4P7BA

Crystal structure of s. typhimurium peptidyl-trna hydrolase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
188
Chain Sequence
AIKLIVGLANPGAEYAATRHNAGAWYVDLLAERLRAPLREEPKFFGYTSRITLEGEDVRLLVPTTFMNLSGKAVGAMASFYRIQPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRVGIGHPVVGFVLGKPPVSEQKLIDEAIDEAARCTELWFKEGLAKATSRLHTFKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Recombinant production, crystallization and X-ray crystallographic structure determination of peptidyl-tRNA hydrolase from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Hydrolase
total genus 58
structure length 188
sequence length 193
chains with identical sequence C
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4p7bA00
3V2IA 4FOPA 4LWQA 3KK0A 4OLJA 5B6JA 2MJLA 4QBKA 4JY7A 4Z86A 4ERXA 3VJRA 4JWKA 5IVPA 4QAJA 4QT4A 3NEAA 4DHWA 1RYBA 1RYNA 2PTHA 3KJZA 4FYJA 3TCNA 5EKTA 4HOYA 3TCKA 2Z2IA 2Z2KA 2NAFA 4FNOA 4JX9A 3TD6A 5IKEA 5IMBA 4ZXPA 3TD2A 4P7BA 1RYMA 3OFVA 2LGJA 2JRCA 3P2JA 4DJJA 4QD3A 4YLYA 2Z2JA 4IKOA 4FOTA 4JC4A
chains in the Genus database with same CATH superfamily
1C30A 3AQIA 3QX8A 4EQZA 1JI0A 4EHIA 3NTOA 4ZEOA 1COZA 1KMMA 2HLDD 5JEEA 4R1UA 4IHJA 1G9SA 1B23P 2OO7A 3H0CA 3ST7A 4M8NE 4PO8A 3ILVA 4PTZA 1LLDA 2BKAA 1I5OA 3QWFA 4BGEA 1WEKA 4HS9A 1YDGA 2BM8A 3IAM6 5EWMA 4CMAA 1T0UA 2WA2A 5H02A 4RJJA 3GJ3A 2IDJA 2ZSHA 1IIRA 1GL3A 4NYIR 2SNIE 4PYMA 4YHHB 3GEDA 2ZT6A 4U7HA 2JHCA 4LXHA 3UJAA 3N8IA 1Z63A 2GJ8A 3B48A 3CWCA 2WKWA 4JBNA 1MVOA 2Q5OA 5E1OA 3DE0X 4M0EA 3ANSA 1PJBA 2P5YA 2PYZA 2IP2A 3GW8A 5EYPB 4YRMA 2PUDA 2AI2A 2DY0A 4WK0B 1HY3A 1L5NA 2R4QA 1Y5NA 3K2EA 1JQ5A 2WJPA 3QKTA 4R2XA 4PS1A 5DTMA 5F78A 2FE4A 3HJGA 4F3CA 2UVDA 3IA7A 3NUGA 4LZOA 5ALKA 1ZHFA 4RSHA 4UM9D 5JAHA 3IFSA 4PAMA 4YO7A 1DUVG 3QBEA 4KXYA 1WCV1 3OSZA 4C1BA 4EO9A 4WLNA 2ZJOA 2HWKA 4QUHA 4B3FX 1IXKA 5J43A 3DE3X 2Q0QA 1U0HC 1YCDA 4PCVA 1J0CA 4PPFA 5M04A 5KO2A 5HMLA 4EYKA 4MRVA 4N3NA 3TGLA 2FK8A 4TLMB 3AZOA 5JI2E 1J0DA 2KLBA 2W37A 3JQFA 2GEJA 2PKYX 1YL5A 4JUCA 2DWPA 1WW8A 1FTWA 3BK2A 4TLAA 3PWZA 3WMEA 4MMXB 2V7WA 3QVWA 3SOZA 3HJBA 3DDOA 4DNFA 3RVRA 1E6MA 1Q0ZA 2VP2A 3GN2A 2BCGY 5DCUA 3NU1A 4BNLA 1IN7A 1O8CA 4D41A 4CQJA 2AC4A 4D9NA 4AKGA 1P72A 5DRTA 4TL9A 3AGQA 5ICGA 3CW9A 2FZGA 4KGVA 7GPBA 2KBEA 5L9AA 3ZWYA 3OO1A 3FZQA 4N5NA 1O5IA 4OH7A 3KU4A 3TDMA 2OGWA 3D7KA 3R2JA 3AF1A 4TRMA 3UUEA 4GBMA 5DI9A 3QF4A 3UHFA 3AX6A 2G09A 2EAUA 4EGAA 4R7TA 1NC1A 4WFKA 2YJGA 3FCUB 1GXSB 1IE3A 5BSKA 2WUFA 1G66A 2RB5A 4JEMA 1K68A 1N9KA 2WLTA 4UEOA 1C3VA 3IR6A 3QV1A 3I2HA 4ITVA 5H3CA 3DFIA 4AKEA 4B4VA 4C76A 3QLEA 3N2YA 3OOHA 1SBNE 1VKHA 4LJ8A 4MKZA 5F9MA 3OLYA 1MIHA 2PH3A 5E1DA 1CQIB 1DKOA 2F9FA 1KJQA 1BKSB 3F3KA 1KY2A 1ZM2A 2BFWA 2HK7A 1L5VA 2JIPA 2OXTA 3JZDA 3DM9B 2JI8A 5ALFA 1GG8A 3QEKA 4YCDA 4DUYB 1GKUB 1F2UA 3PT5A 2L0XA 1GRNA 3F67A 4N8DA 5HBGA 2VSFA 3DBRA 2PZMA 3SNKA 5T5QA 2EOAA 2JFUA 2JIBA 1C7EA 4NU6A 1XQYA 3A4TA 3HV0A 3QWIA 4JFRA 1JHRA 5HNKA 2ZBEA 2A6PA 5EIXA 2Q21A 3EMVA 1LPBB 3LO5A 4UD2A 4ZICA 4AW9A 1GQYA 3P96A 1C29B 3DL0A 4HAIA 2AOTB 2XPCA 2ZIVB 3EGVA 1PEKE 3KZVA 4MCHA 2X77A 3AF6A 1QG6A 3HXKA 4I99A 1CWUA 3V1NA 3TTWA 1G41A 3BTVA 4L3VA 5H8WA 3C4JA 4QOHA 1HL3A 2BR5A 4D3FA 4JGBA 3EK2A 3MS4A 4MIEA 3ZN2A 3KSAC 2AS0A 5ARDA 4X8HA 5JLJA 3V3TA 1Y1KE 5LZ9A 1EVIA 2JASA 4OUKX 1R12A 2AZMA 4XWAA 1XJCA 3SZLA 4OSEA 1BVYF 1TQ6A 2NYUA 4PBRA 1XTPA 2R87A 1DVRA 4CMBA 2O5RA 4UNSA 1ESNA 2IZ1A 4GKAA 5CLLA 1NJ5A 1X0XA 3EVFA 4MS3A 4NQZA 5FOQA 1M2WA 1Z4OA 3GUYA 5L7YA 1JYSA 4JOCA 3HKCA 5KSWB 3AESA 1E7QA 3FAKA 1N4AA 4CKYA 3ODPA 4CYMA 5IJWA 1U0FA 1EVEA 3B20A 3FWHA 3HEAA 4UUOA 5KYTA 2AUMA 1XCGB 1BQ4A 1QHGA 3NHMA 1NRJB 2I4NA 3A1TA 1F2TA 4B5LA 5FXMA 5D1HA 3FPHA 3UGTA 1L5LA 5K5EA 1X13A 1TQ2A 3S6JA 3V4RA 1IB0A 1NLYA 1NYTA 1F0KA 2Q1TA 4GEKA 1YZQA 1W5AA 2OBLA 4PQFA 2IIBA 2ZRAA 5EKSA 3K0HA 3VZCA 3GL9A 2R7LA 4OKNA 3SXPA 3BL8A 4C9BA 2Z30A 5G2OA 3JARB 4FMDF 4RZHA 2IHTA 4KZKA 4TTVA 2M9MA 5KU7A 1X2EA 1YIOA 2VUTA 4FDAA 3AM3A 3EXIB 4OYYA 4NYJQ 2IW1A 4AG6A 3M83A 3H7IA 1Y3BE 4LRXA 2NZXA 4MZDA 1SQFA 3VNSA 3PRYA 2ONJA 3CXUA 1IPHA 4G1VA 1O0SA 1FTYA 2H4ZA 2Y4NA 4XB1A 1SG9A 3Q9LA 1H93A 3TSAA 1IY2A 2CFOA 2E4WA 1Q7TA 4JP5A 1W59A 1Q3HA 1VIAA 4BHTA 3SE0A 3BFJA 1EK1A 1RKQA 5GVRA 1NHWA 2NT4A 2HLDA 3VM6A 2A33A 1L9KA 2JAUA 2VFAA 4KQHA 1E79D 3L5KA 1R3UA 3BTSA 3KJZA 2D2FA 4EB0A 2ZJ4A 2XHEA 3B6EA 1E4VA 1O5OA 2E4XA 1U6KA 4Y2HA 2FW9A 4YJGB 2NUPB 2QTCA 1RI4A 3ELYA 3PHJA 2VDUE 4MRPA 3WKDA 3QU2A 3ZU5A 3AKZA 3M7IA 3W3AD 3KJNA 3NC4A 4BNGA 1Z38A 2BUBA 4H7FA 4N8SA 3UN1A 3L1UA 4R05A 3UPTA 3LP5A 4GDMA 4U6NA 3K96A 3KQYA 2GF0A 3BMNA 5CM2Z 2IT1A 1PU2A 3R40A 1Z5ZA 1NPTO 4HX5A 1C2YA 2JIZD 1LPNA 1UT5A 3ZZNA 2C5BA 4NZMA 5FR2A 5A6SB 4E3WA 1VMEA 3ZUGA 4BNUA 3LX8A 3VAZA 2CCKA 1BGXT 3U81A 3NHZA 3MM4A 2FUG6 2PMFA 3MIIA 4OXXA 2QPLA 3TB4A 4LF5B 1G8FA 1XD8A 2NYAA 521PA 4ODIA 3DR5A 3VNUA 3IUYA 3VAAA 5DTRA 3DZBA 2CEAA 3KT8A 1N36B 4IHQA 5J4KA 4ZI7A 4Q9DA 2IHYA 5LQSA 1R4ZA 4ZEVA 1O0BA 2HH9A 4EF5A 3H2BA 4RDCA 3PG5A 1VRCA 5JCPA 5JJLA 5E6SB 2V3VA 1AK9A 3LPNA 3ESDA 5KX5B 4BQRA 2H4YA 3GMTA 3JR3A 3HKBB 3K30A 4E03A 3ZVMA 3TCXB 4E5NA 2OYCA 2WWFA 2DXIA 3HK2A 3EZNA 1IEWA 1ZD5A 2P4SA 4OL0A 4O0MA 4PLFA 2HPAA 2JFBA 2ODAA 3M9XA 4N5LA 4WLVA 2FZ4A 3WICA 5K4HA 4JIGA 4W5NA 4QBTA 4LQDA 2Z2IA 3C98A 5F7ZA 1KEEB 4K9NA 2QSUA 2IY8A 3CNLA 1K6XA 5EZSA 3OMXA 3VU3A 3QYJA 3P2IA 2C4NA 4MWOA 4LOIA 1CFJA 1NBME 3LBNA 2OWEA 2H08A 1U1DA 1RKXA 2QM0A 3GFTA 4OQEA 5AVUA 5BN1A 3EVBA 4OBXA 1CY7A 1UPBA 2IS4A 4IS3A 1W44A 4J1TC 1WG8A 2GHIA 4JUFA 4ZRNA 2G5CA 2Z83A 3BIFA 3IQWA 1NFFA 3REFA 1JHOA 3V9AA 3O6VA 1U2DC 2R8OA 3BA6A 5JD5A 2SKDA 1IMJA 3CY6A 5A3QA 3TTUA 4F4CA 1TLTA 2YVQA 1W19A 4PAGA 2IZ6A 1B76A 2DLNA 2RGYA 2FUG1 3TLBA 3TQQA 2AA3A 5JH7A 2XB6A 4JI8B 3PICA 2H2FA 5I8ZA 2O2SA 2UAGA 3KFLA 3MGBA 4B71A 4CRWB 1EU1A 1X7ZA 4FYXA 5IVDA 2ZVDA 3C3YA 4CF3A 2FEAA 2CFRA 3DO6A 2O2HA 1X15A 4JSYA 3TNYA 3RLFA 3UWPA 4JLDA 4Y6LA 3I58A 3ML1A 3ZWNA 5LOVB 2JEYA 3TRIA 3ZS9A 2HLPA 2WJGA 2O20A 1VE1A 2CNKA 2PMBA 3BMQB 1MFZA 3FDZA 3JPWA 4FYMA 4C01A 4EARA 3OVMA 1RAGA 2FUCA 5M29A 5AK4A 2HA5A 2WFLB 3SYMA 2I2FA 4G65A 1CEQA 2D13A 3CZAA 5CGQB 3SZMA 1SCKA 1ZONA 4E08A 1T8SA 1NXPA 1A2OA 3WYDA 4HVLA 2E18A 5TXGA 1B1AA 1G8MA 2P7IA 3QUCA 3VSAA 4F92B 1RYBA 2ZIXA 1SBYA 4DR2B 5GWXA 2VPTA 4BTEA 1J5XA 1KARA 5AK5A 1TMKA 2CV2A 5JADA 3RSZA 3OD5A 4Z0TA 1KE1A 4KCGA 2C00A 3AXSA 3Q7TA 4F38A 2EL9A 2Q28A 1JQLB 1QMGA 4IOLA 5L3ZA 3T54A 3EMDA 1ACMA 3DVLA 1XMXA 1QYXA 3KPYA 2G77B 4RJTA 9LDTA 1ZR4A 3FM9A 3IDOA 4L6IA 2AX4A 4LVOA 4KNWA 4TS9A 4UNIA 4K81B 1M74A 2PBLA 5IBQA 2PG3A 1KEPA 3TJMA 2HMAA 1PGPA 3BMCB 1L7VC 3G82C 4DLVA 1AX9A 3E18A 3O84A 3O5AA 4P32A 1MABB 1E7YA 3SQLA 3SHVA 1KWGA 3DDUA 4MV5A 2YYYA 5TEVA 3VKHA 1EWYA 5JMPA 3KYIB 4LRSB 4BIMA 1YR8A 5A0FA 1K3FA 3WA7A 5C46F 5LDHA 4QG7A 4JBLA 1FW6A 3QPDA 1DBRA 2FRDA 3PCRB 1MGPA 1GPBA 1DAIA 2Z04A 4DMCA 5I7RA 3M9LA 2JL1A 4N3CA 1TTTA 3CONA 2HF7A 4AURA 3KVOA 4I4IA 4QXRA 3UMJA 3W4KA 1VE5A 3V1YA 5K2MA 4KVZA 2I3ZA 1RNLA 5BNWA 3PXBA 3TBHA 4BV2A 4MH0R 2YWBA 4MA0A 3BZWA 1H3EA 1B0PA 3FYUB 1I2CA 2XVAA 4WEOA 3RIHA 2V4UA 3UPUA 1OFVA 3BSYA 3SP1A 4QQFA 5KQGA 2GZAA 3B1WA 4QWWA 1V1RA 2ZB4A 4O1MA 1S2LA 1G8SA 2BDEA 2CUNA 5FOTA 4L8GA 4CKEA 3H11B 3P2MA 3IO5A 2PH1A 4RPIA 2VPZA 4XJXA 3ILHA 1J56A 4WCFB 4HG2A 3LVFO 5KSOA 4ID3A 1LNQA 2DSNA 4EY5A 2JCSA 2PX4A 2B2XA 3GEMA 5IP5A 4GDFA 2VYVA 3R9XB 4RABA 4JOBA 5B3AA 1NQUA 2XZLA 1UZUA 5DASA 4F84A 1XBTA 4D4HA 3W3AA 5IKPA 2J3QA 4RC9A 2OG2A 4LC9A 3BF7A 4G5SA 4EZBA 4UFNA 3DEYX 1VPDA 4ZCIA 1P7CA 2VHUA 2X1VA 2RKWA 3DJFA 4PQRA 2C3PA 3VR0A 2VLIA 4DLNA 3DAPA 1ZMBA 3SHQA 1O03A 3TLGB 3WLKX 3R3VA 3NTLA 4DAEA 2GCIA 3OJXA 1EWKA 2JIZA 3KPWA 2IEZA 4WLOA 1JSRA 4RJKA 5TQJA 3PVCA 1ZGBA 4JJKA 1E2PA 3OQIB 3D3NA 2X7XA 3G2QA 3GH1A 4NPAA 1G7RA 3UG7A 4F9FA 4P3PA 3RF7A 2HB6A 5J3JA 1MRSA 4FGLA 1P7WA 4UTXA 1Y9JA 3L92A 1AZLA 1BMTA 2QZPA 3G5UA 3UJ7A 4B7AA 2X4DA 1R6AA 3CX6A 5D00A 4OTZA 4KR2A 5ALWA 5B12A 4HO1X 4IM7A 4WCVA 2Y2VA 1Z5GA 3HKEA 4UU7A 4V3CA 2EBWA 2JA2A 1IWBB 2RBGA 3OE7A 3SHTA 5AXDA 1M2HA 3C41J 4B0OA 4GM1A 5COAA 4BC1A 5HKOA 1GRRA 3W77A 2AG5A 4EX6A 3K94A 5I4BA 4KN9S 4XWGA 4INZA 2E48A 4BGUA 2PCJA 4KLAA 3PS9A 4MGKR 3RVDA 3X0DA 4DTCA 3KE9A 4GX2A 2D1RA 4Y9TA 1T9GS 1WP9A 4G9EA 2SBTA 2VZLA 4A1OA 5HZMA 4PG8A 1G21B 3OM9A 2IBSA 2DC1A 2HJ9A 4R71A 4I1RA 2A5LA 4OQDA 4J0GA 1KORA 4ZRMA 5G0VA 4E46A 2DFKB 3CUKA 1HEYA 3HA7A 1JP7A 2EF0A 2HA2A 4Z51A 3DBLB 4MKFA 1A2BA 2H4XA 4RF3A 5ALUA 3SF8A 5KQPA 2ZIUB 2WSMA 3FFXA 5JRJA 3WOVA 4ARIA 2CYCA 3SQNA 3I1FA 4CMHA 2ID4A 1TM2A 2M1XA 1D1SA 2BZSA 2C1XA 4L4YA 3ULKA 5JSUA 5LKRA 2JDIA 1T5SA 1JHZA 2BJHA 3LUJA 3DHNA 4LJSA 3NOQA 2PZJA 2ZCUA 4FFOA 1DEHA 4JHXA 4MARA 4RDXA 1L5HB 2VJPA 2DOKA 4UFPA 2PUAA 3A6HA 4Z9BA 1K75A 4GLOA 3BE4A 4JX9A 2QTVB 1WCIA 4XGRA 4XGQA 1LXCA 1HG0A 4ZZ3A 1GDDA 3WB9A 2G1KA 2HIHA 3LYHA 2GAJA 3UMGA 1E98A 3DAGA 2O59A 4FSDA 1XRPA 2YDYA 3GJQA 4LMPA 4KSBA 5A3VA 3T3IA 1LI5A 1UKVY 2I65A 2OSBA 3QLUA 1WP4A 2H9YA 1W5FA 2LPMA 2XVZA 4H77A 1W6UA 1Q0TA 2FSIA 4RIGA 1U8EA 2FCAA 3C24A 4DRYA 3DNFA 3VKUA 2ERXA 2RHWA 3VJMA 3QZUA 3TEMA 2VXYA 2GZMA 1QCDA 4TGLA 3M3DA 3FNBA 3ILSA 1Q17A 2NZWA 4PG5A 4EUSA 2Z1MA 1FJGB 2WRZA 4ZRDA 3G9ZA 3M1LA 1C8VB 5AKYA 2FZCA 1EWVA 4YUWA 3VHQA 1Z18A 3BFXA 1U9IA 2AI1A 3AFHA 3IJPA 4IFEA 1MXFA 4OHUA 1NJGA 1PK8A 3RUIA 4BLWA 4BTLA 3F7NA 4NOMA 4IJKA 3R7SA 5J47A 2NU6A 4CCWA 4S04A 3KSRA 1J6UA 3K8ZA 3NBUA 5HKLA 2ZI7A 4RFVA 2YTZA 2BT4A 3MD0A 1E1LA 2QQ0A 1QFSA 3U44A 2GAFA 3TQRA 4GYJA 3QE2A 4NG5A 2VDVE 4U2DA 4GKKB 4EG4A 5JV5A 1M54A 5FWXA 4M6WA 4L3OA 5IDXA 3CZCA 4FYWA 1CZUA 1DRVA 4HLNA 4IH4A 1EGHA 2ZRPA 3CLSC 4LEIA 3DDNA 5EIHA 1PZMA 1GG9A 3F96A 4EZIA 1JIXA 2F59A 3F9IA 2GD1O 4L9RA 3WL5A 3A1EA 1HL7A 3GIWA 3INGA 3TQSA 3I6BA 2ALJA 1RJ9A 2QE7D 1I3NA 4NZYA 3HB0A 3C6BA 1OU4A 2YZ2A 3G1UA 1OC4A 3P2OA 3QYPA 2VNJA 3TBKA 4C0HA 2C7BA 1I1OA 3TRFA 1BQ3A 1E7WA 4WEQA 3M3PA 2CDBA 4DDVA 2W2TA 4TUYF 4GS5A 3LUPA 2QUAA 1D03A 2V0CA 5KNBH 1QRDA 2W6JD 1MQAA 3LDGA 4X95A 5LM3A 4H08A 4MRMA 4WKNA 4C4YA 4RKYA 3PLAE 2WPNA 3QUAA 4YROA 3KOUA 1IRXA 4IDHA 1B73A 1JBQA 2OZKA 5KAMA 1JSXA 4G5OA 4G4JA 3LK6A 1P33A 5L6LB 2QIOA 5DB4A 1LTQA 1RWQA 5AI6A 4B6EA 1JEAA 1W7AA 3PNPA 2ZDQA 5F64A 5GV7A 6REQA 4JI4B 2JRLA 3FVVA 5F35A 1PT8A 1ISIA 1XTZA 2W58A 3BBLA 1XZLA 4KMSA 1XDGA 4LDRA 1NW9B 3KAJA 3LQ2A 3E2PA 1K8RA 3F3SA 3NIWA 4L27A 2AEMA 4D97A 3CZ4A 3EDQA 4GX0A 1T0BA 1Z8NA 2Z43A 4HZGA 4IDOA 1YHNA 2W2QA 4ER3A 1LVHA 2H5EA 3UOGA 2FVYA 2INGX 2PUTA 4GO1A 2NTNA 1BW9B 5BUCA 4R2JA 1RYHA 2J9RA 5EGSA 1WMEA 4GL2A 3I1YA 1I7LA 2Y27A 3Q9NA 4M55A 4X3OA 3KD3A 1VIVA 1MC5A 2KWIA 4BNDA 1FNNA 1Z68A 4FLEA 1NY5A 3EFOB 2OGSA 1K7FB 2R97A 2LR0A 1OWLA 4EMUA 2GUWA 2P35A 3H9BA 4RQAA 2J09A 3DEHA 4UEWA 3PQCA 3TB6A 2BE9A 2GXQA 4TLBA 4DDKA 1LBTA 2C2BA 1FU8A 4U9IS 5CH5A 1ADFA 2G7ZA 2P77A 3ORHA 4CR8A 2R8XA 2VDLB 3MRSA 4Q9JA 3RHZA 3Q8WA 5A9SA 5FAKA 2OAP1 2PTGA 1K7YA 5CK4A 3V7NA 3PPIA 4XUCA 1NMYA 1OVGA 3IC5A 3IJ5A 2O8FA 5CURA 1VZ3A 1X1TA 3NIGB 4GRDA 1GNRA 5EIOA 1ULUA 3FDIA 3IERA 3H5VA 1CUAA 4HRAA 2H1LA 2QPOA 2RC5A 3G8DA 1WY7A 4O1IA 1PR5A 3RIEA 4Q7JB 5DP2A 4TT3A 4UOQA 1PUJA 1XCOA 2BFBB 2QZ4A 2OESA 2ZRCA 1Q5PA 3B5EA 3CQ9A 1ZEMA 1BEEA 1PS9A 2DHRA 4L73A 4P8RA 5CB6A 1OT5A 2BEVA 3O92A 4A0SA 4V1CB 3N07A 1GR0A 2D0IA 2IPNA 2ZJFA 4R1PA 5TX7A 3OIDA 1CQJA 1LGYA 1OXMA 4M9RA 3OFVA 1X3LA 4Z9FA 5EERA 1ZC3A 4LI0A 3I9V6 3RVBA 2P2LA 4MNTA 2PHZA 1Z45A 2QIPA 2ZR8A 1FC0A 4HXFB 4R8LA 5ADHA 1XNQB 3OOSA 3V9PA 1N8KA 4FBMA 1BXGA 2W90A 3RYHA 1DOAA 3R3HA 4W7IA 2YFHA 5CNJA 2RI6A 5U9CA 4F4DA 1M8JA 2G7MC 4ZGBA 3TMAA 3SLRA 4CMIA 2J45A 2WZDA 3DYBA 5M34A 4I81A 5ARBA 3LT5A 4HT3B 1RBQA 2ERCA 3RQSA 3F97A 2OILA 3QU7A 3M5CA 1A1VA 5KMGB 4ZC1A 3GJ5A 4B84A 5A3RA 4TMKA 1WBJB 2I78A 2JGJA 4A0FA 2JCVA 1E3IA 4TTPA 1EUZA 4ZZ0A 1E5DA 2C2OA 1X80B 5SYAA 3OJ0A 2Z6AA 2BFEB 3LZDA 4EJSC 4NCBA 4GPEA 3VO2A 4MQFA 3WGQA 4WJLA 2R1TA 1JR2A 4CMEA 1BSVA 2MSCB 4A8JB 3P0EA 2QLLA 1VKJA 2BHNA 2OC4A 4PYJA 3KTOA 3OIWA 4HH0A 3OIFA 3P2EA 4KQMA 4B3XA 5FOUA 3I92A 1O89A 1YZFA 3DTVD 2HW8A 2GRJA 1JQJC 3OTWA 4I55A 3FLEA 4PGAA 1LK0A 4INAA 4O4HB 3PU6A 4PHTA 5I9SA 4BNFA 4OI0A 2QXUA 1GAQA 3FSEA 3I9V1 1CB0A 3QP9A 1D2CA 2P30A 4OF4A 5CT4A 2Q2WA 3P9ZA 4LBYA 4MVJP 4V2IA 5ELXA 4TLDA 1MJNA 4TMTA 1J24A 4IIXA 2MYPA 1RI2A 2C9CA 3K0AA 2I7XA 3CLTC 1CRWG 2DU8A 4I9NA 2BM9A 4YI5A 1J7JA 1R8JA 2NACA 4KTVE 5G1OA 5JALA 2GWRA 1RD4A 3ZCSA 2XV1A 1GGVA 3AJ8A 3PA6A 5CVVA 3ZPXA 2QRVA 2HNKA 5ELLA 4E2XA 1P62B 4EPRA 5HUJA 1QLHA 3BXGA 2QE7A 2M6KA 1SXJE 3MS7A 4IKPA 3H9UA 3KNZA 4EB6B 2NXNA 2ZPTX 1FVXA 1JL3A 4MJ7A 1J7KA 2IEIA 2P62A 3IIJA 3KUKA 4O4JB 1XGKA 3VHXB 3VHRA 2VNIA 3DVAB 4YCAA 5F21A 2WWVD 5FOSA 3H5LA 1QZTA 1K8ZB 1Z5NA 1R3DA 4E5UA 2PZBA 4H1VA 2MINA 5AUPB 5BV7A 4X1OA 1RIFA 4DTIA 3SQWA 2D4HA 2F6RA 4WSOA 2CLEB 2VVTA 4KQIA 1DJMA 4PRKA 3WLRA 1C0LA 1AUPA 4LOAA 4FC7A 4TXNA 1FQKA 4YUYA 1TEXA 2Q6OA 4JS0A 3JTEA 4FONA 1XRNA 4DG8A 5KNCH 1EE2A 3K71B 1AZSC 1UP6A 1FPQA 1VMDA 4OXNA 3O8QA 5EP2A 4A2PA 1DQSA 4WOKA 2AG6A 2DJ5A 4DCUA 4D9KA 3MZ0A 4EHAA 3DUFB 3DXYA 3TVYA 1X0VA 1GVNB 1NTRA 2B69A 1XFAA 2FKNA 1S3FA 3A37A 4XX0B 4CM4B 4C7XA 3DE7X 1F0YA 5UKDA 2O2GA 2VIIA 2OCKA 4N0QA 4QFDA 4RGQA 5DNCA 2B82A 1N1EA 3KQMA 4RNDB 4QNNA 1DKRA 3GC6A 1AF7A 1WMSA 3FRIA 1QFXA 2HMSA 1HI9A 1U4SA 3BXFA 2ZE7A 3NETA 4BKRA 2X4GA 5IHXA 2FW8A 1NBAA 3PD1A 4GPBA 1U3VA 3E2MA 1FUEA 4PCUA 4YP7A 3S68A 1PZEA 4C3ZA 4OLBA 2EV9A 2HRBA 3ZYCA 4CDGA 2REQA 5IVIA 2V45A 5C8XA 2CJYA 3CF6R 2EBUA 2QD2A 3A36A 3OHPA 2ZIFA 1FOEB 1ZBDA 4F4UA 2Q62A 1UT6A 1RPTA 1AQUA 3LI2A 4XOUA 2HPVA 1WB6A 2GMWA 4JEHA 4TRRA 5EWLB 3VU9B 4DNQA 4E0BA 3RUCA 4H1WA 4ZKDA 3U61B 1NUPA 1W47A 2GEUA 3NTUA 2FCRA 4IH1A 1KZGB 1L4KA 2K2QB 1SBTA 2FPMA 2H2DA 2JAXA 4DYVA 1ZR2A 3G9XA 2JNWA 4YDRA 1JB9A 3RYIA 1G4AE 5L53A 1VP3A 5BWOA 1IN5A 4LV6A 1NE7A 1FNCA 2QZJA 2XZTA 3PQDA 2C2GA 4UJ5A 4OI1A 2ZS8A 4CLDA 1C7JA 5CDUA 3ZWKA 1PBNA 3BXOA 1BMFD 1YV9A 2WP0A 3DKPA 3PPYA 3WHIA 2D6FA 4Y1FA 1GCAA 1QO9A 3EIHA 1KEZA 1YVDA 1UM9A 4HWGA 5DLPA 5EKXA 1PL7A 1SUAA 3WGHA 1M0WA 4XQ0A 1KNQA 2F48A 4MS4A 4P84A 1SHJA 1G3IA 3BEOA 3Q12A 3V80A 2CXUA 2NQTA 3ZXXA 2CV1A 1KP2A 4JR0A 3OO0A 4ZT4A 4GZMA 2Q8QA 3DMDA 4Z49A 4PLPA 3GYBA 1E1KA 3G5TA 1BDMA 3G7UA 3F7OA 1DJQA 2VJCA 3MAGA 3LW8A 4EA8A 1O57A 2R8RA 3DYVA 1LVGA 4Q82A 3D7SA 1HLFA 2ADFA 2V7QD 4J0JA 4P7JA 5FUWA 3UMRA 1ZUHA 1R10A 4NU8X 3RC7A 5JUWA 3K31A 2W7TA 3DZFA 1VRWA 3A1NA 2P1DA 3U7JA 4LOJA 1ZIYA 1GV1A 2EDAA 1EHIA 3U31A 4C6HA 3I9MA 3GQVA 5DT9A 3QTTA 3D59A 1TL7C 3G1WA 2OWDA 4IXTA 2A0UA 2WUDA 3AJAA 1DTSA 2DQKA 4NZ9A 1XROA 1RAFA 2CVHA 4BLVA 4F6LA 3OC6A 1J1ZA 3R7DA 1HYEA 2PUGA 1SCUA 3LQQA 4YEDA 5EE9A 2JJ2D 1W0KD 3O03A 3ZHSA 4CDNA 3R0XA 1GRCA 3B51X 3K70C 4ZV7A 2B34A 3QQPA 1WHTB 2BVNA 4KQ9A 2VF5X 4BX0A 4IYJA 3DKVA 3GLIB 1I4EB 4D5EA 3OJFA 2PL5A 2NQ8A 4MVJI 3WK6A 4LXUA 3ZI4A 1PJ3A 3M89A 3WBJA 1GQQA 4J0QA 3M33A 3LQYA 2XXBA 3E82A 2HF2A 2OO5A 4R5HA 1RFLA 4TTSA 2Q50A 3NT2A 3WFZA 2OQVA 3LKBA 1XU9A 5C4GB 5JNTA 3FVQA 4RKEA 2GI4A 3UMMA 1ZGCA 1SUIA 1Y89A 3UO8B 2NGRA 4HDOB 4HWPA 2ZZKA 3BWBA 1GCOA 1P9RA 5EEGA 3DTVA 1FFHA 3NH6A 1TRKA 3ZE0B 4BP8A 4Z4FA 1SBQA 2VJKA 3ICOA 5KZMB 1XA0A 1Z0DA 1P19A 2DPGA 2X5JO 3HO6A 4UE2A 4PLVA 4ZK6A 1MPTA 2AD1A 1ZH8A 4FZVA 4G84A 4MO9A 3RS9A 1L0BA 3JVIA 4B3HA 5KSZA 4X66B 1BE1A 2HO5A 3Q3IA 3LTNC 4Q9NA 4A8PA 2J31A 4ZJYA 3RJZA 2VI5A 3GNQA 1X77A 4CWAA 1ULBA 4BC0A 2QRNA 3JQEA 4JP1A 1NM5A 2I4MA 2SKEA 2UU9B 2D59A 2R6ZA 3LA8A 2R1VB 3CHYA 4MZXA 4FTWA 1QZ3A 2W98A 4D3DA 1IBKB 3V1KA 1X92A 1JJIA 3L6DA 1GFIA 2NZVG 3CRRA 4MCAA 3DDHA 3JQ7B 1V3TA 1J1IA 3R23A 3D7NA 5C80A 4UDOA 2UVPA 2PXCA 3I39X 5EI5A 4JKIA 5JYDA 2JK0A 1CC1S 3I2FA 5F12A 2AKEA 1XE3A 3HEBA 4C30A 4LKRA 1YULA 3W7AA 5J2TA 2P79A 5ICFA 3IPYA 3VSEA 5K6RA 4NCAA 1ZK2A 4L4ZA 4O4LF 1GZ6A 1C7FA 4Q6WA 3GLFE 1T1EA 4L1KA 1PDWA 3L82B 3WGNA 5U1PA 2J7KA 5IF9A 3UZUA 3R5XA 5JJ5A 2LV8A 4Q18A 3VDQA 3C8UA 2OVFA 3CNNA 3H3XA 1H94A 1DTEA 4PYLA 2OC9A 4CL2A 1V8FA 3Q2OA 1NTOA 1YB4A 3W8NA 2J41A 4H0CA 1VI5A 4WZBE 1V48A 1NQAO 1ONOA 1VLMA 5PGMA 3SAJA 5JD4A 4NDNE 5HF6A 2IS6A 2XCUA 1KMQA 2GHQA 4MW0A 3CVXA 3A70A 5F52A 2RH5A 3PDHA 1OTYA 1B00A 1VHLA 2C83A 2EFJA 3G9UA 1JW9B 3RK1A 3ZDCA 5TARA 4E5SA 3I83A 3DLIA 3SDBA 2BWJA 1QX4A 3DVRX 1O58A 4H4EA 4RQBA 2J32A 1YH3A 2N1BA 1Q1GA 5J2UA 1ZA2A 4RGVA 1O95D 1PD0A 4IIUA 3MVEA 3S8YA 1Y8RB 1JLLA 3H8JA 4ECAA 4EHKA 3BDAA 1XMIA 4LI3X 4BPRA 2FPSA 4OUDB 1MXHA 4A5SA 3BTOA 4W1RA 3UQZA 1B6TA 2QVZX 4O2AA 4QC2A 4ALMA 3NAZA 1EFCA 2EZ9A 2H2GA 3I12A 4DIBA 4XD2A 3WQQA 1QGZA 1I7SB 1T8UA 2H1VA 1NUUA 2BRUC 5EQTA 4N47A 5G40A 3ZGVA 1PKEA 3EQ6A 4CU2A 4UTPA 2HT1A 1NYLA 3I9FA 2GPNA 3DF7A 5EKDA 5KYXA 3T7IA 1T1RA 2PANA 1QIJA 1KKLA 3KEGA 2QX7A 3B5IA 5LCXA 5IK2D 2V6IA 9ABPA 2WHPA 4L50A 1EFRD 4C5AA 3HA2A 4K6FA 4FUQA 3HKDA 5CXQA 2OZLA 1E2HA 4ON9A 3OCUA 3R44A 2AE2A 3F5SA 1O6FA 1E5TA 3BJIC 4TQUS 5B7QA 3G79A 4NP6A 4DR1B 2JLCA 2R5WA 1P3JA 2JAQA 1AU9A 1KH3A 2JCXA 2JGLA 1EQ2A 4L2IA 2H4WA 4EYQA 1BMFA 1E63A 2O8EA 3COJA 2GPYA 2GR9A 3A25A 1AIPA 1PE0A 1QQ5A 1YRQA 1CFZA 2Q2VA 4WZAA 5LYJA 4CJXA 4E31A 4M7WA 4WY8A 4DDTA 3T9DA 2OFXA 4G63A 3KR0A 1WNFA 1DC8A 2WDPA 1AB6A 3CSSA 3D6HA 2GO1A 3GLSA 3HUDA 1U3CA 4Q9IA 2MWMA 3B82A 3DOJA 2WF5A 3MJCA 1U1CA 1K9VF 1N6OA 3QY0A 4OREX 3WGZA 4AJKA 3SZ3A 5BYAA 3O26A 1GR1A 1ULAA 3DV9A 4RJ2A 2ZRGA 1QTRA 2K4MA 1ORDA 1GWNA 1TMYA 1ZJYA 4TV9A 1FSPA 3QITA 4D6YA 3A2MA 3P9SA 1M34E 3ZE9A 3R1IA 1EFLA 2V7QA 5F3RA 4G1CA 5JJKA 2O8BA 2G9VA 1MW9X 2DWQA 3B3GA 4G89A 1ZLXA 3RE1A 2NYVA 3H2ZA 4NAHA 3EMKA 1RWVA 2HXGA 4W8HA 3FB4A 1YKSA 2CXRA 1LF0A 5IT9A 1R0CA 2YOHA 4R81A 3P20A 4PRLA 1E9RA 2ONZA 2ZDGA 1NATA 3LC2O 3NAMA 4KBGA 4OIFA 3INYA 3PNLA 2EGHA 2FSHA 4Q3CA 4QDXA 4RX1A 3I1IA 5SZHB 5CB4B 1H3NA 2AG8A 2CCGA 1Y3FE 2QU7A 3P2KA 4NBTA 1XAGA 3W5HA 2VDPB 5LLDA 2Q5EA 1WXWA 2JJ2A 2XWJI 3OM0A 1AO3A 1EP2B 2VF4X 3DO8A 4EA6A 2LIPA 3CM0A 1CJVC 4NMWA 1QK5A 4H1UA 4RYLA 4DIMA 1SC9A 2G6BA 1EUCB 3OP1A 3SQDA 5CB0A 3DAFA 8AT1A 3KCNA 3D4LA 3NHYA 5EIFA 4W1QA 1JVBA 2HFKA 3FX2A 2VH2A 2QA5A 4WBNB 3ITDA 5I9TA 4D98A 1A8IA 1RXSA 2VJDA 2F64A 3L8HA 1LVUA 4CLEA 1KDPA 2DERA 1JG3A 4JL8A 3UK2A 2VPPA 4LJ9A 2GCNA 1OBCA 4TYQA 2J3EA 3HADA 2G9NA 1AXEA 1U8UA 1P6UA 4D4JA 1Z5WA 2IHZA 3FLAA 3G2LA 2NXJA 1J5PA 5LU9A 4P93A 3LOUA 4UHKA 3N6RA 1N2ZA 1T10A 2HCTA 2VHZA 4Q9HA 4BO3A 3FYUC 2FE1A 4D99A 1MCZA 3I8XA 4JLMA 3KOYA 4D02A 5BO5A 1B15A 2PSJA 4HATA 1E9VA 5DGXA 3RPEA 2A1IA 1C8KA 3D8NA 4I46A 3S2GA 4C5BA 1E20A 3GNSA 3GPLA 5EJ2A 3LQKA 3T7SA 1JG7A 3GBSA 1DKMA 1QK3A 5AVJA 3V8VA 2FR1A 1IN1A 4CFYA 3COZA 4WCFC 3T5BA 4DA8A 2WMNB 4F2WA 1VYHA 3DOFA 4KWIA 4V3BA 2OV3A 4IIJA 3WRYA 3VV3A 3QF7A 2AI3A 5AWFC 1XAIA 2IWHA 2QZSA 4F12A 1OI3A 3QIVA 3GEIA 3IOEA 2XDQB 1W2HA 4D2IA 1BX0A 5CFNA 5K05A 3N2LA 3GT4A 1XTTA 3NKFA 4RK6A 3SS8A 4WECA 5CCBA 1SCBA 4RACA 1R18A 1RTKA 1R88A 3Q7QA 4HZIA 4HNUA 5F5LA 2HCBA 1VFNA 2GN8A 1PN3A 3HU2A 5FR1A 1NI4A 4BFXA 3EPRA 1KQPA 3T0IA 1HO3A 1OBVA 1RRCA 4YPOA 3CKMA 4MV9A 4LFCB 5JCJA 1R0RE 5TNXA 1UDRA 2BR4A 2CMKA 2AR9A 2LRHA 2V65A 3H8WA 2YRXA 4HRXA 4FNAA 4JAVC 1V6CA 1IAVA 1FZQA 4RCZA 3GFOA 2JBAB 3F5DA 4FLFA 3NHFA 3T7EA 2BH2A 4QPJC 5HOQA 5IJ9A 4PNZA 2GPWA 1D1QA 5KTRA 4DLZA 3L18A 3Q2KA 4QRDA 1PT9A 1W88B 4PZ0A 4BOYA 5CX1A 1P75A 1DJNA 3A05A 4FCVA 5J2TF 2FP3A 3E0XA 4A1FA 1RZ3A 3DCIA 4BO9A 2JJ8A 5IKOA 4X92A 3WAGA 2XB2A 1US8B 1RACA 2BEWA 2ZSDA 3ENZA 2FTKE 3I05A 5LJIA 3HVJA 3LZ6A 3EIEA 2XYRA 1XQ9A 3PJFA 3NBQA 3R5TA 4YRRA 1MEOA 3B6IA 1FP2A 1CS4C 5HFNA 1NN5A 3T3MB 3LT2A 2BMVA 5EJ5A 4P34A 1CRPA 4DUPA 2NZUG 3BXZA 2WFMA 4UASA 4YA6A 1MVNA 1OZAA 4R6WA 5LDDC 4X7BA 1BVUA 1PHRA 1HEIA 5EJFA 4OQYA 5E8RA 2DCMA 3VOSA 1CUVA 2WJHA 4F6CA 1ZMTA 2Y1XA 5EZQA 4B43A 2OFWA 4DM4A 4F3NA 1QB7A 4EKNB 1BAPA 3COVA 1JI3A 4IP0A 3JZMA 2G63A 4DMGA 4K40A 4FN4A 4ZT5A 1NXOA 2CF5A 1EFRA 2HQRA 7REQB 1AGYA 1GZSA 3EVCA 4BO6A 4TMZA 3OWXA 3UJ6A 1V0JA 4ZDKA 2BUCA 4O2AF 4D6PA 3RYCA 6CHYA 1MIOB 1DCMA 1QM5A 3OZAA 1CR0A 3IDSA 1AV6A 1PTJA 3J7TA 4MUNA 3L1JA 2C2HA 4PBTA 2FW6A 5DYNA 5ULLA 2JJQA 1SOWA 2VT3A 2ICAA 1A7KA 1SVWA 4FHGA 5A04A 4L4XA 4FMBB 3CWQA 3JALA 5D6NA 3W2FA 1NNI1 2JAPA 1P5ZB 4Y98A 5HSGA 1QLWA 3CT4A 1WVMA 3E48A 4CIVA 1LLFA 2QAJA 4KFCA 4P22A 1QO0A 4QLAA 1KI7A 3B7WA 1NW3A 2ZTVA 3FTNA 3G8AA 3FTCA 4FP9A 4RZ2A 3UGJA 1G7TA 2BGGA 3OIUA 2XIQA 4IXMA 3ZQ4A 4AY5A 2PWAA 3ZOZA 1J8YF 1X87A 2YWRA 1PFUA 1HDCA 4JDPA 1BWSA 1LH0A 1N6RA 2R6DA 1BE8A 4OB7A 1E2BA 3NDBB 4G0VA 1JEQB 1PWEA 2YUTA 1FDTA 1D4AA 1XZAA 4CHGA 1T6ZA 4EFMA 3K6RA 3KHUA 3COYA 5LYJF 2E4UA 4NAVA 4B33A 4LIPD 1ZM9A 4ZQCB 3GA0A 4EHHA 1MJGA 5F77A 3C3EA 3IPLA 3H2YA 5D2CA 1N33B 3P71T 4LNUA 1G0OA 1HTWA 1UXKA 1HKUA 3GJ7A 3OH8A 1YS9A 3A8TA 1QXSA 1K4YA 4BU1A 5K2OA 3TW8B 5L3SA 3OCXA 3NXKA 2OM6A 3M6VA 5CA0F 1L3IA 2R79A 2VT7A 4EI7A 2ID8A 2QL7A 3CEMA 4XQGA 2A9VA 4YUZA 2AYXA 2PKQP 2CLLB 1F2VA 3CT6A 2JHAA 3QVTA 4IV5A 4DG9A 3SKXA 1BHQ1 1YL7A 2OSVA 4GMGA 3OZDA 4UREA 2VZEA 3F9CA 2X5KO 3QKSA 5G0UA 1YHZA 1YRAA 2GXAA 1R64A 1JLRA 4CTKA 4O2LA 2R84A 1QIDA 1JNXX 3DM5A 4ZCQA 2WJVA 4LNHA 4PNEA 1PV4A 3LUGA 3PUHA 2R6CA 2WOOA 1WY5A 4B8WA 1KAGA 3FCXA 3HCDA 5KOHA 1WZEA 3PFBA 3S2UA 1RSZA 3P9XA 2NU7B 4XARA 2DR0A 4Y1RB 1IBLB 3KJXA 4LZNA 3PUXA 3WJ1A 1U0OC 4DLBA 4I66A 2DFDA 1SXHA 3I52A 1JAHA 4MX8A 4XPIB 2XGGA 2Z9CA 4UAUA 3RSFA 4M4SA 3FSJX 2PXXA 2ZLBA 3AZPA 5DM1A 3M81A 1R4MB 3ZLUA 4E5VA 4UVEA 2ECQA 2II6A 5EVJA 3CF2A 3VX3A 2RGWA 3C5WP 4ZZIA 1SQSA 4EDFA 1R00A 1V9CA 3A9SA 3HSKA 4YT5A 1WE2A 3U3MA 3UCXA 2XWBF 2RHJA 3GDOA 3IIIA 4BVFA 3BGIA 3C8HA 1KK3A 4EJ6A 4F2DA 1E4OA 4BB9A 1E3DA 2B37A 3QVOA 2VYNA 3O8OB 3LUHA 5FTWA 1AKYA 2I03A 2IHVA 3HR8A 3D8TA 3LGXA 3IE2A 1VE9A 2RGCA 3E3NA 3ONFA 1XD2B 2HADA 4NV3A 4KQKA 3CE9A 3N70A 4U2GA 1NMZA 4DDMA 3AVOA 5BT8A 5KNDH 3GCZA 4MQUA 4YLGA 3WDSA 3FFWA 3ERCA 1G1AA 2J9ZB 5CYOA 4GQIA 2AOUA 4QO8A 5KYWB 3UM9A 1CR4A 3KHSA 5A4JA 4Y8VA 5K0LA 2NPOA 5FTLA 2C88A 4ZDIA 2HWUA 1QS0B 1DWQA 3KKEA 1QDEA 2DGDA 2I76A 4IIJF 3TQIA 3UGQA 4TL8A 4HPXB 2WYVA 4M87A 1CE8B 1L4YA 1P81A 3TLMA 5HJEA 1F8FA 2D7JA 1F5NA 5JS1A 3LOQA 2JJMA 3FCOA 1KO5A 2IGBA 4KBFA 2AFHE 5MDHA 2B1RA 4DT1B 3RUEA 2JATA 2YV4A 3LCUA 1C30B 3EC1A 3T1YB 5DTQA 1A8SA 1BOOA 1M66A 4YLYA 2C1ZA 1EGAA 2QRJA 1FBNA 4KWCA 5KYNA 3B78A 2W2MA 4IHJB 4MKGA 5DRYA 3CNEA 4J1NA 3K53A 3N2GA 4L74A 4POAA 4LF8B 3PF8A 4DLXA 4EGJA 3ND8A 1Z0JA 2JI7A 4D74A 1LBHA 1RRKA 1IYZA 1J09A 2KB0A 4XIFA 5E8JA 3AJ9A 1XCLA 5EZYB 3LP6A 1OROA 4QYWA 5KHLB 3K32A 2VHWA 3D8UA 3HDHA 2JKZA 4MV1A 1C7RA 1M2FA 2P5SA 1T4CA 3AKEA 3OX1A 3RK0A 4YRZA 5BW8A 5GIPE 1ZQ1A 4GMDA 4AB1A 4DREA 1IDOA 2X8LA 4YYZA 4DR6B 1JWBB 2GEKA 2OLKA 3BBPA 3HPRA 3RUPA 1TK3A 1S02A 3TMKA 2W2KB 1YGYA 5CTJA 4YRNA 4XWKA 4TZ6A 3RS0A 4BJ5A 2DUNA 2WINI 2IUUA 2OQ2A 3BD7A 4ETNA 2NU9A 1E32A 1GZDA 3EQ2A 4AKHA 1BC5A 2O05A 4LK2A 2ACVA 2JH9A 5CMLA 5DJ5A 4ENQA 2GKOA 3Q7SA 2O8DB 3HZHA 1Y9AA 3RWMB 1NW8A 1T6BY 4E1BA 3ZTYA 4UATA 4EFNA 3W2EA 1U0EA 4MKIA 4KJXA 1Y82A 3QA3E 5CIYA 5CFPA 1WZCA 1T8WA 2YWJA 3DMNA 4JLSA 1A71A 2FR0A 4E6EA 1F48A 4KBYA 4G5FA 1OI2A 2QP4A 3P1JA 1KDZA 1MGOA 1IWPB 2SICE 2DFTA 2F3TA 4IOMA 4YGYA 3WTBA 4A0RA 4B87A 4BVAA 3HFJA 1JILA 4A8JC 5TMPA 2F43A 1ZNQO 4O2BF 1D1TA 3I9JA 4R31A 1YRBA 2VP5A 4C4OA 3MXOA 2H54A 3LSYA 1PJCA 5JPIA 2JEZA 3A3NA 3NEAA 7MHTA 3GJXC 2PNFA 5EEHA 4HK4A 2QJWA 2B9EA 1YQWA 2K5UA 3K0EA 4PEVA 1T43A 2FX2A 3PL5A 4DY6A 1LS6A 3CLKA 3VR6D 5BURA 3G5MA 1FSFA 2CLDX 5THQA 4AP5A 5CJPA 4M21A 4IW3B 3WS7A 4ZHSA 1Z8FA 2GYYA 4G56A 1DZ3A 4OBWA 4ENWA 3QX7A 4IGKA 4Z3KA 3GDGA 1EQAA 5CIWA 5GJVC 5FQOA 4O33A 1D1PA 2PO7A 5AK6A 2QAIA 4BX2A 2Z4TA 3L7OA 4QDUA 1I7PA 1AO0A 4OX9B 1E18A 1VLQA 3DKKA 1F2UB 3HWWA 3TLCA 3MBIA 3QNMA 1YU9A 3P27A 4JUAA 4WD3A 5KTMA 4ZI3A 3OQNA 3EGCA 3DBRB 2GEBA 4U2FA 1Z36A 3MAAC 4XQ9A 1PGJA 2VHVA 4EW2A 1HDIA 4FOOA 5F5XA 2F4VB 3MYYA 3KKKA 4EA7A 3TTSA 1W8IA 3ORSA 4XD7D 1MDBA 3ZGOA 5IABA 3H75A 1OFHA 2IZZA 1JEEA 2PH7A 3GEBA 2WQ7A 3KQQA 4RELA 1SVLA 2AJLI 2QPAA 3GNLA 3BX1A 1C0PA 5BNTA 4EY4A 4QYTA 4E7PA 2LE0A 2POQX 1DC6A 5LDGA 5BRJA 4XUGB 3BICA 1RLMA 5GZ1A 4QUKA 1ONSA 3O8LA 2Z5LA 4DANA 2MDTA 3L0IB 1VECA 2PMWB 4I6GA 2I7DA 2I9KA 3DDCA 1OX4A 1G59A 1DIRA 4BJHB 1ISJA 5LQDA 2HLHA 2I62A 2GZ2A 1IDN1 3EBPA 4BDTA 1O9BA 4PXSA 1Z6ZA 1M33A 4TV8A 4DGQA 3HN7A 4FM9A 1FDIA 1S2IA 3NVDA 4MS3B 4XVRA 4JX8A 2JFOA 3IEMA 3AESB 3QM1A 4TX1A 2J0VA 4TKZA 4YQYA 3MJRA 1WR8A 2HBZA 3U9LA 4DEVA 3GUUA 1F2TB 1GUDA 4KK4A 5CA1A 4ZALA 3NP9A 4MV3A 2WHQA 2C42A 1TJYA 2PS9A 4J76A 2QRZA 4FCCA 1LC0A 3FBTA 1VXOA 3QBTA 4K1XA 1ZUWA 4IJWA 4FB5A 2F3SA 4TMVA 1FUUA 3NV9A 3P9PA 3FYDA 1ZW1A 1HNZB 2DHEA 3IRUA 2RG1A 1OFUX 1MMFB 2DR2A 3F5FA 3RJMA 1KMCA 4UUPA 5GV8A 1A95A 4K5QA 5HQJA 5AW8A 2A67A 3I37X 3HDVA 1YIAA 2AOXA 2HOQA 3QHPA 2I71A 4IILA 4MUMA 4WMLA 3STYA 3TKLA 1U3DA 3VTKA 4LE1A 3UB4A 1E9FA 2I67A 1CQPA 1HKHA 4MRNA 2BTQA 3EQ7A 4LG1A 1GPMA 5AJXA 5C9ZA 4J0FA 3TIFA 3UANA 3SG0A 1D07A 3F8TA 1OJLA 4TT8A 3CUTA 1KSGA 2DUUA 4I4LA 4XGNA 3SSOA 3DKRA 1MZVA 2CMFA 3GRVA 3KS9A 4QGFA 1YBMA 1WULS 3E23A 4KKXB 4R41A 4ZD6A 1YB1A 2JD2A 2ZUVA 5JYBA 3PJDA 4B5KA 1KBZA 2PA0A 2W6IA 3N53A 5B1YA 3U3DA 1PTKA 4G5YA 4LJ7A 3D2CA 1E0DA 1GIAA 2WV9A 4ZGWA 4GWGA 2KX7A 3G7SA 3I09A 4NVRA 2O5EA 1A4RA 4ZVSA 2A92A 5JSKA 3I8SA 4MAAA 2R8YA 3BJRA 5ALVA 4LF4B 5CDHA 4WESB 3T9BA 4JROA 1XKQA 2HA6A 2B5OA 3TD2A 1KBOA 3QHAA 4JLJA 2PQ2A 1U2SA 4DYHA 2WJ4A 4IQGA 3BB3A 3AFMA 5T4EA 4NV1A 4KH1A 3BMNB 2ZZNA 2CLCX 4LZZA 4OGWA 4XPZA 4TXLA 2J3KA 4GOND 4AMVA 4F06A 3HXQA 4ISCA 4FC6A 2F3PA 5C32A 4RTJA 2N46A 4UM9B 1GZUA 2OBMA 1FDVA 2R1ZA 3N86A 1WUHS 2ZJ5A 4X6YA 2O7RA 2R6FA 1H6BA 1KP3A 2WE7A 2Y0EA 4KFTA 4UE6A 1ZH6A 3QXJA 1L5OA 1BHSA 1P4HA 5DNUA 1C9EA 3BAFA 1KO4A 1KRHA 5KWEA 5A6VA 1YZUA 3A26A 3OCYA 4FDMA 4OKIA 4Q19A 5ILQA 3UEOA 3L41A 1OXBB 2B6HA 2D5LA 3A0UA 4WA7A 1RJFA 4RZ3A 1M5TA 4F4HA 1NXQA 4L51A 2FWMX 4LHZA 1I1NA 2Q8PA 4KO1S 4ZI7B 3C8DA 4I5IA 4LF9B 2CDRA 2R47A 5HUHA 1ZGGA 1RM4A 2H2WA 3A10A 1T9BA 2JFPA 2PQMA 3ZY6A 4S2EA 5BW6B 5JAQA 1C4WA 4GXRA 2O8NA 2X40A 4PE5B 1VJDA 2ZIGA 2A9RA 1AGRA 1PAUA 4Q93A 5DZSA 3I9KA 1BO6A 1SKAA 2Q41A 2YZ7A 3PFKA 3ZD9A 1A8HA 4BATA 1P31A 1I4DD 3O91A 2YNMA 1K7XB 3PLNA 4QULA 3ED1A 3STUA 4CHTA 2Q3MA 3GEEA 1JDZA 2F7SA 3CF0A 3NYQA 4X8OA 2WP8J 4JLVA 3HUEA 3TPZA 3V7WA 3P7MA 3KXLA 3SFZA 4CLRA 2HMWA 3K2QA 2J7PD 2JGEA 2XIJA 4P31A 5JD3A 3VR6A 3IMFA 1K9SA 3HUFA 5DCWA 5ER9A 1U7XA 1I14A 4DLPA 4TTAA 2IGTA 3F7MA 5A1JA 2XT0A 3IV9A 5L8VA 4K05A 2DQ4A 3CJRA 1Q20A 1MX1A 1Y37A 2KYRA 3PVZA 3WL8A 5BSHA 4WGFA 4X60A 2IH2A 4UEQA 2EVWX 2UZ1B 1DMRA 3PD0A 4EKGA 1O9GA 4PLYA 3VDXA 4JLUA 2PLNA 4DCGA 5INTA 4B8ZA 4D79A 3IDZA 6ADHA 3JWGA 1UQUA 3CLSD 5IVKA 3SFTA 3ENKA 2HHAA 4U2BA 2IPOA 4HLUA 3DEFA 1AQ6A 2AN4A 2ZRIA 1F4LA 2GN4A 4G3XA 3CKYA 4IVPA 2OCBA 4HGYA 3JCZA 4ILKA 4WINA 2FOIA 4AZ3B 4JT2A 2CL5A 4KPYA 1NWCA 1LQ2A 2MIIA 2GCGA 1ZK3A 3FDZB 1ZRMA 3RCBA 2FFQA 2B6NA 3AEUB 2H63A 2LD4A 2VS1A 4OA8A 4EPVA 2XTZA 1J8MF 1OXUA 2XNCA 2I4IA 3FW1A 3O2JA 4JC4A 4BFSA 3E9DA 2DY1A 1KTIA 1CS0A 3PQFA 2PVPA 1NFRA 4QBKA 3T7CA 3PHHA 3FGPA 1II9A 3RSCA 1K2VN 4QHYA 4ZMRA 1N6LA 2G06A 2OQRA 1T91A 2PYDA 2ACKA 1R27A 3MOIA 5CVJA 3FXAA 3FPBA 3SZUA 5ALGA 1WXEA 3GRKA 1RWOA 5FPQA 4EKDA 4NFSA 1TZBA 3ZI7A 4UZSA 5EE3A 4AMGA 1BH6A 2OPBA 3H04A 2VQDA 5I9MA 5KNBA 4NYIQ 4W9NA 1V8ZA 1W49A 3FCSB 4ND4A 3NHRA 4LGMA 1RKBA 2JH8A 2YWDA 3LD9A 1QKIA 2B7LA 4TWIA 2VAVA 4URWR 2IA5A 1Z08A 1Y7HA 4YBZA 2WWXA 2NO5A 3M4YA 4DR5B 3PITA 3VZDA 5HIJA 1QSGA 3K0CC 4TVOA 1OH6A 5KNCD 3WLPA 1JKJA 1HNXB 1EMDA 1DZIA 2J08A 4RXMA 3K9FC 3LRPA 4D9CA 2ZBRA 3SHFA 1ORRA 3KO8A 2R2AA 1N9ZA 2XYGA 2JB9A 1FDWA 1SQGA 3V34A 1F51E 4C7JA 1IN6A 3ZHYA 2X3YA 3M5WA 5FB3A 1RI3A 1AN0A 3I8OA 1LA2A 2ETXA 3ACDA 4MWEA 1JJFA 5D3ZA 3H1FA 1LCIA 3EWNA 3KG2A 3LUKA 2G1UA 1CR6A 2VPQA 3R09A 4PPNA 4AZVA 4NLLA 5CA1F 1WPGA 4OHBA 5CU7A 3UOAB 4DPLA 3HE3A 2ZI4A 3NHUA 3ID6C 5CVCA 3WRXA 1JIQA 3MBKA 2IIQA 4CKEB 1KEKA 4PHGA 1ZI8A 2EBHX 1QO7A 4BCDA 3E3OA 4Z4CA 3X1JA 1JS1X 3IELA 4C0JA 1NSYA 1GOTA 3NH9A 3PSAA 3RVSA 4RHCA 1P1FA 4FYKA 2ZVQX 5TC4A 3LYAA 1BH2A 1K89A 3R3SA 1Y6RA 5BNFA 3NBXX 1YVUA 4GM4A 2DETA 3TD6A 2A8YA 5C53B 1E7RA 1KHTA 2X23A 3SLKA 1PQUA 3KZ1E 1KQ3A 3LC0A 3MB5A 3HA3A 5IYZA 4WWHA 1C3LA 1ZI9A 2W2LD 1M1YA 3DCNA 3KPJA 5DI3A 3ZHCA 4MEBA 4D9MA 4AQ7A 1T1JA 2XYHA 4DBZA 2ZIWB 1BCSB 4PCAA 5EVCA 4MW6A 5FCDA 4TQ9A 3DBIA 3MF4A 5AW0A 2PKXA 4O4IF 3VOAA 1LZKA 1HG1A 3BJEA 3NVMB 2BFDA 4N01A 4UBIA 1YCHA 5H1YA 1BVHA 1JHXA 1P2UA 2NADA 1RDFA 2HRQA 1IUPA 2ZBFA 1KH1A 3EW9A 3IVRA 1OX5A 2XUZA 1M6VA 2RAPA 4IDQA 4L07A 2MYUA 2ZT8A 4AVYA 3SN6A 2OO3A 4HEQA 4MI1A 3UK7A 1O94C 2Y8EA 1HZJA 3NATA 4Q4DA 4JB0A 3BXEA 2YHIA 4JVNA 3RTCA 4GYYA 3E5NA 3KYJB 1CQWA 1Z3IX 4EM6A 4I5GA 4D8VA 2ZYDA 3K5HA 3NWEA 3DZKA 4NTZA 5D3QA 4IXDA 3N58A 4LISA 4B82A 4EQ6A 2XCSB 4EKEA 3GDWA 4LQCA 1NFQA 3LECA 2WD7B 4K9DA 5COBA 1W94A 1LRJA 4DLUA 5D5HA 3LT1A 1SB9A 1YS2X 2B4AA 2MSWA 5HHTA 5I3ZA 1L5KA 4BN4A 3JR7A 2D7CA 3CRMA 4IWYA 3RLIA 2ZM6B 2F9LA 1U5BA 3Q8XB 1EIWA 2YYAA 5GZ3A 4ZYTA 1TQ8A 1P7YA 4H9GA 4YJ3A 2V4MA 3L06A 1N2EA 4UUMA 1IHXA 2P5TB 3FDXA 4HDQB 3TEFA 3ZBTA 2JIQA 4XQCA 5I7EA 1OLXA 3MJ4A 5IAKA 3PGKA 4MV6A 2F4NA 3Q4GA 1RADA 2J7PA 2XJ9A 1GPDG 4CG3A 3ZZMA 3R7NA 4JQOA 2OV8A 1QYIA 4AF6A 1UBOS 2XZDA 2IOFK 4WXEA 1RYYA 2FYTA 1GJRA 3HL4A 3BD6A 2AEEA 3E9RA 2J0UB 1O87A 4G1EB 3ZU3A 4C0AC 5IFLA 2QYOA 3IB3A 5JMTA 3LXRA 3OAAD 3CLTD 2Q3LA 4HHEA 1WCIB 4I1OA 3IXLA 3W3ZB 1AMNA 1IXZA 1YQEA 2WWWA 1MX5A 4N5DA 2VQEB 4G97A 4G5QA 4QUAA 4L08A 2C5HA 3U5ZB 1I3OA 1WF3A 4B6PA 1IC6A 4ZYZA 4JELA 2PLAA 4PYRA 1P4SA 4ZODA 1Q0QA 1FFCA 3IE0A 5BSFA 3KJEA 4P80A 4KK3A 1CJCA 3DZGA 3IKJA 1W93A 1TF7A 5HCIA 1PJTA 3UA3A 3BMOA 4CM8A 1N6NA 1ZDMA 3C15C 3KQNA 3IT3A 5K3SA 4GSKA 1RM0A 4MLCA 1QHXA 2O4CA 2FFAA 2ZJYA 4LRYA 1V9SA 2PRSA 3QJ5A 4NYJR 1WHSB 5FX2A 2BP7A 2Q29A 3EF1A 3PNVA 3LQRA 3ZTTA 4AZ0A 4TXMA 4EG8A 2GAAA 5ALZA 4C7KA 4AAYA 1QYCA 1R5NA 1TKAA 3L05A 3A6ZA 3AR3A 3EZ7A 5HBRA 4E51A 4EEZA 3VBCA 1DEOA 4Q4HB 4JENA 2VK2A 1RS0A 1YNOA 5LZ8A 4BDSA 1AGXA 4ND8A 2H8GA 5FWXB 1R0XA 4M6WB 4QE3A 3EY9A 1KMHA 2V97A 1JYEA 4DA4A 4WE3A 1PSDA 2V7GA 3E4CA 1QF7A 3OU2A 1T5HX 1S9HA 4KPGA 4UDNA 1RHMA 5CJJA 4YACA 3NHPA 1NRIA 5AHXA 3C5HA 3L40A 2FPWA 4IIEA 4YRGA 1T1SA 1YA8A 1GVHA 1CUSA 5P8WA 4A6DA 2PUCA 4MGZR 4C0QC 2VYCA 1RMYA 4RH1A 2R00C 3O4HA 4IUCS 4KAAA 5J1TB 2ZJ1A 5J5AA 3X1YA 4D45A 1JJ7A 2BKUA 3FMPB 4JV5B 1QAOA 2G9ZA 5BV1A 1XVVA 3OF5A 2XYPA 3N2NA 3ZKWB 3RSOA 5IRCD 1DX4A 4WACA 2NSYA 1JSZA 4R2LA 4MA5A 4PIPA 1Z0IA 1X1RA 4V0LA 1IATA 4HSGA 2M6RA 1PDVA 5AUNB 1R6TA 1X1EA 4B09A 3IEVA 3DMYA 3NANA 1P1RA 2PGAA 3KT0A 1CUFA 4I6EA 1NAIA 4OQ4A 5BSUA 6REQB 3SWWA 3OURA 2C58A 5FPPA 2GARA 4HRYA 1GLNA 4MINA 1LJUA 4NJMA 4AP6A 5AESA 4ZI5A 1NONA 2HIAA 1Z4KA 4WL0A 2I6QA 2WWTA 3O95A 5LU8A 2PBZA 3D9QX 2QTGA 4KPFC 2V7BA 2C94A 4HADA 1C14A 3S5UA 3II6X 4INOA 1SD1A 4JR2A 3ZDAA 1QGOA 4CM9D 4EYGA 4F3KA 2PUJA 1VHJA 2AUNA 5HE8A 4BFCA 4M9UA 3WRWA 4EG7A 1IHPA 5AHRA 2FG7C 3FPGA 4D9BA 4ABYA 4BNDB 2IFTA 1KI6B 2AD5A 4O8CA 2PSDA 4WOPA 2C8KA 3C3CA 1JR6A 2WHYA 2JCYA 1PT6A 1LI4A 3MTEA 1ZIDA 4DB2A 1GSIA 3FIUA 3QLJA 4LHWA 3S1SA 3RWOA 3D0QA 1DU4A 1PDOA 1GUYA 2JLQA 4BKQA 3SYKA 4OJKA 4LUCA 4QJ5A 4S1VA 2CVQA 1CIVA 4A03A 1CULC 3L4BC 4BCBA 4EI2A 2P9YA 4MW7A 1SVMA 4JP3A 1SD2A 1AQYA 4RLQA 5IAEA 4D9EA 1V45E 3NDJA 4M53A 3T4UA 1U9JA 4DT1A 3ME5A 1UJ5A 2X2PA 4HFJA 1Y8AA 5LLTA 4Z4GA 3D3WA 3X44A 1ZJWA 3HI6A 3WMXA 4EW3A 4CXMA 3AIKA 3M6FA 4CCSA 4FFSA 2O8FB 8ADHA 1R0ZA 2FN3A 5K45A 2X9QA 4RA6B 5TPZD 1I0IA 4EKYA 4C7VA 5K9ZA 3WGGA 5BN5A 1TGYA 2BF7A 3ZE6A 3B1YA 3K70D 5B1EA 1N2GA 1T0PA 4X1KA 4RV5A 5I48A 1UBUS 2P9TA 4JI0B 2WD8A 3VR1A 4IDEA 3DW3X 4UCWA 4WZAE 2V9PA 4GZ5A 4BZXA 4DOMA 4E5YA 5K8TA 3JD0A 4FWTA 3FPKA 2BEVB 1P73A 1TCAA 2PN1A 3GAAA 2OGZA 4EJSA 1KAHA 1FRVA 3OOWA 4DLKA 4H17A 1CQJB 3OQBA 4UXHA 3EGEA 4W5QA 1GPAA 1Y0BA 2A78A 3C3PA 3QPAA 3AV3A 1XWFA 3WLJA 1LU9A 1KRWA 3R41A 4AWXA 5BWLA 3NMUF 4DCPA 4KO2S 1TYEB 4U6SA 3RRXA 2P9ZA 2RGNA 4IEIA 4MVJA 1BXGB 3C3BA 4Q3DA 1P1KA 1P5RA 4JOSA 4KC0A 4A4DA 3FOCA 2AT1A 3QQ5A 4Y9SA 3MCZA 2F67A 4CMIB 2IOFA 2P2ZA 1I3MA 2WILA 3OPMA 3OTOB 4UBNA 1B43A 2OG1A 3PTLA 3A1UA 4JKYA 3K4QA 3IURA 1HE5A 2QZZA 2ZR7A 4UUBA 3OAAA 3L7DA 1FVHA 2CJFA 1LBQA 1R6UA 5JSZB 5GQSA 5C4IA 3ZOKA 4QXAA 4HDRA 3FOEC 2VSNA 1TJPB 4JZKA 3AL0C 3QKRB 4DG5A 4LVUA 5FUMA 2OORC 4QTZA 5IZCC 1ZRHA 1Z4QA 4FYVA 1RYFA 1B1CA 3ETEA 3RGWS 1HDRA 4YONB 2R1TB 1SIBE 2ZB8A 5EYPA 4YT2A 3GPDG 4TROA 4D3ZA 2GK4A 1O9HA 2AX3A 4WV3A 5TQ2B 2HREA 4HB2A 1JPVA 1YCGA 4TRNA 4M0PA 3TRHA 3RADC 1E1QD 1Y42X 4NMLA 3H8VA 4S0XA 4Y6GB 3M6MD 3ESZA 4J16A 2TYSB 2EYQA 4G0YA 1OJ7A 3FWNA 1GNLA 5KTSA 5ICEA 4KACA 4I55B 5DYYA 4BB0A 4DM7A 1B93A 1MZPA 1TCUA 2X0RA 1ATZA 2X22A 1QHNA 2DM6A 3ZW9A 4NABA 5C37A 3TK1A 4ZHQB 3ECCA 4D6XA 1E89A 1PBTA 1MN6A 4P83A 1ESDA 4NZOA 5CRIA 1MB0A 1U2GA 5AVSA 2DFLA 4GMXA 4W6ZA 1E1RD 2AG1A 2A4KA 2LDXA 3B7PA 4U02A 4WNYA 4CL3A 4DV2B 2BM1A 2X6QA 1UPXA 1PZHA 3EGXB 4XR4A 1XVUA 4F86A 1UCFA 3PKIA 5HFJA 1NKTA 4TZTA 3ZNPA 1IK4A 2FFBA 2GSDA 4I2VA 4RVHA 2GRAA 3REOA 1K5HA 1PK9A 1SHTX 3VGJA 3OZBA 1XZIA 1NOKA 2QRVB 3AR6A 3KHKA 1YT5A 2DH5A 1WL8A 7ABPA 1QONA 1GPNA 1KO8A 2ZK7A 5JISA 3A3KA 3EZLA 4WN9A 1T3LA 2W6QA 4Q4CA 1XTSA 1IG0A 2XHZA 1KF0A 4HEA1 5L3RA 5A5GA 5C8YB 1ZOOA 5FQNA 4BZZA 3IHTA 5EP1A 5ES4B 3U19A 1BS9A 5LNK6 3M5DA 2O1SA 2X13A 5BVGA 3ZLJA 5ITZB 221PA 2YZKA 2OCDA 2PA3A 1DFIA 2CBZA 2MINB 1TO2E 4V24A 1UBKS 3LRTA 4AKTA 1YRLA 3RW9A 4D25A 1GPH1 1QGAA 2QMOA 2NNLD 1HETA 2MSNA 4OH1A 2BIFA 3IPCA 2OFOA 3AB8A 3CW8X 3ZVNA 2A5YB 2RGBA 4QODA 3T0FA 1QHFA 4NZNA 3ZW7A 2FPKA 2K87A 2FJ0A 2UUAB 2A9FA 2Q3BA 1ID1A 3C3KA 4MQLA 3T3GA 4DLAA 2R11A 1NW5A 3BT7A 4Q1DA 2E7ZA 3AHHA 3I3OA 4Z4IA 4C20A 3CN9A 3SX4A 1GILA 3N6XA 2E37A 4UBMA 4JCOA 3SYNA 1P80A 4FSXA 1JT9A 1UJ2A 1BRTA 5E1MA 1Z6AA 2G72A 2J6HA 5KHAA 5JXIA 1HC7A 4CGZA 4U7DA 4A6PA 1CJSA 1U3FA 4CM9A 3D02A 5BRAA 5IJAA 3H9EO 1QU2A 2A9KA 3EVEA 3JZIA 2CZCA 4MQMA 3U7EB 1XK6A 3MT8A 2BEJA 4RORA 4YDSA 4DDWA 2Q3CA 3UH0A 5KJCA 3AM1A 3INRA 4GM0A 4KQFA 4QXMA 3GA7A 2AOTA 1O08A 3GN1A 4L5CA 3RSHA 2REQB 3H0KA 3JYHA 1O6GA 3SNHA 1DUIA 5U4XA 3CUSA 4PQGA 3RS8A 2IP4A 1P1IA 1FSGA 4EMBA 3R0VA 4I5FA 1NXVA 2OFPA 2F1KA 4MR9A 1BNCA 1F4PA 2YV5A 4DPMA 2WIKA 5LNK1 1W46A 2B8NA 2RC6A 1U1GA 2X6RA 1UDCA 3OEHA 3K9LA 1ZJ5A 5BW5A 4YAGA 2VHQA 1V11A 5HF9A 1V6AA 3E61A 1Z7YA 1LJ8A 5AVVA 2ZYIA 1GPKA 2QHXA 4V0QA 4HB4A 5EIWA 5TF4A 3MTIA 1C9DB 1CRLA 4TSFD 3SIPA 3BSWA 2JLUA 3FNRA 3OZUA 5TPZA 4PO3X 4MYHA 1UM9B 3WVNA 2YQ4A 4J0KA 2CF6A 3AM5A 3PP8A 1NU6A 3VSDA 4X1YA 1BKYA 1VMAA 5C8ZA 5KYGA 1FRNA 1U94A 1NVVQ 3LO8A 1S2GA 3VR5H 2DFPA 2GBCA 4M0FA 5DNVA 3WLOA 3EBOA 3SHOA 3KD2A 3LY7A 4XWOA 1R6BX 1YAHA 2J30A 3JARA 4HNSA 4E7OA 3CBGA 1WBDA 1CJUC 1QH9A 1AF4A 2C61A 3ORYA 3EXIA 1AD2A 1GADO 1P9NA 2D06A 1XZPA 4K9QA 5ES3A 1YR6A 3PWKA 1RLOA 2VOJA 5CXUA 2NIPA 3H9GA 3RC9A 2ZBUA 4IZ6A 3V2IA 3WSWA 5B37A 1HDOA 3U7FB 2ZAMA 4FE4A 1FNMA 3IAAA 1WPXA 3A9VA 4RFSB 1YMVA 2WU8A 4QWMA 4TKLA 1XLTC 4UVHA 2VT2A 4M37A 3A9TA 1FMTA 3M82A 2V55B 1F20A 1T0JB 4K8RB 3TNJA 4ARBA 2C5LA 1TYZA 4RXUA 3RVJA 1IJBA 1KYYA 1LD3A 2FSPA 5EJ4A 2NV0A 1SCUB 3OCCA 2W2XA 3RRMA 1VA4A 3H6KA 3IPRA 1N6KA 2GPTA 3BUSA 5JQGB 5LMCA 2NV6A 2QKYA 2IEDA 2C7OA 3TZCA 2XMQA 3MMPA 2J4DA 2NUPA 3WV4A 5ISMA 1KA9H 4X7RA 1QVZA 1JPNA 1A9PA 1TUEA 2O57A 5LZ7A 4A73A 3EZ9A 3DDWA 4HUJA 4EATA 4IMPA 5JH7F 1WZNA 2WM8A 3R6DA 4IJUA 2X3UA 1W5EA 3C4VA 2A1UA 1E2NA 3LK7A 1JFLA 2QT1A 3KAPA 4A9AA 4BNJA 1ZUD1 4LYGA 1BFUA 3RRJA 4AIIA 5KSYA 4P35A 1T5IA 3HLTA 4PXYA 5SICE 1ST2A 1E1QA 2OHJA 4DQDA 3PFFA 3T1HB 1QOZA 2VXBA 4Q21A 1N6IA 3RUHA 5JBQA 1SKMA 3E9YA 2RI1A 1H5QA 1QHYA 3MRTA 1K1EA 4NH0A 5KNDD 2BFCA 1LPOA 2W00A 5T6BA 1ANKA 1B3RA 1UMDB 1V95A 5E38A 3SLGA 4DEYA 3VO8A 1YTUA 2B21A 1DB3A 1E1RA 4RANA 3HU5A 1YJAA 4QD3A 1IZ8A 5BN3A 3T9AA 1CUGA 3MJFA 3R3ZA 4IUYA 2QTNA 5H3HA 3TTTA 4HMPA 4QFCA 4TKMA 5EXXA 4KE7A 5JNLA 3QBJA 1HF3A 1ZGZA 1E5QA 2I2XB 2RKOA 3G2PA 3MUOA 4I3GA 4C4AA 5CFZA 5KX5A 3PGA1 5JRDS 2CFIA 4J91A 3HWX1 1DFGA 2D1QA 3K9CA 4H3VA 2EP5A 1W75A 3M9WA 4RH0A 4IRXA 2UVPB 4W9RA 5FORA 3UJ8A 3ZJYA 4BMCA 4NMHA 3ADCA 2VTKA 1MJFA 2FUNB 3DV0B 3U4QA 2GSWA 1T0IA 3DXFA 3TVDA 3LY5A 2QRPA 4BQOA 4BMVA 1J2EA 1X7XA 4CG0A 1KEEA 1PO7A 1AKTA 3LF1A 3S1AA 3VC7A 3FNHA 4RPJA 1A82A 1CUDA 1P5HA 1NW4A 2GGSA 4G8BA 2BRUA 2XLBA 3KQKA 1W25A 1DUSA 1JDSA 4MMZB 4UHBA 4JJ4A 4ZVOA 3KL2A 2Q49A 5CX4A 4DJ5X 2IJGX 2WDZA 1HYHA 2Q46A 3UWDA 2G82A 1H85A 1A72A 1NA5A 5LBUA 2GYUA 2C4UA 4HGNA 5EXEA 5TIIA 2CYAA 2XAUA 3KVYA 1B6GA 1ZFNA 4FOSA 4KXUA 1EX6A 4GKBA 1L4FA 2GPBA 1ZVMA 4NU5A 3GQBA 3JXEA 1L7NA 2HA7A 3LUFA 1NVBA 1X9GA 3ANTA 5BNZA 3UAVA 3W9UA 4N9WA 4JLPA 1HA3A 1SR8A 5EMHA 4MKRA 3KFVA 2GN9A 1KYZA 3AYZB 4FEGA 5BRNA 2X8JA 5LOVA 3G1TA 5EXSA 2XUAA 2RD2A 4I50A 3BMQA 4M0KA 1UQTA 4X5OA 4NWIA 2VXOA 1ODTC 2WFLA 4Q37A 3ZYZA 4MTLA 5ESXA 4CT0A 3LV8A 3OX3A 2NO0A 4X63A 4N48A 3G2KA 3ZY2A 1DT5A 3PXEA 3NDPA 2IXTA 3OLWA 3Q3JB 4D8UA 2IOHA 3QENA 1QWOA 4ZGGA 1Q7CA 5AUOB 2BFFA 1UJCA 2CC2A 2D4AA 4Z3OA 1OH5A 2HHHB 3FZNA 4ZOLB 1POWA 3FGZA 4LTMA 5HZKA 1E62A 1TEZA 2WHPB 2DEUA 4LJ5A 4Z4EA 1OX6A 1KYWA 1YUMA 3HKDB 4KV7A 4RXTA 3BKXA 4URZR 3AQ4A 1AURA 3SGLA 1QG4A 2HAEA 3GELA 4NMXB 5TRTA 3A4LA 2VYFA 3FCYA 4IDCA 4HTAA 4JA0A 4ARVA 1FL9A 1KEUA 5A7GA 3I04A 2JK1A 4X20B 3VXKA 1D2AA 2OOKA 2GXUA 2XKJE 2ZRBA 2O8EB 1EWRA 1F8GA 2IPXA 5L4NA 2DP4E 3BMCA 2X8AA 5AM5A 3MLAA 3ZGXA 2J4FA 5K0EA 3D3KA 2DFVA 4JLKA 2CXNA 2ROQA 2IBTA 3TXAA 2PJRA 2X2OA 3U37A 2BONA 5LXTA 4LF6B 1F0PA 1IZYA 3W2TA 1RKVA 3FCCA 5JSHA 3LHFA 3G0CA 1CY8A 3ZH2A 3SC4A 1PJ8A 1DINA 4FW9A 4OAPA 1YOVA 4REOA 3S55A 6NULA 5IUNC 2VDQB 1G4HA 4TV9B 5D01A 2C96A 3G17A 4GH5A 2XD9A 4G0XA 3FKJA 3ANNA 2VOEA 1QCZA 2BI7A 3WKCA 5CVEA 3V8NA 4M22A 1QK4A 4XSVA 5EFZA 2A94A 2OGTA 1Z47A 2R6AA 4R83A 5KTNA 4DR3B 2XI4A 1B2LA 2BH9A 2DWCA 1EDEA 1K6MA 3D4NA 3FYUA 3VBEA 5BR7A 1YJ8A 2FQXA 1E94E 4RK0A 4H7IA 1TKRA 2NO7A 4GGMX 1UWCA 1XN1A 4WUTA 1W4CA 3IBGA 3TTVA 4KPEC 1FRFS 4MPTA 4MXDA 4NE2A 4PRZA 2MMGA 2ZRHA 3X1MA 1P9LA 5AOCA 1PJQA 3D0KA 3PGJA 4M8SA 4WCFA 5DYTA 2XB9A 4UAVA 3KAQA 2O5CA 1UFOA 3AF5A 1LW6E 1OV6A 3HXTA 1HFWA 4GEGA 5E4TA 4E11A 1MAUA 1FFXA 1OF1A 2DPMA 2VBIA 2ZSKA 1OR8A 1WSAA 5ERYA 4CGYA 3R9XA 2KQUA 1OZHA 3GBPA 3K2BA 4MYCA 3ZHQA 4OHMA 3TMYA 1DAFA 3P5BA 4OP1A 2LIVA 1NT4A 2JZCA 2Q9CA 1U2RA 3D6VA 4QYXA 5LL6P 2WZCA 4QGAA 1H2ZA 2FRDC 4QFBA 2P9CA 2NLOA 3IDQA 4AT1A 2C3YA 1OOEA 4K9RA 3RAFC 2QT9A 3TDNA 2LZ0A 2KE5A 2WU0A 2BMAA 2JFZA 3E22B 1P0QA 1V1JA 4R1OA 5E6UB 4H3HB 3HS3A 2YN0A 4INJA 1ZNZA 5TLSA 5FL3A 4UCQA 4XEUA 1PJ2A 2RIPA 1LW7A 4G41A 4LC0A 4OHWA 1UJ4A 2VDJA 1XZGA 3GMIA 1IY1A 3N1UA 4KFRA 3T52A 5CGZA 4F60A 1E3WB 4BNYA 1UPTA 5JNRA 3A1DA 5I5EA 4ESOA 3R0IA 4KIUA 3VO1A 4EITA 5GOTA 2QMUA 3ETLA 1JIKA 2HA0A 4GXQA 1NKSA 3GJ6A 1MDFA 3RHFA 3AR9A 1Q1AA 3W4IA 2PNJA 3U56A 5I4KA 2E5LB 3TR5A 1XAJA 2BKVA 1S1CA 4O8ZA 2E4ZA 5ALYA 1OVMA 1PEDA 4ZO7A 1ZOPA 1Q57A 1XZEA 1KFBB 2OBBA 4ZJUA 3U4AA 2E89A 5F33A 4CIDA 3K5IA 4RKWA 2REOA 4JK3A 4NCKA 1MBZA 3GA5A 1WD7A 5TGDA 3UAXA 3CRQA 4CTOA 4F5WA 3HUUA 5BSVA 4LHVA 2KJQA 5JAOA 1QH1B 2D0DA 1NBIA 3C3DA 1INLA 2YXBA 2FDRA 3CC8A 4CTJA 3G8YA 4L76A 5HILA 4LV5B 1WW2A 3NBAA 4UEJA 5ALIA 3V8BA 4YREA 4OMDA 4DJAA 4TZ0A 2C5SA 5EJ8A 3JPYA 4CNBA 1GA1A 3A4VA 3JAKA 2FSVC 5B1DA 4PYQA 1R9NA 3UT5A 1D0VA 1NI4B 2Q0XA 2D2VA 2ISSD 1N5MA 4RIFA 4H6XA 2YJ5A 5BNIA 3G2NA 1K6EA 3ZDEA 3LMKA 2KMLA 1FFDA 4KLZA 4TYPA 3AC0A 3N87A 2VCHA 5KX5F 3CVWA 5IJ9B 2C7QA 3T94A 4K03A 1RC8A 2CLSA 2KHZA 2QXYA 1C8LA 4R2HA 3ICPA 1MNAA 5EUBA 4B76A 1TIBA 4HDMA 1O0CA 1I8TA 1OZGA 3SR0A 3MRXA 1LJLA 5SY6A 4KIFA 5IG2A 2GJAA 2I2AA 3H86A 3K1AA 2QTVA 4PFKA 4EB8A 3E27A 5BR1A 5CYPA 3EA0A 3G85A 2GNPA 2BEWB 2HDNB 3N2KA 1OTHA 1CVRA 3VH2A 1Y63A 3QGMA 3I61A 3WWEA 3UCFA 2IHUA 5B7NA 1NVDA 3QLTA 4DV0B 2FWRA 1FDUA 4NJEB 4I8XA 5A2QA 2CBXA 3HTXA 1H9AA 2BGJA 3F73A 2WSSD 4AZSA 4UVIA 1H4VB 1XCMA 5SYMA 2D00A 1N0UA 3PFNA 5IVPA 2C2XA 3WNBA 3X1WA 1PL6A 2CK3D 3PRKE 3EYWA 3MC1A 1VLLA 3RO7A 2ZWOA 4D0NA 1M7BA 4RK1A 1V7QA 1Z88A 1NG1A 5JNVA 4IGIA 4KL8S 3F1LA 1CNEA 1WNTA 1RI1A 2DE0X 4OHOA 3W1WA 3VNVA 1UBJS 2RGUA 1G60A 2XTMA 3WJAA 1GFWA 1P2SA 1ZZEA 4BKMA 1BKDR 3FTDA 5LOVF 4LYHA 2YHSA 4JT8A 4AS2A 2ES4A 3M6WA 1PYGA 3IEXA 3IP8A 4P4TA 4TM7A 4F1JA 2HUNA 2PYIA 3P5SA 3FIJA 2PZKA 4J94A 1SK8A 2I4TA 4L6AA 4XAQA 3RNOA 2AOWA 3RRBA 1S2NA 3SZRA 5MF6A 4GRIA 4KR3A 2H3HA 2QUJA 1VKRA 2D5BA 2CSUA 5HXAA 1VPVA 1XNHA 2JBWA 3NIBA 3TKAA 1NJ6A 2VJOA 3JALB 1GTZA 4CLXA 9LDBA 4XVCA 3ZU2A 2XVXA 2PIAA 1YUNA 4NBRA 4BU0A 2WIGA 1Z7GA 1U1EA 2Y1CA 1VSBA 1HDEA 5K0JA 3W2GA 2MCFA 3CS3A 1DE0A 1S5PA 4G5GA 4ZN6A 3MFYA 1U4NA 3NG1A 2JF0A 4MHOA 2PGLA 4GMKA 4YAOA 2Y6VA 2PUVA 4KGDA 2CXXA 5J59A 1DJLA 1N0HA 4MW9A 2EZ4A 4YQZA 4P0TA 2CE2X 5FRDA 4BJ1A 2OA0A 3MERA 2V7XA 1IHUA 3FYTA 1MOZA 1IZZA 1VKNA 2ENUA 4OAQA 1GU1A 4Y2SA 5T7BA 2P65A 4URFA 5GOZA 4MVCA 5FFMA 1TRHA 3TQOA 4II3A 2XCIA 3KR2A 3K0FB 3UWMA 5JW6A 1JAZA 3N2IA 4J43A 3IE1A 3COSA 5A9RA 3BYZA 1AUXA 1GRQA 4F4JA 1XKLA 1SG6A 4M99A 1PUIA 1O96A 3L8YA 4PZPA 3WGOA 4EF6A 5IASA 1A77A 5A3SA 1BW9A 2WC1A 3IOYA 1VHDA 4ZVQA 1DTWB 3NONA 8OHMA 3QG5A 1GQOA 3ETCA 3B1KA 1S2MA 3QKSB 1I7DA 5HK8A 2GEDA 5FV4A 1NUTA 1EVZA 4K46A 4HJRA 1L7OA 2FU5C 2P69A 1SCQA 3EFOA 3MWEB 1WXFA 1T25A 1DXHA 1OFGA 3N8GA 4R1SA 4OLHA 2HWYA 4OU4A 2IEAA 4BNKA 5TV2A 1N2BA 1G5FA 4P92A 4ZVLA