The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
66
|
structure length |
66
|
Chain Sequence |
MESGELIKRLEDAGWQIRGGRKTNSGSHVTLCKPGVRKIITLPYPRKDISKGLLRQAQKIAGIKLS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Toxin
|
molecule keywords |
HicB3 antitoxin
|
publication title |
Functional and Structural Analysis of HicA3-HicB3, a Novel Toxin-Antitoxin System of Yersinia pestis.
pubmed doi rcsb |
source organism |
Yersinia pestis
|
total genus |
14
|
structure length |
66
|
sequence length |
66
|
chains with identical sequence |
D
|
ec nomenclature | |
pdb deposition date | 2014-03-26 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Metal Transport, Frataxin; Chain A | Hypothetical protein. |
#chains in the Genus database with same CATH superfamily 4P78 C; 1WHZ A; 4C26 A; #chains in the Genus database with same CATH topology 3IAM 7; 4EC2 A; 3I9V 7; 4LK8 A; 1V5R A; 1WHZ A; 3T3J A; 3SSC A; 3OEQ A; 3SSE A; 4P78 C; 3GD9 A; 4HEA 7; 3S5E A; 4LP1 A; 3S5F A; 2P1X A; 3T3L A; 4JPD A; 3S5D A; 4C26 A; 1EW4 A; 3T3T A; 1D2M A; 4HS5 A; 3IAS 7; 3T3X A; 3OER A; 2GA5 A; 3IMO A; 3A5P A; 3T3K A; 3S4M A; 1EKG A; 1LY7 A; 1SOY A; 2EFF A; 2FUG 7; 3GD0 A; 2FQL A; 3SSD A; #chains in the Genus database with same CATH homology 2DP9 A; 4C26 A; 2E5O A; 1WK2 A; 1WHZ A; 1TE7 A; 1S04 A; 4P78 C; 2KKU A; 2Z0T A; 3IUW A; 1XNE A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...