4P78A

Hica3 and hicb3 toxin-antitoxin complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
MIYPIFIFKTVEGFDGYFPDIDGCFFAGNTFADISKNAEEAFAVHIEALMNEGFPLPSPPKDPHRYIDDPRLKEEGGILGFVEIDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HicB3 antitoxin
publication title Functional and Structural Analysis of HicA3-HicB3, a Novel Toxin-Antitoxin System of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Toxin
total genus 17
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4p78A00
2YZTA 4P7DA 3KWRA 2DSYA 4P78A
chains in the Genus database with same CATH superfamily
4Q35B 2J7JA 2EPZA 1IQSA 1NEIA 2CPNA 1YZ9A 2Q8UA 5TSEA 2V87A 1PJQA 2EOEA 2VE7C 2EMZA 4IS1C 4BHCA 2MDRA 4MLVA 4R2CA 4R2SA 2CTDA 2L2MA 3MHSC 2DLQA 4X66E 1G2FC 3VYYA 3ZOQB 1A1LA 5KL4A 2IHR1 3P1XA 3C4TA 1X47A 4LFCE 3IWBA 2DGCA 2DRPA 2A25A 2M9AA 2L3JA 5AC5A 1MGTA 1X6FA 2EMGA 2WBSA 2EQ1A 2UXCE 3BF2A 2N8XA 2NUFA 2EN8A 3J7AG 2HC5A 2EPXA 2V83A 4DUZE 1F2IG 2JXPA 1GZ6A 1ZBQA 1IBKE 4LF6E 5AASA 2RS7A 2L8TA 2YRHA 2DLKA 2V86A 2YSPA 1UHZA 4L5NC 2WBUA 3HPSA 2LBSB 1XMOE 1XMQE 5LMUE 1SFEA 4OOGC 2LV2A 3VK6A 1RQ0A 2V85A 2V88A 3DF6A 4JI2E 2EOIA 2EM8A 4HTGA 1L4SA 1A1FA 1KYQA 1IQOA 1T4OA 2GLIA 1DQ3A 4BBYA 4LF5E 3KWRA 2EMIA 2EPOA 4WXDA 1LLMC 2L2KB 5KL7A 2G7HA 2JWOA 4L8NA 4DR6E 2ODRC 5AE2A 1TN9A 4NXNE 3BBGA 1P47A 2EM4A 4M0VA 1HNWE 2EN4A 2R1FA 2HGHA 1IMUA 4LU9A 2DMIA 2YT4A 3HQ1A 2JOBA 1SR9A 3MSWA 5A69A 1QNTA 1ZBTA 2EOXA 2FGGA 2RS6A 2YTEA 5A6BD 5KL6A 2EPMX 5A2QC 4DV5E 4OX9E 2BBGA 3JU0A 2LTRA 4DR7E 2B3TB 2EOYA 2EMWA 4LF4E 1JK2A 2EOMA 4M2ZA 1MEYC 2ADRA 1X48A 3ADLA 2D9HA 2L6MA 4WSGA 2LMZA 1GQEA 2YTGA 1IBLE 3L00A 2EN1A 4JI5E 2EOSA 2EQ3A 2EM6A 4R03A 2EOZA 2RSIA 3J7Yp 2B9DA 3FIGA 2M1SA 1A1JA 2EPRA 5IT9C 1I94E 2LUQA 1FJGE 1YYOA 4F9AB 1J5EE 1G2DC 4F54A 2WZOA 2UXDE 1UN6B 2EN7A 4X9JA 1BBOA 3F6HA 1N3GA 3BIDA 3EPHA 4HEIA 3AUZA 2GPIA 2EN3A 4DV0E 2EMFA 4NHRA 1YUJA 1T4LB 2EQ0A 2M7QA 4F9BB 4JI0E 2EJ4A 2EPLX 2JVAA 3EPJA 1A1KA 2EM7A 2EN6A 2LJHA 5BR8E 4DUYE 3HXLA 4DR3E 4AQYE 4WFTA 4GZNC 3LLHA 4WYQB 1EH8A 2V8QB 4X62E 4JYAE 4LTYA 2EOFA 2EZ6A 3C6MA 2EPUA 4IJDA 1T39A 1WHNA 5A6BA 4DV3E 4R2EA 3EQ1A 5FLXC 3OTOE 1AAYA 4TUIA 3JAMC 4F6NA 1BB8A 4R2PA 3KZYA 2EWLA 4B3TE 4DV1E 2EOHA 3HTXA 1Z1BA 4B3ME 2EMBA 1A1HA 1XNQE 2WBTA 1STUA 2UXBE 2YWQA 3LMLA 4LF7E 3HPZA 2DMYA 5AC4A 3K6QA 4KHPE 2EPPA 2L2NA 2MC6A 1PDAA 2MKDA 2YU5A 1HNXE 4GKJE 2JPAA 2EMYA 2VRDA 1ZU1A 5IV8B 3JTZA 1N33E 4ZYHA 4MLQA 2EM2A 2HJJA 2YTQA 2LT7A 5AE1A 2MKNA 4JI3E 5IXMB 1UILA 2NA2A 5KL2A 5KL3A 2MDGA 2GHFA 1RMDA 2I13A 1WJPA 3ADJA 2YTPA 4RH8A 2EMHA 2EMKA 4R2AA 3IWDA 1EH7A 3VYXA 5CFFE 4RHBB 2N3GA 4DR4E 5IWAE 1X3CA 4JV5E 2EM0A 2JY9A 2KHXA 2EOOA 1A1GA 1N36E 4JI1E 1NCSA 4JI8E 1PKPA 2WCC3 1YYWA 2B7VA 1T4NA 2YTNA 2NABA 4X65E 2ZM6E 3C6KA 3UK3C 3EPKA 2YTDA 4Q28A 3ECRA 2RPCA 2EM9A 2LJUA 2M4IA 2NUEA 2LRSA 4X64E 1HNZE 4BC9A 2F4VE 2V89A 2E72A 1J26A 4DV4E 2KOUA 1AH5A 2LE2A 4WPYA 1GTKA 1RC7A 3J81C 4R2DA 2EMCA 2LUPB 1IBME 5KL5A 2VQFE 5LL6R 1YYKA 4DV2E 1A1IA 2JP9A 2E1MA 2EMLA 2RSMA 4F9CB 4JI6E 3IWCA 2DB2A 4DV7E 1HR0E 2YZTA 1EKZA 2EPKX 4BS9A 4ZYEA 4BCAA 1WHQA 2F8BA 4NXME 3TQMA 2ENCA 4LF9E 1EH6A 2ELYA 4FK5C 4P7DA 3C4BA 4X8WA 4M30A 2UUCE 2EM3A 2JR1A 1X49A 4GEQB 2DIXA 2L33A 5LMNE 4WSPA 1FKAE 1N32E 4LFBE 3T1HE 2EP3A 2ENAA 2K4VA 4LF8E 4JI4E 4NZVA 2UUAE 1PJTA 4O4KA 4ZYGA 2FV4B 2BB8A 2PRTA 2EMAA 2EL4A 5T6JA 1B69A 2ELZA 5LLQA 2B7TA 4K0KE 3H09A 3MHHC 1PJSA 2ENHA 1X6HA 2CT1A 1YSAC 2YTIA 2RQLA 2YPNA 4M9VC 2L92A 2CSHA 2YRKA 5A6KA 3ADIA 2UU9E 3DJWA 4J8ZA 2EL5A 2N3HA 1BBGA 3KZZA 2YU8A 1T38A 1ZAAC 2RTXA 2YTOA 4O5GA 2EL6A 4JI7E 3THOB 2VQEE 4TUGA 1KJKA 2JYAA 4ZYDA 2EE8A 1X6EA 2YTJA 4BMJA 5AE3A 3AV0A 2EMXA 4BC7A 4I8OA 5ADZA 4YY3E 1DGCA 4DR2E 4B3RE 2EOJA 3F6GA 1O0WA 1WRJA 3THNA 3VHTB 1JK1A 2LCEA 2UUBE 2EN2A 4KWYA 4F6MA 3BGHA 2ODRD 2EORA 4DR1E 4N4RB 3ADGA 4P78A 2K7IA 1X5WA 4B3SE 2KONA 5F3WA 1YFHA 4GKKE 4DMIA 2H36X 3M99B 3OMLA 2LTSA 2EPCA 1UBDC 2I9IA 1YUIA 1TF3A 4DR5E 4YHHE 4R8OA 3RMPA 2EPAA 1TF6A 4R2QA 2E5LE 3QG5C 2EM5A 2YTFA 5DNYA 4F2JC 4R2RA 4DKKA 2VF1A 1DI2A 2LO3A 4LFAE 2MC5A 1QU6A 4O24A 3J80C 1WXRA 2EPNA 3EPLA 2EOQA 4BHBA 4DV6E 3T1YE 5A6JA 2L3CA 2YRMA 4O43A 4WXCA 2YSOA 2NUGA 1YPNA 4KZSA 1ZR9A 2HHHE 5A6AA 4WX9A 1XNRE 2LVHA 2FTXB 2R76A 1N34E 2DSYA 2JOXA
chains in the Genus database with same CATH topology
5T6JA 4LF4E 3JTZA 1N33E 4M2ZA 2B7TA 2CPNA 4K0KE 3H09A 1X48A 3ADLA 1YZ9A 2L6MA 2LMZA 2V87A 1GQEA 2VE7C 1IBLE 5AE1A 4JI3E 1HNXE 1UILA 2NA2A 2MDRA 4JI5E 2L2MA 4R03A 3J7Yp 2B9DA 4X66E 3ADJA 3FIGA 2M1SA 2L92A 3ADIA 3VYYA 3ZOQB 2UU9E 3DJWA 4J8ZA 2UXBE 2NUEA 5IT9C 2IHR1 1I94E 2LUQA 3IWDA 3P1XA 2N3HA 1N32E 3C4TA 1X47A 4LFCE 1FJGE 3IWBA 2RTXA 4JI7E 4F9AB 1YYOA 2L3JA 2VQEE 4F54A 2WZOA 5CFFE 4TUGA 1J5EE 3VYXA 2UXDE 2N3GA 3F6HA 4DR4E 2UXCE 4BMJA 5IWAE 3AUZA 5AE3A 3AV0A 2JY9A 4JV5E 2KHXA 4I8OA 4BC7A 5ADZA 4YY3E 1N36E 4JI8E 1PKPA 4DR2E 2NUFA 4JI1E 1YYWA 3J7AG 4B3RE 2V83A 2B7VA 1T4NA 4DUZE 4LF6E 1GZ6A 1ZBQA 3F6GA 1IBKE 1O0WA 5AASA 4X65E 4DV0E 2RS7A 2ZM6E 2L8TA 2UUBE 2V86A 1UHZA 4L5NC 4DR7E 1T4LB 3HPSA 4Q28A 2ODRD 2M7QA 4F9BB 2LBSB 4JI0E 1XNQE 2JVAA 1XMOE 1XMQE 5LMUE 4DR1E 2LJHA 5BR8E 4OOGC 2M4IA 4DUYE 3HXLA 3ADGA 4DR3E 3VK6A 4P78A 4WFTA 2LRSA 1RQ0A 2V85A 2V88A 3LLHA 4WYQB 3DF6A 4LFBE 4X64E 4JI2E 1HNZE 4B3SE 4BC9A 2KONA 2F4VE 2V8QB 2V89A 5F3WA 4X62E 4JYAE 4LTYA 1J26A 2EZ6A 4DV4E 1T4OA 2KOUA 2LE2A 4WPYA 4DMIA 1RC7A 2H36X 4GKKE 1DQ3A 3J81C 4BBYA 4LF5E 3KWRA 3OMLA 1WHNA 4DV3E 2LTSA 2LUPB 1IBME 2VQFE 5LL6R 2L2KB 5FLXC 1YYKA 4DV2E 3OTOE 4DR5E 4TUIA 3JAMC 2E1MA 2RSMA 4YHHE 2G7HA 2JWOA 2EWLA 4L8NA 2ODRC 4F9CB 5AE2A 4B3TE 4JI6E 3IWCA 2DB2A 4R8OA 4DV7E 2YZTA 4DV1E 1HR0E 1EKZA 3RMPA 4NXNE 2E5LE 5DNYA 4BS9A 4BCAA 4DKKA 1WHQA 4M0VA 1HNWE 2VF1A 2F8BA 1N34E 1DI2A 4NXME 3HTXA 4LU9A 4LF9E 4LFAE 4DR6E 4AQYE 4B3ME 4P7DA 2MC5A 3C4BA 1QU6A 3J80C 4X8WA 4M30A 2UUCE 2YT4A 3HQ1A 1WXRA 2JOBA 2JR1A 1SR9A 2L33A 1X49A 2DIXA 3MSWA 4GEQB 1STUA 4WSPA 5LMNE 1FKAE 1ZBTA 2FGGA 2RS6A 2L3CA 3LMLA 4DV6E 3T1HE 3T1YE 4LF7E 3HPZA 2K4VA 2NUGA 4KZSA 2DMYA 5A2QC 4LF8E 3K6QA 4DV5E 2HHHE 4JI4E 4KHPE 2UUAE 4OX9E 2L2NA 1XNRE 2MC6A 3JU0A 2FV4B 2FTXB 2LTRA 2DSYA 4GKJE 2B3TB 2JOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZT A;  4P7D A;  3KWR A;  2DSY A;  4P78 A; 
#chains in the Genus database with same CATH topology
 4Q35 B;  2J7J A;  2EPZ A;  1IQS A;  1NEI A;  2CPN A;  1YZ9 A;  2Q8U A;  5TSE A;  2V87 A;  1PJQ A;  2EOE A;  2VE7 C;  2EMZ A;  4IS1 C;  4BHC A;  2MDR A;  4MLV A;  4R2C A;  4R2S A;  2CTD A;  2L2M A;  3MHS C;  2DLQ A;  4X66 E;  1G2F C;  3VYY A;  3ZOQ B;  1A1L A;  5KL4 A;  2IHR 1;  3P1X A;  3C4T A;  1X47 A;  4LFC E;  3IWB A;  2DGC A;  2DRP A;  2A25 A;  2M9A A;  2L3J A;  5AC5 A;  1MGT A;  1X6F A;  2EMG A;  2WBS A;  2EQ1 A;  2UXC E;  3BF2 A;  2N8X A;  2NUF A;  2EN8 A;  3J7A G;  2HC5 A;  2EPX A;  2V83 A;  4DUZ E;  1F2I G;  2JXP A;  1GZ6 A;  1ZBQ A;  1IBK E;  4LF6 E;  5AAS A;  2RS7 A;  2L8T A;  2YRH A;  2DLK A;  2V86 A;  2YSP A;  1UHZ A;  4L5N C;  2WBU A;  3HPS A;  2LBS B;  1XMO E;  1XMQ E;  5LMU E;  1SFE A;  4OOG C;  2LV2 A;  3VK6 A;  1RQ0 A;  2V85 A;  2V88 A;  3DF6 A;  4JI2 E;  2EOI A;  2EM8 A;  4HTG A;  1L4S A;  1A1F A;  1KYQ A;  1IQO A;  1T4O A;  2GLI A;  1DQ3 A;  4BBY A;  4LF5 E;  3KWR A;  2EMI A;  2EPO A;  4WXD A;  1LLM C;  2L2K B;  5KL7 A;  2G7H A;  2JWO A;  4L8N A;  4DR6 E;  2ODR C;  5AE2 A;  1TN9 A;  4NXN E;  3BBG A;  1P47 A;  2EM4 A;  4M0V A;  1HNW E;  2EN4 A;  2R1F A;  2HGH A;  1IMU A;  4LU9 A;  2DMI A;  2YT4 A;  3HQ1 A;  2JOB A;  1SR9 A;  3MSW A;  5A69 A;  1QNT A;  1ZBT A;  2EOX A;  2FGG A;  2RS6 A;  2YTE A;  5A6B D;  5KL6 A;  2EPM X;  5A2Q C;  4DV5 E;  4OX9 E;  2BBG A;  3JU0 A;  2LTR A;  4DR7 E;  2B3T B;  2EOY A;  2EMW A;  4LF4 E;  1JK2 A;  2EOM A;  4M2Z A;  1MEY C;  2ADR A;  1X48 A;  3ADL A;  2D9H A;  2L6M A;  4WSG A;  2LMZ A;  1GQE A;  2YTG A;  1IBL E;  3L00 A;  2EN1 A;  4JI5 E;  2EOS A;  2EQ3 A;  2EM6 A;  4R03 A;  2EOZ A;  2RSI A;  3J7Y p;  2B9D A;  3FIG A;  2M1S A;  1A1J A;  2EPR A;  5IT9 C;  1I94 E;  2LUQ A;  1FJG E;  1YYO A;  4F9A B;  1J5E E;  1G2D C;  4F54 A;  2WZO A;  2UXD E;  1UN6 B;  2EN7 A;  4X9J A;  1BBO A;  3F6H A;  1N3G A;  3BID A;  3EPH A;  4HEI A;  3AUZ A;  2GPI A;  2EN3 A;  4DV0 E;  2EMF A;  4NHR A;  1YUJ A;  1T4L B;  2EQ0 A;  2M7Q A;  4F9B B;  4JI0 E;  2EJ4 A;  2EPL X;  2JVA A;  3EPJ A;  1A1K A;  2EM7 A;  2EN6 A;  2LJH A;  5BR8 E;  4DUY E;  3HXL A;  4DR3 E;  4AQY E;  4WFT A;  4GZN C;  3LLH A;  4WYQ B;  1EH8 A;  2V8Q B;  4X62 E;  4JYA E;  4LTY A;  2EOF A;  2EZ6 A;  3C6M A;  2EPU A;  4IJD A;  1T39 A;  1WHN A;  5A6B A;  4DV3 E;  4R2E A;  3EQ1 A;  5FLX C;  3OTO E;  1AAY A;  4TUI A;  3JAM C;  4F6N A;  1BB8 A;  4R2P A;  3KZY A;  2EWL A;  4B3T E;  4DV1 E;  2EOH A;  3HTX A;  1Z1B A;  4B3M E;  2EMB A;  1A1H A;  1XNQ E;  2WBT A;  1STU A;  2UXB E;  2YWQ A;  3LML A;  4LF7 E;  3HPZ A;  2DMY A;  5AC4 A;  3K6Q A;  4KHP E;  2EPP A;  2L2N A;  2MC6 A;  1PDA A;  2MKD A;  2YU5 A;  1HNX E;  4GKJ E;  2JPA A;  2EMY A;  2VRD A;  1ZU1 A;  5IV8 B;  3JTZ A;  1N33 E;  4ZYH A;  4MLQ A;  2EM2 A;  2HJJ A;  2YTQ A;  2LT7 A;  5AE1 A;  2MKN A;  4JI3 E;  5IXM B;  1UIL A;  2NA2 A;  5KL2 A;  5KL3 A;  2MDG A;  2GHF A;  1RMD A;  2I13 A;  1WJP A;  3ADJ A;  2YTP A;  4RH8 A;  2EMH A;  2EMK A;  4R2A A;  3IWD A;  1EH7 A;  3VYX A;  5CFF E;  4RHB B;  2N3G A;  4DR4 E;  5IWA E;  1X3C A;  4JV5 E;  2EM0 A;  2JY9 A;  2KHX A;  2EOO A;  1A1G A;  1N36 E;  4JI1 E;  1NCS A;  4JI8 E;  1PKP A;  2WCC 3;  1YYW A;  2B7V A;  1T4N A;  2YTN A;  2NAB A;  4X65 E;  2ZM6 E;  3C6K A;  3UK3 C;  3EPK A;  2YTD A;  4Q28 A;  3ECR A;  2RPC A;  2EM9 A;  2LJU A;  2M4I A;  2NUE A;  2LRS A;  4X64 E;  1HNZ E;  4BC9 A;  2F4V E;  2V89 A;  2E72 A;  1J26 A;  4DV4 E;  2KOU A;  1AH5 A;  2LE2 A;  4WPY A;  1GTK A;  1RC7 A;  3J81 C;  4R2D A;  2EMC A;  2LUP B;  1IBM E;  5KL5 A;  2VQF E;  5LL6 R;  1YYK A;  4DV2 E;  1A1I A;  2JP9 A;  2E1M A;  2EML A;  2RSM A;  4F9C B;  4JI6 E;  3IWC A;  2DB2 A;  4DV7 E;  1HR0 E;  2YZT A;  1EKZ A;  2EPK X;  4BS9 A;  4ZYE A;  4BCA A;  1WHQ A;  2F8B A;  4NXM E;  3TQM A;  2ENC A;  4LF9 E;  1EH6 A;  2ELY A;  4FK5 C;  4P7D A;  3C4B A;  4X8W A;  4M30 A;  2UUC E;  2EM3 A;  2JR1 A;  1X49 A;  4GEQ B;  2DIX A;  2L33 A;  5LMN E;  4WSP A;  1FKA E;  1N32 E;  4LFB E;  3T1H E;  2EP3 A;  2ENA A;  2K4V A;  4LF8 E;  4JI4 E;  4NZV A;  2UUA E;  1PJT A;  4O4K A;  4ZYG A;  2FV4 B;  2BB8 A;  2PRT A;  2EMA A;  2EL4 A;  5T6J A;  1B69 A;  2ELZ A;  5LLQ A;  2B7T A;  4K0K E;  3H09 A;  3MHH C;  1PJS A;  2ENH A;  1X6H A;  2CT1 A;  1YSA C;  2YTI A;  2RQL A;  2YPN A;  4M9V C;  2L92 A;  2CSH A;  2YRK A;  5A6K A;  3ADI A;  2UU9 E;  3DJW A;  4J8Z A;  2EL5 A;  2N3H A;  1BBG A;  3KZZ A;  2YU8 A;  1T38 A;  1ZAA C;  2RTX A;  2YTO A;  4O5G A;  2EL6 A;  4JI7 E;  3THO B;  2VQE E;  4TUG A;  1KJK A;  2JYA A;  4ZYD A;  2EE8 A;  1X6E A;  2YTJ A;  4BMJ A;  5AE3 A;  3AV0 A;  2EMX A;  4BC7 A;  4I8O A;  5ADZ A;  4YY3 E;  1DGC A;  4DR2 E;  4B3R E;  2EOJ A;  3F6G A;  1O0W A;  1WRJ A;  3THN A;  3VHT B;  1JK1 A;  2LCE A;  2UUB E;  2EN2 A;  4KWY A;  4F6M A;  3BGH A;  2ODR D;  2EOR A;  4DR1 E;  4N4R B;  3ADG A;  4P78 A;  2K7I A;  1X5W A;  4B3S E;  2KON A;  5F3W A;  1YFH A;  4GKK E;  4DMI A;  2H36 X;  3M99 B;  3OML A;  2LTS A;  2EPC A;  1UBD C;  2I9I A;  1YUI A;  1TF3 A;  4DR5 E;  4YHH E;  4R8O A;  3RMP A;  2EPA A;  1TF6 A;  4R2Q A;  2E5L E;  3QG5 C;  2EM5 A;  2YTF A;  5DNY A;  4F2J C;  4R2R A;  4DKK A;  2VF1 A;  1DI2 A;  2LO3 A;  4LFA E;  2MC5 A;  1QU6 A;  4O24 A;  3J80 C;  1WXR A;  2EPN A;  3EPL A;  2EOQ A;  4BHB A;  4DV6 E;  3T1Y E;  5A6J A;  2L3C A;  2YRM A;  4O43 A;  4WXC A;  2YSO A;  2NUG A;  1YPN A;  4KZS A;  1ZR9 A;  2HHH E;  5A6A A;  4WX9 A;  1XNR E;  2LVH A;  2FTX B;  2R76 A;  1N34 E;  2DSY A;  2JOX A; 
#chains in the Genus database with same CATH homology
 5T6J A;  4LF4 E;  3JTZ A;  1N33 E;  4M2Z A;  2B7T A;  2CPN A;  4K0K E;  3H09 A;  1X48 A;  3ADL A;  1YZ9 A;  2L6M A;  2LMZ A;  2V87 A;  1GQE A;  2VE7 C;  1IBL E;  5AE1 A;  4JI3 E;  1HNX E;  1UIL A;  2NA2 A;  2MDR A;  4JI5 E;  2L2M A;  4R03 A;  3J7Y p;  2B9D A;  4X66 E;  3ADJ A;  3FIG A;  2M1S A;  2L92 A;  3ADI A;  3VYY A;  3ZOQ B;  2UU9 E;  3DJW A;  4J8Z A;  2UXB E;  2NUE A;  5IT9 C;  2IHR 1;  1I94 E;  2LUQ A;  3IWD A;  3P1X A;  2N3H A;  1N32 E;  3C4T A;  1X47 A;  4LFC E;  1FJG E;  3IWB A;  2RTX A;  4JI7 E;  4F9A B;  1YYO A;  2L3J A;  2VQE E;  4F54 A;  2WZO A;  5CFF E;  4TUG A;  1J5E E;  3VYX A;  2UXD E;  2N3G A;  3F6H A;  4DR4 E;  2UXC E;  4BMJ A;  5IWA E;  3AUZ A;  5AE3 A;  3AV0 A;  2JY9 A;  4JV5 E;  2KHX A;  4I8O A;  4BC7 A;  5ADZ A;  4YY3 E;  1N36 E;  4JI8 E;  1PKP A;  4DR2 E;  2NUF A;  4JI1 E;  1YYW A;  3J7A G;  4B3R E;  2V83 A;  2B7V A;  1T4N A;  4DUZ E;  4LF6 E;  1GZ6 A;  1ZBQ A;  3F6G A;  1IBK E;  1O0W A;  5AAS A;  4X65 E;  4DV0 E;  2RS7 A;  2ZM6 E;  2L8T A;  2UUB E;  2V86 A;  1UHZ A;  4L5N C;  4DR7 E;  1T4L B;  3HPS A;  4Q28 A;  2ODR D;  2M7Q A;  4F9B B;  2LBS B;  4JI0 E;  1XNQ E;  2JVA A;  1XMO E;  1XMQ E;  5LMU E;  4DR1 E;  2LJH A;  5BR8 E;  4OOG C;  2M4I A;  4DUY E;  3HXL A;  3ADG A;  4DR3 E;  3VK6 A;  4P78 A;  4WFT A;  2LRS A;  1RQ0 A;  2V85 A;  2V88 A;  3LLH A;  4WYQ B;  3DF6 A;  4LFB E;  4X64 E;  4JI2 E;  1HNZ E;  4B3S E;  4BC9 A;  2KON A;  2F4V E;  2V8Q B;  2V89 A;  5F3W A;  4X62 E;  4JYA E;  4LTY A;  1J26 A;  2EZ6 A;  4DV4 E;  1T4O A;  2KOU A;  2LE2 A;  4WPY A;  4DMI A;  1RC7 A;  2H36 X;  4GKK E;  1DQ3 A;  3J81 C;  4BBY A;  4LF5 E;  3KWR A;  3OML A;  1WHN A;  4DV3 E;  2LTS A;  2LUP B;  1IBM E;  2VQF E;  5LL6 R;  2L2K B;  5FLX C;  1YYK A;  4DV2 E;  3OTO E;  4DR5 E;  4TUI A;  3JAM C;  2E1M A;  2RSM A;  4YHH E;  2G7H A;  2JWO A;  2EWL A;  4L8N A;  2ODR C;  4F9C B;  5AE2 A;  4B3T E;  4JI6 E;  3IWC A;  2DB2 A;  4R8O A;  4DV7 E;  2YZT A;  4DV1 E;  1HR0 E;  1EKZ A;  3RMP A;  4NXN E;  2E5L E;  5DNY A;  4BS9 A;  4BCA A;  4DKK A;  1WHQ A;  4M0V A;  1HNW E;  2VF1 A;  2F8B A;  1N34 E;  1DI2 A;  4NXM E;  3HTX A;  4LU9 A;  4LF9 E;  4LFA E;  4DR6 E;  4AQY E;  4B3M E;  4P7D A;  2MC5 A;  3C4B A;  1QU6 A;  3J80 C;  4X8W A;  4M30 A;  2UUC E;  2YT4 A;  3HQ1 A;  1WXR A;  2JOB A;  2JR1 A;  1SR9 A;  2L33 A;  1X49 A;  2DIX A;  3MSW A;  4GEQ B;  1STU A;  4WSP A;  5LMN E;  1FKA E;  1ZBT A;  2FGG A;  2RS6 A;  2L3C A;  3LML A;  4DV6 E;  3T1H E;  3T1Y E;  4LF7 E;  3HPZ A;  2K4V A;  2NUG A;  4KZS A;  2DMY A;  5A2Q C;  4LF8 E;  3K6Q A;  4DV5 E;  2HHH E;  4JI4 E;  4KHP E;  2UUA E;  4OX9 E;  2L2N A;  1XNR E;  2MC6 A;  3JU0 A;  2FV4 B;  2FTX B;  2LTR A;  2DSY A;  4GKJ E;  2B3T B;  2JOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...