4P74C

Phers in complex with compound 3a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 66
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p74C01
4P3PA 4YRJA 3CMQA 3VQVA 2RHSA 3NETA 4CS3A 2CJBA 2ZZEA 2RHSB 4YRMA 1EVLA 3ERRA 2G4CA 3HY1A 2ZTGA 12ASA 3L4GB 2J3MA 5C52B 3UGTA 1YGBA 4K87A 2QHSA 4XTWA 3I7FA 1WQWA 2EWNA 2ZXFA 4YRRA 3FJPA 3A74A 3E9HA 4BW9A 4YRNA 2FYKA 4G85A 2ZINA 4G84A 1W66A 1H4TA 3QO8A 4H2SA 3RIRA 1NNHA 4P3NA 4XU3A 2ZT6A 4HVCA 2ZT5A 1ATIA 2ZIOA 3P8TA 3A32A 2E10A 3IALA 2ODRC 1IL2A 4KR2A 1BBUA 5F5WA 1KMNA 2ZR2A 3HXXA 3RUXA 4YRGA 2DQ0A 2I4MA 2Q5IA 1EIYA 4YYEA 1JJCB 1H4SA 4H2WA 3HTZA 2E1HA 4Q6GA 4YCWA 2IY5A 2I4LA 3OD1A 2QHVA 3PCOB 4XTXA 3VBBA 4HWPA 4OLFA 1NJ2A 4YDQA 2ZNIA 3A7UA 1ASYA 3UFGA 3VQXA 4YRFA 3A5YA 3HXYA 2C8MA 2RHQB 3M4PA 4H2XA 4K86A 1NJ5A 1WPYA 5K1XA 4NCXA 2ZCEA 1Z7MA 4KR3A 4HWSA 1WYDA 2Q5HA 2AMCA 2DZ9A 4P72A 1LYLA 2DVEA 3WQZA 4P73C 1ASZA 5ELOA 3IKLA 2E64A 3ICAA 1SESA 1B7YA 2ZZGA 3RACA 2EL9A 4H2YA 4YRKA 1BIAA 2I4OA 4RQFA 4ZTZB 4Q15A 3QNEA 3HFZB 2DJZA 3DSQA 5C53B 3VQYA 2IY5B 3EFSA 1J5WA 3HFZA 1USYC 1Z7NA 2PMFA 4TVAA 1E1OA 2DTHA 1SRYA 3PCOA 3RF1A 1USYA 2DDZA 1B8AA 4YRPA 4E51A 3LSQA 3EFRA 5KNNA 2DZCA 4YRQA 3P8YA 2CIMA 2QHUA 4P75A 1X55A 1RIQA 5E3IA 3MEYA 3TUPA 3RL6A 3L4GA 2ARSA 3E9IA 2XTIA 2J3LA 1BIBA 2DXUA 4H2VA 4H2TA 1E1TA 3NEMA 1KOGA 1QE0A 4YREA 4XEOA 1B70A 3RKXA 3V7SA 2P0LA 4LNSA 2ALYB 2CJAA 3LSSA 3HFVA 1B7YB 4XTVA 4TVYA 4UP7A 4ZIBA 4HWOA 4P75C 1C0AA 1X2GA 2C7IA 2EJFA 1HC7A 4BWAA 2DTOA 4TTVA 3A31A 4YRLA 1EFWA 4CH4A 1GGMA 2HNIA 1PYSA 1PYSB 4RMFA 4TVAB 3NENA 4UP9A 3M4QA 3W3SA 4YROA 3V8JA 4PHCA 3RGLA 4YRIA 4YCUA 1G5HA 4H2UA 3UH0A 4YP0A 4UPAA 4WJ3M 4P74A 2ODRD 2AKWB 4CS4A 4DPGA 4CS2A 4YRCA 4XTZA 3HXZA 2EJGA 4CH3A 1NYQA 5HGQA 1WLEA 4XU1A 4YRTA 1X54A 4TWAA 4WF2A 2DQ3A 1QF6A 3IG2A 2DTIA 3R07A 4XEMA 4DQ2A 4ZTUB 4TVWA 3RKYA 1H4VB 1YFRA 3A7RA 3QTCA 4P72C 1WU7A 1EOVA 4WJ4A 3VQWA 3TEGA 4RQEA 2ZGWA 3IKMB 2E5AA 2E3CA 3QO5A 1H4QA 2E65A 4XU0A 2P5IA 3HXVA 4H2XB 11ASA 1EQRA 2DU7A 3A5ZA 4AH6A 1N9WA 1KMMA 3PZCA 3KFUA 1VQZA 1E24A 1NJ1A 2AMCB 1WQ7A 3HRKA 1E22A 4CH5A 4P3OA 1NJ6A 1X56A 2ARTA 2DKGA 2CGHA 4P71A 3L2ZA 4YCVA 4J15A 4XU2A 1YFTA 3REXA 2ZR3A 2Q7GA 3QO7A 1NYRA 3V8LA 1YFSA 1YB3A 1ADJA 2RHQA 4X5OA 5C51B 4EX5A 3P8VA 4OP0A 1G51A 1X2HA 4P74C 5ELNA 4HA8A 1B76A 4KQEA 2ZZFA 2XGTA 1B70B 2DEQA 3V8KA 2ARUA 2PMEA 4YRSA 3G1ZA 4P71C 1EVKA 2Q7HA 3V7RA 4UP8A 1JJCA 3LC0A 3BFMA 2E41A 4XTYA 2QHTA 2ZIMA 3UGQA 3A7AA 3HXUA 4CH6A 4HWTA 1HXDA 4XTUA 3V7CA 4HWRA 3HY0A 4O2DA 2ZT7A 5K1PA 4TQFA 4YPFA 3TEHA 3TEHB 4L87A 3MF1A 4K88A 1L0WA 1SETA 1WNLA 4P73A 4TQDA 1G5IA 2ZNJA 3RKWA 1X01A 2Q7EA 1HTTA 2DXTA 3L1AA 1EIYB 3NELA 4EO4A 4RDXA 2I4NA 3HRIA 4H02A 1ADYA 2CJ9A 2DU5A 2AKWA 1SERA 1NJ8A 2EJ9A 4PG3A 4WI1A 3HXWA 2ZT8A 1FYFA 2ALYA 2EAYA 1BBWA 3MF2A 3REUA 3BJUA
chains in the Genus database with same CATH superfamily
4P3PA 4YRJA 3CMQA 3VQVA 2RHSA 3NETA 4CS3A 2CJBA 2ZZEA 2RHSB 4YRMA 1EVLA 3ERRA 2G4CA 3HY1A 2ZTGA 12ASA 3L4GB 2J3MA 5C52B 3UGTA 1YGBA 4K87A 2QHSA 4XTWA 3I7FA 1WQWA 2EWNA 2ZXFA 4YRRA 3FJPA 3A74A 3E9HA 4BW9A 4YRNA 2FYKA 4G85A 2ZINA 4G84A 1W66A 1H4TA 3QO8A 4H2SA 3RIRA 1NNHA 4P3NA 4XU3A 2ZT6A 4HVCA 2ZT5A 1ATIA 2ZIOA 3P8TA 3A32A 2E10A 3IALA 2ODRC 1IL2A 4KR2A 1BBUA 5F5WA 1KMNA 2ZR2A 3HXXA 3RUXA 4YRGA 2DQ0A 2I4MA 2Q5IA 1EIYA 4YYEA 1JJCB 1H4SA 4H2WA 3HTZA 2E1HA 4Q6GA 4YCWA 2IY5A 4LVJA 2I4LA 3OD1A 2QHVA 3PCOB 4LVKA 4XTXA 3VBBA 4HWPA 4OLFA 1NJ2A 4YDQA 2ZNIA 3A7UA 1ASYA 3UFGA 3VQXA 4YRFA 3A5YA 4LVMA 3HXYA 2C8MA 2RHQB 3M4PA 4H2XA 4K86A 1NJ5A 1WPYA 5K1XA 4NCXA 2ZCEA 1Z7MA 4KR3A 4HWSA 1WYDA 2Q5HA 2AMCA 2DZ9A 4P72A 1LYLA 2DVEA 3WQZA 4P73C 1ASZA 5ELOA 3IKLA 2E64A 3ICAA 1SESA 1B7YA 2ZZGA 3RACA 2EL9A 4H2YA 4YRKA 1BIAA 2I4OA 4RQFA 4ZTZB 4Q15A 3QNEA 3HFZB 2DJZA 3DSQA 5C53B 3VQYA 2IY5B 3EFSA 1J5WA 3HFZA 1USYC 1Z7NA 2PMFA 4TVAA 1E1OA 2DTHA 1SRYA 3PCOA 3RF1A 1USYA 2DDZA 1B8AA 4YRPA 4E51A 3LSQA 3EFRA 5KNNA 2A8EA 2DZCA 4YRQA 3P8YA 2CIMA 2QHUA 4P75A 1X55A 1RIQA 5E3IA 3MEYA 3TUPA 3RL6A 3L4GA 2ARSA 3E9IA 2XTIA 2J3LA 1BIBA 2DXUA 4H2VA 4H2TA 1E1TA 3NEMA 1KOGA 1QE0A 4YREA 4XEOA 1B70A 3RKXA 3V7SA 2P0LA 4LNSA 2ALYB 2CJAA 3LSSA 3HFVA 1B7YB 4XTVA 4TVYA 4UP7A 4ZIBA 4HWOA 4P75C 1C0AA 1X2GA 2C7IA 2EJFA 1HC7A 4BWAA 2DTOA 4TTVA 3A31A 4YRLA 1EFWA 4CH4A 1GGMA 2HNIA 1PYSA 1PYSB 4RMFA 4TVAB 3NENA 4UP9A 3M4QA 3W3SA 4YROA 3V8JA 4PHCA 3RGLA 4YRIA 4YCUA 1G5HA 4H2UA 3UH0A 4YP0A 4UPAA 4WJ3M 4P74A 2ODRD 2AKWB 4CS4A 4DPGA 4CS2A 4YRCA 4XTZA 3HXZA 2EJGA 4CH3A 1NYQA 5HGQA 1WLEA 4XU1A 4YRTA 1X54A 4TWAA 4WF2A 2DQ3A 1QF6A 3IG2A 2NS6A 2DTIA 3R07A 4XEMA 4DQ2A 4ZTUB 4TVWA 3RKYA 1H4VB 1YFRA 3A7RA 3QTCA 4P72C 1WU7A 1EOVA 4LVIA 4WJ4A 3VQWA 3TEGA 4RQEA 2ZGWA 3IKMB 2E5AA 2E3CA 3QO5A 1H4QA 2E65A 4XU0A 2P5IA 3HXVA 4H2XB 11ASA 1EQRA 2DU7A 3A5ZA 4AH6A 1N9WA 1KMMA 3PZCA 3KFUA 1VQZA 1E24A 1NJ1A 2AMCB 1WQ7A 3HRKA 1E22A 4CH5A 4P3OA 1NJ6A 1X56A 2ARTA 2DKGA 2CGHA 4P71A 3L2ZA 4YCVA 4J15A 4XU2A 1YFTA 3REXA 2ZR3A 2Q7GA 3QO7A 1NYRA 3V8LA 1YFSA 1YB3A 1ADJA 2RHQA 4X5OA 5C51B 4EX5A 3P8VA 4OP0A 1G51A 1X2HA 4P74C 5ELNA 4HA8A 1B76A 4KQEA 2ZZFA 2XGTA 1B70B 2DEQA 3V8KA 2ARUA 2PMEA 4YRSA 3G1ZA 4P71C 1EVKA 2Q7HA 3V7RA 4UP8A 1JJCA 3LC0A 3BFMA 2E41A 4XTYA 2QHTA 2ZIMA 3UGQA 3A7AA 3HXUA 4CH6A 4HWTA 1HXDA 4XTUA 3V7CA 4HWRA 3HY0A 4O2DA 2ZT7A 5K1PA 4TQFA 4YPFA 3TEHA 3TEHB 4L87A 3MF1A 4K88A 1L0WA 1SETA 1WNLA 4P73A 4TQDA 1G5IA 2ZNJA 3RKWA 1X01A 2Q7EA 1HTTA 2DXTA 3L1AA 1EIYB 3NELA 4EO4A 4LVLA 4RDXA 2I4NA 3HRIA 4H02A 1ADYA 2CJ9A 4HT4A 2DU5A 2AKWA 1SERA 1NJ8A 2EJ9A 3MQZA 4PG3A 4WI1A 3HXWA 2ZT8A 1FYFA 2ALYA 2EAYA 1BBWA 3MF2A 3REUA 3BJUA
chains in the Genus database with same CATH topology
4P3PA 4YRJA 3CMQA 3VQVA 2RHSA 3NETA 4CS3A 2CJBA 2ZZEA 2RHSB 4YRMA 1EVLA 3ERRA 2G4CA 3HY1A 2ZTGA 12ASA 3L4GB 2J3MA 5C52B 3UGTA 1YGBA 4K87A 2QHSA 4XTWA 3I7FA 1WQWA 2EWNA 2ZXFA 4YRRA 3FJPA 3A74A 3E9HA 4BW9A 4YRNA 2FYKA 4G85A 2ZINA 4G84A 1W66A 1H4TA 3QO8A 4H2SA 3RIRA 1NNHA 4P3NA 4XU3A 2ZT6A 4HVCA 2ZT5A 1ATIA 2ZIOA 3P8TA 3A32A 2E10A 3IALA 2ODRC 1IL2A 4KR2A 1BBUA 5F5WA 1KMNA 2ZR2A 3HXXA 3RUXA 4YRGA 2DQ0A 2I4MA 2Q5IA 1EIYA 4YYEA 1JJCB 1H4SA 4H2WA 3HTZA 2E1HA 4Q6GA 4YCWA 2IY5A 4LVJA 2I4LA 3OD1A 2QHVA 3PCOB 4LVKA 4XTXA 3VBBA 4HWPA 4OLFA 1NJ2A 4YDQA 2ZNIA 3A7UA 1ASYA 3UFGA 3VQXA 4YRFA 3A5YA 4LVMA 3HXYA 2C8MA 2RHQB 3M4PA 4H2XA 4K86A 1NJ5A 1WPYA 5K1XA 4NCXA 2ZCEA 1Z7MA 4KR3A 4HWSA 1WYDA 2Q5HA 2AMCA 2DZ9A 4P72A 1LYLA 2DVEA 3WQZA 4P73C 1ASZA 5ELOA 3IKLA 2E64A 3ICAA 1SESA 1B7YA 2ZZGA 3RACA 2EL9A 4H2YA 4YRKA 1BIAA 2I4OA 4RQFA 4ZTZB 4Q15A 3QNEA 3HFZB 2DJZA 3DSQA 5C53B 3VQYA 2IY5B 3EFSA 1J5WA 3HFZA 1USYC 1Z7NA 2PMFA 4TVAA 1E1OA 2DTHA 1SRYA 3PCOA 3RF1A 1USYA 2DDZA 1B8AA 4YRPA 4E51A 3LSQA 3EFRA 5KNNA 2A8EA 2DZCA 4YRQA 3P8YA 2CIMA 2QHUA 4P75A 1X55A 1RIQA 5E3IA 3MEYA 3TUPA 3RL6A 3L4GA 2ARSA 3E9IA 2XTIA 2J3LA 1BIBA 2DXUA 4H2VA 4H2TA 1E1TA 3NEMA 1KOGA 1QE0A 4YREA 4XEOA 1B70A 3RKXA 3V7SA 2P0LA 4LNSA 2ALYB 2CJAA 3LSSA 3HFVA 1B7YB 4XTVA 4TVYA 4UP7A 4ZIBA 4HWOA 4P75C 1C0AA 1X2GA 2C7IA 2EJFA 1HC7A 4BWAA 2DTOA 4TTVA 3A31A 4YRLA 1EFWA 4CH4A 1GGMA 2HNIA 1PYSA 1PYSB 4RMFA 4TVAB 3NENA 4UP9A 3M4QA 3W3SA 4YROA 3V8JA 4PHCA 3RGLA 4YRIA 4YCUA 1G5HA 4H2UA 3UH0A 4YP0A 4UPAA 4WJ3M 4P74A 2ODRD 2AKWB 4CS4A 4DPGA 4CS2A 4YRCA 4XTZA 3HXZA 2EJGA 4CH3A 1NYQA 5HGQA 1WLEA 4XU1A 4YRTA 1X54A 4TWAA 4WF2A 2DQ3A 1QF6A 3IG2A 2NS6A 2DTIA 3R07A 4XEMA 4DQ2A 4ZTUB 4TVWA 3RKYA 1H4VB 1YFRA 3A7RA 3QTCA 4P72C 1WU7A 1EOVA 4LVIA 4WJ4A 3VQWA 3TEGA 4RQEA 2ZGWA 3IKMB 2E5AA 2E3CA 3QO5A 1H4QA 2E65A 4XU0A 2P5IA 3HXVA 4H2XB 11ASA 1EQRA 2DU7A 3A5ZA 4AH6A 1N9WA 1KMMA 3PZCA 3KFUA 1VQZA 1E24A 1NJ1A 2AMCB 1WQ7A 3HRKA 1E22A 4CH5A 4P3OA 1NJ6A 1X56A 2ARTA 2DKGA 2CGHA 4P71A 3L2ZA 4YCVA 4J15A 4XU2A 1YFTA 3REXA 2ZR3A 2Q7GA 3QO7A 1NYRA 3V8LA 1YFSA 1YB3A 1ADJA 2RHQA 4X5OA 5C51B 4EX5A 3P8VA 4OP0A 1G51A 1X2HA 4P74C 5ELNA 4HA8A 1B76A 4KQEA 2ZZFA 2XGTA 1B70B 2DEQA 3V8KA 2ARUA 2PMEA 4YRSA 3G1ZA 4P71C 1EVKA 2Q7HA 3V7RA 4UP8A 1JJCA 3LC0A 3BFMA 2E41A 4XTYA 2QHTA 2ZIMA 3UGQA 3A7AA 3HXUA 4CH6A 4HWTA 1HXDA 4XTUA 3V7CA 4HWRA 3HY0A 4O2DA 2ZT7A 5K1PA 4TQFA 4YPFA 3TEHA 3TEHB 4L87A 3MF1A 4K88A 1L0WA 1SETA 1WNLA 4P73A 4TQDA 1G5IA 2ZNJA 3RKWA 1X01A 2Q7EA 1HTTA 2DXTA 3L1AA 1EIYB 3NELA 4EO4A 4LVLA 4RDXA 2I4NA 3HRIA 4H02A 1ADYA 2CJ9A 4HT4A 2DU5A 2AKWA 1SERA 1NJ8A 2EJ9A 3MQZA 4PG3A 4WI1A 3HXWA 2ZT8A 1FYFA 2ALYA 2EAYA 1BBWA 3MF2A 3REUA 3BJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P3P A;  4YRJ A;  3CMQ A;  3VQV A;  2RHS A;  3NET A;  4CS3 A;  2CJB A;  2ZZE A;  2RHS B;  4YRM A;  1EVL A;  3ERR A;  2G4C A;  3HY1 A;  2ZTG A;  12AS A;  3L4G B;  2J3M A;  5C52 B;  3UGT A;  1YGB A;  4K87 A;  2QHS A;  4XTW A;  3I7F A;  1WQW A;  2EWN A;  2ZXF A;  4YRR A;  3FJP A;  3A74 A;  3E9H A;  4BW9 A;  4YRN A;  2FYK A;  4G85 A;  2ZIN A;  4G84 A;  1W66 A;  1H4T A;  3QO8 A;  4H2S A;  3RIR A;  1NNH A;  4P3N A;  4XU3 A;  2ZT6 A;  4HVC A;  2ZT5 A;  1ATI A;  2ZIO A;  3P8T A;  3A32 A;  2E10 A;  3IAL A;  2ODR C;  1IL2 A;  4KR2 A;  1BBU A;  5F5W A;  1KMN A;  2ZR2 A;  3HXX A;  3RUX A;  4YRG A;  2DQ0 A;  2I4M A;  2Q5I A;  1EIY A;  4YYE A;  1JJC B;  1H4S A;  4H2W A;  3HTZ A;  2E1H A;  4Q6G A;  4YCW A;  2IY5 A;  2I4L A;  3OD1 A;  2QHV A;  3PCO B;  4XTX A;  3VBB A;  4HWP A;  4OLF A;  1NJ2 A;  4YDQ A;  2ZNI A;  3A7U A;  1ASY A;  3UFG A;  3VQX A;  4YRF A;  3A5Y A;  3HXY A;  2C8M A;  2RHQ B;  3M4P A;  4H2X A;  4K86 A;  1NJ5 A;  1WPY A;  5K1X A;  4NCX A;  2ZCE A;  1Z7M A;  4KR3 A;  4HWS A;  1WYD A;  2Q5H A;  2AMC A;  2DZ9 A;  4P72 A;  1LYL A;  2DVE A;  3WQZ A;  4P73 C;  1ASZ A;  5ELO A;  3IKL A;  2E64 A;  3ICA A;  1SES A;  1B7Y A;  2ZZG A;  3RAC A;  2EL9 A;  4H2Y A;  4YRK A;  1BIA A;  2I4O A;  4RQF A;  4ZTZ B;  4Q15 A;  3QNE A;  3HFZ B;  2DJZ A;  3DSQ A;  5C53 B;  3VQY A;  2IY5 B;  3EFS A;  1J5W A;  3HFZ A;  1USY C;  1Z7N A;  2PMF A;  4TVA A;  1E1O A;  2DTH A;  1SRY A;  3PCO A;  3RF1 A;  1USY A;  2DDZ A;  1B8A A;  4YRP A;  4E51 A;  3LSQ A;  3EFR A;  5KNN A;  2DZC A;  4YRQ A;  3P8Y A;  2CIM A;  2QHU A;  4P75 A;  1X55 A;  1RIQ A;  5E3I A;  3MEY A;  3TUP A;  3RL6 A;  3L4G A;  2ARS A;  3E9I A;  2XTI A;  2J3L A;  1BIB A;  2DXU A;  4H2V A;  4H2T A;  1E1T A;  3NEM A;  1KOG A;  1QE0 A;  4YRE A;  4XEO A;  1B70 A;  3RKX A;  3V7S A;  2P0L A;  4LNS A;  2ALY B;  2CJA A;  3LSS A;  3HFV A;  1B7Y B;  4XTV A;  4TVY A;  4UP7 A;  4ZIB A;  4HWO A;  4P75 C;  1C0A A;  1X2G A;  2C7I A;  2EJF A;  1HC7 A;  4BWA A;  2DTO A;  4TTV A;  3A31 A;  4YRL A;  1EFW A;  4CH4 A;  1GGM A;  2HNI A;  1PYS A;  1PYS B;  4RMF A;  4TVA B;  3NEN A;  4UP9 A;  3M4Q A;  3W3S A;  4YRO A;  3V8J A;  4PHC A;  3RGL A;  4YRI A;  4YCU A;  1G5H A;  4H2U A;  3UH0 A;  4YP0 A;  4UPA A;  4WJ3 M;  4P74 A;  2ODR D;  2AKW B;  4CS4 A;  4DPG A;  4CS2 A;  4YRC A;  4XTZ A;  3HXZ A;  2EJG A;  4CH3 A;  1NYQ A;  5HGQ A;  1WLE A;  4XU1 A;  4YRT A;  1X54 A;  4TWA A;  4WF2 A;  2DQ3 A;  1QF6 A;  3IG2 A;  2DTI A;  3R07 A;  4XEM A;  4DQ2 A;  4ZTU B;  4TVW A;  3RKY A;  1H4V B;  1YFR A;  3A7R A;  3QTC A;  4P72 C;  1WU7 A;  1EOV A;  4WJ4 A;  3VQW A;  3TEG A;  4RQE A;  2ZGW A;  3IKM B;  2E5A A;  2E3C A;  3QO5 A;  1H4Q A;  2E65 A;  4XU0 A;  2P5I A;  3HXV A;  4H2X B;  11AS A;  1EQR A;  2DU7 A;  3A5Z A;  4AH6 A;  1N9W A;  1KMM A;  3PZC A;  3KFU A;  1VQZ A;  1E24 A;  1NJ1 A;  2AMC B;  1WQ7 A;  3HRK A;  1E22 A;  4CH5 A;  4P3O A;  1NJ6 A;  1X56 A;  2ART A;  2DKG A;  2CGH A;  4P71 A;  3L2Z A;  4YCV A;  4J15 A;  4XU2 A;  1YFT A;  3REX A;  2ZR3 A;  2Q7G A;  3QO7 A;  1NYR A;  3V8L A;  1YFS A;  1YB3 A;  1ADJ A;  2RHQ A;  4X5O A;  5C51 B;  4EX5 A;  3P8V A;  4OP0 A;  1G51 A;  1X2H A;  4P74 C;  5ELN A;  4HA8 A;  1B76 A;  4KQE A;  2ZZF A;  2XGT A;  1B70 B;  2DEQ A;  3V8K A;  2ARU A;  2PME A;  4YRS A;  3G1Z A;  4P71 C;  1EVK A;  2Q7H A;  3V7R A;  4UP8 A;  1JJC A;  3LC0 A;  3BFM A;  2E41 A;  4XTY A;  2QHT A;  2ZIM A;  3UGQ A;  3A7A A;  3HXU A;  4CH6 A;  4HWT A;  1HXD A;  4XTU A;  3V7C A;  4HWR A;  3HY0 A;  4O2D A;  2ZT7 A;  5K1P A;  4TQF A;  4YPF A;  3TEH A;  3TEH B;  4L87 A;  3MF1 A;  4K88 A;  1L0W A;  1SET A;  1WNL A;  4P73 A;  4TQD A;  1G5I A;  2ZNJ A;  3RKW A;  1X01 A;  2Q7E A;  1HTT A;  2DXT A;  3L1A A;  1EIY B;  3NEL A;  4EO4 A;  4RDX A;  2I4N A;  3HRI A;  4H02 A;  1ADY A;  2CJ9 A;  2DU5 A;  2AKW A;  1SER A;  1NJ8 A;  2EJ9 A;  4PG3 A;  4WI1 A;  3HXW A;  2ZT8 A;  1FYF A;  2ALY A;  2EAY A;  1BBW A;  3MF2 A;  3REU A;  3BJU A; 
#chains in the Genus database with same CATH topology
 4P3P A;  4YRJ A;  3CMQ A;  3VQV A;  2RHS A;  3NET A;  4CS3 A;  2CJB A;  2ZZE A;  2RHS B;  4YRM A;  1EVL A;  3ERR A;  2G4C A;  3HY1 A;  2ZTG A;  12AS A;  3L4G B;  2J3M A;  5C52 B;  3UGT A;  1YGB A;  4K87 A;  2QHS A;  4XTW A;  3I7F A;  1WQW A;  2EWN A;  2ZXF A;  4YRR A;  3FJP A;  3A74 A;  3E9H A;  4BW9 A;  4YRN A;  2FYK A;  4G85 A;  2ZIN A;  4G84 A;  1W66 A;  1H4T A;  3QO8 A;  4H2S A;  3RIR A;  1NNH A;  4P3N A;  4XU3 A;  2ZT6 A;  4HVC A;  2ZT5 A;  1ATI A;  2ZIO A;  3P8T A;  3A32 A;  2E10 A;  3IAL A;  2ODR C;  1IL2 A;  4KR2 A;  1BBU A;  5F5W A;  1KMN A;  2ZR2 A;  3HXX A;  3RUX A;  4YRG A;  2DQ0 A;  2I4M A;  2Q5I A;  1EIY A;  4YYE A;  1JJC B;  1H4S A;  4H2W A;  3HTZ A;  2E1H A;  4Q6G A;  4YCW A;  2IY5 A;  4LVJ A;  2I4L A;  3OD1 A;  2QHV A;  3PCO B;  4LVK A;  4XTX A;  3VBB A;  4HWP A;  4OLF A;  1NJ2 A;  4YDQ A;  2ZNI A;  3A7U A;  1ASY A;  3UFG A;  3VQX A;  4YRF A;  3A5Y A;  4LVM A;  3HXY A;  2C8M A;  2RHQ B;  3M4P A;  4H2X A;  4K86 A;  1NJ5 A;  1WPY A;  5K1X A;  4NCX A;  2ZCE A;  1Z7M A;  4KR3 A;  4HWS A;  1WYD A;  2Q5H A;  2AMC A;  2DZ9 A;  4P72 A;  1LYL A;  2DVE A;  3WQZ A;  4P73 C;  1ASZ A;  5ELO A;  3IKL A;  2E64 A;  3ICA A;  1SES A;  1B7Y A;  2ZZG A;  3RAC A;  2EL9 A;  4H2Y A;  4YRK A;  1BIA A;  2I4O A;  4RQF A;  4ZTZ B;  4Q15 A;  3QNE A;  3HFZ B;  2DJZ A;  3DSQ A;  5C53 B;  3VQY A;  2IY5 B;  3EFS A;  1J5W A;  3HFZ A;  1USY C;  1Z7N A;  2PMF A;  4TVA A;  1E1O A;  2DTH A;  1SRY A;  3PCO A;  3RF1 A;  1USY A;  2DDZ A;  1B8A A;  4YRP A;  4E51 A;  3LSQ A;  3EFR A;  5KNN A;  2A8E A;  2DZC A;  4YRQ A;  3P8Y A;  2CIM A;  2QHU A;  4P75 A;  1X55 A;  1RIQ A;  5E3I A;  3MEY A;  3TUP A;  3RL6 A;  3L4G A;  2ARS A;  3E9I A;  2XTI A;  2J3L A;  1BIB A;  2DXU A;  4H2V A;  4H2T A;  1E1T A;  3NEM A;  1KOG A;  1QE0 A;  4YRE A;  4XEO A;  1B70 A;  3RKX A;  3V7S A;  2P0L A;  4LNS A;  2ALY B;  2CJA A;  3LSS A;  3HFV A;  1B7Y B;  4XTV A;  4TVY A;  4UP7 A;  4ZIB A;  4HWO A;  4P75 C;  1C0A A;  1X2G A;  2C7I A;  2EJF A;  1HC7 A;  4BWA A;  2DTO A;  4TTV A;  3A31 A;  4YRL A;  1EFW A;  4CH4 A;  1GGM A;  2HNI A;  1PYS A;  1PYS B;  4RMF A;  4TVA B;  3NEN A;  4UP9 A;  3M4Q A;  3W3S A;  4YRO A;  3V8J A;  4PHC A;  3RGL A;  4YRI A;  4YCU A;  1G5H A;  4H2U A;  3UH0 A;  4YP0 A;  4UPA A;  4WJ3 M;  4P74 A;  2ODR D;  2AKW B;  4CS4 A;  4DPG A;  4CS2 A;  4YRC A;  4XTZ A;  3HXZ A;  2EJG A;  4CH3 A;  1NYQ A;  5HGQ A;  1WLE A;  4XU1 A;  4YRT A;  1X54 A;  4TWA A;  4WF2 A;  2DQ3 A;  1QF6 A;  3IG2 A;  2NS6 A;  2DTI A;  3R07 A;  4XEM A;  4DQ2 A;  4ZTU B;  4TVW A;  3RKY A;  1H4V B;  1YFR A;  3A7R A;  3QTC A;  4P72 C;  1WU7 A;  1EOV A;  4LVI A;  4WJ4 A;  3VQW A;  3TEG A;  4RQE A;  2ZGW A;  3IKM B;  2E5A A;  2E3C A;  3QO5 A;  1H4Q A;  2E65 A;  4XU0 A;  2P5I A;  3HXV A;  4H2X B;  11AS A;  1EQR A;  2DU7 A;  3A5Z A;  4AH6 A;  1N9W A;  1KMM A;  3PZC A;  3KFU A;  1VQZ A;  1E24 A;  1NJ1 A;  2AMC B;  1WQ7 A;  3HRK A;  1E22 A;  4CH5 A;  4P3O A;  1NJ6 A;  1X56 A;  2ART A;  2DKG A;  2CGH A;  4P71 A;  3L2Z A;  4YCV A;  4J15 A;  4XU2 A;  1YFT A;  3REX A;  2ZR3 A;  2Q7G A;  3QO7 A;  1NYR A;  3V8L A;  1YFS A;  1YB3 A;  1ADJ A;  2RHQ A;  4X5O A;  5C51 B;  4EX5 A;  3P8V A;  4OP0 A;  1G51 A;  1X2H A;  4P74 C;  5ELN A;  4HA8 A;  1B76 A;  4KQE A;  2ZZF A;  2XGT A;  1B70 B;  2DEQ A;  3V8K A;  2ARU A;  2PME A;  4YRS A;  3G1Z A;  4P71 C;  1EVK A;  2Q7H A;  3V7R A;  4UP8 A;  1JJC A;  3LC0 A;  3BFM A;  2E41 A;  4XTY A;  2QHT A;  2ZIM A;  3UGQ A;  3A7A A;  3HXU A;  4CH6 A;  4HWT A;  1HXD A;  4XTU A;  3V7C A;  4HWR A;  3HY0 A;  4O2D A;  2ZT7 A;  5K1P A;  4TQF A;  4YPF A;  3TEH A;  3TEH B;  4L87 A;  3MF1 A;  4K88 A;  1L0W A;  1SET A;  1WNL A;  4P73 A;  4TQD A;  1G5I A;  2ZNJ A;  3RKW A;  1X01 A;  2Q7E A;  1HTT A;  2DXT A;  3L1A A;  1EIY B;  3NEL A;  4EO4 A;  4LVL A;  4RDX A;  2I4N A;  3HRI A;  4H02 A;  1ADY A;  2CJ9 A;  4HT4 A;  2DU5 A;  2AKW A;  1SER A;  1NJ8 A;  2EJ9 A;  3MQZ A;  4PG3 A;  4WI1 A;  3HXW A;  2ZT8 A;  1FYF A;  2ALY A;  2EAY A;  1BBW A;  3MF2 A;  3REU A;  3BJU A; 
#chains in the Genus database with same CATH homology
 4P3P A;  4YRJ A;  3CMQ A;  3VQV A;  2RHS A;  3NET A;  4CS3 A;  2CJB A;  2ZZE A;  2RHS B;  4YRM A;  1EVL A;  3ERR A;  2G4C A;  3HY1 A;  2ZTG A;  12AS A;  3L4G B;  2J3M A;  5C52 B;  3UGT A;  1YGB A;  4K87 A;  2QHS A;  4XTW A;  3I7F A;  1WQW A;  2EWN A;  2ZXF A;  4YRR A;  3FJP A;  3A74 A;  3E9H A;  4BW9 A;  4YRN A;  2FYK A;  4G85 A;  2ZIN A;  4G84 A;  1W66 A;  1H4T A;  3QO8 A;  4H2S A;  3RIR A;  1NNH A;  4P3N A;  4XU3 A;  2ZT6 A;  4HVC A;  2ZT5 A;  1ATI A;  2ZIO A;  3P8T A;  3A32 A;  2E10 A;  3IAL A;  2ODR C;  1IL2 A;  4KR2 A;  1BBU A;  5F5W A;  1KMN A;  2ZR2 A;  3HXX A;  3RUX A;  4YRG A;  2DQ0 A;  2I4M A;  2Q5I A;  1EIY A;  4YYE A;  1JJC B;  1H4S A;  4H2W A;  3HTZ A;  2E1H A;  4Q6G A;  4YCW A;  2IY5 A;  4LVJ A;  2I4L A;  3OD1 A;  2QHV A;  3PCO B;  4LVK A;  4XTX A;  3VBB A;  4HWP A;  4OLF A;  1NJ2 A;  4YDQ A;  2ZNI A;  3A7U A;  1ASY A;  3UFG A;  3VQX A;  4YRF A;  3A5Y A;  4LVM A;  3HXY A;  2C8M A;  2RHQ B;  3M4P A;  4H2X A;  4K86 A;  1NJ5 A;  1WPY A;  5K1X A;  4NCX A;  2ZCE A;  1Z7M A;  4KR3 A;  4HWS A;  1WYD A;  2Q5H A;  2AMC A;  2DZ9 A;  4P72 A;  1LYL A;  2DVE A;  3WQZ A;  4P73 C;  1ASZ A;  5ELO A;  3IKL A;  2E64 A;  3ICA A;  1SES A;  1B7Y A;  2ZZG A;  3RAC A;  2EL9 A;  4H2Y A;  4YRK A;  1BIA A;  2I4O A;  4RQF A;  4ZTZ B;  4Q15 A;  3QNE A;  3HFZ B;  2DJZ A;  3DSQ A;  5C53 B;  3VQY A;  2IY5 B;  3EFS A;  1J5W A;  3HFZ A;  1USY C;  1Z7N A;  2PMF A;  4TVA A;  1E1O A;  2DTH A;  1SRY A;  3PCO A;  3RF1 A;  1USY A;  2DDZ A;  1B8A A;  4YRP A;  4E51 A;  3LSQ A;  3EFR A;  5KNN A;  2A8E A;  2DZC A;  4YRQ A;  3P8Y A;  2CIM A;  2QHU A;  4P75 A;  1X55 A;  1RIQ A;  5E3I A;  3MEY A;  3TUP A;  3RL6 A;  3L4G A;  2ARS A;  3E9I A;  2XTI A;  2J3L A;  1BIB A;  2DXU A;  4H2V A;  4H2T A;  1E1T A;  3NEM A;  1KOG A;  1QE0 A;  4YRE A;  4XEO A;  1B70 A;  3RKX A;  3V7S A;  2P0L A;  4LNS A;  2ALY B;  2CJA A;  3LSS A;  3HFV A;  1B7Y B;  4XTV A;  4TVY A;  4UP7 A;  4ZIB A;  4HWO A;  4P75 C;  1C0A A;  1X2G A;  2C7I A;  2EJF A;  1HC7 A;  4BWA A;  2DTO A;  4TTV A;  3A31 A;  4YRL A;  1EFW A;  4CH4 A;  1GGM A;  2HNI A;  1PYS A;  1PYS B;  4RMF A;  4TVA B;  3NEN A;  4UP9 A;  3M4Q A;  3W3S A;  4YRO A;  3V8J A;  4PHC A;  3RGL A;  4YRI A;  4YCU A;  1G5H A;  4H2U A;  3UH0 A;  4YP0 A;  4UPA A;  4WJ3 M;  4P74 A;  2ODR D;  2AKW B;  4CS4 A;  4DPG A;  4CS2 A;  4YRC A;  4XTZ A;  3HXZ A;  2EJG A;  4CH3 A;  1NYQ A;  5HGQ A;  1WLE A;  4XU1 A;  4YRT A;  1X54 A;  4TWA A;  4WF2 A;  2DQ3 A;  1QF6 A;  3IG2 A;  2NS6 A;  2DTI A;  3R07 A;  4XEM A;  4DQ2 A;  4ZTU B;  4TVW A;  3RKY A;  1H4V B;  1YFR A;  3A7R A;  3QTC A;  4P72 C;  1WU7 A;  1EOV A;  4LVI A;  4WJ4 A;  3VQW A;  3TEG A;  4RQE A;  2ZGW A;  3IKM B;  2E5A A;  2E3C A;  3QO5 A;  1H4Q A;  2E65 A;  4XU0 A;  2P5I A;  3HXV A;  4H2X B;  11AS A;  1EQR A;  2DU7 A;  3A5Z A;  4AH6 A;  1N9W A;  1KMM A;  3PZC A;  3KFU A;  1VQZ A;  1E24 A;  1NJ1 A;  2AMC B;  1WQ7 A;  3HRK A;  1E22 A;  4CH5 A;  4P3O A;  1NJ6 A;  1X56 A;  2ART A;  2DKG A;  2CGH A;  4P71 A;  3L2Z A;  4YCV A;  4J15 A;  4XU2 A;  1YFT A;  3REX A;  2ZR3 A;  2Q7G A;  3QO7 A;  1NYR A;  3V8L A;  1YFS A;  1YB3 A;  1ADJ A;  2RHQ A;  4X5O A;  5C51 B;  4EX5 A;  3P8V A;  4OP0 A;  1G51 A;  1X2H A;  4P74 C;  5ELN A;  4HA8 A;  1B76 A;  4KQE A;  2ZZF A;  2XGT A;  1B70 B;  2DEQ A;  3V8K A;  2ARU A;  2PME A;  4YRS A;  3G1Z A;  4P71 C;  1EVK A;  2Q7H A;  3V7R A;  4UP8 A;  1JJC A;  3LC0 A;  3BFM A;  2E41 A;  4XTY A;  2QHT A;  2ZIM A;  3UGQ A;  3A7A A;  3HXU A;  4CH6 A;  4HWT A;  1HXD A;  4XTU A;  3V7C A;  4HWR A;  3HY0 A;  4O2D A;  2ZT7 A;  5K1P A;  4TQF A;  4YPF A;  3TEH A;  3TEH B;  4L87 A;  3MF1 A;  4K88 A;  1L0W A;  1SET A;  1WNL A;  4P73 A;  4TQD A;  1G5I A;  2ZNJ A;  3RKW A;  1X01 A;  2Q7E A;  1HTT A;  2DXT A;  3L1A A;  1EIY B;  3NEL A;  4EO4 A;  4LVL A;  4RDX A;  2I4N A;  3HRI A;  4H02 A;  1ADY A;  2CJ9 A;  4HT4 A;  2DU5 A;  2AKW A;  1SER A;  1NJ8 A;  2EJ9 A;  3MQZ A;  4PG3 A;  4WI1 A;  3HXW A;  2ZT8 A;  1FYF A;  2ALY A;  2EAY A;  1BBW A;  3MF2 A;  3REU A;  3BJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...