4P78C

Hica3 and hicb3 toxin-antitoxin complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MESGELIKRLEDAGWQIRGGRKTNSGSHVTLCKPGVRKIITLPYPRKDISKGLLRQAQKIAGIKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HicB3 antitoxin
publication title Functional and Structural Analysis of HicA3-HicB3, a Novel Toxin-Antitoxin System of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Toxin
total genus 14
structure length 66
sequence length 66
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.920.30 Alpha Beta 2-Layer Sandwich Metal Transport, Frataxin; Chain A Hypothetical protein. 4p78C00
1WHZA 4C26A 4P78C
chains in the Genus database with same CATH superfamily
3T3LA 1LY7A 4EC2A 2FQLA 1SOYA 3SSCA 3S5DA 3GD0A 2P1XA 3OEQA 3OERA 3T3JA 3I9V7 2EFFA 4P78C 4LK8A 1V5RA 3IMOA 3A5PA 3IAM7 3S4MA 1EW4A 4LP1A 1D2MA 4HS5A 1WHZA 3T3TA 3T3XA 3S5FA 1EKGA 2FUG7 3GD9A 4C26A 3SSDA 2GA5A 3S5EA 3IAS7 3T3KA 3SSEA 4HEA7 4JPDA
chains in the Genus database with same CATH topology
2Z0TA 1XNEA 1WHZA 1TE7A 1S04A 1WK2A 2DP9A 3IUWA 4P78C 2KKUA 2E5OA 4C26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHZ A;  4C26 A;  4P78 C; 
#chains in the Genus database with same CATH topology
 3T3L A;  1LY7 A;  4EC2 A;  2FQL A;  1SOY A;  3SSC A;  3S5D A;  3GD0 A;  2P1X A;  3OEQ A;  3OER A;  3T3J A;  3I9V 7;  2EFF A;  4P78 C;  4LK8 A;  1V5R A;  3IMO A;  3A5P A;  3IAM 7;  3S4M A;  1EW4 A;  4LP1 A;  1D2M A;  4HS5 A;  1WHZ A;  3T3T A;  3T3X A;  3S5F A;  1EKG A;  2FUG 7;  3GD9 A;  4C26 A;  3SSD A;  2GA5 A;  3S5E A;  3IAS 7;  3T3K A;  3SSE A;  4HEA 7;  4JPD A; 
#chains in the Genus database with same CATH homology
 2Z0T A;  1XNE A;  1WHZ A;  1TE7 A;  1S04 A;  1WK2 A;  2DP9 A;  3IUW A;  4P78 C;  2KKU A;  2E5O A;  4C26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...