4P78A

Hica3 and hicb3 toxin-antitoxin complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
MIYPIFIFKTVEGFDGYFPDIDGCFFAGNTFADISKNAEEAFAVHIEALMNEGFPLPSPPKDPHRYIDDPRLKEEGGILGFVEIDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HicB3 antitoxin
publication title Functional and Structural Analysis of HicA3-HicB3, a Novel Toxin-Antitoxin System of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Toxin
total genus 17
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4p78A00
4P7DA 4P78A 2YZTA 3KWRA 2DSYA
chains in the Genus database with same CATH superfamily
1A1JA 4NXME 4JI4E 4DUYE 5A6KA 2L3JA 1WHNA 2EN1A 5F3WA 2EPRA 3ADGA 4ZYGA 2ODRC 4J8ZA 4R03A 3BIDA 3THOB 4BS9A 5LLQA 3DF6A 1A1HA 2L2MA 3L00A 1X48A 2EOXA 2GHFA 2F4VE 3KWRA 4WX9A 5IXMB 3VYYA 4DR2E 2HJJA 2DB2A 3IWDA 4M9VC 2EORA 4MLVA 5A6BA 5FLXC 3J80C 3T1HE 2V88A 1FKAE 4L5NC 5AE1A 4X66E 1N36E 2ENAA 3LMLA 4KZSA 2NUGA 1YFHA 2DLKA 1AAYA 4M2ZA 2YRHA 1X49A 2WCC3 2EMYA 3C6MA 4P7DA 1YSAC 2LVHA 1DQ3A 1N3GA 2UUAE 5IWAE 4KWYA 2JVAA 2EN7A 2EL4A 2EOEA 4I8OA 1NEIA 1GTKA 4MLQA 2EPCA 4M0VA 4OX9E 2EQ1A 1YZ9A 3KZZA 2L2NA 2RQLA 2YTNA 1ZBTA 2WBTA 1JK1A 2R76A 1N32E 2ENCA 1ZAAC 2VRDA 3VYXA 4R2RA 2MDGA 4DMIA 2EOSA 2EPZA 4WSGA 2EOQA 2LV2A 2N3HA 1WRJA 3F6HA 2EQ0A 2YTPA 4DR1E 4WXCA 1UBDC 4HTGA 3RMPA 3F6GA 4BC9A 3THNA 2EN2A 4JI6E 1X3CA 2B3TB 5AASA 4X9JA 4BHCA 1QNTA 2L2KB 2B7TA 3C6KA 1YYOA 1A1KA 1IQSA 1PJTA 3JTZA 2EOFA 5ADZA 2F8BA 2V8QB 2YTIA 4LFBE 4WPYA 2FGGA 2M1SA 4JI2E 2EMKA 2EN6A 4GZNC 1N34E 4JI0E 4DV4E 4GKJE 4RH8A 2YTEA 1GQEA 5KL5A 2A25A 5A6JA 1YYWA 4BCAA 2LUQA 4KHPE 3BF2A 2EPMX 5LL6R 4BC7A 4R2QA 2BB8A 2E1MA 2EN3A 2EMHA 1TF3A 2EP3A 2EMCA 2DRPA 3T1YE 4R2DA 1HNZE 1UN6B 2UXDE 2EM7A 1MGTA 2B9DA 4B3SE 4LU9A 2N8XA 4DV7E 3C4BA 3ZOQB 2V83A 2KHXA 3C4TA 1UHZA 1X47A 3EPHA 1FJGE 2FTXB 2EN4A 5KL2A 3LLHA 2DMIA 2EPPA 5A6AA 2ENHA 2L33A 2YRMA 2YTFA 3AUZA 5T6JA 1AH5A 2EMLA 2EM9A 1HNXE 2ADRA 2EOOA 2LBSB 2JPAA 4F6MA 2CPNA 1X5WA 1KJKA 2YU5A 4R2CA 4Q35B 2VE7C 4F9BB 4WFTA 5KL6A 3UK3C 1A1GA 1STUA 4ZYDA 4JI8E 2LTSA 5A69A 1X6HA 1QU6A 4WSPA 2EMBA 2HC5A 1ZBQA 2G7HA 1YPNA 1TN9A 2EM2A 5AC4A 4F2JC 1RC7A 2EMFA 2M9AA 4DV5E 3K6QA 2M4IA 2EOJA 2L3CA 3ADJA 2HGHA 3VHTB 3JAMC 2EPOA 2DSYA 2VF1A 4WXDA 1N33E 4F6NA 2EM5A 2NUEA 5LMUE 1HNWE 1PKPA 2J7JA 2V85A 2UXCE 1RQ0A 1G2DC 4DV2E 4GKKE 2EM0A 4LTYA 2JYAA 1J26A 2YTQA 4JI5E 1XNRE 1YYKA 4RHBB 3ADIA 3BBGA 4DR5E 1B69A 2NUFA 2Q8UA 1A1IA 2JP9A 2ODRD 2VQEE 2YU8A 2YSOA 3HPZA 3EPKA 4DR3E 2EMAA 5KL3A 2GPIA 1WJPA 2EJ4A 2EOHA 2JXPA 4L8NA 1ZR9A 3JU0A 3J7Yp 1A1LA 1EKZA 2YZTA 4R8OA 2YTDA 1DGCA 1I94E 5IV8B 2VQFE 4YY3E 2YTOA 4O43A 2EOMA 1LLMC 2DLQA 1XNQE 4LF6E 2MC5A 2JOBA 2UU9E 5KL4A 2CSHA 3EPLA 1MEYC 4X65E 5BR8E 4HEIA 2EOYA 4NZVA 2YWQA 4R2EA 2EM8A 2UXBE 2KONA 2D9HA 2LUPB 4TUGA 3H09A 2I9IA 2K7IA 1EH7A 1XMOE 4AQYE 2LJUA 2EL5A 2GLIA 2YPNA 2YRKA 2JR1A 2LCEA 2MKNA 1NCSA 2H36X 4O24A 3MHSC 4DV1E 4DKKA 4ZYEA 2UUCE 2L6MA 2LE2A 4NXNE 3KZYA 2WBSA 4LF7E 2V87A 4R2PA 1F2IG 1UILA 1SR9A 2L8TA 4JV5E 3QG5C 2K4VA 3OMLA 1DI2A 1BB8A 4DV3E 1IBLE 3ECRA 4B3RE 4GEQB 2YTGA 3BGHA 4M30A 2WBUA 2EPUA 3EPJA 4R2SA 2KOUA 2LTRA 2RSMA 3HQ1A 4JYAE 4B3ME 2V89A 2UUBE 2DMYA 4DUZE 1PJQA 1XMQE 5AC5A 5DNYA 1WXRA 4ZYHA 5LMNE 2ELZA 1IMUA 2EM3A 2EPKX 2R1FA 4X8WA 3FIGA 2EPNA 2JY9A 4BMJA 2RS6A 2RTXA 3DJWA 4LF4E 2I13A 2ZM6E 4DV6E 1YUJA 5A6BD 2E72A 2EN8A 2LJHA 2EQ3A 2YSPA 1ZU1A 1X6FA 4IJDA 3J81C 4F9CB 4B3TE 4P78A 2LT7A 3AV0A 4X62E 2EOIA 3M99B 2EMZA 1T4OA 1T39A 3HXLA 1GZ6A 1PDAA 2NABA 1T38A 1SFEA 2FV4B 2EMXA 2WZOA 2E5LE 5AE3A 2EWLA 1PJSA 4BBYA 1EH6A 3HPSA 3P1XA 1HR0E 1BBGA 2PRTA 3MHHC 3TQMA 4LF8E 2EPLX 2B7VA 2M7QA 4JI7E 2DIXA 2EM4A 4DV0E 2IHR1 4IS1C 4K0KE 2EL6A 2ELYA 1A1FA 1IQOA 2EM6A 4LFAE 3MSWA 2CTDA 2N3GA 2MDRA 5IT9C 2LMZA 4JI1E 2HHHE 2EE8A 1T4NA 2YTJA 5CFFE 3EQ1A 4F9AB 2RS7A 4LFCE 3IWCA 2LO3A 2MC6A 4DR6E 3IWBA 5A2QC 1JK2A 2EMWA 4NHRA 5TSEA 4DR7E 1X6EA 2EMIA 4R2AA 2EPXA 1O0WA 1IBKE 2EPAA 5KL7A 2YT4A 3J7AG 4Q28A 2EZ6A 4F54A 2JWOA 2DGCA 2JOXA 1Z1BA 1KYQA 1WHQA 2L92A 4O4KA 4FK5C 4X64E 4JI3E 4BHBA 4YHHE 3OTOE 1YUIA 1L4SA 4OOGC 3ADLA 4LF9E 2BBGA 2MKDA 1T4LB 3HTXA 2EOZA 4DR4E 1IBME 5AE2A 1J5EE 4O5GA 4TUIA 1G2FC 2V86A 2CT1A 1EH8A 2RSIA 2NA2A 4LF5E 1TF6A 2EMGA 1P47A 4WYQB 2RPCA 2LRSA 1BBOA 1RMDA 4N4RB 3VK6A
chains in the Genus database with same CATH topology
4DR5E 2ZM6E 4DV6E 2LJHA 3JTZA 2NUFA 4LFBE 5ADZA 2F8BA 2V8QB 4NXME 2ODRD 3J81C 4WPYA 2VQEE 4F9CB 4JI4E 4DUYE 2L3JA 3HPZA 1WHNA 2FGGA 4DR3E 2M1SA 4P78A 5F3WA 4B3TE 3AV0A 4X62E 3ADGA 4JI2E 1N34E 4JI0E 4DV4E 4GKJE 1T4OA 2ODRC 4J8ZA 4R03A 4BS9A 1GQEA 3HXLA 1GZ6A 3DF6A 4L8NA 2L2MA 1X48A 3JU0A 1YYWA 4BCAA 2FV4B 2F4VE 2LUQA 2WZOA 2E5LE 5AE3A 3J7Yp 2EWLA 4BBYA 1EKZA 4KHPE 2YZTA 5LL6R 3HPSA 3P1XA 4R8OA 3KWRA 4BC7A 1HR0E 2E1MA 3VYYA 1I94E 4LF8E 2VQFE 2B7VA 4YY3E 3T1YE 2M7QA 4JI7E 2DIXA 4DV0E 4DR2E 2DB2A 2IHR1 1HNZE 4LF6E 2MC5A 3IWDA 1XNQE 2UXDE 2JOBA 4K0KE 2B9DA 4B3SE 2UU9E 4LU9A 4DV7E 5FLXC 3C4BA 3ZOQB 2V83A 4LFAE 3J80C 3T1HE 2KHXA 2V88A 3C4TA 1UHZA 3MSWA 4X65E 1X47A 4L5NC 5BR8E 5AE1A 3LMLA 4KZSA 4X66E 1N36E 2NUGA 2N3GA 2MDRA 1FJGE 2FTXB 5IT9C 2LMZA 4JI1E 2HHHE 3LLHA 4M2ZA 1X49A 2UXBE 1T4NA 2KONA 2L33A 4P7DA 5CFFE 4F9AB 2LUPB 4TUGA 1DQ3A 3H09A 3AUZA 2RS7A 5T6JA 1YYKA 1XMOE 4AQYE 1HNXE 2UUAE 5IWAE 4LFCE 3IWCA 2LBSB 2JR1A 2JVAA 2MC6A 4DR6E 3IWBA 2H36X 2CPNA 4DV1E 5A2QC 4DKKA 2UUCE 2L6MA 2LE2A 4NXNE 4DR7E 2VE7C 4I8OA 4F9BB 4WFTA 1O0WA 1IBKE 1STUA 4M0VA 4LF7E 4OX9E 1YZ9A 2V87A 2YT4A 4JI8E 3J7AG 2L2NA 2LTSA 4Q28A 1ZBTA 2EZ6A 4F54A 2JWOA 1UILA 1N32E 1QU6A 1SR9A 4WSPA 2JOXA 2L8TA 3VYXA 4JV5E 1WHQA 2L92A 1ZBQA 2G7HA 4X64E 2K4VA 3OMLA 4JI3E 4YHHE 3OTOE 1DI2A 4DV3E 1RC7A 4DMIA 1IBLE 4DV5E 1FKAE 4OOGC 3ADLA 3K6QA 4B3RE 4LF9E 2M4IA 4GEQB 2N3HA 2L3CA 3ADJA 3F6HA 4M30A 1T4LB 3HTXA 3JAMC 2DSYA 2KOUA 2LTRA 2VF1A 2RSMA 5AE2A 3HQ1A 4DR1E 1IBME 4DR4E 4JYAE 1J5EE 4B3ME 2V89A 2UUBE 1N33E 2DMYA 3RMPA 3F6GA 4DUZE 4BC9A 4TUIA 2NUEA 2V86A 3ADIA 5LMUE 1XMQE 4JI6E 5DNYA 1HNWE 2B3TB 1PKPA 2NA2A 1WXRA 5LMNE 4LF5E 2V85A 5AASA 4WYQB 1RQ0A 2LRSA 4DV2E 4GKKE 2UXCE 4LTYA 2L2KB 1J26A 2B7TA 4X8WA 1YYOA 3FIGA 2JY9A 3VK6A 4BMJA 2RS6A 4JI5E 1XNRE 2RTXA 3DJWA 4LF4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7D A;  4P78 A;  2YZT A;  3KWR A;  2DSY A; 
#chains in the Genus database with same CATH topology
 1A1J A;  4NXM E;  4JI4 E;  4DUY E;  5A6K A;  2L3J A;  1WHN A;  2EN1 A;  5F3W A;  2EPR A;  3ADG A;  4ZYG A;  2ODR C;  4J8Z A;  4R03 A;  3BID A;  3THO B;  4BS9 A;  5LLQ A;  3DF6 A;  1A1H A;  2L2M A;  3L00 A;  1X48 A;  2EOX A;  2GHF A;  2F4V E;  3KWR A;  4WX9 A;  5IXM B;  3VYY A;  4DR2 E;  2HJJ A;  2DB2 A;  3IWD A;  4M9V C;  2EOR A;  4MLV A;  5A6B A;  5FLX C;  3J80 C;  3T1H E;  2V88 A;  1FKA E;  4L5N C;  5AE1 A;  4X66 E;  1N36 E;  2ENA A;  3LML A;  4KZS A;  2NUG A;  1YFH A;  2DLK A;  1AAY A;  4M2Z A;  2YRH A;  1X49 A;  2WCC 3;  2EMY A;  3C6M A;  4P7D A;  1YSA C;  2LVH A;  1DQ3 A;  1N3G A;  2UUA E;  5IWA E;  4KWY A;  2JVA A;  2EN7 A;  2EL4 A;  2EOE A;  4I8O A;  1NEI A;  1GTK A;  4MLQ A;  2EPC A;  4M0V A;  4OX9 E;  2EQ1 A;  1YZ9 A;  3KZZ A;  2L2N A;  2RQL A;  2YTN A;  1ZBT A;  2WBT A;  1JK1 A;  2R76 A;  1N32 E;  2ENC A;  1ZAA C;  2VRD A;  3VYX A;  4R2R A;  2MDG A;  4DMI A;  2EOS A;  2EPZ A;  4WSG A;  2EOQ A;  2LV2 A;  2N3H A;  1WRJ A;  3F6H A;  2EQ0 A;  2YTP A;  4DR1 E;  4WXC A;  1UBD C;  4HTG A;  3RMP A;  3F6G A;  4BC9 A;  3THN A;  2EN2 A;  4JI6 E;  1X3C A;  2B3T B;  5AAS A;  4X9J A;  4BHC A;  1QNT A;  2L2K B;  2B7T A;  3C6K A;  1YYO A;  1A1K A;  1IQS A;  1PJT A;  3JTZ A;  2EOF A;  5ADZ A;  2F8B A;  2V8Q B;  2YTI A;  4LFB E;  4WPY A;  2FGG A;  2M1S A;  4JI2 E;  2EMK A;  2EN6 A;  4GZN C;  1N34 E;  4JI0 E;  4DV4 E;  4GKJ E;  4RH8 A;  2YTE A;  1GQE A;  5KL5 A;  2A25 A;  5A6J A;  1YYW A;  4BCA A;  2LUQ A;  4KHP E;  3BF2 A;  2EPM X;  5LL6 R;  4BC7 A;  4R2Q A;  2BB8 A;  2E1M A;  2EN3 A;  2EMH A;  1TF3 A;  2EP3 A;  2EMC A;  2DRP A;  3T1Y E;  4R2D A;  1HNZ E;  1UN6 B;  2UXD E;  2EM7 A;  1MGT A;  2B9D A;  4B3S E;  4LU9 A;  2N8X A;  4DV7 E;  3C4B A;  3ZOQ B;  2V83 A;  2KHX A;  3C4T A;  1UHZ A;  1X47 A;  3EPH A;  1FJG E;  2FTX B;  2EN4 A;  5KL2 A;  3LLH A;  2DMI A;  2EPP A;  5A6A A;  2ENH A;  2L33 A;  2YRM A;  2YTF A;  3AUZ A;  5T6J A;  1AH5 A;  2EML A;  2EM9 A;  1HNX E;  2ADR A;  2EOO A;  2LBS B;  2JPA A;  4F6M A;  2CPN A;  1X5W A;  1KJK A;  2YU5 A;  4R2C A;  4Q35 B;  2VE7 C;  4F9B B;  4WFT A;  5KL6 A;  3UK3 C;  1A1G A;  1STU A;  4ZYD A;  4JI8 E;  2LTS A;  5A69 A;  1X6H A;  1QU6 A;  4WSP A;  2EMB A;  2HC5 A;  1ZBQ A;  2G7H A;  1YPN A;  1TN9 A;  2EM2 A;  5AC4 A;  4F2J C;  1RC7 A;  2EMF A;  2M9A A;  4DV5 E;  3K6Q A;  2M4I A;  2EOJ A;  2L3C A;  3ADJ A;  2HGH A;  3VHT B;  3JAM C;  2EPO A;  2DSY A;  2VF1 A;  4WXD A;  1N33 E;  4F6N A;  2EM5 A;  2NUE A;  5LMU E;  1HNW E;  1PKP A;  2J7J A;  2V85 A;  2UXC E;  1RQ0 A;  1G2D C;  4DV2 E;  4GKK E;  2EM0 A;  4LTY A;  2JYA A;  1J26 A;  2YTQ A;  4JI5 E;  1XNR E;  1YYK A;  4RHB B;  3ADI A;  3BBG A;  4DR5 E;  1B69 A;  2NUF A;  2Q8U A;  1A1I A;  2JP9 A;  2ODR D;  2VQE E;  2YU8 A;  2YSO A;  3HPZ A;  3EPK A;  4DR3 E;  2EMA A;  5KL3 A;  2GPI A;  1WJP A;  2EJ4 A;  2EOH A;  2JXP A;  4L8N A;  1ZR9 A;  3JU0 A;  3J7Y p;  1A1L A;  1EKZ A;  2YZT A;  4R8O A;  2YTD A;  1DGC A;  1I94 E;  5IV8 B;  2VQF E;  4YY3 E;  2YTO A;  4O43 A;  2EOM A;  1LLM C;  2DLQ A;  1XNQ E;  4LF6 E;  2MC5 A;  2JOB A;  2UU9 E;  5KL4 A;  2CSH A;  3EPL A;  1MEY C;  4X65 E;  5BR8 E;  4HEI A;  2EOY A;  4NZV A;  2YWQ A;  4R2E A;  2EM8 A;  2UXB E;  2KON A;  2D9H A;  2LUP B;  4TUG A;  3H09 A;  2I9I A;  2K7I A;  1EH7 A;  1XMO E;  4AQY E;  2LJU A;  2EL5 A;  2GLI A;  2YPN A;  2YRK A;  2JR1 A;  2LCE A;  2MKN A;  1NCS A;  2H36 X;  4O24 A;  3MHS C;  4DV1 E;  4DKK A;  4ZYE A;  2UUC E;  2L6M A;  2LE2 A;  4NXN E;  3KZY A;  2WBS A;  4LF7 E;  2V87 A;  4R2P A;  1F2I G;  1UIL A;  1SR9 A;  2L8T A;  4JV5 E;  3QG5 C;  2K4V A;  3OML A;  1DI2 A;  1BB8 A;  4DV3 E;  1IBL E;  3ECR A;  4B3R E;  4GEQ B;  2YTG A;  3BGH A;  4M30 A;  2WBU A;  2EPU A;  3EPJ A;  4R2S A;  2KOU A;  2LTR A;  2RSM A;  3HQ1 A;  4JYA E;  4B3M E;  2V89 A;  2UUB E;  2DMY A;  4DUZ E;  1PJQ A;  1XMQ E;  5AC5 A;  5DNY A;  1WXR A;  4ZYH A;  5LMN E;  2ELZ A;  1IMU A;  2EM3 A;  2EPK X;  2R1F A;  4X8W A;  3FIG A;  2EPN A;  2JY9 A;  4BMJ A;  2RS6 A;  2RTX A;  3DJW A;  4LF4 E;  2I13 A;  2ZM6 E;  4DV6 E;  1YUJ A;  5A6B D;  2E72 A;  2EN8 A;  2LJH A;  2EQ3 A;  2YSP A;  1ZU1 A;  1X6F A;  4IJD A;  3J81 C;  4F9C B;  4B3T E;  4P78 A;  2LT7 A;  3AV0 A;  4X62 E;  2EOI A;  3M99 B;  2EMZ A;  1T4O A;  1T39 A;  3HXL A;  1GZ6 A;  1PDA A;  2NAB A;  1T38 A;  1SFE A;  2FV4 B;  2EMX A;  2WZO A;  2E5L E;  5AE3 A;  2EWL A;  1PJS A;  4BBY A;  1EH6 A;  3HPS A;  3P1X A;  1HR0 E;  1BBG A;  2PRT A;  3MHH C;  3TQM A;  4LF8 E;  2EPL X;  2B7V A;  2M7Q A;  4JI7 E;  2DIX A;  2EM4 A;  4DV0 E;  2IHR 1;  4IS1 C;  4K0K E;  2EL6 A;  2ELY A;  1A1F A;  1IQO A;  2EM6 A;  4LFA E;  3MSW A;  2CTD A;  2N3G A;  2MDR A;  5IT9 C;  2LMZ A;  4JI1 E;  2HHH E;  2EE8 A;  1T4N A;  2YTJ A;  5CFF E;  3EQ1 A;  4F9A B;  2RS7 A;  4LFC E;  3IWC A;  2LO3 A;  2MC6 A;  4DR6 E;  3IWB A;  5A2Q C;  1JK2 A;  2EMW A;  4NHR A;  5TSE A;  4DR7 E;  1X6E A;  2EMI A;  4R2A A;  2EPX A;  1O0W A;  1IBK E;  2EPA A;  5KL7 A;  2YT4 A;  3J7A G;  4Q28 A;  2EZ6 A;  4F54 A;  2JWO A;  2DGC A;  2JOX A;  1Z1B A;  1KYQ A;  1WHQ A;  2L92 A;  4O4K A;  4FK5 C;  4X64 E;  4JI3 E;  4BHB A;  4YHH E;  3OTO E;  1YUI A;  1L4S A;  4OOG C;  3ADL A;  4LF9 E;  2BBG A;  2MKD A;  1T4L B;  3HTX A;  2EOZ A;  4DR4 E;  1IBM E;  5AE2 A;  1J5E E;  4O5G A;  4TUI A;  1G2F C;  2V86 A;  2CT1 A;  1EH8 A;  2RSI A;  2NA2 A;  4LF5 E;  1TF6 A;  2EMG A;  1P47 A;  4WYQ B;  2RPC A;  2LRS A;  1BBO A;  1RMD A;  4N4R B;  3VK6 A; 
#chains in the Genus database with same CATH homology
 4DR5 E;  2ZM6 E;  4DV6 E;  2LJH A;  3JTZ A;  2NUF A;  4LFB E;  5ADZ A;  2F8B A;  2V8Q B;  4NXM E;  2ODR D;  3J81 C;  4WPY A;  2VQE E;  4F9C B;  4JI4 E;  4DUY E;  2L3J A;  3HPZ A;  1WHN A;  2FGG A;  4DR3 E;  2M1S A;  4P78 A;  5F3W A;  4B3T E;  3AV0 A;  4X62 E;  3ADG A;  4JI2 E;  1N34 E;  4JI0 E;  4DV4 E;  4GKJ E;  1T4O A;  2ODR C;  4J8Z A;  4R03 A;  4BS9 A;  1GQE A;  3HXL A;  1GZ6 A;  3DF6 A;  4L8N A;  2L2M A;  1X48 A;  3JU0 A;  1YYW A;  4BCA A;  2FV4 B;  2F4V E;  2LUQ A;  2WZO A;  2E5L E;  5AE3 A;  3J7Y p;  2EWL A;  4BBY A;  1EKZ A;  4KHP E;  2YZT A;  5LL6 R;  3HPS A;  3P1X A;  4R8O A;  3KWR A;  4BC7 A;  1HR0 E;  2E1M A;  3VYY A;  1I94 E;  4LF8 E;  2VQF E;  2B7V A;  4YY3 E;  3T1Y E;  2M7Q A;  4JI7 E;  2DIX A;  4DV0 E;  4DR2 E;  2DB2 A;  2IHR 1;  1HNZ E;  4LF6 E;  2MC5 A;  3IWD A;  1XNQ E;  2UXD E;  2JOB A;  4K0K E;  2B9D A;  4B3S E;  2UU9 E;  4LU9 A;  4DV7 E;  5FLX C;  3C4B A;  3ZOQ B;  2V83 A;  4LFA E;  3J80 C;  3T1H E;  2KHX A;  2V88 A;  3C4T A;  1UHZ A;  3MSW A;  4X65 E;  1X47 A;  4L5N C;  5BR8 E;  5AE1 A;  3LML A;  4KZS A;  4X66 E;  1N36 E;  2NUG A;  2N3G A;  2MDR A;  1FJG E;  2FTX B;  5IT9 C;  2LMZ A;  4JI1 E;  2HHH E;  3LLH A;  4M2Z A;  1X49 A;  2UXB E;  1T4N A;  2KON A;  2L33 A;  4P7D A;  5CFF E;  4F9A B;  2LUP B;  4TUG A;  1DQ3 A;  3H09 A;  3AUZ A;  2RS7 A;  5T6J A;  1YYK A;  1XMO E;  4AQY E;  1HNX E;  2UUA E;  5IWA E;  4LFC E;  3IWC A;  2LBS B;  2JR1 A;  2JVA A;  2MC6 A;  4DR6 E;  3IWB A;  2H36 X;  2CPN A;  4DV1 E;  5A2Q C;  4DKK A;  2UUC E;  2L6M A;  2LE2 A;  4NXN E;  4DR7 E;  2VE7 C;  4I8O A;  4F9B B;  4WFT A;  1O0W A;  1IBK E;  1STU A;  4M0V A;  4LF7 E;  4OX9 E;  1YZ9 A;  2V87 A;  2YT4 A;  4JI8 E;  3J7A G;  2L2N A;  2LTS A;  4Q28 A;  1ZBT A;  2EZ6 A;  4F54 A;  2JWO A;  1UIL A;  1N32 E;  1QU6 A;  1SR9 A;  4WSP A;  2JOX A;  2L8T A;  3VYX A;  4JV5 E;  1WHQ A;  2L92 A;  1ZBQ A;  2G7H A;  4X64 E;  2K4V A;  3OML A;  4JI3 E;  4YHH E;  3OTO E;  1DI2 A;  4DV3 E;  1RC7 A;  4DMI A;  1IBL E;  4DV5 E;  1FKA E;  4OOG C;  3ADL A;  3K6Q A;  4B3R E;  4LF9 E;  2M4I A;  4GEQ B;  2N3H A;  2L3C A;  3ADJ A;  3F6H A;  4M30 A;  1T4L B;  3HTX A;  3JAM C;  2DSY A;  2KOU A;  2LTR A;  2VF1 A;  2RSM A;  5AE2 A;  3HQ1 A;  4DR1 E;  1IBM E;  4DR4 E;  4JYA E;  1J5E E;  4B3M E;  2V89 A;  2UUB E;  1N33 E;  2DMY A;  3RMP A;  3F6G A;  4DUZ E;  4BC9 A;  4TUI A;  2NUE A;  2V86 A;  3ADI A;  5LMU E;  1XMQ E;  4JI6 E;  5DNY A;  1HNW E;  2B3T B;  1PKP A;  2NA2 A;  1WXR A;  5LMN E;  4LF5 E;  2V85 A;  5AAS A;  4WYQ B;  1RQ0 A;  2LRS A;  4DV2 E;  4GKK E;  2UXC E;  4LTY A;  2L2K B;  1J26 A;  2B7T A;  4X8W A;  1YYO A;  3FIG A;  2JY9 A;  3VK6 A;  4BMJ A;  2RS6 A;  4JI5 E;  1XNR E;  2RTX A;  3DJW A;  4LF4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...