4P78A

Hica3 and hicb3 toxin-antitoxin complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
MIYPIFIFKTVEGFDGYFPDIDGCFFAGNTFADISKNAEEAFAVHIEALMNEGFPLPSPPKDPHRYIDDPRLKEEGGILGFVEIDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Analysis of HicA3-HicB3, a Novel Toxin-Antitoxin System of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Toxin
molecule keywords HicB3 antitoxin
total genus 17
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4p78A00
3KWRA 4P7DA 2DSYA 2YZTA 4P78A
chains in the Genus database with same CATH superfamily
3M99B 2VE7C 5LMUE 1KJKA 2N3GA 3HQ1A 2CTDA 5IWAE 2RSIA 2VQFE 2YU5A 4WPYA 5A6AA 2MKNA 2FTXB 4R8OA 2GPIA 3BF2A 4N4RB 2L3CA 2EPKX 1HNZE 2EM9A 1NEIA 1B69A 1YUJA 1T38A 1X6EA 2ELZA 1UILA 1GQEA 3MSWA 1I94E 2JY9A 5A6KA 2L3JA 1JK1A 1TF6A 3AUZA 2EN2A 2RQLA 2YTEA 2EOMA 2M9AA 2EPNA 5A69A 2EOZA 1WRJA 1XNQE 1TF3A 2K4VA 2RTXA 4K0KE 2YSOA 2EMYA 3DF6A 2LUPB 2V8QB 5A2QC 2RS6A 2EMCA 2YTPA 2EOQA 2YTJA 4ZYHA 4R2QA 4IS1C 5DNYA 5KL3A 2B9DA 4Q28A 1GZ6A 1T4OA 1YSAC 1N36E 2KONA 1XNRE 4B3TE 4DV1E 2JVAA 2JPAA 3KWRA 2DSYA 2VRDA 4DKKA 2DLKA 2DMIA 2EMHA 4YHHE 4DV6E 4R2SA 1DGCA 2R76A 4R03A 3C6MA 1MGTA 2B7TA 4JI0E 3HPSA 1WJPA 5A6JA 2EM3A 3F6HA 2EMFA 5KL5A 2YTQA 2EPLX 2ENCA 3HXLA 2LO3A 1O0WA 2WBTA 2EPUA 2EZ6A 2EL4A 3MHSC 2EOOA 4LF5E 2V87A 1A1LA 2NUEA 1HNXE 2Q8UA 3J7AG 2EP3A 1ZR9A 2EMAA 4WX9A 4HEIA 1IBME 4BBYA 4O4KA 2D9HA 3H09A 3HPZA 2FGGA 2YTFA 3KZZA 4NXME 2JOBA 4B3ME 2UXCE 1WHNA 2V86A 4WYQB 4BMJA 1AAYA 3F6GA 2HC5A 2L2NA 2UUBE 4FK5C 4GEQB 4M30A 3J81C 3BIDA 4X9JA 4M2ZA 3HTXA 1YYWA 2EPZA 2HJJA 2M4IA 3ADLA 3VYXA 2EN6A 4B3RE 4ZYDA 2EM8A 2YTGA 2MC5A 2UUAE 1UN6B 4LF6E 1A1IA 2JP9A 1PJQA 1A1FA 1EH6A 1JK2A 2EPAA 1KYQA 2YU8A 2WCC3 2WBUA 4WXDA 2HHHE 3BBGA 4WFTA 1A1GA 4KZSA 4GKKE 2J7JA 1FJGE 2F4VE 4X64E 2UUCE 5IV8B 4DUYE 3LLHA 4DR7E 2K7IA 4HTGA 2YTOA 2EM4A 4KWYA 1SR9A 1BBGA 4J8ZA 4I8OA 4JI7E 2EM2A 5A6BA 4L8NA 2EOIA 3BGHA 2NA2A 4DV0E 1ZU1A 1EH8A 1BBOA 1UBDC 2MDGA 2YT4A 2EPOA 5ADZA 4JI1E 3OMLA 4NZVA 3L00A 3EPKA 4JI5E 2DLQA 2NABA 5AE2A 4R2CA 5LLQA 3DJWA 2WBSA 2EPMX 1N32E 1HNWE 2EOHA 1YYKA 1STUA 4DV3E 1YYOA 1T39A 2ADRA 2YRMA 2EMZA 1DQ3A 2EN7A 2DMYA 4X66E 2M7QA 2I9IA 2JXPA 3IWCA 1L4SA 1DI2A 2L8TA 3T1HE 4F6NA 1SFEA 2LJUA 2YWQA 2ENAA 3EPHA 3LMLA 1AH5A 2L33A 2EORA 1G2DC 4BHCA 2ODRC 4DV4E 4LTYA 3THOB 3VK6A 4AQYE 2BBGA 2EOJA 2YRHA 3C4TA 1GTKA 3C4BA 2LE2A 2EPXA 1EKZA 1PJTA 1A1KA 4DMIA 4BC7A 4KHPE 4WSPA 2EOXA 3IWBA 4OOGC 4DV2E 2EN8A 4O24A 4ZYEA 4X62E 1J5EE 4M0VA 5AASA 2L2KB 3VHTB 1X5WA 2V83A 4BC9A 2LT7A 2FV4B 3TQMA 5CFFE 3JAMC 1WXRA 5KL6A 1A1HA 5LMNE 2CT1A 2LCEA 4WSGA 4MLQA 4P7DA 2I13A 4LU9A 3FIGA 1X3CA 4O5GA 4Q35B 1QU6A 2WZOA 1G2FC 4DV7E 4F9CB 4F9AB 4LFBE 5T6JA 1X48A 1RMDA 3UK3C 3AV0A 2F8BA 2ELYA 2EE8A 2JWOA 2EMGA 2YTDA 3C6KA 2EMLA 4TUGA 4JYAE 3ADIA 3VYYA 5IT9C 4BS9A 2JR1A 2BB8A 2GHFA 4DR3E 2YSPA 4P78A 4LFCE 1F2IG 3EQ1A 2LTRA 1FKAE 2EQ1A 4DR2E 4R2RA 2YZTA 2LRSA 2LTSA 1X47A 4R2DA 1X6FA 2RS7A 5AE1A 2MC6A 2N3HA 4X8WA 3ECRA 2DIXA 2B3TB 2ODRD 2UXDE 2EL6A 4DR1E 1ZBTA 2RSMA 4F9BB 4JI2E 1IQSA 2G7HA 4RH8A 4R2EA 4LF8E 1XMOE 2JYAA 4LF9E 4DR6E 2DB2A 4GKJE 4BCAA 2LV2A 3EPLA 2LBSB 3ADGA 2R1FA 4R2AA 2JOXA 3J80C 2EJ4A 1A1JA 2YTIA 2L2MA 1T4NA 2EL5A 1MEYC 2DRPA 1IBLE 4YY3E 4BHBA 3MHHC 2ENHA 2EMWA 3ZOQB 2V88A 1TN9A 2NUGA 2CSHA 2EM6A 2A25A 4F6MA 2LVHA 2EN4A 2GLIA 4DR5E 4TUIA 5AC5A 2V85A 1XMQE 2MDRA 5KL4A 4DR4E 1PJSA 2B7VA 4IJDA 2EM0A 4MLVA 4JI8E 5FLXC 4B3SE 4OX9E 2LUQA 4R2PA 2UXBE 2EN1A 2EOSA 1YZ9A 2VF1A 1HR0E 5LL6R 2EOEA 5F3WA 4LFAE 2LJHA 4JV5E 2EOYA 2KHXA 2HGHA 2EQ3A 2YTNA 4LF4E 3J7Yp 2E5LE 1RQ0A 3QG5C 5BR8E 2KOUA 1X49A 4JI4E 1QNTA 1IQOA 5AC4A 4DUZE 4JI3E 5KL2A 2EOFA 3RMPA 2E1MA 1RC7A 1IMUA 3IWDA 1UHZA 1YFHA 1YPNA 3KZYA 4X65E 2EPRA 2EN3A 2PRTA 4DV5E 1ZAAC 1YUIA 2IHR1 4RHBB 3JTZA 1P47A 2H36X 2M1SA 2LMZA 1PKPA 1EH7A 2EM5A 4LF7E 1NCSA 2CPNA 1LLMC 1ZBQA 2EMIA 2EMBA 5A6BD 1N3GA 2DGCA 3OTOE 2L6MA 5IXMB 2UU9E 2EM7A 4F54A 2N8XA 2E72A 2V89A 1T4LB 2EPPA 3K6QA 1J26A 2NUFA 1N34E 2EMXA 1PDAA 2ZM6E 4M9VC 1Z1BA 2MKDA 4ZYGA 2YRKA 4NHRA 2VQEE 4JI6E 1BB8A 4F2JC 5AE3A 2RPCA 4L5NC 4GZNC 1WHQA 3ADJA 2EWLA 1N33E 3THNA 2L92A 2EQ0A 4NXNE 3P1XA 4O43A 2EPCA 1IBKE 3EPJA 5TSEA 3JU0A 1X6HA 4WXCA 2YPNA 2EMKA 3T1YE 5KL7A
chains in the Genus database with same CATH topology
3IWBA 4OOGC 4DV2E 2MC5A 2UUAE 2VE7C 2V85A 5LMUE 1XMQE 2MDRA 4DR4E 2N3GA 3HQ1A 4X62E 2B7VA 5IWAE 1J5EE 4LF6E 4JI8E 4M0VA 2VQFE 5AASA 2L2KB 5FLXC 2V83A 4WPYA 4BC9A 4B3SE 2FTXB 4R8OA 4OX9E 2FV4B 2LUQA 2L3CA 2UXBE 5CFFE 3JAMC 1WXRA 5LMNE 1HNZE 1YZ9A 2HHHE 2VF1A 4WFTA 1HR0E 4KZSA 5LL6R 4P7DA 4LU9A 5F3WA 1UILA 3FIGA 2LJHA 1GQEA 4LFAE 4GKKE 3MSWA 2KHXA 1I94E 1FJGE 2JY9A 2L3JA 2F4VE 4LF4E 3J7Yp 2E5LE 1RQ0A 5BR8E 3AUZA 1QU6A 2KOUA 1X49A 2WZOA 4X64E 2UUCE 4JI4E 4DV7E 4F9CB 4DUYE 4F9AB 3LLHA 4LFBE 4DR7E 5T6JA 1X48A 4DUZE 4JI3E 1XNQE 3RMPA 3AV0A 2RTXA 2E1MA 2F8BA 2K4VA 1RC7A 4K0KE 2JWOA 2LUPB 3DF6A 3IWDA 2V8QB 1UHZA 5A2QC 4B3RE 2RS6A 4TUGA 4JYAE 1SR9A 4J8ZA 4JI7E 4I8OA 5DNYA 3ADIA 4L8NA 4X65E 2B9DA 3VYYA 4Q28A 5IT9C 4BS9A 1GZ6A 4DV5E 1T4OA 2JR1A 1N36E 2KONA 1XNRE 2NA2A 2IHR1 4DV0E 4P78A 4DR3E 4B3TE 4DV1E 4LFCE 2LTRA 2JVAA 1FKAE 4DR2E 3KWRA 2DSYA 2YT4A 4DKKA 3JTZA 2YZTA 5ADZA 4YHHE 4DV6E 2LRSA 4JI1E 3OMLA 2H36X 1X47A 2LTSA 2M1SA 4R03A 2LMZA 1PKPA 2RS7A 4JI5E 2B7TA 4JI0E 4LF7E 5AE2A 3VYXA 3HPSA 2CPNA 5AE1A 2MC6A 1ZBQA 2N3HA 3DJWA 4X8WA 3F6HA 2DIXA 2B3TB 2ODRD 2UXDE 1N32E 1HNWE 1YYKA 4DR1E 1STUA 3OTOE 1ZBTA 2L6MA 2RSMA 4F9BB 4DV3E 1YYOA 4JI2E 2G7HA 3HXLA 4JV5E 1DQ3A 2UU9E 1O0WA 4F54A 4LF8E 2DMYA 4X66E 1XMOE 2EZ6A 2V89A 1T4LB 2M7QA 3K6QA 4LF9E 4DR6E 2DB2A 1J26A 4GKJE 3IWCA 2NUFA 1N34E 1DI2A 2L8TA 2ZM6E 4LF5E 2V87A 4BCAA 3T1HE 2NUEA 1HNXE 2LBSB 3J7AG 3ADGA 1IBME 2VQEE 2JOXA 4BBYA 3J80C 3LMLA 4JI6E 2L33A 3H09A 3HPZA 5AE3A 2FGGA 2L2MA 4L5NC 2ODRC 1WHQA 4NXME 2JOBA 4DV4E 1T4NA 3ADJA 4B3ME 2EWLA 4LTYA 3VK6A 4AQYE 1WHNA 1IBLE 2V86A 4WYQB 4BMJA 4YY3E 3F6GA 2L2NA 1N33E 3C4TA 2UUBE 2L92A 3C4BA 2LE2A 4NXNE 4GEQB 4M30A 3ZOQB 2V88A 3J81C 4M2ZA 3HTXA 2NUGA 1YYWA 3P1XA 1IBKE 1EKZA 2M4IA 3JU0A 4DMIA 4BC7A 3ADLA 4WSPA 4KHPE 4DR5E 3T1YE 4TUIA 2UXCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWR A;  4P7D A;  2DSY A;  2YZT A;  4P78 A; 
#chains in the Genus database with same CATH topology
 3M99 B;  2VE7 C;  5LMU E;  1KJK A;  2N3G A;  3HQ1 A;  2CTD A;  5IWA E;  2RSI A;  2VQF E;  2YU5 A;  4WPY A;  5A6A A;  2MKN A;  2FTX B;  4R8O A;  2GPI A;  3BF2 A;  4N4R B;  2L3C A;  2EPK X;  1HNZ E;  2EM9 A;  1NEI A;  1B69 A;  1YUJ A;  1T38 A;  1X6E A;  2ELZ A;  1UIL A;  1GQE A;  3MSW A;  1I94 E;  2JY9 A;  5A6K A;  2L3J A;  1JK1 A;  1TF6 A;  3AUZ A;  2EN2 A;  2RQL A;  2YTE A;  2EOM A;  2M9A A;  2EPN A;  5A69 A;  2EOZ A;  1WRJ A;  1XNQ E;  1TF3 A;  2K4V A;  2RTX A;  4K0K E;  2YSO A;  2EMY A;  3DF6 A;  2LUP B;  2V8Q B;  5A2Q C;  2RS6 A;  2EMC A;  2YTP A;  2EOQ A;  2YTJ A;  4ZYH A;  4R2Q A;  4IS1 C;  5DNY A;  5KL3 A;  2B9D A;  4Q28 A;  1GZ6 A;  1T4O A;  1YSA C;  1N36 E;  2KON A;  1XNR E;  4B3T E;  4DV1 E;  2JVA A;  2JPA A;  3KWR A;  2DSY A;  2VRD A;  4DKK A;  2DLK A;  2DMI A;  2EMH A;  4YHH E;  4DV6 E;  4R2S A;  1DGC A;  2R76 A;  4R03 A;  3C6M A;  1MGT A;  2B7T A;  4JI0 E;  3HPS A;  1WJP A;  5A6J A;  2EM3 A;  3F6H A;  2EMF A;  5KL5 A;  2YTQ A;  2EPL X;  2ENC A;  3HXL A;  2LO3 A;  1O0W A;  2WBT A;  2EPU A;  2EZ6 A;  2EL4 A;  3MHS C;  2EOO A;  4LF5 E;  2V87 A;  1A1L A;  2NUE A;  1HNX E;  2Q8U A;  3J7A G;  2EP3 A;  1ZR9 A;  2EMA A;  4WX9 A;  4HEI A;  1IBM E;  4BBY A;  4O4K A;  2D9H A;  3H09 A;  3HPZ A;  2FGG A;  2YTF A;  3KZZ A;  4NXM E;  2JOB A;  4B3M E;  2UXC E;  1WHN A;  2V86 A;  4WYQ B;  4BMJ A;  1AAY A;  3F6G A;  2HC5 A;  2L2N A;  2UUB E;  4FK5 C;  4GEQ B;  4M30 A;  3J81 C;  3BID A;  4X9J A;  4M2Z A;  3HTX A;  1YYW A;  2EPZ A;  2HJJ A;  2M4I A;  3ADL A;  3VYX A;  2EN6 A;  4B3R E;  4ZYD A;  2EM8 A;  2YTG A;  2MC5 A;  2UUA E;  1UN6 B;  4LF6 E;  1A1I A;  2JP9 A;  1PJQ A;  1A1F A;  1EH6 A;  1JK2 A;  2EPA A;  1KYQ A;  2YU8 A;  2WCC 3;  2WBU A;  4WXD A;  2HHH E;  3BBG A;  4WFT A;  1A1G A;  4KZS A;  4GKK E;  2J7J A;  1FJG E;  2F4V E;  4X64 E;  2UUC E;  5IV8 B;  4DUY E;  3LLH A;  4DR7 E;  2K7I A;  4HTG A;  2YTO A;  2EM4 A;  4KWY A;  1SR9 A;  1BBG A;  4J8Z A;  4I8O A;  4JI7 E;  2EM2 A;  5A6B A;  4L8N A;  2EOI A;  3BGH A;  2NA2 A;  4DV0 E;  1ZU1 A;  1EH8 A;  1BBO A;  1UBD C;  2MDG A;  2YT4 A;  2EPO A;  5ADZ A;  4JI1 E;  3OML A;  4NZV A;  3L00 A;  3EPK A;  4JI5 E;  2DLQ A;  2NAB A;  5AE2 A;  4R2C A;  5LLQ A;  3DJW A;  2WBS A;  2EPM X;  1N32 E;  1HNW E;  2EOH A;  1YYK A;  1STU A;  4DV3 E;  1YYO A;  1T39 A;  2ADR A;  2YRM A;  2EMZ A;  1DQ3 A;  2EN7 A;  2DMY A;  4X66 E;  2M7Q A;  2I9I A;  2JXP A;  3IWC A;  1L4S A;  1DI2 A;  2L8T A;  3T1H E;  4F6N A;  1SFE A;  2LJU A;  2YWQ A;  2ENA A;  3EPH A;  3LML A;  1AH5 A;  2L33 A;  2EOR A;  1G2D C;  4BHC A;  2ODR C;  4DV4 E;  4LTY A;  3THO B;  3VK6 A;  4AQY E;  2BBG A;  2EOJ A;  2YRH A;  3C4T A;  1GTK A;  3C4B A;  2LE2 A;  2EPX A;  1EKZ A;  1PJT A;  1A1K A;  4DMI A;  4BC7 A;  4KHP E;  4WSP A;  2EOX A;  3IWB A;  4OOG C;  4DV2 E;  2EN8 A;  4O24 A;  4ZYE A;  4X62 E;  1J5E E;  4M0V A;  5AAS A;  2L2K B;  3VHT B;  1X5W A;  2V83 A;  4BC9 A;  2LT7 A;  2FV4 B;  3TQM A;  5CFF E;  3JAM C;  1WXR A;  5KL6 A;  1A1H A;  5LMN E;  2CT1 A;  2LCE A;  4WSG A;  4MLQ A;  4P7D A;  2I13 A;  4LU9 A;  3FIG A;  1X3C A;  4O5G A;  4Q35 B;  1QU6 A;  2WZO A;  1G2F C;  4DV7 E;  4F9C B;  4F9A B;  4LFB E;  5T6J A;  1X48 A;  1RMD A;  3UK3 C;  3AV0 A;  2F8B A;  2ELY A;  2EE8 A;  2JWO A;  2EMG A;  2YTD A;  3C6K A;  2EML A;  4TUG A;  4JYA E;  3ADI A;  3VYY A;  5IT9 C;  4BS9 A;  2JR1 A;  2BB8 A;  2GHF A;  4DR3 E;  2YSP A;  4P78 A;  4LFC E;  1F2I G;  3EQ1 A;  2LTR A;  1FKA E;  2EQ1 A;  4DR2 E;  4R2R A;  2YZT A;  2LRS A;  2LTS A;  1X47 A;  4R2D A;  1X6F A;  2RS7 A;  5AE1 A;  2MC6 A;  2N3H A;  4X8W A;  3ECR A;  2DIX A;  2B3T B;  2ODR D;  2UXD E;  2EL6 A;  4DR1 E;  1ZBT A;  2RSM A;  4F9B B;  4JI2 E;  1IQS A;  2G7H A;  4RH8 A;  4R2E A;  4LF8 E;  1XMO E;  2JYA A;  4LF9 E;  4DR6 E;  2DB2 A;  4GKJ E;  4BCA A;  2LV2 A;  3EPL A;  2LBS B;  3ADG A;  2R1F A;  4R2A A;  2JOX A;  3J80 C;  2EJ4 A;  1A1J A;  2YTI A;  2L2M A;  1T4N A;  2EL5 A;  1MEY C;  2DRP A;  1IBL E;  4YY3 E;  4BHB A;  3MHH C;  2ENH A;  2EMW A;  3ZOQ B;  2V88 A;  1TN9 A;  2NUG A;  2CSH A;  2EM6 A;  2A25 A;  4F6M A;  2LVH A;  2EN4 A;  2GLI A;  4DR5 E;  4TUI A;  5AC5 A;  2V85 A;  1XMQ E;  2MDR A;  5KL4 A;  4DR4 E;  1PJS A;  2B7V A;  4IJD A;  2EM0 A;  4MLV A;  4JI8 E;  5FLX C;  4B3S E;  4OX9 E;  2LUQ A;  4R2P A;  2UXB E;  2EN1 A;  2EOS A;  1YZ9 A;  2VF1 A;  1HR0 E;  5LL6 R;  2EOE A;  5F3W A;  4LFA E;  2LJH A;  4JV5 E;  2EOY A;  2KHX A;  2HGH A;  2EQ3 A;  2YTN A;  4LF4 E;  3J7Y p;  2E5L E;  1RQ0 A;  3QG5 C;  5BR8 E;  2KOU A;  1X49 A;  4JI4 E;  1QNT A;  1IQO A;  5AC4 A;  4DUZ E;  4JI3 E;  5KL2 A;  2EOF A;  3RMP A;  2E1M A;  1RC7 A;  1IMU A;  3IWD A;  1UHZ A;  1YFH A;  1YPN A;  3KZY A;  4X65 E;  2EPR A;  2EN3 A;  2PRT A;  4DV5 E;  1ZAA C;  1YUI A;  2IHR 1;  4RHB B;  3JTZ A;  1P47 A;  2H36 X;  2M1S A;  2LMZ A;  1PKP A;  1EH7 A;  2EM5 A;  4LF7 E;  1NCS A;  2CPN A;  1LLM C;  1ZBQ A;  2EMI A;  2EMB A;  5A6B D;  1N3G A;  2DGC A;  3OTO E;  2L6M A;  5IXM B;  2UU9 E;  2EM7 A;  4F54 A;  2N8X A;  2E72 A;  2V89 A;  1T4L B;  2EPP A;  3K6Q A;  1J26 A;  2NUF A;  1N34 E;  2EMX A;  1PDA A;  2ZM6 E;  4M9V C;  1Z1B A;  2MKD A;  4ZYG A;  2YRK A;  4NHR A;  2VQE E;  4JI6 E;  1BB8 A;  4F2J C;  5AE3 A;  2RPC A;  4L5N C;  4GZN C;  1WHQ A;  3ADJ A;  2EWL A;  1N33 E;  3THN A;  2L92 A;  2EQ0 A;  4NXN E;  3P1X A;  4O43 A;  2EPC A;  1IBK E;  3EPJ A;  5TSE A;  3JU0 A;  1X6H A;  4WXC A;  2YPN A;  2EMK A;  3T1Y E;  5KL7 A; 
#chains in the Genus database with same CATH homology
 3IWB A;  4OOG C;  4DV2 E;  2MC5 A;  2UUA E;  2VE7 C;  2V85 A;  5LMU E;  1XMQ E;  2MDR A;  4DR4 E;  2N3G A;  3HQ1 A;  4X62 E;  2B7V A;  5IWA E;  1J5E E;  4LF6 E;  4JI8 E;  4M0V A;  2VQF E;  5AAS A;  2L2K B;  5FLX C;  2V83 A;  4WPY A;  4BC9 A;  4B3S E;  2FTX B;  4R8O A;  4OX9 E;  2FV4 B;  2LUQ A;  2L3C A;  2UXB E;  5CFF E;  3JAM C;  1WXR A;  5LMN E;  1HNZ E;  1YZ9 A;  2HHH E;  2VF1 A;  4WFT A;  1HR0 E;  4KZS A;  5LL6 R;  4P7D A;  4LU9 A;  5F3W A;  1UIL A;  3FIG A;  2LJH A;  1GQE A;  4LFA E;  4GKK E;  3MSW A;  2KHX A;  1I94 E;  1FJG E;  2JY9 A;  2L3J A;  2F4V E;  4LF4 E;  3J7Y p;  2E5L E;  1RQ0 A;  5BR8 E;  3AUZ A;  1QU6 A;  2KOU A;  1X49 A;  2WZO A;  4X64 E;  2UUC E;  4JI4 E;  4DV7 E;  4F9C B;  4DUY E;  4F9A B;  3LLH A;  4LFB E;  4DR7 E;  5T6J A;  1X48 A;  4DUZ E;  4JI3 E;  1XNQ E;  3RMP A;  3AV0 A;  2RTX A;  2E1M A;  2F8B A;  2K4V A;  1RC7 A;  4K0K E;  2JWO A;  2LUP B;  3DF6 A;  3IWD A;  2V8Q B;  1UHZ A;  5A2Q C;  4B3R E;  2RS6 A;  4TUG A;  4JYA E;  1SR9 A;  4J8Z A;  4JI7 E;  4I8O A;  5DNY A;  3ADI A;  4L8N A;  4X65 E;  2B9D A;  3VYY A;  4Q28 A;  5IT9 C;  4BS9 A;  1GZ6 A;  4DV5 E;  1T4O A;  2JR1 A;  1N36 E;  2KON A;  1XNR E;  2NA2 A;  2IHR 1;  4DV0 E;  4P78 A;  4DR3 E;  4B3T E;  4DV1 E;  4LFC E;  2LTR A;  2JVA A;  1FKA E;  4DR2 E;  3KWR A;  2DSY A;  2YT4 A;  4DKK A;  3JTZ A;  2YZT A;  5ADZ A;  4YHH E;  4DV6 E;  2LRS A;  4JI1 E;  3OML A;  2H36 X;  1X47 A;  2LTS A;  2M1S A;  4R03 A;  2LMZ A;  1PKP A;  2RS7 A;  4JI5 E;  2B7T A;  4JI0 E;  4LF7 E;  5AE2 A;  3VYX A;  3HPS A;  2CPN A;  5AE1 A;  2MC6 A;  1ZBQ A;  2N3H A;  3DJW A;  4X8W A;  3F6H A;  2DIX A;  2B3T B;  2ODR D;  2UXD E;  1N32 E;  1HNW E;  1YYK A;  4DR1 E;  1STU A;  3OTO E;  1ZBT A;  2L6M A;  2RSM A;  4F9B B;  4DV3 E;  1YYO A;  4JI2 E;  2G7H A;  3HXL A;  4JV5 E;  1DQ3 A;  2UU9 E;  1O0W A;  4F54 A;  4LF8 E;  2DMY A;  4X66 E;  1XMO E;  2EZ6 A;  2V89 A;  1T4L B;  2M7Q A;  3K6Q A;  4LF9 E;  4DR6 E;  2DB2 A;  1J26 A;  4GKJ E;  3IWC A;  2NUF A;  1N34 E;  1DI2 A;  2L8T A;  2ZM6 E;  4LF5 E;  2V87 A;  4BCA A;  3T1H E;  2NUE A;  1HNX E;  2LBS B;  3J7A G;  3ADG A;  1IBM E;  2VQE E;  2JOX A;  4BBY A;  3J80 C;  3LML A;  4JI6 E;  2L33 A;  3H09 A;  3HPZ A;  5AE3 A;  2FGG A;  2L2M A;  4L5N C;  2ODR C;  1WHQ A;  4NXM E;  2JOB A;  4DV4 E;  1T4N A;  3ADJ A;  4B3M E;  2EWL A;  4LTY A;  3VK6 A;  4AQY E;  1WHN A;  1IBL E;  2V86 A;  4WYQ B;  4BMJ A;  4YY3 E;  3F6G A;  2L2N A;  1N33 E;  3C4T A;  2UUB E;  2L92 A;  3C4B A;  2LE2 A;  4NXN E;  4GEQ B;  4M30 A;  3ZOQ B;  2V88 A;  3J81 C;  4M2Z A;  3HTX A;  2NUG A;  1YYW A;  3P1X A;  1IBK E;  1EKZ A;  2M4I A;  3JU0 A;  4DMI A;  4BC7 A;  3ADL A;  4WSP A;  4KHP E;  4DR5 E;  3T1Y E;  4TUI A;  2UXC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...