4P74C

Phers in complex with compound 3a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
235
Chain Sequence
b'ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
total genus 66
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p74C01
1WLEA 3TUPA 2E3CA 4CH5A 3IKMB 2Q7EA 4YYEA 4PHCA 4H2XA 1WU7A 4OP0A 4YRJA 4P71C 4XTZA 3V8JA 3HRIA 3VQYA 2DU5A 1B70A 4P75A 4YROA 2J3MA 3HFVA 4UP8A 3LSSA 1SERA 4Q15A 3UGTA 3V8LA 3HXXA 4YCVA 12ASA 3PCOA 1YGBA 3TEHA 4YCWA 2RHQB 5C52B 4YRSA 4YPFA 5F5WA 2Q7HA 3BFMA 3IALA 4WJ4A 3ICAA 1SETA 4P74C 1YFRA 4HWOA 2ARTA 1JJCA 2IY5B 1HTTA 3E9HA 3UH0A 4ZIBA 1E24A 1NJ5A 2I4NA 4YDQA 1IL2A 1H4VB 4G85A 3RIRA 3P8TA 3M4PA 2QHVA 1EQRA 4K86A 3G1ZA 4P73A 2I4MA 4YRCA 2QHUA 1BBUA 3HRKA 4HA8A 3A7RA 4OLFA 4ZTUB 3MF2A 4NCXA 3HFZA 4YRQA 1BIAA 1Z7MA 4CH3A 5C51B 1C0AA 3A32A 3FJPA 3HXUA 4P3OA 1USYC 1NJ8A 2CIMA 1ADJA 3DSQA 2DQ0A 2QHTA 1H4TA 2ZZGA 3NENA 3A5ZA 2ZXFA 4UPAA 1LYLA 2ZINA 2ZZEA 4E51A 3RKYA 4HWPA 4RDXA 3QTCA 4YRMA 2E10A 1GGMA 4J15A 1EOVA 4P72A 4H2XB 4BW9A 4H02A 1ATIA 2E41A 1ADYA 1B70B 2ALYA 3P8YA 1W66A 5K1PA 1NJ6A 3RKXA 2C8MA 1E1OA 2E64A 4TQDA 4H2YA 1X55A 2CGHA 2CJBA 2Q7GA 1HXDA 3PCOB 3TEHB 4YRIA 4YRRA 1WQWA 3QNEA 3CMQA 2XTIA 1WYDA 1ASZA 1BBWA 1JJCB 2DJZA 3A5YA 4TVWA 4HWSA 2ZTGA 3EFRA 2DEQA 1YFSA 4XTVA 1E22A 4K87A 4YRFA 3L1AA 4RQFA 1SESA 2ZCEA 2EAYA 4P71A 1YFTA 2DZCA 2CJAA 2C7IA 3HFZB 4KR3A 2I4OA 2DXUA 3RGLA 4K88A 4XEOA 1J5WA 1NJ2A 4DPGA 3A74A 1WNLA 3UFGA 3M4QA 3VBBA 1EVLA 2DKGA 2EJFA 1E1TA 4P74A 4RMFA 3RKWA 1SRYA 3ERRA 3VQXA 4UP7A 3HXWA 4G84A 4CH6A 1FYFA 2CJ9A 3LSQA 1ASYA 1QF6A 1HC7A 3E9IA 4HVCA 2DTIA 3V7SA 2PMEA 2RHSA 4UP9A 1EVKA 2EL9A 3QO7A 4YRPA 3EFSA 2AMCA 4Q6GA 3QO8A 2ZZFA 4AH6A 2XGTA 1EIYA 3I7FA 1X54A 2ALYB 4H2UA 4TTVA 5K1XA 1USYA 11ASA 3L4GA 1L0WA 4RQEA 3VQWA 3WQZA 3BJUA 1RIQA 3L2ZA 3OD1A 2ZT5A 3HY1A 4HWRA 2EJ9A 1B7YA 2Q5IA 1PYSA 2ZIMA 2AKWA 1G5IA 4HWTA 2E1HA 4XTYA 1WPYA 3HTZA 3PZCA 4TQFA 4KR2A 2HNIA 2ZR3A 2DVEA 4YRNA 2DXTA 2ZT7A 3RACA 1G5HA 2ODRC 2QHSA 3HXZA 4TVYA 3V8KA 4TVAA 3KFUA 4XTXA 2PMFA 3NELA 4H2WA 1VQZA 2P0LA 1X56A 3V7RA 4P75C 1KMNA 2DDZA 1EFWA 3P8VA 4L87A 4DQ2A 4LNSA 4H2VA 3A31A 3NEMA 3HXYA 4YRKA 2I4LA 1B76A 2DTHA 2P5IA 4YRTA 4H2SA 4CS2A 2ZNJA 2ZT8A 3HY0A 4XU0A 3LC0A 1X2GA 1Z7NA 3IG2A 4XEMA 5ELNA 4YRGA 4CH4A 4PG3A 4XU3A 2DTOA 2RHSB 4YCUA 4XU1A 1YB3A 2ZNIA 1KMMA 2AMCB 3RL6A 4P73C 4ZTZB 1EIYB 2ARUA 1BIBA 4EO4A 5ELOA 5HGQA 3L4GB 4CS3A 3REXA 2FYKA 1H4QA 4O2DA 3HXVA 4X5OA 1B7YB 5E3IA 3QO5A 4WJ3M 2RHQA 1N9WA 5KNNA 4XU2A 1PYSB 1NYRA 4H2TA 1NYQA 4YREA 2ODRD 2ZT6A 2ZIOA 5C53B 2AKWB 2IY5A 3V7CA 2ARSA 3RF1A 4EX5A 3TEGA 4XTUA 2J3LA 1H4SA 1X01A 3VQVA 4XTWA 4YP0A 3W3SA 4TWAA 1X2HA 3RUXA 4CS4A 3IKLA 4P3PA 3A7UA 4P72C 4TVAB 1NJ1A 1QE0A 2E5AA 1B8AA 4WF2A 3REUA 2ZGWA 2EJGA 2Q5HA 4BWAA 4P3NA 2EWNA 2ZR2A 1G51A 3R07A 3MEYA 1KOGA 2G4CA 4KQEA 3MF1A 3UGQA 3NETA 2DZ9A 2DU7A 1NNHA 3A7AA 4WI1A 1WQ7A 2DQ3A 4YRLA 2E65A
chains in the Genus database with same CATH superfamily
1WLEA 3TUPA 2E3CA 4CH5A 3IKMB 2Q7EA 4YYEA 4PHCA 4H2XA 1WU7A 4OP0A 4YRJA 4P71C 4XTZA 3V8JA 3HRIA 3VQYA 2DU5A 1B70A 4P75A 4YROA 2J3MA 3HFVA 4UP8A 3LSSA 1SERA 4Q15A 3UGTA 3V8LA 3HXXA 4YCVA 12ASA 3PCOA 1YGBA 3TEHA 4YCWA 2RHQB 5C52B 4YRSA 4YPFA 5F5WA 2Q7HA 3BFMA 3IALA 4WJ4A 3ICAA 1SETA 4P74C 1YFRA 4HWOA 2ARTA 1JJCA 2IY5B 1HTTA 3E9HA 3UH0A 4ZIBA 1E24A 1NJ5A 2I4NA 4YDQA 1IL2A 1H4VB 4G85A 3RIRA 3P8TA 3M4PA 2QHVA 1EQRA 4K86A 3G1ZA 4P73A 2I4MA 4YRCA 2QHUA 1BBUA 3HRKA 4HA8A 3A7RA 4OLFA 4ZTUB 3MF2A 4NCXA 3HFZA 4YRQA 1BIAA 2A8EA 1Z7MA 4CH3A 5C51B 1C0AA 3A32A 3FJPA 3HXUA 4P3OA 1USYC 1NJ8A 2CIMA 1ADJA 3DSQA 2DQ0A 2QHTA 1H4TA 2ZZGA 3NENA 3A5ZA 2ZXFA 4UPAA 1LYLA 2ZINA 2ZZEA 4E51A 3RKYA 4HWPA 4RDXA 3QTCA 4YRMA 2E10A 1GGMA 4J15A 1EOVA 4P72A 4H2XB 4BW9A 4H02A 1ATIA 2E41A 1ADYA 1B70B 2ALYA 3P8YA 1W66A 5K1PA 1NJ6A 3RKXA 2C8MA 1E1OA 2E64A 4TQDA 4H2YA 1X55A 2CGHA 2CJBA 2Q7GA 1HXDA 3PCOB 3TEHB 4YRIA 4YRRA 1WQWA 3QNEA 3CMQA 2XTIA 1WYDA 1ASZA 1BBWA 1JJCB 2DJZA 3A5YA 4LVMA 4TVWA 4HWSA 2ZTGA 3EFRA 2DEQA 1YFSA 4XTVA 1E22A 4K87A 4YRFA 3L1AA 4RQFA 1SESA 2ZCEA 2EAYA 4P71A 1YFTA 2DZCA 2CJAA 2C7IA 3HFZB 4KR3A 2I4OA 2DXUA 3RGLA 4K88A 4XEOA 1J5WA 1NJ2A 4DPGA 3A74A 1WNLA 3UFGA 3M4QA 3VBBA 1EVLA 2DKGA 2EJFA 1E1TA 4P74A 4RMFA 3RKWA 1SRYA 3MQZA 3ERRA 3VQXA 4UP7A 3HXWA 4G84A 4CH6A 1FYFA 2CJ9A 3LSQA 1ASYA 1QF6A 1HC7A 3E9IA 4HVCA 2DTIA 3V7SA 4LVKA 2PMEA 2RHSA 4UP9A 1EVKA 2EL9A 3QO7A 4YRPA 3EFSA 2AMCA 4Q6GA 3QO8A 2ZZFA 4AH6A 2XGTA 1EIYA 3I7FA 1X54A 2ALYB 4H2UA 4TTVA 5K1XA 1USYA 11ASA 3L4GA 1L0WA 4RQEA 3VQWA 3WQZA 3BJUA 1RIQA 3L2ZA 3OD1A 2ZT5A 3HY1A 4HWRA 2EJ9A 1B7YA 2Q5IA 1PYSA 4HT4A 2ZIMA 2AKWA 1G5IA 4HWTA 2E1HA 4XTYA 1WPYA 3HTZA 3PZCA 4TQFA 4KR2A 2HNIA 2ZR3A 2DVEA 4YRNA 2DXTA 2ZT7A 3RACA 1G5HA 2ODRC 2QHSA 3HXZA 4TVYA 3V8KA 4TVAA 3KFUA 4XTXA 2PMFA 3NELA 4H2WA 1VQZA 2P0LA 1X56A 3V7RA 4P75C 1KMNA 2DDZA 1EFWA 3P8VA 4L87A 4DQ2A 4LNSA 4H2VA 3A31A 3NEMA 3HXYA 4YRKA 2I4LA 1B76A 2DTHA 2P5IA 4YRTA 4H2SA 4CS2A 2ZNJA 2ZT8A 3HY0A 4XU0A 3LC0A 1X2GA 1Z7NA 3IG2A 4XEMA 5ELNA 4YRGA 4CH4A 4PG3A 4XU3A 2DTOA 2RHSB 4YCUA 4XU1A 1YB3A 2ZNIA 1KMMA 2AMCB 3RL6A 4P73C 4ZTZB 1EIYB 2ARUA 1BIBA 4EO4A 5ELOA 5HGQA 3L4GB 4CS3A 3REXA 2FYKA 1H4QA 4O2DA 3HXVA 4LVJA 4X5OA 1B7YB 5E3IA 3QO5A 4WJ3M 2RHQA 1N9WA 5KNNA 4XU2A 1PYSB 1NYRA 4H2TA 1NYQA 4YREA 4LVIA 2ODRD 2ZT6A 2ZIOA 5C53B 2AKWB 2IY5A 3V7CA 2ARSA 3RF1A 4EX5A 3TEGA 4XTUA 2J3LA 1H4SA 1X01A 3VQVA 4LVLA 4XTWA 4YP0A 3W3SA 4TWAA 1X2HA 3RUXA 4CS4A 3IKLA 4P3PA 3A7UA 4P72C 4TVAB 1NJ1A 1QE0A 2E5AA 1B8AA 4WF2A 3REUA 2ZGWA 2EJGA 2Q5HA 4BWAA 4P3NA 2EWNA 2NS6A 2ZR2A 1G51A 3R07A 3MEYA 1KOGA 2G4CA 4KQEA 3MF1A 3UGQA 3NETA 2DZ9A 2DU7A 1NNHA 3A7AA 4WI1A 1WQ7A 2DQ3A 4YRLA 2E65A
chains in the Genus database with same CATH topology
1WLEA 3TUPA 2E3CA 4CH5A 3IKMB 2Q7EA 4YYEA 4PHCA 4H2XA 1WU7A 4OP0A 4YRJA 4P71C 4XTZA 3V8JA 3HRIA 3VQYA 2DU5A 1B70A 4P75A 4YROA 2J3MA 3HFVA 4UP8A 3LSSA 1SERA 4Q15A 3UGTA 3V8LA 3HXXA 4YCVA 12ASA 3PCOA 1YGBA 3TEHA 4YCWA 2RHQB 5C52B 4YRSA 4YPFA 5F5WA 2Q7HA 3BFMA 3IALA 4WJ4A 3ICAA 1SETA 4P74C 1YFRA 4HWOA 2ARTA 1JJCA 2IY5B 1HTTA 3E9HA 3UH0A 4ZIBA 1E24A 1NJ5A 2I4NA 4YDQA 1IL2A 1H4VB 4G85A 3RIRA 3P8TA 3M4PA 2QHVA 1EQRA 4K86A 3G1ZA 4P73A 2I4MA 4YRCA 2QHUA 1BBUA 3HRKA 4HA8A 3A7RA 4OLFA 4ZTUB 3MF2A 4NCXA 3HFZA 4YRQA 1BIAA 2A8EA 1Z7MA 4CH3A 5C51B 1C0AA 3A32A 3FJPA 3HXUA 4P3OA 1USYC 1NJ8A 2CIMA 1ADJA 3DSQA 2DQ0A 2QHTA 1H4TA 2ZZGA 3NENA 3A5ZA 2ZXFA 4UPAA 1LYLA 2ZINA 2ZZEA 4E51A 3RKYA 4HWPA 4RDXA 3QTCA 4YRMA 2E10A 1GGMA 4J15A 1EOVA 4P72A 4H2XB 4BW9A 4H02A 1ATIA 2E41A 1ADYA 1B70B 2ALYA 3P8YA 1W66A 5K1PA 1NJ6A 3RKXA 2C8MA 1E1OA 2E64A 4TQDA 4H2YA 1X55A 2CGHA 2CJBA 2Q7GA 1HXDA 3PCOB 3TEHB 4YRIA 4YRRA 1WQWA 3QNEA 3CMQA 2XTIA 1WYDA 1ASZA 1BBWA 1JJCB 2DJZA 3A5YA 4LVMA 4TVWA 4HWSA 2ZTGA 3EFRA 2DEQA 1YFSA 4XTVA 1E22A 4K87A 4YRFA 3L1AA 4RQFA 1SESA 2ZCEA 2EAYA 4P71A 1YFTA 2DZCA 2CJAA 2C7IA 3HFZB 4KR3A 2I4OA 2DXUA 3RGLA 4K88A 4XEOA 1J5WA 1NJ2A 4DPGA 3A74A 1WNLA 3UFGA 3M4QA 3VBBA 1EVLA 2DKGA 2EJFA 1E1TA 4P74A 4RMFA 3RKWA 1SRYA 3MQZA 3ERRA 3VQXA 4UP7A 3HXWA 4G84A 4CH6A 1FYFA 2CJ9A 3LSQA 1ASYA 1QF6A 1HC7A 3E9IA 4HVCA 2DTIA 3V7SA 4LVKA 2PMEA 2RHSA 4UP9A 1EVKA 2EL9A 3QO7A 4YRPA 3EFSA 2AMCA 4Q6GA 3QO8A 2ZZFA 4AH6A 2XGTA 1EIYA 3I7FA 1X54A 2ALYB 4H2UA 4TTVA 5K1XA 1USYA 11ASA 3L4GA 1L0WA 4RQEA 3VQWA 3WQZA 3BJUA 1RIQA 3L2ZA 3OD1A 2ZT5A 3HY1A 4HWRA 2EJ9A 1B7YA 2Q5IA 1PYSA 4HT4A 2ZIMA 2AKWA 1G5IA 4HWTA 2E1HA 4XTYA 1WPYA 3HTZA 3PZCA 4TQFA 4KR2A 2HNIA 2ZR3A 2DVEA 4YRNA 2DXTA 2ZT7A 3RACA 1G5HA 2ODRC 2QHSA 3HXZA 4TVYA 3V8KA 4TVAA 3KFUA 4XTXA 2PMFA 3NELA 4H2WA 1VQZA 2P0LA 1X56A 3V7RA 4P75C 1KMNA 2DDZA 1EFWA 3P8VA 4L87A 4DQ2A 4LNSA 4H2VA 3A31A 3NEMA 3HXYA 4YRKA 2I4LA 1B76A 2DTHA 2P5IA 4YRTA 4H2SA 4CS2A 2ZNJA 2ZT8A 3HY0A 4XU0A 3LC0A 1X2GA 1Z7NA 3IG2A 4XEMA 5ELNA 4YRGA 4CH4A 4PG3A 4XU3A 2DTOA 2RHSB 4YCUA 4XU1A 1YB3A 2ZNIA 1KMMA 2AMCB 3RL6A 4P73C 4ZTZB 1EIYB 2ARUA 1BIBA 4EO4A 5ELOA 5HGQA 3L4GB 4CS3A 3REXA 2FYKA 1H4QA 4O2DA 3HXVA 4LVJA 4X5OA 1B7YB 5E3IA 3QO5A 4WJ3M 2RHQA 1N9WA 5KNNA 4XU2A 1PYSB 1NYRA 4H2TA 1NYQA 4YREA 4LVIA 2ODRD 2ZT6A 2ZIOA 5C53B 2AKWB 2IY5A 3V7CA 2ARSA 3RF1A 4EX5A 3TEGA 4XTUA 2J3LA 1H4SA 1X01A 3VQVA 4LVLA 4XTWA 4YP0A 3W3SA 4TWAA 1X2HA 3RUXA 4CS4A 3IKLA 4P3PA 3A7UA 4P72C 4TVAB 1NJ1A 1QE0A 2E5AA 1B8AA 4WF2A 3REUA 2ZGWA 2EJGA 2Q5HA 4BWAA 4P3NA 2EWNA 2NS6A 2ZR2A 1G51A 3R07A 3MEYA 1KOGA 2G4CA 4KQEA 3MF1A 3UGQA 3NETA 2DZ9A 2DU7A 1NNHA 3A7AA 4WI1A 1WQ7A 2DQ3A 4YRLA 2E65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLE A;  3TUP A;  2E3C A;  4CH5 A;  3IKM B;  2Q7E A;  4YYE A;  4PHC A;  4H2X A;  1WU7 A;  4OP0 A;  4YRJ A;  4P71 C;  4XTZ A;  3V8J A;  3HRI A;  3VQY A;  2DU5 A;  1B70 A;  4P75 A;  4YRO A;  2J3M A;  3HFV A;  4UP8 A;  3LSS A;  1SER A;  4Q15 A;  3UGT A;  3V8L A;  3HXX A;  4YCV A;  12AS A;  3PCO A;  1YGB A;  3TEH A;  4YCW A;  2RHQ B;  5C52 B;  4YRS A;  4YPF A;  5F5W A;  2Q7H A;  3BFM A;  3IAL A;  4WJ4 A;  3ICA A;  1SET A;  4P74 C;  1YFR A;  4HWO A;  2ART A;  1JJC A;  2IY5 B;  1HTT A;  3E9H A;  3UH0 A;  4ZIB A;  1E24 A;  1NJ5 A;  2I4N A;  4YDQ A;  1IL2 A;  1H4V B;  4G85 A;  3RIR A;  3P8T A;  3M4P A;  2QHV A;  1EQR A;  4K86 A;  3G1Z A;  4P73 A;  2I4M A;  4YRC A;  2QHU A;  1BBU A;  3HRK A;  4HA8 A;  3A7R A;  4OLF A;  4ZTU B;  3MF2 A;  4NCX A;  3HFZ A;  4YRQ A;  1BIA A;  1Z7M A;  4CH3 A;  5C51 B;  1C0A A;  3A32 A;  3FJP A;  3HXU A;  4P3O A;  1USY C;  1NJ8 A;  2CIM A;  1ADJ A;  3DSQ A;  2DQ0 A;  2QHT A;  1H4T A;  2ZZG A;  3NEN A;  3A5Z A;  2ZXF A;  4UPA A;  1LYL A;  2ZIN A;  2ZZE A;  4E51 A;  3RKY A;  4HWP A;  4RDX A;  3QTC A;  4YRM A;  2E10 A;  1GGM A;  4J15 A;  1EOV A;  4P72 A;  4H2X B;  4BW9 A;  4H02 A;  1ATI A;  2E41 A;  1ADY A;  1B70 B;  2ALY A;  3P8Y A;  1W66 A;  5K1P A;  1NJ6 A;  3RKX A;  2C8M A;  1E1O A;  2E64 A;  4TQD A;  4H2Y A;  1X55 A;  2CGH A;  2CJB A;  2Q7G A;  1HXD A;  3PCO B;  3TEH B;  4YRI A;  4YRR A;  1WQW A;  3QNE A;  3CMQ A;  2XTI A;  1WYD A;  1ASZ A;  1BBW A;  1JJC B;  2DJZ A;  3A5Y A;  4TVW A;  4HWS A;  2ZTG A;  3EFR A;  2DEQ A;  1YFS A;  4XTV A;  1E22 A;  4K87 A;  4YRF A;  3L1A A;  4RQF A;  1SES A;  2ZCE A;  2EAY A;  4P71 A;  1YFT A;  2DZC A;  2CJA A;  2C7I A;  3HFZ B;  4KR3 A;  2I4O A;  2DXU A;  3RGL A;  4K88 A;  4XEO A;  1J5W A;  1NJ2 A;  4DPG A;  3A74 A;  1WNL A;  3UFG A;  3M4Q A;  3VBB A;  1EVL A;  2DKG A;  2EJF A;  1E1T A;  4P74 A;  4RMF A;  3RKW A;  1SRY A;  3ERR A;  3VQX A;  4UP7 A;  3HXW A;  4G84 A;  4CH6 A;  1FYF A;  2CJ9 A;  3LSQ A;  1ASY A;  1QF6 A;  1HC7 A;  3E9I A;  4HVC A;  2DTI A;  3V7S A;  2PME A;  2RHS A;  4UP9 A;  1EVK A;  2EL9 A;  3QO7 A;  4YRP A;  3EFS A;  2AMC A;  4Q6G A;  3QO8 A;  2ZZF A;  4AH6 A;  2XGT A;  1EIY A;  3I7F A;  1X54 A;  2ALY B;  4H2U A;  4TTV A;  5K1X A;  1USY A;  11AS A;  3L4G A;  1L0W A;  4RQE A;  3VQW A;  3WQZ A;  3BJU A;  1RIQ A;  3L2Z A;  3OD1 A;  2ZT5 A;  3HY1 A;  4HWR A;  2EJ9 A;  1B7Y A;  2Q5I A;  1PYS A;  2ZIM A;  2AKW A;  1G5I A;  4HWT A;  2E1H A;  4XTY A;  1WPY A;  3HTZ A;  3PZC A;  4TQF A;  4KR2 A;  2HNI A;  2ZR3 A;  2DVE A;  4YRN A;  2DXT A;  2ZT7 A;  3RAC A;  1G5H A;  2ODR C;  2QHS A;  3HXZ A;  4TVY A;  3V8K A;  4TVA A;  3KFU A;  4XTX A;  2PMF A;  3NEL A;  4H2W A;  1VQZ A;  2P0L A;  1X56 A;  3V7R A;  4P75 C;  1KMN A;  2DDZ A;  1EFW A;  3P8V A;  4L87 A;  4DQ2 A;  4LNS A;  4H2V A;  3A31 A;  3NEM A;  3HXY A;  4YRK A;  2I4L A;  1B76 A;  2DTH A;  2P5I A;  4YRT A;  4H2S A;  4CS2 A;  2ZNJ A;  2ZT8 A;  3HY0 A;  4XU0 A;  3LC0 A;  1X2G A;  1Z7N A;  3IG2 A;  4XEM A;  5ELN A;  4YRG A;  4CH4 A;  4PG3 A;  4XU3 A;  2DTO A;  2RHS B;  4YCU A;  4XU1 A;  1YB3 A;  2ZNI A;  1KMM A;  2AMC B;  3RL6 A;  4P73 C;  4ZTZ B;  1EIY B;  2ARU A;  1BIB A;  4EO4 A;  5ELO A;  5HGQ A;  3L4G B;  4CS3 A;  3REX A;  2FYK A;  1H4Q A;  4O2D A;  3HXV A;  4X5O A;  1B7Y B;  5E3I A;  3QO5 A;  4WJ3 M;  2RHQ A;  1N9W A;  5KNN A;  4XU2 A;  1PYS B;  1NYR A;  4H2T A;  1NYQ A;  4YRE A;  2ODR D;  2ZT6 A;  2ZIO A;  5C53 B;  2AKW B;  2IY5 A;  3V7C A;  2ARS A;  3RF1 A;  4EX5 A;  3TEG A;  4XTU A;  2J3L A;  1H4S A;  1X01 A;  3VQV A;  4XTW A;  4YP0 A;  3W3S A;  4TWA A;  1X2H A;  3RUX A;  4CS4 A;  3IKL A;  4P3P A;  3A7U A;  4P72 C;  4TVA B;  1NJ1 A;  1QE0 A;  2E5A A;  1B8A A;  4WF2 A;  3REU A;  2ZGW A;  2EJG A;  2Q5H A;  4BWA A;  4P3N A;  2EWN A;  2ZR2 A;  1G51 A;  3R07 A;  3MEY A;  1KOG A;  2G4C A;  4KQE A;  3MF1 A;  3UGQ A;  3NET A;  2DZ9 A;  2DU7 A;  1NNH A;  3A7A A;  4WI1 A;  1WQ7 A;  2DQ3 A;  4YRL A;  2E65 A; 
#chains in the Genus database with same CATH topology
 1WLE A;  3TUP A;  2E3C A;  4CH5 A;  3IKM B;  2Q7E A;  4YYE A;  4PHC A;  4H2X A;  1WU7 A;  4OP0 A;  4YRJ A;  4P71 C;  4XTZ A;  3V8J A;  3HRI A;  3VQY A;  2DU5 A;  1B70 A;  4P75 A;  4YRO A;  2J3M A;  3HFV A;  4UP8 A;  3LSS A;  1SER A;  4Q15 A;  3UGT A;  3V8L A;  3HXX A;  4YCV A;  12AS A;  3PCO A;  1YGB A;  3TEH A;  4YCW A;  2RHQ B;  5C52 B;  4YRS A;  4YPF A;  5F5W A;  2Q7H A;  3BFM A;  3IAL A;  4WJ4 A;  3ICA A;  1SET A;  4P74 C;  1YFR A;  4HWO A;  2ART A;  1JJC A;  2IY5 B;  1HTT A;  3E9H A;  3UH0 A;  4ZIB A;  1E24 A;  1NJ5 A;  2I4N A;  4YDQ A;  1IL2 A;  1H4V B;  4G85 A;  3RIR A;  3P8T A;  3M4P A;  2QHV A;  1EQR A;  4K86 A;  3G1Z A;  4P73 A;  2I4M A;  4YRC A;  2QHU A;  1BBU A;  3HRK A;  4HA8 A;  3A7R A;  4OLF A;  4ZTU B;  3MF2 A;  4NCX A;  3HFZ A;  4YRQ A;  1BIA A;  2A8E A;  1Z7M A;  4CH3 A;  5C51 B;  1C0A A;  3A32 A;  3FJP A;  3HXU A;  4P3O A;  1USY C;  1NJ8 A;  2CIM A;  1ADJ A;  3DSQ A;  2DQ0 A;  2QHT A;  1H4T A;  2ZZG A;  3NEN A;  3A5Z A;  2ZXF A;  4UPA A;  1LYL A;  2ZIN A;  2ZZE A;  4E51 A;  3RKY A;  4HWP A;  4RDX A;  3QTC A;  4YRM A;  2E10 A;  1GGM A;  4J15 A;  1EOV A;  4P72 A;  4H2X B;  4BW9 A;  4H02 A;  1ATI A;  2E41 A;  1ADY A;  1B70 B;  2ALY A;  3P8Y A;  1W66 A;  5K1P A;  1NJ6 A;  3RKX A;  2C8M A;  1E1O A;  2E64 A;  4TQD A;  4H2Y A;  1X55 A;  2CGH A;  2CJB A;  2Q7G A;  1HXD A;  3PCO B;  3TEH B;  4YRI A;  4YRR A;  1WQW A;  3QNE A;  3CMQ A;  2XTI A;  1WYD A;  1ASZ A;  1BBW A;  1JJC B;  2DJZ A;  3A5Y A;  4LVM A;  4TVW A;  4HWS A;  2ZTG A;  3EFR A;  2DEQ A;  1YFS A;  4XTV A;  1E22 A;  4K87 A;  4YRF A;  3L1A A;  4RQF A;  1SES A;  2ZCE A;  2EAY A;  4P71 A;  1YFT A;  2DZC A;  2CJA A;  2C7I A;  3HFZ B;  4KR3 A;  2I4O A;  2DXU A;  3RGL A;  4K88 A;  4XEO A;  1J5W A;  1NJ2 A;  4DPG A;  3A74 A;  1WNL A;  3UFG A;  3M4Q A;  3VBB A;  1EVL A;  2DKG A;  2EJF A;  1E1T A;  4P74 A;  4RMF A;  3RKW A;  1SRY A;  3MQZ A;  3ERR A;  3VQX A;  4UP7 A;  3HXW A;  4G84 A;  4CH6 A;  1FYF A;  2CJ9 A;  3LSQ A;  1ASY A;  1QF6 A;  1HC7 A;  3E9I A;  4HVC A;  2DTI A;  3V7S A;  4LVK A;  2PME A;  2RHS A;  4UP9 A;  1EVK A;  2EL9 A;  3QO7 A;  4YRP A;  3EFS A;  2AMC A;  4Q6G A;  3QO8 A;  2ZZF A;  4AH6 A;  2XGT A;  1EIY A;  3I7F A;  1X54 A;  2ALY B;  4H2U A;  4TTV A;  5K1X A;  1USY A;  11AS A;  3L4G A;  1L0W A;  4RQE A;  3VQW A;  3WQZ A;  3BJU A;  1RIQ A;  3L2Z A;  3OD1 A;  2ZT5 A;  3HY1 A;  4HWR A;  2EJ9 A;  1B7Y A;  2Q5I A;  1PYS A;  4HT4 A;  2ZIM A;  2AKW A;  1G5I A;  4HWT A;  2E1H A;  4XTY A;  1WPY A;  3HTZ A;  3PZC A;  4TQF A;  4KR2 A;  2HNI A;  2ZR3 A;  2DVE A;  4YRN A;  2DXT A;  2ZT7 A;  3RAC A;  1G5H A;  2ODR C;  2QHS A;  3HXZ A;  4TVY A;  3V8K A;  4TVA A;  3KFU A;  4XTX A;  2PMF A;  3NEL A;  4H2W A;  1VQZ A;  2P0L A;  1X56 A;  3V7R A;  4P75 C;  1KMN A;  2DDZ A;  1EFW A;  3P8V A;  4L87 A;  4DQ2 A;  4LNS A;  4H2V A;  3A31 A;  3NEM A;  3HXY A;  4YRK A;  2I4L A;  1B76 A;  2DTH A;  2P5I A;  4YRT A;  4H2S A;  4CS2 A;  2ZNJ A;  2ZT8 A;  3HY0 A;  4XU0 A;  3LC0 A;  1X2G A;  1Z7N A;  3IG2 A;  4XEM A;  5ELN A;  4YRG A;  4CH4 A;  4PG3 A;  4XU3 A;  2DTO A;  2RHS B;  4YCU A;  4XU1 A;  1YB3 A;  2ZNI A;  1KMM A;  2AMC B;  3RL6 A;  4P73 C;  4ZTZ B;  1EIY B;  2ARU A;  1BIB A;  4EO4 A;  5ELO A;  5HGQ A;  3L4G B;  4CS3 A;  3REX A;  2FYK A;  1H4Q A;  4O2D A;  3HXV A;  4LVJ A;  4X5O A;  1B7Y B;  5E3I A;  3QO5 A;  4WJ3 M;  2RHQ A;  1N9W A;  5KNN A;  4XU2 A;  1PYS B;  1NYR A;  4H2T A;  1NYQ A;  4YRE A;  4LVI A;  2ODR D;  2ZT6 A;  2ZIO A;  5C53 B;  2AKW B;  2IY5 A;  3V7C A;  2ARS A;  3RF1 A;  4EX5 A;  3TEG A;  4XTU A;  2J3L A;  1H4S A;  1X01 A;  3VQV A;  4LVL A;  4XTW A;  4YP0 A;  3W3S A;  4TWA A;  1X2H A;  3RUX A;  4CS4 A;  3IKL A;  4P3P A;  3A7U A;  4P72 C;  4TVA B;  1NJ1 A;  1QE0 A;  2E5A A;  1B8A A;  4WF2 A;  3REU A;  2ZGW A;  2EJG A;  2Q5H A;  4BWA A;  4P3N A;  2EWN A;  2NS6 A;  2ZR2 A;  1G51 A;  3R07 A;  3MEY A;  1KOG A;  2G4C A;  4KQE A;  3MF1 A;  3UGQ A;  3NET A;  2DZ9 A;  2DU7 A;  1NNH A;  3A7A A;  4WI1 A;  1WQ7 A;  2DQ3 A;  4YRL A;  2E65 A; 
#chains in the Genus database with same CATH homology
 1WLE A;  3TUP A;  2E3C A;  4CH5 A;  3IKM B;  2Q7E A;  4YYE A;  4PHC A;  4H2X A;  1WU7 A;  4OP0 A;  4YRJ A;  4P71 C;  4XTZ A;  3V8J A;  3HRI A;  3VQY A;  2DU5 A;  1B70 A;  4P75 A;  4YRO A;  2J3M A;  3HFV A;  4UP8 A;  3LSS A;  1SER A;  4Q15 A;  3UGT A;  3V8L A;  3HXX A;  4YCV A;  12AS A;  3PCO A;  1YGB A;  3TEH A;  4YCW A;  2RHQ B;  5C52 B;  4YRS A;  4YPF A;  5F5W A;  2Q7H A;  3BFM A;  3IAL A;  4WJ4 A;  3ICA A;  1SET A;  4P74 C;  1YFR A;  4HWO A;  2ART A;  1JJC A;  2IY5 B;  1HTT A;  3E9H A;  3UH0 A;  4ZIB A;  1E24 A;  1NJ5 A;  2I4N A;  4YDQ A;  1IL2 A;  1H4V B;  4G85 A;  3RIR A;  3P8T A;  3M4P A;  2QHV A;  1EQR A;  4K86 A;  3G1Z A;  4P73 A;  2I4M A;  4YRC A;  2QHU A;  1BBU A;  3HRK A;  4HA8 A;  3A7R A;  4OLF A;  4ZTU B;  3MF2 A;  4NCX A;  3HFZ A;  4YRQ A;  1BIA A;  2A8E A;  1Z7M A;  4CH3 A;  5C51 B;  1C0A A;  3A32 A;  3FJP A;  3HXU A;  4P3O A;  1USY C;  1NJ8 A;  2CIM A;  1ADJ A;  3DSQ A;  2DQ0 A;  2QHT A;  1H4T A;  2ZZG A;  3NEN A;  3A5Z A;  2ZXF A;  4UPA A;  1LYL A;  2ZIN A;  2ZZE A;  4E51 A;  3RKY A;  4HWP A;  4RDX A;  3QTC A;  4YRM A;  2E10 A;  1GGM A;  4J15 A;  1EOV A;  4P72 A;  4H2X B;  4BW9 A;  4H02 A;  1ATI A;  2E41 A;  1ADY A;  1B70 B;  2ALY A;  3P8Y A;  1W66 A;  5K1P A;  1NJ6 A;  3RKX A;  2C8M A;  1E1O A;  2E64 A;  4TQD A;  4H2Y A;  1X55 A;  2CGH A;  2CJB A;  2Q7G A;  1HXD A;  3PCO B;  3TEH B;  4YRI A;  4YRR A;  1WQW A;  3QNE A;  3CMQ A;  2XTI A;  1WYD A;  1ASZ A;  1BBW A;  1JJC B;  2DJZ A;  3A5Y A;  4LVM A;  4TVW A;  4HWS A;  2ZTG A;  3EFR A;  2DEQ A;  1YFS A;  4XTV A;  1E22 A;  4K87 A;  4YRF A;  3L1A A;  4RQF A;  1SES A;  2ZCE A;  2EAY A;  4P71 A;  1YFT A;  2DZC A;  2CJA A;  2C7I A;  3HFZ B;  4KR3 A;  2I4O A;  2DXU A;  3RGL A;  4K88 A;  4XEO A;  1J5W A;  1NJ2 A;  4DPG A;  3A74 A;  1WNL A;  3UFG A;  3M4Q A;  3VBB A;  1EVL A;  2DKG A;  2EJF A;  1E1T A;  4P74 A;  4RMF A;  3RKW A;  1SRY A;  3MQZ A;  3ERR A;  3VQX A;  4UP7 A;  3HXW A;  4G84 A;  4CH6 A;  1FYF A;  2CJ9 A;  3LSQ A;  1ASY A;  1QF6 A;  1HC7 A;  3E9I A;  4HVC A;  2DTI A;  3V7S A;  4LVK A;  2PME A;  2RHS A;  4UP9 A;  1EVK A;  2EL9 A;  3QO7 A;  4YRP A;  3EFS A;  2AMC A;  4Q6G A;  3QO8 A;  2ZZF A;  4AH6 A;  2XGT A;  1EIY A;  3I7F A;  1X54 A;  2ALY B;  4H2U A;  4TTV A;  5K1X A;  1USY A;  11AS A;  3L4G A;  1L0W A;  4RQE A;  3VQW A;  3WQZ A;  3BJU A;  1RIQ A;  3L2Z A;  3OD1 A;  2ZT5 A;  3HY1 A;  4HWR A;  2EJ9 A;  1B7Y A;  2Q5I A;  1PYS A;  4HT4 A;  2ZIM A;  2AKW A;  1G5I A;  4HWT A;  2E1H A;  4XTY A;  1WPY A;  3HTZ A;  3PZC A;  4TQF A;  4KR2 A;  2HNI A;  2ZR3 A;  2DVE A;  4YRN A;  2DXT A;  2ZT7 A;  3RAC A;  1G5H A;  2ODR C;  2QHS A;  3HXZ A;  4TVY A;  3V8K A;  4TVA A;  3KFU A;  4XTX A;  2PMF A;  3NEL A;  4H2W A;  1VQZ A;  2P0L A;  1X56 A;  3V7R A;  4P75 C;  1KMN A;  2DDZ A;  1EFW A;  3P8V A;  4L87 A;  4DQ2 A;  4LNS A;  4H2V A;  3A31 A;  3NEM A;  3HXY A;  4YRK A;  2I4L A;  1B76 A;  2DTH A;  2P5I A;  4YRT A;  4H2S A;  4CS2 A;  2ZNJ A;  2ZT8 A;  3HY0 A;  4XU0 A;  3LC0 A;  1X2G A;  1Z7N A;  3IG2 A;  4XEM A;  5ELN A;  4YRG A;  4CH4 A;  4PG3 A;  4XU3 A;  2DTO A;  2RHS B;  4YCU A;  4XU1 A;  1YB3 A;  2ZNI A;  1KMM A;  2AMC B;  3RL6 A;  4P73 C;  4ZTZ B;  1EIY B;  2ARU A;  1BIB A;  4EO4 A;  5ELO A;  5HGQ A;  3L4G B;  4CS3 A;  3REX A;  2FYK A;  1H4Q A;  4O2D A;  3HXV A;  4LVJ A;  4X5O A;  1B7Y B;  5E3I A;  3QO5 A;  4WJ3 M;  2RHQ A;  1N9W A;  5KNN A;  4XU2 A;  1PYS B;  1NYR A;  4H2T A;  1NYQ A;  4YRE A;  4LVI A;  2ODR D;  2ZT6 A;  2ZIO A;  5C53 B;  2AKW B;  2IY5 A;  3V7C A;  2ARS A;  3RF1 A;  4EX5 A;  3TEG A;  4XTU A;  2J3L A;  1H4S A;  1X01 A;  3VQV A;  4LVL A;  4XTW A;  4YP0 A;  3W3S A;  4TWA A;  1X2H A;  3RUX A;  4CS4 A;  3IKL A;  4P3P A;  3A7U A;  4P72 C;  4TVA B;  1NJ1 A;  1QE0 A;  2E5A A;  1B8A A;  4WF2 A;  3REU A;  2ZGW A;  2EJG A;  2Q5H A;  4BWA A;  4P3N A;  2EWN A;  2NS6 A;  2ZR2 A;  1G51 A;  3R07 A;  3MEY A;  1KOG A;  2G4C A;  4KQE A;  3MF1 A;  3UGQ A;  3NET A;  2DZ9 A;  2DU7 A;  1NNH A;  3A7A A;  4WI1 A;  1WQ7 A;  2DQ3 A;  4YRL A;  2E65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...