4P74C

Phers in complex with compound 3a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 66
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p74C01
4P72C 4XEOA 2Q7GA 2DJZA 2EJFA 4RMFA 2CGHA 4BW9A 1WNLA 3QO5A 4YRLA 4HVCA 3NENA 1X55A 4P73A 4P74C 4XU3A 2DDZA 3RUXA 3P8YA 4XTXA 3RIRA 3BJUA 3RL6A 4K88A 2DQ3A 2E65A 2EL9A 3LSQA 3TEGA 3RKWA 2EAYA 1JJCB 1NYQA 4XU1A 2EJGA 3RACA 1NJ5A 2E5AA 4H2TA 4G84A 3MF2A 4WF2A 3EFSA 2Q5IA 2AMCA 3M4PA 2AMCB 3DSQA 4YREA 2I4OA 3CMQA 3HXWA 4CS2A 3TUPA 1N9WA 1H4QA 4UP7A 3QTCA 2DZ9A 3L4GB 4H2SA 3RGLA 3WQZA 1QF6A 3E9HA 2ZNJA 2ZT8A 1WPYA 4XTVA 1ASZA 2E10A 2J3MA 11ASA 1X2GA 1J5WA 1SERA 4ZTUB 3A5YA 3A7UA 1EVKA 4YRNA 3PZCA 3QNEA 2DKGA 3L2ZA 3A74A 4P73C 2ZT5A 1BBUA 2QHVA 2ZZGA 5K1PA 1X2HA 1USYA 4HA8A 3NELA 3P8VA 5HGQA 4YYEA 2RHQA 2QHTA 4PHCA 4YRSA 2CJBA 4PG3A 4YRQA 4H2VA 4LNSA 3E9IA 4RDXA 1IL2A 4NCXA 4OLFA 4CH3A 2I4LA 4DPGA 4XU0A 2DTHA 1EQRA 1HTTA 4YCVA 1KOGA 4WJ3M 1FYFA 4CS4A 5C53B 1YFTA 3HY0A 3G1ZA 3LC0A 3HFZB 4XEMA 4XTUA 2XGTA 4WI1A 3RKYA 3HXZA 4X5OA 4J15A 4YDQA 3HRKA 2ZIOA 4CH6A 4HWOA 1H4TA 2ZR3A 3V8JA 3RKXA 12ASA 2AKWB 2Q7EA 3ICAA 4UPAA 2ARSA 2ZT6A 4RQEA 3VQVA 4P71C 5K1XA 1YFSA 3VQWA 1NJ1A 1LYLA 4XTYA 4YPFA 2C7IA 3A7RA 1BIBA 4YCWA 1WQ7A 1E24A 4E51A 1PYSA 1Z7MA 4YRMA 4P3PA 3V8KA 4WJ4A 4BWAA 4EX5A 2ZZEA 4TVYA 4KR2A 1NJ2A 1NNHA 1RIQA 4AH6A 1X54A 3A7AA 2ODRD 4H2XA 3P8TA 4CH5A 2I4NA 3HTZA 3I7FA 4H2XB 3V7CA 2DTIA 4YRKA 2J3LA 1HXDA 3V7SA 1G5IA 3KFUA 5F5WA 3A32A 1BBWA 1EVLA 3HXUA 4DQ2A 4YRGA 4CH4A 4YRFA 1X56A 2EWNA 4UP8A 2QHSA 3PCOB 2E1HA 3V7RA 2ZIMA 1WLEA 4XTWA 4TWAA 2PMEA 4P3OA 2QHUA 2ZGWA 2ZZFA 3IKMB 2FYKA 4TVWA 2ARTA 3HXXA 1WYDA 4K87A 1B7YA 5KNNA 2E41A 4TTVA 2CJ9A 1EIYB 4G85A 2DU7A 1WU7A 3VQYA 1USYC 4P75C 4HWPA 1YGBA 2E3CA 3R07A 4K86A 2DVEA 5E3IA 2ZNIA 3BFMA 2IY5A 2ALYA 1W66A 4EO4A 1H4VB 4YRPA 2ALYB 4YRJA 4P71A 2ZXFA 1X01A 4YP0A 2XTIA 4Q15A 1EIYA 4YRIA 4TVAA 3MEYA 3VQXA 2ZINA 4YCUA 3HY1A 1E1OA 4ZIBA 1NYRA 2Q7HA 4HWTA 4YRTA 1EOVA 1B8AA 1VQZA 3IKLA 3MF1A 2DTOA 3L1AA 4XTZA 3RF1A 3UH0A 3HXYA 3UGTA 4H2WA 2Q5HA 4P75A 3L4GA 1ADJA 1YFRA 4H2YA 2RHSA 4OP0A 2PMFA 3HRIA 4P74A 1L0WA 3REUA 3QO7A 2EJ9A 4YRCA 1H4SA 2P5IA 3A5ZA 4L87A 1SETA 1NJ6A 1BIAA 1ATIA 3IG2A 4O2DA 3A31A 1C0AA 3PCOA 1YB3A 3EFRA 3M4QA 2I4MA 1JJCA 2DZCA 1E1TA 1HC7A 4RQFA 3UFGA 2ZT7A 3IALA 1NJ8A 5C52B 1G51A 4CS3A 3NETA 2G4CA 3QO8A 1E22A 2RHSB 2DEQA 1ADYA 2ZR2A 2HNIA 2P0LA 3REXA 2ZTGA 4YROA 1EFWA 4H2UA 3HFZA 3VBBA 1PYSB 2CIMA 1QE0A 4HWSA 2CJAA 4TQFA 5ELNA 4P72A 3NEMA 3OD1A 1KMMA 3TEHB 4KQEA 3W3SA 4UP9A 2DQ0A 3HXVA 2AKWA 1B76A 1WQWA 4Q6GA 3V8LA 3HFVA 1B70B 2ZCEA 4TVAB 2RHQB 1SRYA 5ELOA 4XU2A 4YRRA 1B70A 1G5HA 4TQDA 2DXUA 2DXTA 3LSSA 2ODRC 1ASYA 1SESA 1GGMA 2E64A 3TEHA 4P3NA 2IY5B 1KMNA 3ERRA 3UGQA 4KR3A 3FJPA 4H02A 4HWRA 4ZTZB 2DU5A 5C51B 1Z7NA 2ARUA 2C8MA 1B7YB
chains in the Genus database with same CATH superfamily
4P72C 4XEOA 2Q7GA 2DJZA 2EJFA 4RMFA 2CGHA 4BW9A 4LVLA 1WNLA 3QO5A 4YRLA 4HVCA 3NENA 1X55A 4P73A 4P74C 4XU3A 2DDZA 3RUXA 3P8YA 4XTXA 3RIRA 3BJUA 3RL6A 4K88A 2DQ3A 2E65A 2EL9A 3LSQA 3TEGA 3RKWA 2EAYA 1JJCB 1NYQA 4XU1A 2EJGA 3RACA 1NJ5A 2E5AA 4H2TA 4G84A 3MF2A 4WF2A 3EFSA 2Q5IA 2AMCA 3M4PA 2AMCB 3DSQA 4YREA 2I4OA 3CMQA 3HXWA 4CS2A 3TUPA 1N9WA 1H4QA 4UP7A 3QTCA 2DZ9A 3L4GB 4H2SA 3RGLA 3WQZA 1QF6A 3E9HA 2ZNJA 4LVMA 2ZT8A 1WPYA 4XTVA 2A8EA 1ASZA 2E10A 2J3MA 11ASA 1X2GA 1J5WA 4HT4A 1SERA 4ZTUB 3A5YA 3A7UA 1EVKA 4YRNA 3PZCA 3QNEA 2DKGA 3L2ZA 3A74A 4P73C 2ZT5A 1BBUA 2QHVA 2ZZGA 5K1PA 1X2HA 1USYA 4HA8A 3NELA 3P8VA 5HGQA 4YYEA 2RHQA 2QHTA 4PHCA 4YRSA 3MQZA 2CJBA 4PG3A 4YRQA 4H2VA 4LNSA 3E9IA 4RDXA 1IL2A 4NCXA 4OLFA 4CH3A 2I4LA 4DPGA 4XU0A 2DTHA 1EQRA 1HTTA 4YCVA 1KOGA 4WJ3M 1FYFA 4CS4A 5C53B 1YFTA 3HY0A 3G1ZA 3LC0A 3HFZB 4XEMA 4XTUA 2XGTA 4WI1A 3RKYA 3HXZA 4X5OA 4J15A 4YDQA 3HRKA 2ZIOA 4CH6A 4HWOA 1H4TA 2ZR3A 3V8JA 3RKXA 12ASA 2AKWB 2Q7EA 3ICAA 4UPAA 2ARSA 2ZT6A 4RQEA 3VQVA 4P71C 5K1XA 1YFSA 3VQWA 4LVJA 1NJ1A 1LYLA 4XTYA 4YPFA 2C7IA 3A7RA 1BIBA 4YCWA 1WQ7A 1E24A 4E51A 1PYSA 1Z7MA 4YRMA 4P3PA 3V8KA 4WJ4A 4BWAA 4EX5A 2ZZEA 4TVYA 4KR2A 1NJ2A 1NNHA 1RIQA 4AH6A 1X54A 3A7AA 2ODRD 4H2XA 3P8TA 4CH5A 2I4NA 3HTZA 3I7FA 4H2XB 3V7CA 2DTIA 4YRKA 2J3LA 1HXDA 3V7SA 1G5IA 3KFUA 5F5WA 3A32A 1BBWA 1EVLA 3HXUA 4DQ2A 4YRGA 4CH4A 4YRFA 1X56A 2EWNA 4UP8A 2QHSA 3PCOB 2E1HA 3V7RA 2ZIMA 1WLEA 4XTWA 4TWAA 2NS6A 2PMEA 4P3OA 2QHUA 2ZGWA 2ZZFA 3IKMB 2FYKA 4TVWA 2ARTA 3HXXA 1WYDA 4K87A 1B7YA 5KNNA 2E41A 4TTVA 2CJ9A 1EIYB 4G85A 2DU7A 1WU7A 3VQYA 1USYC 4P75C 4HWPA 1YGBA 2E3CA 3R07A 4K86A 2DVEA 5E3IA 2ZNIA 3BFMA 2IY5A 2ALYA 1W66A 4EO4A 1H4VB 4YRPA 2ALYB 4YRJA 4P71A 2ZXFA 1X01A 4YP0A 2XTIA 4Q15A 1EIYA 4YRIA 4TVAA 3MEYA 3VQXA 2ZINA 4YCUA 3HY1A 1E1OA 4ZIBA 1NYRA 2Q7HA 4HWTA 4YRTA 1EOVA 1B8AA 1VQZA 3IKLA 3MF1A 2DTOA 3L1AA 4XTZA 3RF1A 3UH0A 3HXYA 3UGTA 4H2WA 2Q5HA 4P75A 3L4GA 1ADJA 1YFRA 4H2YA 2RHSA 4OP0A 2PMFA 3HRIA 4P74A 1L0WA 3REUA 3QO7A 2EJ9A 4YRCA 1H4SA 2P5IA 3A5ZA 4L87A 1SETA 1NJ6A 1BIAA 1ATIA 3IG2A 4O2DA 3A31A 1C0AA 3PCOA 1YB3A 3EFRA 3M4QA 2I4MA 1JJCA 2DZCA 1E1TA 1HC7A 4RQFA 3UFGA 2ZT7A 3IALA 1NJ8A 5C52B 1G51A 4CS3A 3NETA 2G4CA 3QO8A 1E22A 2RHSB 2DEQA 1ADYA 2ZR2A 2HNIA 2P0LA 3REXA 2ZTGA 4YROA 1EFWA 4H2UA 3HFZA 3VBBA 1PYSB 2CIMA 1QE0A 4HWSA 2CJAA 4TQFA 5ELNA 4P72A 3NEMA 3OD1A 1KMMA 3TEHB 4KQEA 3W3SA 4UP9A 2DQ0A 3HXVA 2AKWA 1B76A 1WQWA 4Q6GA 3V8LA 3HFVA 1B70B 2ZCEA 4TVAB 2RHQB 1SRYA 5ELOA 4XU2A 4YRRA 1B70A 1G5HA 4LVKA 4TQDA 2DXUA 2DXTA 3LSSA 2ODRC 1ASYA 1SESA 1GGMA 2E64A 3TEHA 4P3NA 2IY5B 1KMNA 3ERRA 3UGQA 4KR3A 3FJPA 4H02A 4HWRA 4ZTZB 2DU5A 5C51B 4LVIA 1Z7NA 2ARUA 2C8MA 1B7YB
chains in the Genus database with same CATH topology
4P72C 4XEOA 2Q7GA 2DJZA 2EJFA 4RMFA 2CGHA 4BW9A 4LVLA 1WNLA 3QO5A 4YRLA 4HVCA 3NENA 1X55A 4P73A 4P74C 4XU3A 2DDZA 3RUXA 3P8YA 4XTXA 3RIRA 3BJUA 3RL6A 4K88A 2DQ3A 2E65A 2EL9A 3LSQA 3TEGA 3RKWA 2EAYA 1JJCB 1NYQA 4XU1A 2EJGA 3RACA 1NJ5A 2E5AA 4H2TA 4G84A 3MF2A 4WF2A 3EFSA 2Q5IA 2AMCA 3M4PA 2AMCB 3DSQA 4YREA 2I4OA 3CMQA 3HXWA 4CS2A 3TUPA 1N9WA 1H4QA 4UP7A 3QTCA 2DZ9A 3L4GB 4H2SA 3RGLA 3WQZA 1QF6A 3E9HA 2ZNJA 4LVMA 2ZT8A 1WPYA 4XTVA 2A8EA 1ASZA 2E10A 2J3MA 11ASA 1X2GA 1J5WA 4HT4A 1SERA 4ZTUB 3A5YA 3A7UA 1EVKA 4YRNA 3PZCA 3QNEA 2DKGA 3L2ZA 3A74A 4P73C 2ZT5A 1BBUA 2QHVA 2ZZGA 5K1PA 1X2HA 1USYA 4HA8A 3NELA 3P8VA 5HGQA 4YYEA 2RHQA 2QHTA 4PHCA 4YRSA 3MQZA 2CJBA 4PG3A 4YRQA 4H2VA 4LNSA 3E9IA 4RDXA 1IL2A 4NCXA 4OLFA 4CH3A 2I4LA 4DPGA 4XU0A 2DTHA 1EQRA 1HTTA 4YCVA 1KOGA 4WJ3M 1FYFA 4CS4A 5C53B 1YFTA 3HY0A 3G1ZA 3LC0A 3HFZB 4XEMA 4XTUA 2XGTA 4WI1A 3RKYA 3HXZA 4X5OA 4J15A 4YDQA 3HRKA 2ZIOA 4CH6A 4HWOA 1H4TA 2ZR3A 3V8JA 3RKXA 12ASA 2AKWB 2Q7EA 3ICAA 4UPAA 2ARSA 2ZT6A 4RQEA 3VQVA 4P71C 5K1XA 1YFSA 3VQWA 4LVJA 1NJ1A 1LYLA 4XTYA 4YPFA 2C7IA 3A7RA 1BIBA 4YCWA 1WQ7A 1E24A 4E51A 1PYSA 1Z7MA 4YRMA 4P3PA 3V8KA 4WJ4A 4BWAA 4EX5A 2ZZEA 4TVYA 4KR2A 1NJ2A 1NNHA 1RIQA 4AH6A 1X54A 3A7AA 2ODRD 4H2XA 3P8TA 4CH5A 2I4NA 3HTZA 3I7FA 4H2XB 3V7CA 2DTIA 4YRKA 2J3LA 1HXDA 3V7SA 1G5IA 3KFUA 5F5WA 3A32A 1BBWA 1EVLA 3HXUA 4DQ2A 4YRGA 4CH4A 4YRFA 1X56A 2EWNA 4UP8A 2QHSA 3PCOB 2E1HA 3V7RA 2ZIMA 1WLEA 4XTWA 4TWAA 2NS6A 2PMEA 4P3OA 2QHUA 2ZGWA 2ZZFA 3IKMB 2FYKA 4TVWA 2ARTA 3HXXA 1WYDA 4K87A 1B7YA 5KNNA 2E41A 4TTVA 2CJ9A 1EIYB 4G85A 2DU7A 1WU7A 3VQYA 1USYC 4P75C 4HWPA 1YGBA 2E3CA 3R07A 4K86A 2DVEA 5E3IA 2ZNIA 3BFMA 2IY5A 2ALYA 1W66A 4EO4A 1H4VB 4YRPA 2ALYB 4YRJA 4P71A 2ZXFA 1X01A 4YP0A 2XTIA 4Q15A 1EIYA 4YRIA 4TVAA 3MEYA 3VQXA 2ZINA 4YCUA 3HY1A 1E1OA 4ZIBA 1NYRA 2Q7HA 4HWTA 4YRTA 1EOVA 1B8AA 1VQZA 3IKLA 3MF1A 2DTOA 3L1AA 4XTZA 3RF1A 3UH0A 3HXYA 3UGTA 4H2WA 2Q5HA 4P75A 3L4GA 1ADJA 1YFRA 4H2YA 2RHSA 4OP0A 2PMFA 3HRIA 4P74A 1L0WA 3REUA 3QO7A 2EJ9A 4YRCA 1H4SA 2P5IA 3A5ZA 4L87A 1SETA 1NJ6A 1BIAA 1ATIA 3IG2A 4O2DA 3A31A 1C0AA 3PCOA 1YB3A 3EFRA 3M4QA 2I4MA 1JJCA 2DZCA 1E1TA 1HC7A 4RQFA 3UFGA 2ZT7A 3IALA 1NJ8A 5C52B 1G51A 4CS3A 3NETA 2G4CA 3QO8A 1E22A 2RHSB 2DEQA 1ADYA 2ZR2A 2HNIA 2P0LA 3REXA 2ZTGA 4YROA 1EFWA 4H2UA 3HFZA 3VBBA 1PYSB 2CIMA 1QE0A 4HWSA 2CJAA 4TQFA 5ELNA 4P72A 3NEMA 3OD1A 1KMMA 3TEHB 4KQEA 3W3SA 4UP9A 2DQ0A 3HXVA 2AKWA 1B76A 1WQWA 4Q6GA 3V8LA 3HFVA 1B70B 2ZCEA 4TVAB 2RHQB 1SRYA 5ELOA 4XU2A 4YRRA 1B70A 1G5HA 4LVKA 4TQDA 2DXUA 2DXTA 3LSSA 2ODRC 1ASYA 1SESA 1GGMA 2E64A 3TEHA 4P3NA 2IY5B 1KMNA 3ERRA 3UGQA 4KR3A 3FJPA 4H02A 4HWRA 4ZTZB 2DU5A 5C51B 4LVIA 1Z7NA 2ARUA 2C8MA 1B7YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P72 C;  4XEO A;  2Q7G A;  2DJZ A;  2EJF A;  4RMF A;  2CGH A;  4BW9 A;  1WNL A;  3QO5 A;  4YRL A;  4HVC A;  3NEN A;  1X55 A;  4P73 A;  4P74 C;  4XU3 A;  2DDZ A;  3RUX A;  3P8Y A;  4XTX A;  3RIR A;  3BJU A;  3RL6 A;  4K88 A;  2DQ3 A;  2E65 A;  2EL9 A;  3LSQ A;  3TEG A;  3RKW A;  2EAY A;  1JJC B;  1NYQ A;  4XU1 A;  2EJG A;  3RAC A;  1NJ5 A;  2E5A A;  4H2T A;  4G84 A;  3MF2 A;  4WF2 A;  3EFS A;  2Q5I A;  2AMC A;  3M4P A;  2AMC B;  3DSQ A;  4YRE A;  2I4O A;  3CMQ A;  3HXW A;  4CS2 A;  3TUP A;  1N9W A;  1H4Q A;  4UP7 A;  3QTC A;  2DZ9 A;  3L4G B;  4H2S A;  3RGL A;  3WQZ A;  1QF6 A;  3E9H A;  2ZNJ A;  2ZT8 A;  1WPY A;  4XTV A;  1ASZ A;  2E10 A;  2J3M A;  11AS A;  1X2G A;  1J5W A;  1SER A;  4ZTU B;  3A5Y A;  3A7U A;  1EVK A;  4YRN A;  3PZC A;  3QNE A;  2DKG A;  3L2Z A;  3A74 A;  4P73 C;  2ZT5 A;  1BBU A;  2QHV A;  2ZZG A;  5K1P A;  1X2H A;  1USY A;  4HA8 A;  3NEL A;  3P8V A;  5HGQ A;  4YYE A;  2RHQ A;  2QHT A;  4PHC A;  4YRS A;  2CJB A;  4PG3 A;  4YRQ A;  4H2V A;  4LNS A;  3E9I A;  4RDX A;  1IL2 A;  4NCX A;  4OLF A;  4CH3 A;  2I4L A;  4DPG A;  4XU0 A;  2DTH A;  1EQR A;  1HTT A;  4YCV A;  1KOG A;  4WJ3 M;  1FYF A;  4CS4 A;  5C53 B;  1YFT A;  3HY0 A;  3G1Z A;  3LC0 A;  3HFZ B;  4XEM A;  4XTU A;  2XGT A;  4WI1 A;  3RKY A;  3HXZ A;  4X5O A;  4J15 A;  4YDQ A;  3HRK A;  2ZIO A;  4CH6 A;  4HWO A;  1H4T A;  2ZR3 A;  3V8J A;  3RKX A;  12AS A;  2AKW B;  2Q7E A;  3ICA A;  4UPA A;  2ARS A;  2ZT6 A;  4RQE A;  3VQV A;  4P71 C;  5K1X A;  1YFS A;  3VQW A;  1NJ1 A;  1LYL A;  4XTY A;  4YPF A;  2C7I A;  3A7R A;  1BIB A;  4YCW A;  1WQ7 A;  1E24 A;  4E51 A;  1PYS A;  1Z7M A;  4YRM A;  4P3P A;  3V8K A;  4WJ4 A;  4BWA A;  4EX5 A;  2ZZE A;  4TVY A;  4KR2 A;  1NJ2 A;  1NNH A;  1RIQ A;  4AH6 A;  1X54 A;  3A7A A;  2ODR D;  4H2X A;  3P8T A;  4CH5 A;  2I4N A;  3HTZ A;  3I7F A;  4H2X B;  3V7C A;  2DTI A;  4YRK A;  2J3L A;  1HXD A;  3V7S A;  1G5I A;  3KFU A;  5F5W A;  3A32 A;  1BBW A;  1EVL A;  3HXU A;  4DQ2 A;  4YRG A;  4CH4 A;  4YRF A;  1X56 A;  2EWN A;  4UP8 A;  2QHS A;  3PCO B;  2E1H A;  3V7R A;  2ZIM A;  1WLE A;  4XTW A;  4TWA A;  2PME A;  4P3O A;  2QHU A;  2ZGW A;  2ZZF A;  3IKM B;  2FYK A;  4TVW A;  2ART A;  3HXX A;  1WYD A;  4K87 A;  1B7Y A;  5KNN A;  2E41 A;  4TTV A;  2CJ9 A;  1EIY B;  4G85 A;  2DU7 A;  1WU7 A;  3VQY A;  1USY C;  4P75 C;  4HWP A;  1YGB A;  2E3C A;  3R07 A;  4K86 A;  2DVE A;  5E3I A;  2ZNI A;  3BFM A;  2IY5 A;  2ALY A;  1W66 A;  4EO4 A;  1H4V B;  4YRP A;  2ALY B;  4YRJ A;  4P71 A;  2ZXF A;  1X01 A;  4YP0 A;  2XTI A;  4Q15 A;  1EIY A;  4YRI A;  4TVA A;  3MEY A;  3VQX A;  2ZIN A;  4YCU A;  3HY1 A;  1E1O A;  4ZIB A;  1NYR A;  2Q7H A;  4HWT A;  4YRT A;  1EOV A;  1B8A A;  1VQZ A;  3IKL A;  3MF1 A;  2DTO A;  3L1A A;  4XTZ A;  3RF1 A;  3UH0 A;  3HXY A;  3UGT A;  4H2W A;  2Q5H A;  4P75 A;  3L4G A;  1ADJ A;  1YFR A;  4H2Y A;  2RHS A;  4OP0 A;  2PMF A;  3HRI A;  4P74 A;  1L0W A;  3REU A;  3QO7 A;  2EJ9 A;  4YRC A;  1H4S A;  2P5I A;  3A5Z A;  4L87 A;  1SET A;  1NJ6 A;  1BIA A;  1ATI A;  3IG2 A;  4O2D A;  3A31 A;  1C0A A;  3PCO A;  1YB3 A;  3EFR A;  3M4Q A;  2I4M A;  1JJC A;  2DZC A;  1E1T A;  1HC7 A;  4RQF A;  3UFG A;  2ZT7 A;  3IAL A;  1NJ8 A;  5C52 B;  1G51 A;  4CS3 A;  3NET A;  2G4C A;  3QO8 A;  1E22 A;  2RHS B;  2DEQ A;  1ADY A;  2ZR2 A;  2HNI A;  2P0L A;  3REX A;  2ZTG A;  4YRO A;  1EFW A;  4H2U A;  3HFZ A;  3VBB A;  1PYS B;  2CIM A;  1QE0 A;  4HWS A;  2CJA A;  4TQF A;  5ELN A;  4P72 A;  3NEM A;  3OD1 A;  1KMM A;  3TEH B;  4KQE A;  3W3S A;  4UP9 A;  2DQ0 A;  3HXV A;  2AKW A;  1B76 A;  1WQW A;  4Q6G A;  3V8L A;  3HFV A;  1B70 B;  2ZCE A;  4TVA B;  2RHQ B;  1SRY A;  5ELO A;  4XU2 A;  4YRR A;  1B70 A;  1G5H A;  4TQD A;  2DXU A;  2DXT A;  3LSS A;  2ODR C;  1ASY A;  1SES A;  1GGM A;  2E64 A;  3TEH A;  4P3N A;  2IY5 B;  1KMN A;  3ERR A;  3UGQ A;  4KR3 A;  3FJP A;  4H02 A;  4HWR A;  4ZTZ B;  2DU5 A;  5C51 B;  1Z7N A;  2ARU A;  2C8M A;  1B7Y B; 
#chains in the Genus database with same CATH topology
 4P72 C;  4XEO A;  2Q7G A;  2DJZ A;  2EJF A;  4RMF A;  2CGH A;  4BW9 A;  4LVL A;  1WNL A;  3QO5 A;  4YRL A;  4HVC A;  3NEN A;  1X55 A;  4P73 A;  4P74 C;  4XU3 A;  2DDZ A;  3RUX A;  3P8Y A;  4XTX A;  3RIR A;  3BJU A;  3RL6 A;  4K88 A;  2DQ3 A;  2E65 A;  2EL9 A;  3LSQ A;  3TEG A;  3RKW A;  2EAY A;  1JJC B;  1NYQ A;  4XU1 A;  2EJG A;  3RAC A;  1NJ5 A;  2E5A A;  4H2T A;  4G84 A;  3MF2 A;  4WF2 A;  3EFS A;  2Q5I A;  2AMC A;  3M4P A;  2AMC B;  3DSQ A;  4YRE A;  2I4O A;  3CMQ A;  3HXW A;  4CS2 A;  3TUP A;  1N9W A;  1H4Q A;  4UP7 A;  3QTC A;  2DZ9 A;  3L4G B;  4H2S A;  3RGL A;  3WQZ A;  1QF6 A;  3E9H A;  2ZNJ A;  4LVM A;  2ZT8 A;  1WPY A;  4XTV A;  2A8E A;  1ASZ A;  2E10 A;  2J3M A;  11AS A;  1X2G A;  1J5W A;  4HT4 A;  1SER A;  4ZTU B;  3A5Y A;  3A7U A;  1EVK A;  4YRN A;  3PZC A;  3QNE A;  2DKG A;  3L2Z A;  3A74 A;  4P73 C;  2ZT5 A;  1BBU A;  2QHV A;  2ZZG A;  5K1P A;  1X2H A;  1USY A;  4HA8 A;  3NEL A;  3P8V A;  5HGQ A;  4YYE A;  2RHQ A;  2QHT A;  4PHC A;  4YRS A;  3MQZ A;  2CJB A;  4PG3 A;  4YRQ A;  4H2V A;  4LNS A;  3E9I A;  4RDX A;  1IL2 A;  4NCX A;  4OLF A;  4CH3 A;  2I4L A;  4DPG A;  4XU0 A;  2DTH A;  1EQR A;  1HTT A;  4YCV A;  1KOG A;  4WJ3 M;  1FYF A;  4CS4 A;  5C53 B;  1YFT A;  3HY0 A;  3G1Z A;  3LC0 A;  3HFZ B;  4XEM A;  4XTU A;  2XGT A;  4WI1 A;  3RKY A;  3HXZ A;  4X5O A;  4J15 A;  4YDQ A;  3HRK A;  2ZIO A;  4CH6 A;  4HWO A;  1H4T A;  2ZR3 A;  3V8J A;  3RKX A;  12AS A;  2AKW B;  2Q7E A;  3ICA A;  4UPA A;  2ARS A;  2ZT6 A;  4RQE A;  3VQV A;  4P71 C;  5K1X A;  1YFS A;  3VQW A;  4LVJ A;  1NJ1 A;  1LYL A;  4XTY A;  4YPF A;  2C7I A;  3A7R A;  1BIB A;  4YCW A;  1WQ7 A;  1E24 A;  4E51 A;  1PYS A;  1Z7M A;  4YRM A;  4P3P A;  3V8K A;  4WJ4 A;  4BWA A;  4EX5 A;  2ZZE A;  4TVY A;  4KR2 A;  1NJ2 A;  1NNH A;  1RIQ A;  4AH6 A;  1X54 A;  3A7A A;  2ODR D;  4H2X A;  3P8T A;  4CH5 A;  2I4N A;  3HTZ A;  3I7F A;  4H2X B;  3V7C A;  2DTI A;  4YRK A;  2J3L A;  1HXD A;  3V7S A;  1G5I A;  3KFU A;  5F5W A;  3A32 A;  1BBW A;  1EVL A;  3HXU A;  4DQ2 A;  4YRG A;  4CH4 A;  4YRF A;  1X56 A;  2EWN A;  4UP8 A;  2QHS A;  3PCO B;  2E1H A;  3V7R A;  2ZIM A;  1WLE A;  4XTW A;  4TWA A;  2NS6 A;  2PME A;  4P3O A;  2QHU A;  2ZGW A;  2ZZF A;  3IKM B;  2FYK A;  4TVW A;  2ART A;  3HXX A;  1WYD A;  4K87 A;  1B7Y A;  5KNN A;  2E41 A;  4TTV A;  2CJ9 A;  1EIY B;  4G85 A;  2DU7 A;  1WU7 A;  3VQY A;  1USY C;  4P75 C;  4HWP A;  1YGB A;  2E3C A;  3R07 A;  4K86 A;  2DVE A;  5E3I A;  2ZNI A;  3BFM A;  2IY5 A;  2ALY A;  1W66 A;  4EO4 A;  1H4V B;  4YRP A;  2ALY B;  4YRJ A;  4P71 A;  2ZXF A;  1X01 A;  4YP0 A;  2XTI A;  4Q15 A;  1EIY A;  4YRI A;  4TVA A;  3MEY A;  3VQX A;  2ZIN A;  4YCU A;  3HY1 A;  1E1O A;  4ZIB A;  1NYR A;  2Q7H A;  4HWT A;  4YRT A;  1EOV A;  1B8A A;  1VQZ A;  3IKL A;  3MF1 A;  2DTO A;  3L1A A;  4XTZ A;  3RF1 A;  3UH0 A;  3HXY A;  3UGT A;  4H2W A;  2Q5H A;  4P75 A;  3L4G A;  1ADJ A;  1YFR A;  4H2Y A;  2RHS A;  4OP0 A;  2PMF A;  3HRI A;  4P74 A;  1L0W A;  3REU A;  3QO7 A;  2EJ9 A;  4YRC A;  1H4S A;  2P5I A;  3A5Z A;  4L87 A;  1SET A;  1NJ6 A;  1BIA A;  1ATI A;  3IG2 A;  4O2D A;  3A31 A;  1C0A A;  3PCO A;  1YB3 A;  3EFR A;  3M4Q A;  2I4M A;  1JJC A;  2DZC A;  1E1T A;  1HC7 A;  4RQF A;  3UFG A;  2ZT7 A;  3IAL A;  1NJ8 A;  5C52 B;  1G51 A;  4CS3 A;  3NET A;  2G4C A;  3QO8 A;  1E22 A;  2RHS B;  2DEQ A;  1ADY A;  2ZR2 A;  2HNI A;  2P0L A;  3REX A;  2ZTG A;  4YRO A;  1EFW A;  4H2U A;  3HFZ A;  3VBB A;  1PYS B;  2CIM A;  1QE0 A;  4HWS A;  2CJA A;  4TQF A;  5ELN A;  4P72 A;  3NEM A;  3OD1 A;  1KMM A;  3TEH B;  4KQE A;  3W3S A;  4UP9 A;  2DQ0 A;  3HXV A;  2AKW A;  1B76 A;  1WQW A;  4Q6G A;  3V8L A;  3HFV A;  1B70 B;  2ZCE A;  4TVA B;  2RHQ B;  1SRY A;  5ELO A;  4XU2 A;  4YRR A;  1B70 A;  1G5H A;  4LVK A;  4TQD A;  2DXU A;  2DXT A;  3LSS A;  2ODR C;  1ASY A;  1SES A;  1GGM A;  2E64 A;  3TEH A;  4P3N A;  2IY5 B;  1KMN A;  3ERR A;  3UGQ A;  4KR3 A;  3FJP A;  4H02 A;  4HWR A;  4ZTZ B;  2DU5 A;  5C51 B;  4LVI A;  1Z7N A;  2ARU A;  2C8M A;  1B7Y B; 
#chains in the Genus database with same CATH homology
 4P72 C;  4XEO A;  2Q7G A;  2DJZ A;  2EJF A;  4RMF A;  2CGH A;  4BW9 A;  4LVL A;  1WNL A;  3QO5 A;  4YRL A;  4HVC A;  3NEN A;  1X55 A;  4P73 A;  4P74 C;  4XU3 A;  2DDZ A;  3RUX A;  3P8Y A;  4XTX A;  3RIR A;  3BJU A;  3RL6 A;  4K88 A;  2DQ3 A;  2E65 A;  2EL9 A;  3LSQ A;  3TEG A;  3RKW A;  2EAY A;  1JJC B;  1NYQ A;  4XU1 A;  2EJG A;  3RAC A;  1NJ5 A;  2E5A A;  4H2T A;  4G84 A;  3MF2 A;  4WF2 A;  3EFS A;  2Q5I A;  2AMC A;  3M4P A;  2AMC B;  3DSQ A;  4YRE A;  2I4O A;  3CMQ A;  3HXW A;  4CS2 A;  3TUP A;  1N9W A;  1H4Q A;  4UP7 A;  3QTC A;  2DZ9 A;  3L4G B;  4H2S A;  3RGL A;  3WQZ A;  1QF6 A;  3E9H A;  2ZNJ A;  4LVM A;  2ZT8 A;  1WPY A;  4XTV A;  2A8E A;  1ASZ A;  2E10 A;  2J3M A;  11AS A;  1X2G A;  1J5W A;  4HT4 A;  1SER A;  4ZTU B;  3A5Y A;  3A7U A;  1EVK A;  4YRN A;  3PZC A;  3QNE A;  2DKG A;  3L2Z A;  3A74 A;  4P73 C;  2ZT5 A;  1BBU A;  2QHV A;  2ZZG A;  5K1P A;  1X2H A;  1USY A;  4HA8 A;  3NEL A;  3P8V A;  5HGQ A;  4YYE A;  2RHQ A;  2QHT A;  4PHC A;  4YRS A;  3MQZ A;  2CJB A;  4PG3 A;  4YRQ A;  4H2V A;  4LNS A;  3E9I A;  4RDX A;  1IL2 A;  4NCX A;  4OLF A;  4CH3 A;  2I4L A;  4DPG A;  4XU0 A;  2DTH A;  1EQR A;  1HTT A;  4YCV A;  1KOG A;  4WJ3 M;  1FYF A;  4CS4 A;  5C53 B;  1YFT A;  3HY0 A;  3G1Z A;  3LC0 A;  3HFZ B;  4XEM A;  4XTU A;  2XGT A;  4WI1 A;  3RKY A;  3HXZ A;  4X5O A;  4J15 A;  4YDQ A;  3HRK A;  2ZIO A;  4CH6 A;  4HWO A;  1H4T A;  2ZR3 A;  3V8J A;  3RKX A;  12AS A;  2AKW B;  2Q7E A;  3ICA A;  4UPA A;  2ARS A;  2ZT6 A;  4RQE A;  3VQV A;  4P71 C;  5K1X A;  1YFS A;  3VQW A;  4LVJ A;  1NJ1 A;  1LYL A;  4XTY A;  4YPF A;  2C7I A;  3A7R A;  1BIB A;  4YCW A;  1WQ7 A;  1E24 A;  4E51 A;  1PYS A;  1Z7M A;  4YRM A;  4P3P A;  3V8K A;  4WJ4 A;  4BWA A;  4EX5 A;  2ZZE A;  4TVY A;  4KR2 A;  1NJ2 A;  1NNH A;  1RIQ A;  4AH6 A;  1X54 A;  3A7A A;  2ODR D;  4H2X A;  3P8T A;  4CH5 A;  2I4N A;  3HTZ A;  3I7F A;  4H2X B;  3V7C A;  2DTI A;  4YRK A;  2J3L A;  1HXD A;  3V7S A;  1G5I A;  3KFU A;  5F5W A;  3A32 A;  1BBW A;  1EVL A;  3HXU A;  4DQ2 A;  4YRG A;  4CH4 A;  4YRF A;  1X56 A;  2EWN A;  4UP8 A;  2QHS A;  3PCO B;  2E1H A;  3V7R A;  2ZIM A;  1WLE A;  4XTW A;  4TWA A;  2NS6 A;  2PME A;  4P3O A;  2QHU A;  2ZGW A;  2ZZF A;  3IKM B;  2FYK A;  4TVW A;  2ART A;  3HXX A;  1WYD A;  4K87 A;  1B7Y A;  5KNN A;  2E41 A;  4TTV A;  2CJ9 A;  1EIY B;  4G85 A;  2DU7 A;  1WU7 A;  3VQY A;  1USY C;  4P75 C;  4HWP A;  1YGB A;  2E3C A;  3R07 A;  4K86 A;  2DVE A;  5E3I A;  2ZNI A;  3BFM A;  2IY5 A;  2ALY A;  1W66 A;  4EO4 A;  1H4V B;  4YRP A;  2ALY B;  4YRJ A;  4P71 A;  2ZXF A;  1X01 A;  4YP0 A;  2XTI A;  4Q15 A;  1EIY A;  4YRI A;  4TVA A;  3MEY A;  3VQX A;  2ZIN A;  4YCU A;  3HY1 A;  1E1O A;  4ZIB A;  1NYR A;  2Q7H A;  4HWT A;  4YRT A;  1EOV A;  1B8A A;  1VQZ A;  3IKL A;  3MF1 A;  2DTO A;  3L1A A;  4XTZ A;  3RF1 A;  3UH0 A;  3HXY A;  3UGT A;  4H2W A;  2Q5H A;  4P75 A;  3L4G A;  1ADJ A;  1YFR A;  4H2Y A;  2RHS A;  4OP0 A;  2PMF A;  3HRI A;  4P74 A;  1L0W A;  3REU A;  3QO7 A;  2EJ9 A;  4YRC A;  1H4S A;  2P5I A;  3A5Z A;  4L87 A;  1SET A;  1NJ6 A;  1BIA A;  1ATI A;  3IG2 A;  4O2D A;  3A31 A;  1C0A A;  3PCO A;  1YB3 A;  3EFR A;  3M4Q A;  2I4M A;  1JJC A;  2DZC A;  1E1T A;  1HC7 A;  4RQF A;  3UFG A;  2ZT7 A;  3IAL A;  1NJ8 A;  5C52 B;  1G51 A;  4CS3 A;  3NET A;  2G4C A;  3QO8 A;  1E22 A;  2RHS B;  2DEQ A;  1ADY A;  2ZR2 A;  2HNI A;  2P0L A;  3REX A;  2ZTG A;  4YRO A;  1EFW A;  4H2U A;  3HFZ A;  3VBB A;  1PYS B;  2CIM A;  1QE0 A;  4HWS A;  2CJA A;  4TQF A;  5ELN A;  4P72 A;  3NEM A;  3OD1 A;  1KMM A;  3TEH B;  4KQE A;  3W3S A;  4UP9 A;  2DQ0 A;  3HXV A;  2AKW A;  1B76 A;  1WQW A;  4Q6G A;  3V8L A;  3HFV A;  1B70 B;  2ZCE A;  4TVA B;  2RHQ B;  1SRY A;  5ELO A;  4XU2 A;  4YRR A;  1B70 A;  1G5H A;  4LVK A;  4TQD A;  2DXU A;  2DXT A;  3LSS A;  2ODR C;  1ASY A;  1SES A;  1GGM A;  2E64 A;  3TEH A;  4P3N A;  2IY5 B;  1KMN A;  3ERR A;  3UGQ A;  4KR3 A;  3FJP A;  4H02 A;  4HWR A;  4ZTZ B;  2DU5 A;  5C51 B;  4LVI A;  1Z7N A;  2ARU A;  2C8M A;  1B7Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...