;  3V3S A;  3NIA A;  3C4O A;  3IQA A;  3Q7Z A;  3BRM A;  5DF7 A;  3LEZ A;  4N1X A;  3M6B A;  4KQQ A;  5E2H A;  1BLP A;  4ZJ1 A;  3Q1F A;  4MNR A;  3NI9 A;  4X56 A;  3SH9 A;  4ZJ2 A;  3CZD A;  2HP6 A;  1ES2 A;  3HLW A;  4WEJ A;  4WMC D;  5E43 A;  5AQ7 A;  4CJN A;  5GLD A;  3IH8 A;  1IYO A;  3MKE A;  1PWD A;  3UDX A;  1XGI A;  4U3T A;  4ZTK A;  4OPQ A;  1ZKJ A;  4K0X A;  5A90 A;  5M19 A;  1MBL A;  1O7E A;  3ZG0 A;  4DE3 A;  2Y2N A;  1IYQ A;  3ZG8 B;  5FAS A;  5GLA A;  1MWS A;  4JLF A;  4JXW A;  4ID4 A;  4WMC A;  1PYY A;  5HAR A;  3S1Y A;  4BLM A;  1HD8 A;  4LV1 A;  3QNB A;  3NDG A;  2FFF B;  1QMF A;  4QD4 A;  1G68 A;  1Z6F A;  1MKI A;  4KQR A;  3IWO A;  4MBK A;  1ES3 A;  3DW0 A;  5EPH A;  3MKF A;  1IKG A;  2ZLY A;  5DF8 A;  2IWD A;  5M1A A;  1L0D A;  5CGW A;  1BLH A;  3MXR A;  5A92 A;  3IH9 A;  5FA7 A;  4LV0 A;  1GHP A;  4H8R A;  4PM9 A;  4KZ4 A;  1XA7 A;  4R4S A;  4S2N A;  1H8Y A;  2XD1 A;  5KSH A;  1YLZ A;  2Y59 A;  2E8I A;  4EBN A;  3HL9 A;  3BFC A;  1LL9 A;  4E3L A;  3V39 A;  2Y2Q A;  1YT4 A;  2JE5 A;  1KGF A;  4OH0 A;  4KEN B;  1W8Y A;  2H5S A;  4GD6 A;  5FQJ A;  2WZZ A;  1S6R A;  1ESU A;  4WZ4 A;  3N8R A;  2Y2P A;  4KZ9 A;  4KZ3 A;  4BQM A;  4L0L A;  3WRZ A;  3M2J A;  5CTN A;  1IEL A;  1K54 A;  5CGX A;  2Y2G A;  2ZQ9 A;  4EUZ A;  1MWR A;  3O88 A;  4S2L A;  4R3B A;  3PBN A;  2A49 A;  3UNW A;  1Y54 A;  4P87 A;  5DF9 A;  3IHA A;  1MWT A;  3N4I A;  1K4F A;  3NY4 A;  5JYO A;  5GHZ A;  4FH4 A;  3O87 A;  3WS2 A;  1FR1 A;  5G18 A;  3HUO A;  1L0G A;  3VP0 A;  4KG6 A;  3N7W A;  1FCO A;  5CEC A;  2XGN A;  2Y2O A;  1BSG A;  2RL3 A;  3A3D A;  4QJG A;  4QU3 A;  4UAA A;  5TR7 A;  1KDS A;  2P9V B;  1ERQ A;  2OSU A;  2WAE A;  5FAQ A;  4E3J A;  4BL3 A;  3W4Q A;  5EOO A;  4E3M A;  2XK1 A;  1NYM A;  3I7J A;  3Q82 A;  2ZJ9 A;  4WYY A;  3OC2 A;  3PAE A;  2ZC6 B;  4OQG A;  5HW3 A;  1Q2P A;  3BEB A;  4KZB A;  3SH8 A;  4DRT A;  4BD0 A;  1YQS A;  1S0W A;  3D4F A;  3FKW A;  4HEF A;  4GD8 A;  2ZD8 A;  1XXM A;  3V5M A;  1M6K A;  2JC7 A;  3IWQ A;  1JTD A;  3AGD A;  1FR6 A;  1ZG6 A;  5CXW A;  3A3F A;  3GTC A;  4XUX A;  4FSF A;  5HL1 A;  3E2K A;  3O3V A;  2EX8 A;  3UO9 A;  4EBP A;  2QPN A;  3VP2 A;  5HAP A;  1PW8 A;  2XH9 A;  1HZO A;  1YMS A;  4R1G A;  2DRW A;  1RP5 A;  2VGK A;  4HES A;  1YLJ A;  3B3X A;  4QY6 A;  1FQG A;  2C6W B;  2IWC A;  1DJC A;  2X71 A;  3QNC A;  4YIN A;  2V1Z A;  1W8Q A;  4JBF A;  1YLT A;  3S22 A;  3G32 A;  4LV2 A;  4DDS A;  1W7F A;  3GMW A;  5M18 A;  4OLG A;  1YLY A;  5FQM A;  4WBG A;  5EVI A;  5CER A;  4GDN A;  3UE3 A;  4B4X A;  1BLS A;  1LI9 A;  3DWK A;  4DE0 A;  4Y0U A;  1YM1 A;  2BLS A;  2EXA A;  2P74 A;  3OPH A;  5FQQ A;  5U47 A;  4LCM A;  4GB7 A;  2Y2L A;  2WUQ A;  3FYZ A;  2UWX A;  4UA9 A;  4IBR A;  1ONH A;  1TDL A;  1BUL A;  4JKT A;  1E3U D;  2WKI A;  2FFY A;  2V2F F;  1BTL A;  2EX2 A;  4N9L A;  5IHV A;  2Y2J A;  4X69 A;  2I72 A;  4E3N A;  2OLU A;  4K0W A;  4WM9 A;  5FI2 A;  4IVK A;  2XFT A;  3PTE A;  4DF6 A;  4HBU A;  1FCM A;  4S2J A;  4ZJ3 A;  2QZ6 A;  1KVM A;  3FV7 A;  5AQ9 A;  5JYP A;  3VFH A;  5E2E A;  3JYI A;  3BLM A;  1PI4 A;  3CMZ A;  3G34 A;  2DNS A;  3MZE A;  3N6I A;  5CEB A;  1BZA A;  3C4P A;  1CI9 A;  4UHU A;  3ISG A;  5FQI A;  1HTZ A;  4BD1 A;  4GZB A;  3AGF A;  2OLV A;  2JBF A;  1XGJ A;  3PAG A;  1WYC A;  3ZG5 A;  5EVL A;  3OPR A;  4NET A;  4OQ0 A;  3ZVT A;  3SOI A;  1TDG A;  1CEG A;  4UA7 A;  3BFE A;  2XEP A;  3OPL A;  4KZ7 A;  4XUZ A;  2ZM8 A;  5EEC A;  3G35 A;  5HAI A;  4LCL A;  2ZQC A;  3A3E A;  2ZC5 B;  3IF6 A;  4EQI A;  3ZG7 B;  3UDI A;  4KG2 A;  1KE4 A;  4O7D A;  4DKI A;  3G2Y A;  4JXV A;  3OPP A;  3VP4 A;  3TOI A;  2WGV A;  3IXD A;  5GLC A;  4KG5 A;  3UE0 A;  1O07 A;  3GQZ A;  4GNU A;  3GV9 A;  2HDR A;  2Y4A A;  5TFQ A;  5DTT A;  2B5R A;  3NDE A;  4EV4 A;  1NXY A;  2ZC7 A;  3UE1 A;  5F82 A;  1CI8 A;  1JWZ A;  4OOL A;  1CK3 A;  4Y0O A;  3RJU A;  4WZ5 C;  3WS5 A;  2Y91 A;  2ZQ8 A;  1SDE A;  1MXO A;  2A3U A;  3EQV A;  5DTS A;  1DY6 A;  5CED A;  3GSG A;  4BJP A;  4IED A;  3V50 A;  1XA1 A;  3WS1 A;  3NBL A;  3IXG A;  1I2S A;  1DJA A;  1YLW A;  3FKV A;  4Y7P A;  4C75 A;  5EVI B;  5DTK A;  1PZP A;  2H0Y A;  2J9P A;  3Q07 A;  2X02 A;  5E2F A;  2HDU A;  1IEM A;  1BUE A;  3Q7V A;  3G2Z A;  1NY0 A;  1PZO A;  2V20 A;  2EFU A;  4GDB A;  3ZHH A;  1JTG A;  1C3B A;  2HDS A;  2Q9M A;  2GDN A;  5EUA A;  3A3I A;  5AQA A;  2ZQ7 A;  2PU4 A;  3MZD A;  2WAF A;  4OOM A;  3RXW A;  2Z2L B;  1RCJ A;  3GR2 A;  4PPR A;  3SS3 A;  3GVB A;  4A5R A;  2Y55 A;  1ZC2 A;  3CJM A;  5EVI C;  1SHV A;  2ZM2 A;  5F83 A;  3LY3 A;  5A91 A;  5CRF A;  3WRT A;  4JF5 A;  4NK3 A;  3IXB A;  1WYB A;  5L2F A;  2P9V A;  2QMI A;  2C5W B;  4R23 A;  3UY6 A;  1IYS A;  4K91 A;  2OV5 A;  3VSK A;  3OCL A;  2RCX A;  4F94 A;  1FSW A;  2XD5 A;  4FD8 A;  3WWX A;  3E2L A;  4E6X A;  3BEC A;  4S2M A;  2VGJ A;  4IVI A;  4BL2 A;  5CHU A;  4GKU A;  5I94 A;  1I5Q A;  4QHC A;  1E4D A;  1RGY A;  1WE4 A;  1K6S A;  1GA0 A;  4MBF A;  4RA7 A;  1XPB A;  3TSG A;  3SH7 A;  1MY8 A;  3HBR A;  3LCE A;  4P0M A;  4EBL A;  5KSC A;  3PBQ A;  1JWV A;  4LEN A;  4E3I A;  4DDY A;  4JF4 A;  3IXH A;  1E25 A;  1OME A;  3VOY A;  3ZNT A;  4R4R A;  4HBT A;  5E2G A;  3SS5 A;  3BM6 A;  1L0E A;  3IF6 B;  3PBT A;  3OCN A;  4OLD A;  5EE8 A;  1L0F A;  4PMA A;  3Q7V B;  5CHJ A;  5GL9 A;  2WKH A;  3S4X A;  2Y2I A;  4E6W A;  3C7V A;  3M6H A;  1K4E A;  5FAO A;  4C6Y A;  4OPY A;  2Q9N A;  4S2K A;  5HFO A;  4JXG A;  4N92 A;  2PBY A;  5FAP A;  5F1F A;  1ESI A;  4U0T A;  1YLP A;  3RXX A;  1PIO A;  4RX2 A;  4XXR A;  1K56 A;  3P09 A;  1MPL A;  3LO7 A;  2DCF A;  4JF6 A;  1M40 A;  1FOF A;  2Z2M B;  3MBZ A;  3Q81 A;  1BT5 A;  4B88 A;  2HP5 A;  1E3U A;  4RYE A;  3ZCZ A;  4OVD A;  1K55 C;  3IT9 A;  1K25 A;  2EX9 A;  4S2P A;  1GHM A;  4PM7 A;  2EX6 A;  5FQ9 A;  1KDW A;  1LL5 A;  1AXB A;  1L2S A;  1IYP A;  2R9W A;  5FSR A;  1J9M A;  5GLB A;  3BYD A;  3LY4 A;  2ZC3 B;  3IWI A;  3ZNY A;  3AGE A;  1GCE A;  1NZU A;  1EI5 A;  1PWC A;  3OZH A;  4N1H A;  4QY5 A;  1ZG4 A;  4X53 A;  3A3J A;  2WKE A;  1I2W A;  4OKP A;  4R0Q A;  3VMA A;  1PWG A;  4WZ5 A;  3HLB A;  3UDF A;  1FCN A;  2J9O A;  1HVB A;  2H10 A;  4KZ6 A;  4Y0T A;  4ZDX A;  2XFS A;  5FI6 A;  3DWZ A;  3VP1 A;  3VOZ A;  2JCH A;  1NZO A;  4OPZ A;  4OPR A;  1ES5 A;  1LLB A;  1W5D A;  4BEN A;  1EWZ A;  4CPK A;  1VQQ A;  1GHI A;  4GOG A;  3ZDJ A;  1GA9 A;  3FWL A;  5DVA A;  3HLD A;  4OOY A;  3P98 A;  1K54 C;  3G30 A;  2IWB A;  5GHY A;  3ZGA B;  5EVI D;  4E3K A;  3NCK A;  1DJB A;  1FSY A;  1RGZ A;  2J7V A;  3BFG A;  4OQH A;  1U60 A;  4D2O A;  3UPP A;  4OQI A;  1IKI A;  3ZVW A;  5FDH A;  1NRF A;  3QHY A;  2G2U A; 
#chains in the Genus database with same CATH topology
 4LV3 A;  3EOI A;  1SDN A;  1X0O A;  2Y2H A;  3QP8 A;  5KIZ A;  2ZQD A;  1TS7 A;  2WGW B;  2EXB A;  2L1M A;  4ZBE A;  3B42 A;  1XX2 A;  4KZA A;  4UA6 A;  3PBS A;  4ARZ B;  4MN5 A;  3T4J A;  2L4R A;  3ITB A;  5F6A A;  1G6A A;  4PAU A;  2VGL S;  4X6T A;  3V3R A;  2NUT C;  4HQA A;  4I38 A;  3EQU A;  2HF6 A;  5HX9 A;  3C7U A;  5CGS A;  5FAT A;  1XP4 A;  1W79 A;  3WS4 A;  3QP1 A;  5D3O A;  3BFD A;  1VET B;  4U0X A;  4MEZ A;  3N8L A;  4DXC A;  3UPN A;  2O99 A;  1F5M A;  2O0Y A;  4FH2 A;  5CTM A;  4D60 A;  3W4P A;  4YOF A;  4Y2F A;  2JN7 A;  2HP9 A;  1ZTU A;  4Y17 A;  2EA9 A;  4C3Q A;  4EXO A;  1T19 A;  5FDS A;  3VSL A;  4RVA A;  3HUM A;  4XT2 B;  5AJG A;  3S7N A;  5CHM A;  2XR0 A;  5LBR A;  4OP5 A;  2HV1 A;  3HRE A;  3F1O A;  1NJ4 A;  4NEE D;  2OWH A;  2FH5 A;  1K57 C;  1SKF A;  3UB9 A;  2PRF A;  3LEZ A;  3M6B A;  4KQQ A;  2ZL1 B;  4IHQ A;  5F69 A;  2OAP 1;  3NI9 A;  4GHI B;  4ZJ2 A;  1H3Q A;  3CZD A;  1ES2 A;  5GLD A;  1IYO A;  3MKE A;  2OWJ A;  2Q0O A;  1ZKJ A;  3ZG0 A;  1F9I A;  3T1Q B;  2PD8 A;  5GLA A;  1LSX A;  4JLF A;  3S1Y A;  1PYY A;  5FL3 A;  4BLM A;  1HD8 A;  3QNB A;  4HI4 A;  2FFF B;  1QMF A;  4KUK A;  5DJU A;  4XT2 A;  5EPH A;  5DF8 A;  2IWD A;  4G3V A;  1SKO B;  4PM9 A;  2Y59 A;  4GS9 B;  3BFC A;  4E3L A;  1YT4 A;  3UB6 A;  5J3W A;  2WZZ A;  4WZ4 A;  2Y2P A;  4KZ3 A;  4BQM A;  4EUZ A;  3ULF A;  2B18 A;  4O8G A;  1Y54 A;  3IHA A;  3N4I A;  1K4F A;  3UB5 P;  4HJ6 A;  2PYR A;  3A3D A;  3IS2 A;  1BYW A;  2WAE A;  4E3J A;  3TE8 A;  5TJJ A;  2XK1 A;  1NYM A;  2ZJ9 A;  1P97 A;  2W27 A;  4G3K A;  1YQS A;  3FKW A;  1XXM A;  3KYQ A;  3IWQ A;  4FTX A;  1JTD A;  3E4P A;  3A3F A;  5HL1 A;  2QPN A;  3KSH A;  3VP2 A;  5HAP A;  1PW8 A;  2W1T B;  2G7U A;  2DRW A;  3B3X A;  1FQG A;  2ZMF A;  2V1Z A;  1W8Q A;  1YLT A;  2M7V A;  3GMW A;  3UE3 A;  1LI9 A;  3DWK A;  2V8F A;  3KYZ A;  4Y0U A;  2BLS A;  4MCW A;  4WUJ A;  3S7P A;  2UWX A;  3NHQ A;  3T1S A;  4AFI A;  4JKT A;  3MSH A;  4HOI A;  2LB5 A;  1UWP X;  4E3N A;  5FI2 A;  1YSQ A;  4LLO B;  5IS1 A;  2Y8H A;  1KVM A;  5AQ9 A;  5E2E A;  3N6I A;  1CI9 A;  4BD1 A;  4GZB A;  2JBF A;  1XGJ A;  3PAG A;  3B47 A;  3ZG5 A;  4OQ0 A;  4UA7 A;  1CEG A;  5HAI A;  2ZQC A;  3ZG7 B;  4BBV A;  1OTE A;  1PNE A;  4K08 A;  4O7D A;  1T1A A;  4JGR A;  3VV4 A;  4ARZ A;  1XJ4 A;  3UE0 A;  3V67 A;  5DTT A;  4HJ3 A;  1A0K A;  1CI8 A;  3RTY A;  4PKY A;  1CK3 A;  2I9V A;  3W2Z A;  1MXO A;  3EQV A;  5DTS A;  4BJP A;  1YPR A;  3V50 A;  3EGD C;  1YLW A;  3FKV A;  1N9N A;  5EM1 A;  4B9O A;  5DTK A;  2H0Y A;  5E2F A;  2X02 A;  4ETZ A;  5HDS A;  5HD5 A;  1PZO A;  2EFU A;  4GDB A;  1C3B A;  3GEC A;  2D01 A;  2HDS A;  1IOU A;  3T1X A;  3GVB A;  4A5R A;  2Y55 A;  3CJM A;  3K3D A;  4Y3I A;  3IXB A;  1WYB A;  5L2F A;  4R23 A;  1SKO A;  4E6X A;  3WWX A;  3E2L A;  2L0W A;  5I94 A;  1NWZ A;  4GS9 A;  4MBF A;  1XPB A;  2VX8 A;  1MY8 A;  4IJG A;  5L07 A;  3PBQ A;  4LEN A;  4R4R A;  4HJ4 A;  1L0E A;  4L9E A;  5HDC A;  3NUL A;  3SZT A;  5CHJ A;  1SZV A;  4E6W A;  3C7V A;  5HFO A;  3TRC A;  1PIO A;  1MPL A;  3LO7 A;  2Z2M B;  1E3U A;  2QJ5 A;  4FOF A;  4S2P A;  3F1N B;  4PM7 A;  5FQ9 A;  1KDW A;  1LL5 A;  3LY4 A;  3K3C A;  1EI5 A;  2IA2 A;  4QY5 A;  1DP9 A;  1ZG4 A;  1D06 A;  4OKP A;  3HLB A;  3UDF A;  1FCN A;  2J9O A;  2H10 A;  4ZDX A;  3KSI A;  4BEN A;  4CPK A;  1VQQ A;  4GOG A;  2WKQ A;  3FWL A;  3G30 A;  5GHY A;  5EVI D;  4E3K A;  1RGZ A;  4OQH A;  3R4K A;  4D2O A;  4OQI A;  5FDH A;  4F3L B;  4Y5F A;  2G2U A;  4M3K A;  4S2O A;  2XF3 A;  4B4Z A;  2XDM A;  3MXS A;  4X68 A;  1NYY A;  1KGG A;  3VE3 A;  2J3T D;  4CLC E;  4PM8 A;  3C30 A;  4PM5 A;  4MBH A;  4Q8I A;  3O86 A;  3C8C A;  5J7E A;  4E3O A;  5KMW A;  5A93 A;  2UV0 E;  1J3W A;  2KX6 A;  3D72 A;  3CLO A;  4R70 A;  3NOP C;  5F1G A;  3IHB A;  4YFM A;  4DJ3 A;  2WGW A;  2Z6C A;  2BG1 A;  2CC1 A;  1TS6 A;  4JGO A;  3GRJ A;  3C2W A;  3H7W B;  3WS0 A;  4IBX A;  2WZX A;  3BFF A;  2WK0 A;  3HLE A;  3CPT A;  3HUN A;  3E0Y A;  2EFX A;  4EEP A;  1T18 A;  1YMX A;  5A8B A;  2PD7 A;  1K6R A;  5HAQ A;  3QP2 A;  4KQO A;  4FCF A;  2Y2K A;  3B33 A;  2PT7 A;  2G2W A;  1N9B A;  3V3S A;  3HJK A;  3BRM A;  5E2H A;  1BLP A;  3ICY A;  3Q1F A;  4MNR A;  2K31 A;  4WMC D;  3IH8 A;  1PWD A;  3LIF A;  3UDX A;  4U3T A;  4ZTK A;  1MBL A;  3T50 A;  4Q0I A;  4LV1 A;  1N9O A;  3NDG A;  4DMZ A;  2BTF P;  1G68 A;  1Z6F A;  4KQR A;  1MZU A;  3MKF A;  5I5L A;  1LSV A;  5CGW A;  1BLH A;  5A92 A;  5FA7 A;  1H8M A;  1P9W A;  4KZ4 A;  1XA7 A;  4R4S A;  5C5K A;  2W3D A;  2XD1 A;  3CIT A;  3LID A;  1UGU A;  2E8I A;  4EBN A;  3HL9 A;  1LL9 A;  3EGX C;  3D3O A;  4LRX C;  2QYB A;  3LFV A;  4HNB A;  4KZ9 A;  1FIL A;  4L0L A;  2V9A A;  1IEL A;  5FEF A;  2ZQ9 A;  3O88 A;  4NXB A;  4R3B A;  5GHZ A;  2EWV A;  1L0G A;  3TJZ C;  3VP0 A;  1BSG A;  3OOV A;  4QU3 A;  4R3A A;  5TR7 A;  4QWO A;  2W3F A;  2DMW A;  4EET B;  5EOO A;  5DKK A;  4E3M A;  4MN7 A;  3I7J A;  4WYY A;  5HW3 A;  1Q2P A;  3BEB A;  4DRT A;  4GCZ A;  2JKR M;  4HEF A;  3V5M A;  2JC7 A;  2QKP A;  2FZ0 A;  3IS2 B;  1ZG6 A;  3SW1 A;  4XUX A;  4FSF A;  3E2K A;  4EBP A;  3FG8 A;  3CWF A;  2XH9 A;  2VGK A;  1YLJ A;  2X71 A;  1DJC A;  4YIN A;  3S22 A;  4EW7 A;  1Y28 A;  5M18 A;  5FQM A;  5EV0 A;  5EVI A;  4B4X A;  1BLS A;  2Y79 A;  3MS6 A;  2B02 A;  5U47 A;  2HJ9 C;  2YKH A;  2Y2L A;  2WUQ A;  4UA9 A;  4IBR A;  1TDL A;  3LIA A;  3A0V A;  4QPR A;  4NXF A;  2EX2 A;  4N9L A;  4X69 A;  2I72 A;  2OLU A;  4K0W A;  4WM9 A;  1OT9 A;  3D9Y A;  1V9Y A;  1FCM A;  4HBU A;  4S2J A;  3UMD A;  2BAS A;  4ZJ3 A;  4PKY G;  5JYP A;  3VFH A;  3CMZ A;  3G34 A;  3MZE A;  3MFX A;  3T12 B;  3ISG A;  3AGF A;  3JVV A;  3CPT B;  3OPR A;  3SOI A;  3BFE A;  3DAV A;  3IF6 A;  1OJG A;  1TS8 A;  4KG2 A;  1KE4 A;  4LFU A;  3KO6 A;  3T4Q A;  2V1A A;  3TOI A;  1S4R A;  2O9A A;  3GQZ A;  4GNU A;  3GV9 A;  2HDR A;  4EV4 A;  1NXY A;  5F82 A;  4OOL A;  1DY6 A;  4YNR A;  4WLA A;  1DJA A;  3EWK A;  1K0K A;  1PZP A;  3Q07 A;  5G4Y A;  2HDU A;  1IEM A;  4NKP A;  1NY0 A;  1TF1 A;  2V20 A;  5L09 A;  3ZHH A;  3A3I A;  5AQA A;  3MZD A;  3PXP A;  5DFX A;  4UQI M;  3GR2 A;  3SS3 A;  2CMN A;  3A0R A;  1ZC2 A;  5A91 A;  4JF5 A;  3LUQ A;  2P9V A;  2QMI A;  2V1B A;  3BQ8 A;  3BEC A;  2QJ7 A;  2VGJ A;  4IVI A;  4BL2 A;  3BY9 A;  3L9K A;  1Y4O A;  1MKM A;  1E4D A;  1WE4 A;  4RA7 A;  1P9R A;  3KYE A;  4X25 A;  1S67 L;  3LCE A;  2XRN A;  2K2N A;  5KSC A;  2M1C A;  1JWV A;  3IXH A;  1E25 A;  3VOY A;  5G4Z A;  5E2G A;  3SS5 A;  4JGP A;  4PMA A;  5GL9 A;  2WKH A;  3BJN A;  3M6H A;  4C6Y A;  4KQD A;  2Q9N A;  4S2K A;  1TS0 A;  4N92 A;  5F1F A;  2EWW A;  4GLQ A;  2A24 A;  4RX2 A;  4XXR A;  1K56 A;  1FOF A;  3CHW P;  3Q81 A;  1BT5 A;  4B88 A;  2HP5 A;  3ZCZ A;  4OVD A;  1K55 C;  3IT9 A;  3U2A A;  2EX9 A;  2EX6 A;  3LYX A;  1ACF A;  4R6L A;  4ZRR A;  2R9W A;  2W1R A;  5GLB A;  3ZNY A;  4MN6 A;  3AGE A;  1LT0 A;  3OZH A;  1PWC A;  3A3J A;  1T1B A;  1I2W A;  1F98 A;  1PWG A;  2J80 A;  3VOZ A;  4KUO A;  1GHI A;  3EEH A;  2VKS A;  5DVA A;  4OOY A;  5HWV A;  3NCK A;  1DJB A;  1FSY A;  1GSW A;  1IKI A;  2ZMV A;  1NRF A;  3NJA A;  5FQQ A;  3KX0 X;  1ALQ A;  1ES4 A;  1H8Z A;  1BLC A;  2H0T A;  5AQB A;  2PR6 A;  3VP3 A;  4DE2 A;  2X01 A;  5F5Y A;  2P04 A;  3HVF A;  4WEL A;  3K2N A;  4P85 A;  3FZC A;  3UN7 A;  1N4O A;  2ZL1 A;  2PBD P;  2XLN A;  1QME A;  3T4O A;  4JXS A;  2LB9 A;  1XJ2 A;  3MZF A;  3F1P B;  1S1Z A;  1MWU A;  1CEF A;  1VM1 A;  2PHY A;  3IX4 A;  4EQ1 A;  4PM6 A;  5GHX A;  1LL8 A;  1K57 A;  4R38 A;  4OON A;  3VFF A;  2XRO A;  3ITA A;  4RX3 A;  1TVF A;  3N8S A;  2KLI A;  3P01 A;  5IU1 A;  3R7W A;  5HDD A;  4P6B A;  2PAV P;  3HLF A;  4HP4 A;  2ZQA A;  3NC8 A;  3M2K A;  3IF5 A;  2R9X A;  3QP4 A;  2WGI A;  4E04 A;  3PBR A;  1K55 A;  4DXB A;  3ZG9 B;  2A24 B;  3BLS A;  2WYX A;  5BOH A;  4KZ8 A;  2W0N A;  3E4O A;  4MLL A;  5HPF A;  1KE3 A;  1ERO A;  4OP8 A;  3H7W A;  2J8Y A;  5J8X A;  2HPB A;  2ZM0 A;  4S2N C;  5EOE A;  1JVJ A;  2PU2 A;  3SS4 A;  1STZ A;  4DE1 A;  1TEM A;  1DP8 A;  4KZ5 A;  2ZOI A;  3DTK A;  1K38 A;  3C4O A;  3IQA A;  1T1C A;  5AVE A;  3OBF A;  1L3L A;  4Q0H A;  4ZJ1 A;  3S7Q A;  3FC7 A;  4CJN A;  5E43 A;  5AQ7 A;  4BMW A;  2O9C A;  2XSS A;  4OPQ A;  3TW8 A;  4K0X A;  5A90 A;  5M19 A;  4DE3 A;  1O7E A;  3LI9 A;  2Y2N A;  3ZG8 B;  5FAS A;  1W63 M;  4JXW A;  4ID4 A;  5AVF A;  1G28 A;  1ES3 A;  1VHM A;  2ZLY A;  5M1A A;  2GX5 A;  4LV0 A;  1GHP A;  4S2N A;  5KSH A;  1YLZ A;  2JKT M;  3V39 A;  1KGF A;  3U4L P;  1W8Y A;  3A0S A;  3O5Y A;  2JKT I;  4GD6 A;  1S1Y A;  1S6R A;  5MC7 A;  3M2J A;  4NXE A;  2VV7 A;  1K54 A;  5CGX A;  2Y2G A;  5DFY A;  2XA7 M;  3DTI A;  3PBN A;  2A49 A;  3UNW A;  5DF9 A;  1MWT A;  5F68 A;  4X1M A;  3O87 A;  1FR1 A;  5G18 A;  3HUO A;  4KG6 A;  3N7W A;  1FCO A;  2XGN A;  2RL3 A;  4QJG A;  1PRQ A;  2KDK A;  1KDS A;  2P9V B;  4GHI A;  4ESP A;  1MC0 A;  2OSU A;  3JPU A;  3CUE A;  4MDZ A;  4L9F A;  3OC2 A;  4OQG A;  3SH8 A;  4BD0 A;  3IX3 A;  4GD8 A;  2ZD8 A;  1M6K A;  3AGD A;  2WKR A;  2H28 A;  4LGW A;  2Z6D A;  2EX8 A;  1GSV A;  1HZO A;  3PHY A;  4HES A;  4QY6 A;  2IWC A;  3QNC A;  4O01 A;  3G32 A;  1G5U A;  4DDS A;  1JNU A;  2OAQ 1;  3MQ0 A;  4OLG A;  4GDN A;  1YM1 A;  2EXA A;  2P74 A;  3OPH A;  4LCM A;  4GB7 A;  3FYZ A;  2HGV A;  3ZYT A;  1ONH A;  4EES A;  4YWZ A;  1BUL A;  3CUE C;  4IUK A;  1E3U D;  1CF0 A;  2WKI A;  2NUP C;  2V2F F;  5IHV A;  2XFT A;  3PTE A;  4DF6 A;  1H0M A;  4DN0 A;  2QZ6 A;  3FV7 A;  2DNS A;  1S66 L;  5CEB A;  3C4P A;  4B93 A;  3LI8 A;  2OLV A;  2V8C A;  1WYC A;  2PR5 A;  5EVL A;  3ZVT A;  2INW A;  2ZM8 A;  3G35 A;  1NLZ A;  2VJW A;  4EUV A;  3A3E A;  4BWI A;  3KSF A;  3FPW A;  3L7H A;  5EVE A;  3T4S A;  2ZOH A;  3MR0 A;  4JXV A;  3OPP A;  2WGV A;  3IXD A;  2QWS A;  4KG5 A;  1O07 A;  2Y4A A;  5TFQ A;  2B5R A;  3NDE A;  3T4K A;  3NOT C;  1JWZ A;  4WZ5 C;  3WS5 A;  2A3U A;  2Y91 A;  3F1N A;  3IX8 A;  2W3E A;  4IED A;  3WS1 A;  4UQI S;  3IXG A;  4Y7P A;  1FIK A;  4C75 A;  3IBR A;  2JHE A;  3G2Z A;  1JTG A;  3RH8 B;  2P08 A;  2Q9M A;  2V0W A;  5EUA A;  4CLC C;  2ZQ7 A;  2WAF A;  4NXG A;  3RXW A;  2Z2L B;  1RCJ A;  4PPR A;  3T4T A;  2R78 A;  3UE6 A;  1OTD A;  4HIA A;  5F83 A;  1SHV A;  2ZM2 A;  4NK3 A;  3BY8 A;  2C5W B;  3UY6 A;  1IYS A;  4MMN A;  2OV5 A;  3LEQ A;  3OCL A;  4F94 A;  1FSW A;  2XD5 A;  4FD8 A;  4CLC D;  4GKU A;  3P7N A;  4F3L A;  1GA0 A;  3TSG A;  3SH7 A;  3HBR A;  3NEC A;  2KOI A;  4DDY A;  1OME A;  1OTI A;  3ZNT A;  1YSP A;  4HBT A;  5HL6 A;  3BM6 A;  4OLD A;  5EE8 A;  1L0F A;  3S4X A;  3VOL A;  2Y2I A;  1W63 Q;  1KOU A;  5FAP A;  1ESI A;  1YLP A;  5HD3 A;  4DJ2 A;  5HWT A;  3P09 A;  4JF6 A;  3MBZ A;  2JKG A;  3HCY A;  2B95 A;  1AXB A;  2VEA A;  2VLG A;  2ZC3 B;  3NOU C;  1ODV A;  2VV8 A;  1N9L A;  4R0Q A;  4WZ5 A;  4KZ6 A;  4P6Z M;  2XFS A;  3VP1 A;  4NG2 A;  1NZO A;  3CAX A;  4OPR A;  1W5D A;  3ZDJ A;  4HH2 A;  1DP6 A;  3HLD A;  4H6J B;  1K54 C;  3ZGA B;  1G6O A;  3UPP A;  2AVX A;  3ZVW A;  3G4P A;  5TGF A;  1KGE A;  3HLG A;  4CQH A;  4BBT A;  4EWF A;  3CG5 A;  2XQZ A;  3UPO A;  3W4O A;  4QB8 A;  2PYP A;  3IF6 C;  1JWP A;  4BBU A;  1VB6 A;  2WKP A;  4JPM A;  2OOL A;  3ZFZ A;  2ZMA A;  5FQK A;  3BQA A;  3MJQ A;  4N9K A;  1ERM A;  3MMH A;  4GN2 A;  1PI5 A;  4I3A A;  3DTM A;  1ONG A;  5K5B A;  1VEU A;  4RQ9 A;  1H5X A;  2XA7 S;  5FI7 A;  1LHY A;  2VZW A;  3LIE A;  3PBO A;  5KZH A;  2Y2M A;  4X55 A;  4ETX A;  1LI0 A;  4ME4 A;  3UB7 A;  3MXQ A;  5HWW A;  1Q2Q A;  2VV6 A;  3KSG A;  2WAD A;  4EEU A;  3JVU A;  2W3H A;  2D02 A;  2HDQ A;  1AWI A;  1PW1 A;  1UWN X;  4R3J A;  5L10 A;  1KVL A;  1SCW A;  3MFD A;  3HLC A;  1XKZ A;  3TG9 A;  3C5A A;  1K56 D;  4HH3 A;  3G31 A;  3W8K A;  4LRZ E;  4Z9Q A;  1KE0 A;  4WEK A;  2ZC4 B;  1OJ5 A;  4ZAM A;  4S2I A;  4WF0 A;  4LRY C;  3NIA A;  3Q7Z A;  5DF7 A;  4N1X A;  3LR3 A;  1ZHH B;  2M7U A;  4X56 A;  3SH9 A;  4H6J A;  1XJ3 A;  2HP6 A;  3HLW A;  4WEJ A;  4CLC B;  1XGI A;  2E8J A;  3S7O A;  1IYQ A;  1MWS A;  4WMC A;  5HAR A;  2GNX A;  4PHT A;  4QD4 A;  1MKI A;  3IWO A;  4MBK A;  2GJ3 A;  3BW6 A;  5DJT A;  3DW0 A;  1IFQ A;  1IKG A;  1L0D A;  3UB8 A;  1Z09 A;  3MXR A;  3IH9 A;  3T4L A;  1S4S A;  4H8R A;  4I3J A;  1H8Y A;  3OLO A;  2J3W A;  2Y2Q A;  3VE4 A;  2JE5 A;  4O0P A;  4OH0 A;  4KEN B;  2H5S A;  2VK3 A;  1GSX A;  1CQA A;  1WA9 A;  5FQJ A;  1ESU A;  3N8R A;  5TBM A;  3WRZ A;  5CTN A;  1LSW A;  1P0Z A;  4CLC A;  1MWR A;  1YAX A;  4S2L A;  4P87 A;  1D1J A;  5JYO A;  3NY4 A;  2K7S A;  4I39 A;  4FH4 A;  3ZQ5 A;  1OTB A;  3WS2 A;  1DRM A;  5J4E A;  3LR0 A;  3MQQ A;  5CEC A;  2Y2O A;  3LR4 A;  3PR6 A;  4UAA A;  3LR5 A;  1ERQ A;  5FAQ A;  4BL3 A;  3W4Q A;  2HJE A;  3Q82 A;  4Z1W A;  3PAE A;  2ZC6 B;  1XFN A;  4KZB A;  3D4F A;  1S0W A;  1HLU P;  5TBM B;  5EFW A;  1FR6 A;  5CXW A;  3GTC A;  3QP6 A;  4G3W A;  3O3V A;  3UO9 A;  1YMS A;  3E98 A;  4R1G A;  1RP5 A;  2C6W B;  1PFL A;  4JBF A;  2ACG A;  4LV2 A;  1W7F A;  3R7W B;  4UEY A;  4GW9 A;  1D7E A;  1YLY A;  4II7 A;  4WBG A;  5CER A;  1TD5 A;  4DE0 A;  1XJ6 A;  2GZA A;  3BWL A;  1NLY A;  3QP5 A;  2FFY A;  1BTL A;  3LIB A;  2Y2J A;  3CI6 A;  4IVK A;  2O9B A;  4IUH A;  4WN5 A;  1CJF A;  3G6O A;  4M4X A;  3JYI A;  3BLM A;  1PI4 A;  2JKF A;  2MJ6 A;  1BZA A;  4HY8 A;  3DBA A;  1VET A;  4UHU A;  5FQI A;  1HTZ A;  4LPZ A;  5L8M A;  5HZH A;  4Q0J A;  4NET A;  1TDG A;  2XEP A;  3OPL A;  4KZ7 A;  4XUZ A;  5EEC A;  4LCL A;  2ZC5 B;  4EQI A;  4I3I A;  3UDI A;  5HSQ A;  3IBJ A;  4HP9 A;  3H82 B;  5EM0 A;  4DKI A;  3G2Y A;  1YKD A;  2PDR A;  3VP4 A;  4I5S A;  5GLC A;  2VGL M;  2V0U A;  2ZC7 A;  3UE1 A;  3RJU A;  4Y0O A;  4P6Z S;  2ZQ8 A;  1VEU B;  1SDE A;  5CED A;  3GSG A;  1XA1 A;  3NBL A;  1I2S A;  1OT6 A;  3E4Q A;  5EVI B;  2J9P A;  1BUE A;  3Q7V A;  2J3T C;  4EER A;  4HHD A;  1OTA A;  2GDN A;  2PU4 A;  4OOM A;  1F2K A;  5EVI C;  3WRT A;  3LY3 A;  5CRF A;  3RFB A;  3H82 A;  4K91 A;  3VSK A;  2RCX A;  3H9W A;  4GJ4 A;  3LIC A;  2A2L A;  2YKF A;  4S2M A;  5CHU A;  1I5Q A;  4QHC A;  2HZ5 A;  3T1R A;  4Y13 A;  1RGY A;  4WL9 A;  1K6S A;  5DKL A;  3MF0 A;  4P0M A;  4EBL A;  5FEG A;  1XFQ A;  4E3I A;  5IT5 A;  4JF4 A;  5HPI A;  1V9Z A;  3IF6 B;  3PBT A;  3OCN A;  3F1P A;  3Q7V B;  1K4E A;  5FAO A;  2W1T A;  4OPY A;  4JXG A;  2PBY A;  3FPV A;  4U0T A;  1EW0 A;  3RXX A;  2DCF A;  1M40 A;  4JGQ A;  4X1L A;  4RYE A;  1K25 A;  1GHM A;  4L9G A;  1OPX A;  3GDI A;  3LGO A;  2W3G A;  4FUW A;  1L2S A;  3C38 A;  3HJI A;  1IYP A;  3UME A;  5FSR A;  3MQO A;  1J9M A;  3BYD A;  3IWI A;  3F1O B;  1GCE A;  1NZU A;  4N1H A;  4X53 A;  2WKE A;  3VMA A;  3DTE A;  1HVB A;  4Y0T A;  5FI6 A;  3DWZ A;  4EU0 A;  4OPZ A;  2JCH A;  1ES5 A;  1LLB A;  2P7J A;  1EWZ A;  1NRJ A;  2JKR I;  2VA0 A;  5CX7 A;  1GA9 A;  2ZBB A;  3EEA A;  3P98 A;  4Y15 A;  2IWB A;  3PYP A;  2J7V A;  3BFG A;  2QHK A;  1U60 A;  3QHY A; 
#chains in the Genus database with same CATH homology
 4M3K A;  1ALQ A;  1ES4 A;  1H8Z A;  3G4P A;  4LV3 A;  4S2O A;  2XF3 A;  1BLC A;  5TGF A;  1SDN A;  2H0T A;  1KGE A;  2XDM A;  5AQB A;  4B4Z A;  3VP3 A;  4DE2 A;  3MXS A;  2X01 A;  3HLG A;  4X68 A;  1NYY A;  3HVF A;  1KGG A;  2Y2H A;  4EWF A;  4WEL A;  3CG5 A;  4P85 A;  3FZC A;  2ZQD A;  4PM8 A;  2XQZ A;  4PM5 A;  3UN7 A;  1N4O A;  2WGW B;  2EXB A;  4MBH A;  3UPO A;  2XLN A;  1QME A;  4ZBE A;  4JXS A;  3O86 A;  3W4O A;  4Q8I A;  4QB8 A;  1XX2 A;  4KZA A;  4UA6 A;  3MZF A;  4E3O A;  3IF6 C;  1JWP A;  5KMW A;  3PBS A;  3ITB A;  4JPM A;  5A93 A;  1MWU A;  1CEF A;  1VM1 A;  3ZFZ A;  2ZMA A;  5FQK A;  4PM6 A;  5GHX A;  4N9K A;  1K57 A;  1G6A A;  1ERM A;  4OON A;  4GN2 A;  1PI5 A;  3VFF A;  3ITA A;  3DTM A;  1ONG A;  4X6T A;  3V3R A;  1H5X A;  4RX3 A;  1TVF A;  5F1G A;  3IHB A;  3N8S A;  5FI7 A;  4YFM A;  2WGW A;  3EQU A;  1LHY A;  2BG1 A;  5HX9 A;  3C7U A;  5CGS A;  2CC1 A;  5FAT A;  3PBO A;  5KZH A;  1XP4 A;  1W79 A;  4P6B A;  2Y2M A;  3WS4 A;  3GRJ A;  3HLF A;  5D3O A;  4X55 A;  2ZQA A;  3BFD A;  3NC8 A;  1LI0 A;  4U0X A;  4MEZ A;  3M2K A;  3IF5 A;  3N8L A;  2R9X A;  1Q2Q A;  3WS0 A;  4DXC A;  2WAD A;  3UPN A;  2WGI A;  3PBR A;  4IBX A;  2WZX A;  1K55 A;  4DXB A;  3BFF A;  3ZG9 B;  2HDQ A;  2WK0 A;  3BLS A;  1PW1 A;  2WYX A;  4FH2 A;  4R3J A;  3HLE A;  5CTM A;  5BOH A;  3HUN A;  2EFX A;  3W4P A;  4KZ8 A;  1KVL A;  2HP9 A;  1SCW A;  3MFD A;  1YMX A;  3HLC A;  1XKZ A;  4MLL A;  3TG9 A;  4C3Q A;  3C5A A;  1K56 D;  1KE3 A;  1ERO A;  3VSL A;  3G31 A;  4OP8 A;  2J8Y A;  1K6R A;  5HAQ A;  4RVA A;  3HUM A;  3W8K A;  5J8X A;  4Z9Q A;  1KE0 A;  2HPB A;  2XR0 A;  2ZM0 A;  4WEK A;  4OP5 A;  4S2N C;  5CHM A;  1JVJ A;  5EOE A;  2PU2 A;  3SS4 A;  3HRE A;  1NJ4 A;  2ZC4 B;  4DE1 A;  4KQO A;  4FCF A;  1TEM A;  2Y2K A;  4ZAM A;  1K57 C;  4KZ5 A;  4S2I A;  1SKF A;  1N9B A;  2G2W A;  1K38 A;  3V3S A;  3NIA A;  3C4O A;  3IQA A;  3Q7Z A;  3BRM A;  5DF7 A;  3LEZ A;  4N1X A;  3M6B A;  4KQQ A;  5E2H A;  1BLP A;  4ZJ1 A;  3Q1F A;  4MNR A;  3NI9 A;  4X56 A;  3SH9 A;  4ZJ2 A;  3CZD A;  2HP6 A;  1ES2 A;  3HLW A;  4WEJ A;  4WMC D;  5E43 A;  5AQ7 A;  4CJN A;  5GLD A;  3IH8 A;  1IYO A;  3MKE A;  1PWD A;  3UDX A;  1XGI A;  4U3T A;  4ZTK A;  4OPQ A;  1ZKJ A;  4K0X A;  5A90 A;  5M19 A;  1MBL A;  1O7E A;  3ZG0 A;  4DE3 A;  2Y2N A;  1IYQ A;  3ZG8 B;  5FAS A;  5GLA A;  1MWS A;  4JLF A;  4JXW A;  4ID4 A;  4WMC A;  1PYY A;  5HAR A;  3S1Y A;  4BLM A;  1HD8 A;  4LV1 A;  3QNB A;  3NDG A;  2FFF B;  1QMF A;  4QD4 A;  1G68 A;  1Z6F A;  1MKI A;  4KQR A;  3IWO A;  4MBK A;  1ES3 A;  3DW0 A;  5EPH A;  3MKF A;  1IKG A;  2ZLY A;  5DF8 A;  2IWD A;  5M1A A;  1L0D A;  5CGW A;  1BLH A;  3MXR A;  5A92 A;  3IH9 A;  5FA7 A;  4LV0 A;  1GHP A;  4H8R A;  4PM9 A;  4KZ4 A;  1XA7 A;  4R4S A;  4S2N A;  1H8Y A;  2XD1 A;  5KSH A;  1YLZ A;  2Y59 A;  2E8I A;  4EBN A;  3HL9 A;  3BFC A;  1LL9 A;  4E3L A;  3V39 A;  2Y2Q A;  1YT4 A;  2JE5 A;  1KGF A;  4OH0 A;  4KEN B;  1W8Y A;  2H5S A;  4GD6 A;  5FQJ A;  2WZZ A;  1S6R A;  1ESU A;  4WZ4 A;  3N8R A;  2Y2P A;  4KZ9 A;  4KZ3 A;  4BQM A;  4L0L A;  3WRZ A;  3M2J A;  5CTN A;  1IEL A;  1K54 A;  5CGX A;  2Y2G A;  2ZQ9 A;  4EUZ A;  1MWR A;  3O88 A;  4S2L A;  4R3B A;  3PBN A;  2A49 A;  3UNW A;  1Y54 A;  4P87 A;  5DF9 A;  3IHA A;  1MWT A;  3N4I A;  1K4F A;  3NY4 A;  5JYO A;  5GHZ A;  4FH4 A;  3O87 A;  3WS2 A;  1FR1 A;  5G18 A;  3HUO A;  1L0G A;  3VP0 A;  4KG6 A;  3N7W A;  1FCO A;  5CEC A;  2XGN A;  2Y2O A;  1BSG A;  2RL3 A;  3A3D A;  4QJG A;  4QU3 A;  4UAA A;  5TR7 A;  1KDS A;  2P9V B;  1ERQ A;  2OSU A;  2WAE A;  5FAQ A;  4E3J A;  4BL3 A;  3W4Q A;  5EOO A;  4E3M A;  2XK1 A;  1NYM A;  3I7J A;  3Q82 A;  2ZJ9 A;  4WYY A;  3OC2 A;  3PAE A;  2ZC6 B;  4OQG A;  5HW3 A;  1Q2P A;  3BEB A;  4KZB A;  3SH8 A;  4DRT A;  4BD0 A;  1YQS A;  1S0W A;  3D4F A;  3FKW A;  4HEF A;  4GD8 A;  2ZD8 A;  1XXM A;  3V5M A;  1M6K A;  2JC7 A;  3IWQ A;  1JTD A;  3AGD A;  1FR6 A;  1ZG6 A;  5CXW A;  3A3F A;  3GTC A;  4XUX A;  4FSF A;  5HL1 A;  3E2K A;  3O3V A;  2EX8 A;  3UO9 A;  4EBP A;  2QPN A;  3VP2 A;  5HAP A;  1PW8 A;  2XH9 A;  1HZO A;  1YMS A;  4R1G A;  2DRW A;  1RP5 A;  2VGK A;  4HES A;  1YLJ A;  3B3X A;  4QY6 A;  1FQG A;  2C6W B;  2IWC A;  1DJC A;  2X71 A;  3QNC A;  4YIN A;  2V1Z A;  1W8Q A;  4JBF A;  1YLT A;  3S22 A;  3G32 A;  4LV2 A;  4DDS A;  1W7F A;  3GMW A;  5M18 A;  4OLG A;  1YLY A;  5FQM A;  4WBG A;  5EVI A;  5CER A;  4GDN A;  3UE3 A;  4B4X A;  1BLS A;  1LI9 A;  3DWK A;  4DE0 A;  4Y0U A;  1YM1 A;  2BLS A;  2EXA A;  2P74 A;  3OPH A;  5FQQ A;  5U47 A;  4LCM A;  4GB7 A;  2Y2L A;  2WUQ A;  3FYZ A;  2UWX A;  4UA9 A;  4IBR A;  1ONH A;  1TDL A;  1BUL A;  4JKT A;  1E3U D;  2WKI A;  2FFY A;  2V2F F;  1BTL A;  2EX2 A;  4N9L A;  5IHV A;  2Y2J A;  4X69 A;  2I72 A;  4E3N A;  2OLU A;  4K0W A;  4WM9 A;  5FI2 A;  4IVK A;  2XFT A;  3PTE A;  4DF6 A;  4HBU A;  1FCM A;  4S2J A;  4ZJ3 A;  2QZ6 A;  1KVM A;  3FV7 A;  5AQ9 A;  5JYP A;  3VFH A;  5E2E A;  3JYI A;  3BLM A;  1PI4 A;  3CMZ A;  3G34 A;  2DNS A;  3MZE A;  3N6I A;  5CEB A;  1BZA A;  3C4P A;  1CI9 A;  4UHU A;  3ISG A;  5FQI A;  1HTZ A;  4BD1 A;  4GZB A;  3AGF A;  2OLV A;  2JBF A;  1XGJ A;  3PAG A;  1WYC A;  3ZG5 A;  5EVL A;  3OPR A;  4NET A;  4OQ0 A;  3ZVT A;  3SOI A;  1TDG A;  1CEG A;  4UA7 A;  3BFE A;  2XEP A;  3OPL A;  4KZ7 A;  4XUZ A;  2ZM8 A;  5EEC A;  3G35 A;  5HAI A;  4LCL A;  2ZQC A;  3A3E A;  2ZC5 B;  3IF6 A;  4EQI A;  3ZG7 B;  3UDI A;  4KG2 A;  1KE4 A;  4O7D A;  4DKI A;  3G2Y A;  4JXV A;  3OPP A;  3VP4 A;  3TOI A;  2WGV A;  3IXD A;  5GLC A;  4KG5 A;  3UE0 A;  1O07 A;  3GQZ A;  4GNU A;  3GV9 A;  2HDR A;  2Y4A A;  5TFQ A;  5DTT A;  2B5R A;  3NDE A;  4EV4 A;  1NXY A;  2ZC7 A;  3UE1 A;  5F82 A;  1CI8 A;  1JWZ A;  4OOL A;  1CK3 A;  4Y0O A;  3RJU A;  4WZ5 C;  3WS5 A;  2Y91 A;  2ZQ8 A;  1SDE A;  1MXO A;  2A3U A;  3EQV A;  5DTS A;  1DY6 A;  5CED A;  3GSG A;  4BJP A;  4IED A;  3V50 A;  1XA1 A;  3WS1 A;  3NBL A;  3IXG A;  1I2S A;  1DJA A;  1YLW A;  3FKV A;  4Y7P A;  4C75 A;  5EVI B;  5DTK A;  1PZP A;  2H0Y A;  2J9P A;  3Q07 A;  2X02 A;  5E2F A;  2HDU A;  1IEM A;  1BUE A;  3Q7V A;  3G2Z A;  1NY0 A;  1PZO A;  2V20 A;  2EFU A;  4GDB A;  3ZHH A;  1JTG A;  1C3B A;  2HDS A;  2Q9M A;  2GDN A;  5EUA A;  3A3I A;  5AQA A;  2ZQ7 A;  2PU4 A;  3MZD A;  2WAF A;  4OOM A;  3RXW A;  2Z2L B;  1RCJ A;  3GR2 A;  4PPR A;  3SS3 A;  3GVB A;  4A5R A;  2Y55 A;  1ZC2 A;  3CJM A;  5EVI C;  1SHV A;  2ZM2 A;  5F83 A;  3LY3 A;  5A91 A;  5CRF A;  3WRT A;  4JF5 A;  4NK3 A;  3IXB A;  1WYB A;  5L2F A;  2P9V A;  2QMI A;  2C5W B;  4R23 A;  3UY6 A;  1IYS A;  4K91 A;  2OV5 A;  3VSK A;  3OCL A;  2RCX A;  4F94 A;  1FSW A;  2XD5 A;  4FD8 A;  3WWX A;  3E2L A;  4E6X A;  3BEC A;  4S2M A;  2VGJ A;  4IVI A;  4BL2 A;  5CHU A;  4GKU A;  5I94 A;  1I5Q A;  4QHC A;  1E4D A;  1RGY A;  1WE4 A;  1K6S A;  1GA0 A;  4MBF A;  4RA7 A;  1XPB A;  3TSG A;  3SH7 A;  1MY8 A;  3HBR A;  3LCE A;  4P0M A;  4EBL A;  5KSC A;  3PBQ A;  1JWV A;  4LEN A;  4E3I A;  4DDY A;  4JF4 A;  3IXH A;  1E25 A;  1OME A;  3VOY A;  3ZNT A;  4R4R A;  4HBT A;  5E2G A;  3SS5 A;  3BM6 A;  1L0E A;  3IF6 B;  3PBT A;  3OCN A;  4OLD A;  5EE8 A;  1L0F A;  4PMA A;  3Q7V B;  5CHJ A;  5GL9 A;  2WKH A;  3S4X A;  2Y2I A;  4E6W A;  3C7V A;  3M6H A;  1K4E A;  5FAO A;  4C6Y A;  4OPY A;  2Q9N A;  4S2K A;  5HFO A;  4JXG A;  4N92 A;  2PBY A;  5FAP A;  5F1F A;  1ESI A;  4U0T A;  1YLP A;  3RXX A;  1PIO A;  4RX2 A;  4XXR A;  1K56 A;  3P09 A;  1MPL A;  3LO7 A;  2DCF A;  4JF6 A;  1M40 A;  1FOF A;  2Z2M B;  3MBZ A;  3Q81 A;  1BT5 A;  4B88 A;  2HP5 A;  1E3U A;  4RYE A;  3ZCZ A;  4OVD A;  1K55 C;  3IT9 A;  1K25 A;  2EX9 A;  4S2P A;  1GHM A;  4PM7 A;  2EX6 A;  5FQ9 A;  1KDW A;  1LL5 A;  1AXB A;  1L2S A;  1IYP A;  2R9W A;  5FSR A;  1J9M A;  5GLB A;  3BYD A;  3LY4 A;  2ZC3 B;  3IWI A;  3ZNY A;  3AGE A;  1GCE A;  1NZU A;  1EI5 A;  1PWC A;  3OZH A;  4N1H A;  4QY5 A;  1ZG4 A;  4X53 A;  3A3J A;  2WKE A;  1I2W A;  4OKP A;  4R0Q A;  3VMA A;  1PWG A;  4WZ5 A;  3HLB A;  3UDF A;  1FCN A;  2J9O A;  1HVB A;  2H10 A;  4KZ6 A;  4Y0T A;  4ZDX A;  2XFS A;  5FI6 A;  3DWZ A;  3VP1 A;  3VOZ A;  2JCH A;  1NZO A;  4OPZ A;  4OPR A;  1ES5 A;  1LLB A;  1W5D A;  4BEN A;  1EWZ A;  4CPK A;  1VQQ A;  1GHI A;  4GOG A;  3ZDJ A;  1GA9 A;  3FWL A;  5DVA A;  3HLD A;  4OOY A;  3P98 A;  1K54 C;  3G30 A;  2IWB A;  5GHY A;  3ZGA B;  5EVI D;  4E3K A;  3NCK A;  1DJB A;  1FSY A;  1RGZ A;  2J7V A;  3BFG A;  4OQH A;  1U60 A;  4D2O A;  3UPP A;  4OQI A;  1IKI A;  3ZVW A;  5FDH A;  1NRF A;  3QHY A;  2G2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...