4P74C

Phers in complex with compound 3a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
total genus 66
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p74C01
4YCUA 4PHCA 4YRKA 3HXZA 4P74A 3IG2A 2EAYA 3HXYA 3V7SA 1X56A 4YPFA 2ZR3A 4YREA 3RKWA 4HWOA 4RDXA 1USYC 3HTZA 1EVKA 5K1PA 4YRCA 3QTCA 1SERA 4P72A 3R07A 1BBWA 1RIQA 2G4CA 4XTVA 1W66A 4YRIA 2C8MA 1G51A 11ASA 2CJ9A 3PZCA 2ODRC 4UPAA 2DJZA 5K1XA 2E65A 2ALYB 4XU1A 3RKXA 1VQZA 4XU3A 4P3NA 1E1OA 4RMFA 2DU7A 4XTUA 1X54A 3A7AA 3UGTA 1WU7A 1Z7NA 4CS2A 2XTIA 4HA8A 1H4QA 2Q7HA 4H2TA 4TVAB 1G5HA 2ALYA 3MF2A 4WF2A 3VBBA 3HFZB 2ZZFA 2DZCA 1YB3A 2ARUA 2CGHA 4TVYA 2DZ9A 3I7FA 2PMFA 5C51B 3QO8A 4XU0A 2ZR2A 1N9WA 4J15A 4EX5A 1PYSA 4P75C 4KR3A 3TEHB 3RGLA 5HGQA 1QE0A 2ZIMA 4YDQA 2AKWA 4P74C 3EFSA 4TVAA 3ICAA 2DXUA 3EFRA 4P73A 3A7RA 3A5ZA 3QNEA 4TQFA 3QO7A 1G5IA 4YRPA 2AMCB 3P8VA 4UP8A 4ZTUB 3UGQA 4Q15A 4P72C 3L2ZA 4BW9A 3TEHA 1HC7A 2E3CA 1E1TA 3UFGA 1X55A 1X2GA 1H4TA 2ZZEA 2P0LA 1X01A 3REXA 2AMCA 1EQRA 4RQEA 12ASA 3HFVA 3MEYA 4OP0A 2DEQA 2ZIOA 3A7UA 4OLFA 1E24A 3IALA 4WJ4A 1NJ2A 3UH0A 1YFTA 3A74A 2ZCEA 2ZINA 2IY5B 5KNNA 1KOGA 2ARSA 3VQWA 4DPGA 3OD1A 1KMNA 3NENA 4XTZA 4YROA 3LSSA 2FYKA 4H2YA 1EFWA 3HXXA 4TVWA 1B70B 4H2UA 1IL2A 2DQ0A 2IY5A 1ASYA 3RKYA 4TTVA 3WQZA 3HXWA 3TEGA 4P71A 4O2DA 4G84A 1GGMA 2CIMA 1JJCB 3RACA 2EWNA 4HWTA 4YRRA 1C0AA 2QHVA 4YRFA 4YRSA 3VQVA 2E10A 4L87A 3IKMB 4K87A 2EL9A 4YCVA 1WYDA 1WPYA 4CS3A 1NNHA 3A31A 3VQYA 1JJCA 2QHUA 2ZT7A 1ATIA 1SETA 4HVCA 1ASZA 2E1HA 1NJ6A 3NEMA 1WQWA 2ZT8A 4XEOA 3RL6A 3LC0A 4TWAA 1EVLA 4YP0A 2XGTA 2P5IA 3REUA 4ZTZB 2I4NA 3HRKA 3KFUA 4P3PA 3E9HA 3PCOB 3HFZA 1B7YB 4YRGA 4XEMA 3ERRA 1B8AA 5C52B 4P3OA 3A5YA 4H2XB 1YGBA 2RHSB 1NYRA 4YRJA 2J3MA 3PCOA 3QO5A 3V7RA 3HRIA 1B7YA 2ZXFA 2DDZA 5C53B 3V7CA 1EIYB 2E64A 3FJPA 3BFMA 1QF6A 4Q6GA 4EO4A 4H2XA 1WNLA 4K86A 2ZTGA 2ARTA 3V8JA 1Z7MA 2DU5A 1BBUA 4CS4A 4H2VA 2DTHA 4AH6A 3P8YA 4HWPA 2E41A 2ZGWA 1EIYA 3P8TA 5ELNA 3M4QA 2DKGA 4XTYA 4LNSA 2DTOA 4RQFA 1NYQA 4CH5A 3NELA 1B76A 4P75A 3DSQA 3L4GB 2EJFA 1H4VB 4WI1A 3HXUA 4HWRA 4XTWA 3RIRA 1X2HA 4P73C 4YRMA 2C7IA 3RF1A 1B70A 1HTTA 3HY1A 2I4LA 3L4GA 3BJUA 4XU2A 4G85A 4CH4A 3IKLA 1FYFA 2CJBA 1BIBA 2Q5IA 3W3SA 1ADJA 4KQEA 2I4MA 1J5WA 4KR2A 4CH3A 2DXTA 2EJ9A 2QHTA 1ADYA 2EJGA 2ZNJA 2DQ3A 2DTIA 4PG3A 1WLEA 3A32A 4TQDA 3HY0A 1SESA 1YFSA 3G1ZA 3V8LA 4YRQA 3L1AA 3HXVA 1PYSB 5ELOA 1EOVA 4H02A 1HXDA 2AKWB 2I4OA 4YYEA 4WJ3M 4XTXA 4UP9A 2ODRD 1USYA 2Q7EA 2RHQB 2QHSA 3TUPA 2DVEA 3NETA 2ZT5A 2CJAA 1NJ5A 2PMEA 5F5WA 3RUXA 2ZNIA 4ZIBA 3VQXA 4HWSA 3E9IA 2RHQA 4E51A 2ZT6A 2ZZGA 3CMQA 4DQ2A 4P71C 4YRLA 1NJ1A 4YRNA 3LSQA 2Q5HA 2J3LA 3M4PA 3V8KA 4X5OA 2HNIA 1E22A 1L0WA 2E5AA 4YRTA 2RHSA 1KMMA 4BWAA 1SRYA 1NJ8A 4H2SA 4UP7A 4NCXA 4CH6A 3MF1A 2Q7GA 1LYLA 1H4SA 4H2WA 4K88A 4YCWA 5E3IA 1BIAA 1YFRA 1WQ7A
chains in the Genus database with same CATH superfamily
4YCUA 4PHCA 4YRKA 3HXZA 4P74A 3IG2A 2EAYA 3HXYA 3V7SA 1X56A 4YPFA 2ZR3A 4YREA 3RKWA 4HWOA 4RDXA 1USYC 3HTZA 1EVKA 2A8EA 5K1PA 4YRCA 3QTCA 1SERA 4P72A 3R07A 1BBWA 1RIQA 3MQZA 2G4CA 4XTVA 1W66A 4YRIA 2C8MA 1G51A 11ASA 2CJ9A 3PZCA 2ODRC 4UPAA 2DJZA 5K1XA 2E65A 2ALYB 4XU1A 3RKXA 1VQZA 4XU3A 4P3NA 1E1OA 4RMFA 2DU7A 4XTUA 1X54A 3A7AA 3UGTA 1WU7A 1Z7NA 4CS2A 2XTIA 4HA8A 1H4QA 2Q7HA 4H2TA 4TVAB 1G5HA 2ALYA 3MF2A 4WF2A 3VBBA 3HFZB 2ZZFA 2DZCA 1YB3A 2ARUA 2CGHA 4TVYA 2DZ9A 3I7FA 2PMFA 5C51B 3QO8A 4XU0A 2ZR2A 1N9WA 4J15A 4EX5A 1PYSA 4P75C 4KR3A 3TEHB 3RGLA 5HGQA 1QE0A 2ZIMA 4YDQA 2AKWA 4P74C 3EFSA 4TVAA 3ICAA 2DXUA 3EFRA 4P73A 3A7RA 3A5ZA 3QNEA 4TQFA 3QO7A 1G5IA 4YRPA 2AMCB 3P8VA 4UP8A 4ZTUB 3UGQA 4Q15A 4P72C 3L2ZA 4BW9A 3TEHA 1HC7A 2E3CA 1E1TA 3UFGA 1X55A 1X2GA 1H4TA 2ZZEA 2P0LA 1X01A 3REXA 2AMCA 1EQRA 4RQEA 12ASA 3HFVA 3MEYA 4OP0A 2DEQA 2ZIOA 3A7UA 4OLFA 1E24A 3IALA 4WJ4A 1NJ2A 3UH0A 1YFTA 3A74A 2ZCEA 2ZINA 2IY5B 5KNNA 2NS6A 1KOGA 2ARSA 3VQWA 4DPGA 3OD1A 1KMNA 3NENA 4XTZA 4YROA 3LSSA 2FYKA 4H2YA 1EFWA 3HXXA 4TVWA 1B70B 4H2UA 1IL2A 2DQ0A 2IY5A 1ASYA 3RKYA 4TTVA 3WQZA 3HXWA 3TEGA 4P71A 4O2DA 4G84A 1GGMA 2CIMA 1JJCB 3RACA 2EWNA 4HWTA 4YRRA 1C0AA 2QHVA 4YRFA 4YRSA 3VQVA 2E10A 4L87A 3IKMB 4K87A 2EL9A 4YCVA 1WYDA 1WPYA 4CS3A 1NNHA 3A31A 3VQYA 1JJCA 2QHUA 2ZT7A 1ATIA 1SETA 4HVCA 4LVKA 1ASZA 2E1HA 1NJ6A 3NEMA 1WQWA 2ZT8A 4XEOA 3RL6A 3LC0A 4TWAA 1EVLA 4YP0A 2XGTA 2P5IA 3REUA 4ZTZB 2I4NA 3HRKA 3KFUA 4P3PA 3E9HA 3PCOB 3HFZA 1B7YB 4YRGA 4XEMA 3ERRA 1B8AA 5C52B 4P3OA 3A5YA 4H2XB 1YGBA 2RHSB 1NYRA 4YRJA 2J3MA 3PCOA 3QO5A 3V7RA 3HRIA 1B7YA 2ZXFA 4HT4A 2DDZA 5C53B 3V7CA 1EIYB 2E64A 3FJPA 3BFMA 1QF6A 4Q6GA 4EO4A 4H2XA 1WNLA 4K86A 2ZTGA 2ARTA 3V8JA 1Z7MA 2DU5A 1BBUA 4CS4A 4H2VA 2DTHA 4AH6A 3P8YA 4HWPA 2E41A 2ZGWA 1EIYA 3P8TA 5ELNA 3M4QA 2DKGA 4XTYA 4LNSA 2DTOA 4RQFA 1NYQA 4CH5A 3NELA 1B76A 4P75A 3DSQA 3L4GB 2EJFA 4LVJA 1H4VB 4WI1A 3HXUA 4HWRA 4XTWA 3RIRA 1X2HA 4P73C 4YRMA 2C7IA 3RF1A 1B70A 1HTTA 3HY1A 4LVMA 2I4LA 3L4GA 3BJUA 4XU2A 4G85A 4CH4A 3IKLA 1FYFA 2CJBA 1BIBA 2Q5IA 3W3SA 1ADJA 4KQEA 2I4MA 1J5WA 4KR2A 4CH3A 2DXTA 2EJ9A 2QHTA 1ADYA 2EJGA 2ZNJA 2DQ3A 2DTIA 4PG3A 1WLEA 3A32A 4TQDA 3HY0A 1SESA 1YFSA 3G1ZA 3V8LA 4YRQA 3L1AA 3HXVA 1PYSB 4LVLA 5ELOA 1EOVA 4H02A 1HXDA 2AKWB 2I4OA 4YYEA 4WJ3M 4XTXA 4UP9A 2ODRD 1USYA 2Q7EA 2RHQB 2QHSA 3TUPA 2DVEA 3NETA 2ZT5A 2CJAA 1NJ5A 2PMEA 5F5WA 3RUXA 2ZNIA 4ZIBA 3VQXA 4HWSA 3E9IA 2RHQA 4E51A 2ZT6A 2ZZGA 3CMQA 4DQ2A 4LVIA 4P71C 4YRLA 1NJ1A 4YRNA 3LSQA 2Q5HA 2J3LA 3M4PA 3V8KA 4X5OA 2HNIA 1E22A 1L0WA 2E5AA 4YRTA 2RHSA 1KMMA 4BWAA 1SRYA 1NJ8A 4H2SA 4UP7A 4NCXA 4CH6A 3MF1A 2Q7GA 1LYLA 1H4SA 4H2WA 4K88A 4YCWA 5E3IA 1BIAA 1YFRA 1WQ7A
chains in the Genus database with same CATH topology
4YCUA 4PHCA 4YRKA 3HXZA 4P74A 3IG2A 2EAYA 3HXYA 3V7SA 1X56A 4YPFA 2ZR3A 4YREA 3RKWA 4HWOA 4RDXA 1USYC 3HTZA 1EVKA 2A8EA 5K1PA 4YRCA 3QTCA 1SERA 4P72A 3R07A 1BBWA 1RIQA 3MQZA 2G4CA 4XTVA 1W66A 4YRIA 2C8MA 1G51A 11ASA 2CJ9A 3PZCA 2ODRC 4UPAA 2DJZA 5K1XA 2E65A 2ALYB 4XU1A 3RKXA 1VQZA 4XU3A 4P3NA 1E1OA 4RMFA 2DU7A 4XTUA 1X54A 3A7AA 3UGTA 1WU7A 1Z7NA 4CS2A 2XTIA 4HA8A 1H4QA 2Q7HA 4H2TA 4TVAB 1G5HA 2ALYA 3MF2A 4WF2A 3VBBA 3HFZB 2ZZFA 2DZCA 1YB3A 2ARUA 2CGHA 4TVYA 2DZ9A 3I7FA 2PMFA 5C51B 3QO8A 4XU0A 2ZR2A 1N9WA 4J15A 4EX5A 1PYSA 4P75C 4KR3A 3TEHB 3RGLA 5HGQA 1QE0A 2ZIMA 4YDQA 2AKWA 4P74C 3EFSA 4TVAA 3ICAA 2DXUA 3EFRA 4P73A 3A7RA 3A5ZA 3QNEA 4TQFA 3QO7A 1G5IA 4YRPA 2AMCB 3P8VA 4UP8A 4ZTUB 3UGQA 4Q15A 4P72C 3L2ZA 4BW9A 3TEHA 1HC7A 2E3CA 1E1TA 3UFGA 1X55A 1X2GA 1H4TA 2ZZEA 2P0LA 1X01A 3REXA 2AMCA 1EQRA 4RQEA 12ASA 3HFVA 3MEYA 4OP0A 2DEQA 2ZIOA 3A7UA 4OLFA 1E24A 3IALA 4WJ4A 1NJ2A 3UH0A 1YFTA 3A74A 2ZCEA 2ZINA 2IY5B 5KNNA 2NS6A 1KOGA 2ARSA 3VQWA 4DPGA 3OD1A 1KMNA 3NENA 4XTZA 4YROA 3LSSA 2FYKA 4H2YA 1EFWA 3HXXA 4TVWA 1B70B 4H2UA 1IL2A 2DQ0A 2IY5A 1ASYA 3RKYA 4TTVA 3WQZA 3HXWA 3TEGA 4P71A 4O2DA 4G84A 1GGMA 2CIMA 1JJCB 3RACA 2EWNA 4HWTA 4YRRA 1C0AA 2QHVA 4YRFA 4YRSA 3VQVA 2E10A 4L87A 3IKMB 4K87A 2EL9A 4YCVA 1WYDA 1WPYA 4CS3A 1NNHA 3A31A 3VQYA 1JJCA 2QHUA 2ZT7A 1ATIA 1SETA 4HVCA 4LVKA 1ASZA 2E1HA 1NJ6A 3NEMA 1WQWA 2ZT8A 4XEOA 3RL6A 3LC0A 4TWAA 1EVLA 4YP0A 2XGTA 2P5IA 3REUA 4ZTZB 2I4NA 3HRKA 3KFUA 4P3PA 3E9HA 3PCOB 3HFZA 1B7YB 4YRGA 4XEMA 3ERRA 1B8AA 5C52B 4P3OA 3A5YA 4H2XB 1YGBA 2RHSB 1NYRA 4YRJA 2J3MA 3PCOA 3QO5A 3V7RA 3HRIA 1B7YA 2ZXFA 4HT4A 2DDZA 5C53B 3V7CA 1EIYB 2E64A 3FJPA 3BFMA 1QF6A 4Q6GA 4EO4A 4H2XA 1WNLA 4K86A 2ZTGA 2ARTA 3V8JA 1Z7MA 2DU5A 1BBUA 4CS4A 4H2VA 2DTHA 4AH6A 3P8YA 4HWPA 2E41A 2ZGWA 1EIYA 3P8TA 5ELNA 3M4QA 2DKGA 4XTYA 4LNSA 2DTOA 4RQFA 1NYQA 4CH5A 3NELA 1B76A 4P75A 3DSQA 3L4GB 2EJFA 4LVJA 1H4VB 4WI1A 3HXUA 4HWRA 4XTWA 3RIRA 1X2HA 4P73C 4YRMA 2C7IA 3RF1A 1B70A 1HTTA 3HY1A 4LVMA 2I4LA 3L4GA 3BJUA 4XU2A 4G85A 4CH4A 3IKLA 1FYFA 2CJBA 1BIBA 2Q5IA 3W3SA 1ADJA 4KQEA 2I4MA 1J5WA 4KR2A 4CH3A 2DXTA 2EJ9A 2QHTA 1ADYA 2EJGA 2ZNJA 2DQ3A 2DTIA 4PG3A 1WLEA 3A32A 4TQDA 3HY0A 1SESA 1YFSA 3G1ZA 3V8LA 4YRQA 3L1AA 3HXVA 1PYSB 4LVLA 5ELOA 1EOVA 4H02A 1HXDA 2AKWB 2I4OA 4YYEA 4WJ3M 4XTXA 4UP9A 2ODRD 1USYA 2Q7EA 2RHQB 2QHSA 3TUPA 2DVEA 3NETA 2ZT5A 2CJAA 1NJ5A 2PMEA 5F5WA 3RUXA 2ZNIA 4ZIBA 3VQXA 4HWSA 3E9IA 2RHQA 4E51A 2ZT6A 2ZZGA 3CMQA 4DQ2A 4LVIA 4P71C 4YRLA 1NJ1A 4YRNA 3LSQA 2Q5HA 2J3LA 3M4PA 3V8KA 4X5OA 2HNIA 1E22A 1L0WA 2E5AA 4YRTA 2RHSA 1KMMA 4BWAA 1SRYA 1NJ8A 4H2SA 4UP7A 4NCXA 4CH6A 3MF1A 2Q7GA 1LYLA 1H4SA 4H2WA 4K88A 4YCWA 5E3IA 1BIAA 1YFRA 1WQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCU A;  4PHC A;  4YRK A;  3HXZ A;  4P74 A;  3IG2 A;  2EAY A;  3HXY A;  3V7S A;  1X56 A;  4YPF A;  2ZR3 A;  4YRE A;  3RKW A;  4HWO A;  4RDX A;  1USY C;  3HTZ A;  1EVK A;  5K1P A;  4YRC A;  3QTC A;  1SER A;  4P72 A;  3R07 A;  1BBW A;  1RIQ A;  2G4C A;  4XTV A;  1W66 A;  4YRI A;  2C8M A;  1G51 A;  11AS A;  2CJ9 A;  3PZC A;  2ODR C;  4UPA A;  2DJZ A;  5K1X A;  2E65 A;  2ALY B;  4XU1 A;  3RKX A;  1VQZ A;  4XU3 A;  4P3N A;  1E1O A;  4RMF A;  2DU7 A;  4XTU A;  1X54 A;  3A7A A;  3UGT A;  1WU7 A;  1Z7N A;  4CS2 A;  2XTI A;  4HA8 A;  1H4Q A;  2Q7H A;  4H2T A;  4TVA B;  1G5H A;  2ALY A;  3MF2 A;  4WF2 A;  3VBB A;  3HFZ B;  2ZZF A;  2DZC A;  1YB3 A;  2ARU A;  2CGH A;  4TVY A;  2DZ9 A;  3I7F A;  2PMF A;  5C51 B;  3QO8 A;  4XU0 A;  2ZR2 A;  1N9W A;  4J15 A;  4EX5 A;  1PYS A;  4P75 C;  4KR3 A;  3TEH B;  3RGL A;  5HGQ A;  1QE0 A;  2ZIM A;  4YDQ A;  2AKW A;  4P74 C;  3EFS A;  4TVA A;  3ICA A;  2DXU A;  3EFR A;  4P73 A;  3A7R A;  3A5Z A;  3QNE A;  4TQF A;  3QO7 A;  1G5I A;  4YRP A;  2AMC B;  3P8V A;  4UP8 A;  4ZTU B;  3UGQ A;  4Q15 A;  4P72 C;  3L2Z A;  4BW9 A;  3TEH A;  1HC7 A;  2E3C A;  1E1T A;  3UFG A;  1X55 A;  1X2G A;  1H4T A;  2ZZE A;  2P0L A;  1X01 A;  3REX A;  2AMC A;  1EQR A;  4RQE A;  12AS A;  3HFV A;  3MEY A;  4OP0 A;  2DEQ A;  2ZIO A;  3A7U A;  4OLF A;  1E24 A;  3IAL A;  4WJ4 A;  1NJ2 A;  3UH0 A;  1YFT A;  3A74 A;  2ZCE A;  2ZIN A;  2IY5 B;  5KNN A;  1KOG A;  2ARS A;  3VQW A;  4DPG A;  3OD1 A;  1KMN A;  3NEN A;  4XTZ A;  4YRO A;  3LSS A;  2FYK A;  4H2Y A;  1EFW A;  3HXX A;  4TVW A;  1B70 B;  4H2U A;  1IL2 A;  2DQ0 A;  2IY5 A;  1ASY A;  3RKY A;  4TTV A;  3WQZ A;  3HXW A;  3TEG A;  4P71 A;  4O2D A;  4G84 A;  1GGM A;  2CIM A;  1JJC B;  3RAC A;  2EWN A;  4HWT A;  4YRR A;  1C0A A;  2QHV A;  4YRF A;  4YRS A;  3VQV A;  2E10 A;  4L87 A;  3IKM B;  4K87 A;  2EL9 A;  4YCV A;  1WYD A;  1WPY A;  4CS3 A;  1NNH A;  3A31 A;  3VQY A;  1JJC A;  2QHU A;  2ZT7 A;  1ATI A;  1SET A;  4HVC A;  1ASZ A;  2E1H A;  1NJ6 A;  3NEM A;  1WQW A;  2ZT8 A;  4XEO A;  3RL6 A;  3LC0 A;  4TWA A;  1EVL A;  4YP0 A;  2XGT A;  2P5I A;  3REU A;  4ZTZ B;  2I4N A;  3HRK A;  3KFU A;  4P3P A;  3E9H A;  3PCO B;  3HFZ A;  1B7Y B;  4YRG A;  4XEM A;  3ERR A;  1B8A A;  5C52 B;  4P3O A;  3A5Y A;  4H2X B;  1YGB A;  2RHS B;  1NYR A;  4YRJ A;  2J3M A;  3PCO A;  3QO5 A;  3V7R A;  3HRI A;  1B7Y A;  2ZXF A;  2DDZ A;  5C53 B;  3V7C A;  1EIY B;  2E64 A;  3FJP A;  3BFM A;  1QF6 A;  4Q6G A;  4EO4 A;  4H2X A;  1WNL A;  4K86 A;  2ZTG A;  2ART A;  3V8J A;  1Z7M A;  2DU5 A;  1BBU A;  4CS4 A;  4H2V A;  2DTH A;  4AH6 A;  3P8Y A;  4HWP A;  2E41 A;  2ZGW A;  1EIY A;  3P8T A;  5ELN A;  3M4Q A;  2DKG A;  4XTY A;  4LNS A;  2DTO A;  4RQF A;  1NYQ A;  4CH5 A;  3NEL A;  1B76 A;  4P75 A;  3DSQ A;  3L4G B;  2EJF A;  1H4V B;  4WI1 A;  3HXU A;  4HWR A;  4XTW A;  3RIR A;  1X2H A;  4P73 C;  4YRM A;  2C7I A;  3RF1 A;  1B70 A;  1HTT A;  3HY1 A;  2I4L A;  3L4G A;  3BJU A;  4XU2 A;  4G85 A;  4CH4 A;  3IKL A;  1FYF A;  2CJB A;  1BIB A;  2Q5I A;  3W3S A;  1ADJ A;  4KQE A;  2I4M A;  1J5W A;  4KR2 A;  4CH3 A;  2DXT A;  2EJ9 A;  2QHT A;  1ADY A;  2EJG A;  2ZNJ A;  2DQ3 A;  2DTI A;  4PG3 A;  1WLE A;  3A32 A;  4TQD A;  3HY0 A;  1SES A;  1YFS A;  3G1Z A;  3V8L A;  4YRQ A;  3L1A A;  3HXV A;  1PYS B;  5ELO A;  1EOV A;  4H02 A;  1HXD A;  2AKW B;  2I4O A;  4YYE A;  4WJ3 M;  4XTX A;  4UP9 A;  2ODR D;  1USY A;  2Q7E A;  2RHQ B;  2QHS A;  3TUP A;  2DVE A;  3NET A;  2ZT5 A;  2CJA A;  1NJ5 A;  2PME A;  5F5W A;  3RUX A;  2ZNI A;  4ZIB A;  3VQX A;  4HWS A;  3E9I A;  2RHQ A;  4E51 A;  2ZT6 A;  2ZZG A;  3CMQ A;  4DQ2 A;  4P71 C;  4YRL A;  1NJ1 A;  4YRN A;  3LSQ A;  2Q5H A;  2J3L A;  3M4P A;  3V8K A;  4X5O A;  2HNI A;  1E22 A;  1L0W A;  2E5A A;  4YRT A;  2RHS A;  1KMM A;  4BWA A;  1SRY A;  1NJ8 A;  4H2S A;  4UP7 A;  4NCX A;  4CH6 A;  3MF1 A;  2Q7G A;  1LYL A;  1H4S A;  4H2W A;  4K88 A;  4YCW A;  5E3I A;  1BIA A;  1YFR A;  1WQ7 A; 
#chains in the Genus database with same CATH topology
 4YCU A;  4PHC A;  4YRK A;  3HXZ A;  4P74 A;  3IG2 A;  2EAY A;  3HXY A;  3V7S A;  1X56 A;  4YPF A;  2ZR3 A;  4YRE A;  3RKW A;  4HWO A;  4RDX A;  1USY C;  3HTZ A;  1EVK A;  2A8E A;  5K1P A;  4YRC A;  3QTC A;  1SER A;  4P72 A;  3R07 A;  1BBW A;  1RIQ A;  3MQZ A;  2G4C A;  4XTV A;  1W66 A;  4YRI A;  2C8M A;  1G51 A;  11AS A;  2CJ9 A;  3PZC A;  2ODR C;  4UPA A;  2DJZ A;  5K1X A;  2E65 A;  2ALY B;  4XU1 A;  3RKX A;  1VQZ A;  4XU3 A;  4P3N A;  1E1O A;  4RMF A;  2DU7 A;  4XTU A;  1X54 A;  3A7A A;  3UGT A;  1WU7 A;  1Z7N A;  4CS2 A;  2XTI A;  4HA8 A;  1H4Q A;  2Q7H A;  4H2T A;  4TVA B;  1G5H A;  2ALY A;  3MF2 A;  4WF2 A;  3VBB A;  3HFZ B;  2ZZF A;  2DZC A;  1YB3 A;  2ARU A;  2CGH A;  4TVY A;  2DZ9 A;  3I7F A;  2PMF A;  5C51 B;  3QO8 A;  4XU0 A;  2ZR2 A;  1N9W A;  4J15 A;  4EX5 A;  1PYS A;  4P75 C;  4KR3 A;  3TEH B;  3RGL A;  5HGQ A;  1QE0 A;  2ZIM A;  4YDQ A;  2AKW A;  4P74 C;  3EFS A;  4TVA A;  3ICA A;  2DXU A;  3EFR A;  4P73 A;  3A7R A;  3A5Z A;  3QNE A;  4TQF A;  3QO7 A;  1G5I A;  4YRP A;  2AMC B;  3P8V A;  4UP8 A;  4ZTU B;  3UGQ A;  4Q15 A;  4P72 C;  3L2Z A;  4BW9 A;  3TEH A;  1HC7 A;  2E3C A;  1E1T A;  3UFG A;  1X55 A;  1X2G A;  1H4T A;  2ZZE A;  2P0L A;  1X01 A;  3REX A;  2AMC A;  1EQR A;  4RQE A;  12AS A;  3HFV A;  3MEY A;  4OP0 A;  2DEQ A;  2ZIO A;  3A7U A;  4OLF A;  1E24 A;  3IAL A;  4WJ4 A;  1NJ2 A;  3UH0 A;  1YFT A;  3A74 A;  2ZCE A;  2ZIN A;  2IY5 B;  5KNN A;  2NS6 A;  1KOG A;  2ARS A;  3VQW A;  4DPG A;  3OD1 A;  1KMN A;  3NEN A;  4XTZ A;  4YRO A;  3LSS A;  2FYK A;  4H2Y A;  1EFW A;  3HXX A;  4TVW A;  1B70 B;  4H2U A;  1IL2 A;  2DQ0 A;  2IY5 A;  1ASY A;  3RKY A;  4TTV A;  3WQZ A;  3HXW A;  3TEG A;  4P71 A;  4O2D A;  4G84 A;  1GGM A;  2CIM A;  1JJC B;  3RAC A;  2EWN A;  4HWT A;  4YRR A;  1C0A A;  2QHV A;  4YRF A;  4YRS A;  3VQV A;  2E10 A;  4L87 A;  3IKM B;  4K87 A;  2EL9 A;  4YCV A;  1WYD A;  1WPY A;  4CS3 A;  1NNH A;  3A31 A;  3VQY A;  1JJC A;  2QHU A;  2ZT7 A;  1ATI A;  1SET A;  4HVC A;  4LVK A;  1ASZ A;  2E1H A;  1NJ6 A;  3NEM A;  1WQW A;  2ZT8 A;  4XEO A;  3RL6 A;  3LC0 A;  4TWA A;  1EVL A;  4YP0 A;  2XGT A;  2P5I A;  3REU A;  4ZTZ B;  2I4N A;  3HRK A;  3KFU A;  4P3P A;  3E9H A;  3PCO B;  3HFZ A;  1B7Y B;  4YRG A;  4XEM A;  3ERR A;  1B8A A;  5C52 B;  4P3O A;  3A5Y A;  4H2X B;  1YGB A;  2RHS B;  1NYR A;  4YRJ A;  2J3M A;  3PCO A;  3QO5 A;  3V7R A;  3HRI A;  1B7Y A;  2ZXF A;  4HT4 A;  2DDZ A;  5C53 B;  3V7C A;  1EIY B;  2E64 A;  3FJP A;  3BFM A;  1QF6 A;  4Q6G A;  4EO4 A;  4H2X A;  1WNL A;  4K86 A;  2ZTG A;  2ART A;  3V8J A;  1Z7M A;  2DU5 A;  1BBU A;  4CS4 A;  4H2V A;  2DTH A;  4AH6 A;  3P8Y A;  4HWP A;  2E41 A;  2ZGW A;  1EIY A;  3P8T A;  5ELN A;  3M4Q A;  2DKG A;  4XTY A;  4LNS A;  2DTO A;  4RQF A;  1NYQ A;  4CH5 A;  3NEL A;  1B76 A;  4P75 A;  3DSQ A;  3L4G B;  2EJF A;  4LVJ A;  1H4V B;  4WI1 A;  3HXU A;  4HWR A;  4XTW A;  3RIR A;  1X2H A;  4P73 C;  4YRM A;  2C7I A;  3RF1 A;  1B70 A;  1HTT A;  3HY1 A;  4LVM A;  2I4L A;  3L4G A;  3BJU A;  4XU2 A;  4G85 A;  4CH4 A;  3IKL A;  1FYF A;  2CJB A;  1BIB A;  2Q5I A;  3W3S A;  1ADJ A;  4KQE A;  2I4M A;  1J5W A;  4KR2 A;  4CH3 A;  2DXT A;  2EJ9 A;  2QHT A;  1ADY A;  2EJG A;  2ZNJ A;  2DQ3 A;  2DTI A;  4PG3 A;  1WLE A;  3A32 A;  4TQD A;  3HY0 A;  1SES A;  1YFS A;  3G1Z A;  3V8L A;  4YRQ A;  3L1A A;  3HXV A;  1PYS B;  4LVL A;  5ELO A;  1EOV A;  4H02 A;  1HXD A;  2AKW B;  2I4O A;  4YYE A;  4WJ3 M;  4XTX A;  4UP9 A;  2ODR D;  1USY A;  2Q7E A;  2RHQ B;  2QHS A;  3TUP A;  2DVE A;  3NET A;  2ZT5 A;  2CJA A;  1NJ5 A;  2PME A;  5F5W A;  3RUX A;  2ZNI A;  4ZIB A;  3VQX A;  4HWS A;  3E9I A;  2RHQ A;  4E51 A;  2ZT6 A;  2ZZG A;  3CMQ A;  4DQ2 A;  4LVI A;  4P71 C;  4YRL A;  1NJ1 A;  4YRN A;  3LSQ A;  2Q5H A;  2J3L A;  3M4P A;  3V8K A;  4X5O A;  2HNI A;  1E22 A;  1L0W A;  2E5A A;  4YRT A;  2RHS A;  1KMM A;  4BWA A;  1SRY A;  1NJ8 A;  4H2S A;  4UP7 A;  4NCX A;  4CH6 A;  3MF1 A;  2Q7G A;  1LYL A;  1H4S A;  4H2W A;  4K88 A;  4YCW A;  5E3I A;  1BIA A;  1YFR A;  1WQ7 A; 
#chains in the Genus database with same CATH homology
 4YCU A;  4PHC A;  4YRK A;  3HXZ A;  4P74 A;  3IG2 A;  2EAY A;  3HXY A;  3V7S A;  1X56 A;  4YPF A;  2ZR3 A;  4YRE A;  3RKW A;  4HWO A;  4RDX A;  1USY C;  3HTZ A;  1EVK A;  2A8E A;  5K1P A;  4YRC A;  3QTC A;  1SER A;  4P72 A;  3R07 A;  1BBW A;  1RIQ A;  3MQZ A;  2G4C A;  4XTV A;  1W66 A;  4YRI A;  2C8M A;  1G51 A;  11AS A;  2CJ9 A;  3PZC A;  2ODR C;  4UPA A;  2DJZ A;  5K1X A;  2E65 A;  2ALY B;  4XU1 A;  3RKX A;  1VQZ A;  4XU3 A;  4P3N A;  1E1O A;  4RMF A;  2DU7 A;  4XTU A;  1X54 A;  3A7A A;  3UGT A;  1WU7 A;  1Z7N A;  4CS2 A;  2XTI A;  4HA8 A;  1H4Q A;  2Q7H A;  4H2T A;  4TVA B;  1G5H A;  2ALY A;  3MF2 A;  4WF2 A;  3VBB A;  3HFZ B;  2ZZF A;  2DZC A;  1YB3 A;  2ARU A;  2CGH A;  4TVY A;  2DZ9 A;  3I7F A;  2PMF A;  5C51 B;  3QO8 A;  4XU0 A;  2ZR2 A;  1N9W A;  4J15 A;  4EX5 A;  1PYS A;  4P75 C;  4KR3 A;  3TEH B;  3RGL A;  5HGQ A;  1QE0 A;  2ZIM A;  4YDQ A;  2AKW A;  4P74 C;  3EFS A;  4TVA A;  3ICA A;  2DXU A;  3EFR A;  4P73 A;  3A7R A;  3A5Z A;  3QNE A;  4TQF A;  3QO7 A;  1G5I A;  4YRP A;  2AMC B;  3P8V A;  4UP8 A;  4ZTU B;  3UGQ A;  4Q15 A;  4P72 C;  3L2Z A;  4BW9 A;  3TEH A;  1HC7 A;  2E3C A;  1E1T A;  3UFG A;  1X55 A;  1X2G A;  1H4T A;  2ZZE A;  2P0L A;  1X01 A;  3REX A;  2AMC A;  1EQR A;  4RQE A;  12AS A;  3HFV A;  3MEY A;  4OP0 A;  2DEQ A;  2ZIO A;  3A7U A;  4OLF A;  1E24 A;  3IAL A;  4WJ4 A;  1NJ2 A;  3UH0 A;  1YFT A;  3A74 A;  2ZCE A;  2ZIN A;  2IY5 B;  5KNN A;  2NS6 A;  1KOG A;  2ARS A;  3VQW A;  4DPG A;  3OD1 A;  1KMN A;  3NEN A;  4XTZ A;  4YRO A;  3LSS A;  2FYK A;  4H2Y A;  1EFW A;  3HXX A;  4TVW A;  1B70 B;  4H2U A;  1IL2 A;  2DQ0 A;  2IY5 A;  1ASY A;  3RKY A;  4TTV A;  3WQZ A;  3HXW A;  3TEG A;  4P71 A;  4O2D A;  4G84 A;  1GGM A;  2CIM A;  1JJC B;  3RAC A;  2EWN A;  4HWT A;  4YRR A;  1C0A A;  2QHV A;  4YRF A;  4YRS A;  3VQV A;  2E10 A;  4L87 A;  3IKM B;  4K87 A;  2EL9 A;  4YCV A;  1WYD A;  1WPY A;  4CS3 A;  1NNH A;  3A31 A;  3VQY A;  1JJC A;  2QHU A;  2ZT7 A;  1ATI A;  1SET A;  4HVC A;  4LVK A;  1ASZ A;  2E1H A;  1NJ6 A;  3NEM A;  1WQW A;  2ZT8 A;  4XEO A;  3RL6 A;  3LC0 A;  4TWA A;  1EVL A;  4YP0 A;  2XGT A;  2P5I A;  3REU A;  4ZTZ B;  2I4N A;  3HRK A;  3KFU A;  4P3P A;  3E9H A;  3PCO B;  3HFZ A;  1B7Y B;  4YRG A;  4XEM A;  3ERR A;  1B8A A;  5C52 B;  4P3O A;  3A5Y A;  4H2X B;  1YGB A;  2RHS B;  1NYR A;  4YRJ A;  2J3M A;  3PCO A;  3QO5 A;  3V7R A;  3HRI A;  1B7Y A;  2ZXF A;  4HT4 A;  2DDZ A;  5C53 B;  3V7C A;  1EIY B;  2E64 A;  3FJP A;  3BFM A;  1QF6 A;  4Q6G A;  4EO4 A;  4H2X A;  1WNL A;  4K86 A;  2ZTG A;  2ART A;  3V8J A;  1Z7M A;  2DU5 A;  1BBU A;  4CS4 A;  4H2V A;  2DTH A;  4AH6 A;  3P8Y A;  4HWP A;  2E41 A;  2ZGW A;  1EIY A;  3P8T A;  5ELN A;  3M4Q A;  2DKG A;  4XTY A;  4LNS A;  2DTO A;  4RQF A;  1NYQ A;  4CH5 A;  3NEL A;  1B76 A;  4P75 A;  3DSQ A;  3L4G B;  2EJF A;  4LVJ A;  1H4V B;  4WI1 A;  3HXU A;  4HWR A;  4XTW A;  3RIR A;  1X2H A;  4P73 C;  4YRM A;  2C7I A;  3RF1 A;  1B70 A;  1HTT A;  3HY1 A;  4LVM A;  2I4L A;  3L4G A;  3BJU A;  4XU2 A;  4G85 A;  4CH4 A;  3IKL A;  1FYF A;  2CJB A;  1BIB A;  2Q5I A;  3W3S A;  1ADJ A;  4KQE A;  2I4M A;  1J5W A;  4KR2 A;  4CH3 A;  2DXT A;  2EJ9 A;  2QHT A;  1ADY A;  2EJG A;  2ZNJ A;  2DQ3 A;  2DTI A;  4PG3 A;  1WLE A;  3A32 A;  4TQD A;  3HY0 A;  1SES A;  1YFS A;  3G1Z A;  3V8L A;  4YRQ A;  3L1A A;  3HXV A;  1PYS B;  4LVL A;  5ELO A;  1EOV A;  4H02 A;  1HXD A;  2AKW B;  2I4O A;  4YYE A;  4WJ3 M;  4XTX A;  4UP9 A;  2ODR D;  1USY A;  2Q7E A;  2RHQ B;  2QHS A;  3TUP A;  2DVE A;  3NET A;  2ZT5 A;  2CJA A;  1NJ5 A;  2PME A;  5F5W A;  3RUX A;  2ZNI A;  4ZIB A;  3VQX A;  4HWS A;  3E9I A;  2RHQ A;  4E51 A;  2ZT6 A;  2ZZG A;  3CMQ A;  4DQ2 A;  4LVI A;  4P71 C;  4YRL A;  1NJ1 A;  4YRN A;  3LSQ A;  2Q5H A;  2J3L A;  3M4P A;  3V8K A;  4X5O A;  2HNI A;  1E22 A;  1L0W A;  2E5A A;  4YRT A;  2RHS A;  1KMM A;  4BWA A;  1SRY A;  1NJ8 A;  4H2S A;  4UP7 A;  4NCX A;  4CH6 A;  3MF1 A;  2Q7G A;  1LYL A;  1H4S A;  4H2W A;  4K88 A;  4YCW A;  5E3I A;  1BIA A;  1YFR A;  1WQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...