4P7GA

Rat apo-comt, phosphate bound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
213
structure length
213
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 74
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7gA00
3G5TA 4Y2HA 2ZBRA 4OX9Y 1HMYA 3DXYA 2ADMA 5E9QA 1NKVA 5HIKA 4RTRA 3NMUF 4C4AA 1O9GA 2CWWA 2UYOA 3HVHA 5DLYA 1X19A 2QYOA 1WXWA 3FRHA 3GWZA 4KIFA 2ESRA 3OU6A 5HFJA 3KPYA 1I4WA 1H1DA 3ERCA 4KWCA 2C7OA 2YTZA 3JWGA 2ONZA 4KRGA 3C0KA 5K0EA 3ER9A 1RI1A 1EAMA 1L3BA 2PXAA 4MQ4A 3LDGA 4GC9A 5K0JA 1G8AA 5EMMA 3TM4A 3IYLW 4V0QA 1JQEA 5ICGA 5K0FA 5EGSA 1VPTA 3NDIA 4PYOA 5E1BA 1RJEA 1I1NA 4QPNA 4AUKA 2ZIGA 3LDUA 3P9CA 5EC8A 1DL5A 3TOSA 3UA4A 3EMBA 4CKBA 4DKJA 2AVDA 2OB1A 5K0LA 4PYIA 3A27A 3GGDA 3LECA 2WA2A 4Y30A 5E1OA 5JUWA 4L7VA 1RI4A 4QTUB 5LQKA 3MAGA 5DRYA 3ORHA 2PX4A 4DCGA 5LQNA 3OZTA 3FYCA 4EK9A 3RIEA 4AZSA 3SR4A 3CC8A 4A6DA 5DWQA 1KHHA 2G72A 5LQAA 5E2BA 2Z6QA 3FUTA 1V39A 3GRRA 5EIWA 1SUSA 5C0OE 3DH0A 3PX2A 10MHA 5K01A 5EHGA 5FQOA 4YV1A 4ER0A 2JHCA 2NXJA 2IP2A 5B1SA 5F2NA 3BZBA 1TW2A 3QOWA 1X1CA 1KXZA 2ERCA 1QZZA 2NNWB 3B7PA 5LQUA 4DZRA 4CXMA 4HG2A 4XCXA 3THSA 2ZCJA 5GP1A 3CJQA 3TR6A 2JHPA 3BUSA 1L3CA 4RTKA 5U4XA 4E30A 3QV2A 3R0QA 4PYJA 1BHJA 2DULA 5K0BA 4ZTBA 4FSXA 3UJBA 4RVDA 1G6Q1 3M6WA 4RX1A 2NP7A 1BKYA 2VDWA 2IH5A 4F84A 3HCAA 2YUIA 1Q0TA 3GO4A 5E1MA 1U2ZA 1ORHA 1XXLA 2IPXA 4IWNA 5EMJA 3SSNA 3TMAA 1XDSA 2QRVB 1OR8A 4R6WA 4E33A 4BP3A 3GRUA 2R6ZA 3HTXA 4U7TB 4XUCA 3UZUA 5DSXA 5CCXA 4FZVA 2NXNA 1RI5A 1D2GA 4PIPA 1D2HA 5ICFA 4Z2YA 4OBXA 3PVCA 1N7IA 2UZ4A 1MHTA 5IH3A 3Q7EA 4LECA 5F2KA 3EGIA 3UJ8A 3V8VA 3DMHA 5DSTA 3FPHA 3NJRA 4PONA 4OA5A 5DTRA 5HEKA 2I9KA 3LCCA 4CWAA 2PX5A 1R8YA 4MIKA 5D1NA 4EMSA 5LQCA 5BXYA 3H2BA 3OE5A 3KQQA 2ZSUA 3I53A 4PWYA 2VZ9A 2P3OA 3LL7A 3E23A 5FQNA 1N2XA 1WY7A 2O07A 2ZIFA 4RTJA 2EX4A 2XVMA 5T64A 3JWHA 2AN3A 3I5UA 1G55A 5EPEA 3BT7A 1JSXA 2O06A 3T7RA 4HSGA 2PLWA 1VLMA 3KPVA 3TM5A 3EVGA 2HWKA 5FULA 4FS8A 1JSZA 3DOUA 3HM2A 3BXOA 5FHRA 5H02A 5JR3A 5DXJA 3AJDA 3NTVA 3OE4A 1FP2A 2UYHA 2NYUA 2OPBA 2YR0A 4IV0A 4P7JA 3EEYA 3SGLA 2C7PA 3RODA 3BGIA 1JR4A 2OBFA 4M38A 4E2WA 3UA3A 4CKCA 5GINE 4YUZA 5GIOE 2CKDA 3PFHA 3OCJA 1SUIA 3SXJA 5M5BA 1YZHA 2GA9A 2ZBQA 3CJRA 3GNLA 3A7EA 2JH8A 2JJQA 3EVDA 3V97A 2HNKA 1SKMA 3DXXA 3IHTA 2BZGA 2PT6A 4CKEA 3M4XA 5EQJB 3P2IA 3EVAA 4WVLA 3TFWA 3DXZA 4E2ZA 4AZWA 3BWYA 4QQNA 1KPHA 1RI2A 2FK8A 4LWPA 3CBGA 4E32A 1WZNA 1KIAA 2LD4A 2UYCA 2JG3A 1YF3A 2G71A 3HVJA 1ZG3A 5HILA 5E2AA 3NVMB 1ZKDA 5DRTA 4G56A 3M33A 4RVHA 3EEOA 3FPEA 4WXHA 4E70A 2WK1A 4MWZA 5CIYA 1QAQA 2YQZA 5EKXA 1FPQA 5CVUA 4YV2A 4YUXA 5FTWA 1JTFA 4AX8A 2GB4A 5CUQA 4PYNA 5HOQA 2PVCA 1JG3A 2IFTA 3LCVB 2G8NA 1QANA 3DLCA 3DP7A 4V0RA 4HTFA 2I62A 4HGYA 4KVZA 1P91A 2PKWA 3FPJA 3KQYA 1SVUA 2IBTA 2P7IA 3FTCA 3LBFA 4R05A 5EEHA 1ZGJA 2VS1A 2ZZMA 3U81A 3MTIA 2VP3A 5DTQA 4X60A 4F86A 1BOOA 4POOA 3ANXA 4P7GA 1RJGA 5C1IA 3LBYA 1L3IA 2FCAA 3MHTA 3F4KA 5LQJA 4AZVA 2IH2A 3KQTA 3P8ZA 4XUDA 1P1CA 4R8RA 4C08A 4KIGA 2GPYA 3G5LA 4K6MA 3TLJA 4EQZA 1I9GA 3LKZA 3R3HA 3TQSA 5DM2A 5E1DA 2GS9A 1D2CA 1QYRA 4EKIA 1O54A 1JQ3A 3LPMA 5CVDA 4CTKA 5CVJA 5CM2Z 4ER7A 4OQDA 1PJZA 2E5WA 4YV0A 3DUWA 4EKGA 2PV0A 3NWEA 5EVJA 1Q0SA 3SM3A 3G2QA 5C9ZA 3KQOA 2EJUA 4KW7A 5IKMA 5KQRA 3GRVA 1UFKA 5FWDA 4E2YA 4GOOD 3RW9A 3SX0A 2V7EA 4YMGA 5GOZA 3GRYA 1M6EX 3OFKA 5P8WA 2Y1WA 7MHTA 1EJ0A 5KVAA 1X1DA 1NW6A 2EJTA 2ZLBA 4IKPA 3K6RA 3UJ6A 3P2EA 3UJCA 3A26A 1PRYA 1YZ3A 2YVLA 4DA4A 3KR9A 5EOVA 3ME5A 4PINA 3C3YA 4PYKA 2CMHA 3FZGA 2O05A 1SQFA 3E8SA 4RVFA 5EKUA 4A6EA 4BLVA 1R00A 4AZTA 2XYQA 5EMKA 2WA1A 2ZVJA 5BW4A 5FA8A 3MQ2A 1EIZA 1B42A 4QVKA 3HA7A 1X1BA 3FUUA 4ISCA 4RSRA 5DX1A 4RTMA 1IM8A 2K4MA 3MCTA 3UBTA 3PLAE 2B9EA 1Y8CA 3KPJA 2GLUA 2H11A 2BR4A 3G2PA 3JWJA 2PXCA 3FUXA 3I58A 3KQWA 4FR0A 2AOUB 3X0DA 3T7TA 2VDUE 3B89A 4QQKA 2GAFA 5T67A 1KP9A 3A4TA 2P35A 3B3FA 3REOA 5LR6A 4GBED 1DUSA 3EPPA 3BWBA 3CKKA 3ER8A 5ICCA 2BR5A 5ICEA 5BP7A 4RTLA 1P1BA 3TKAA 2BH2A 3OPNA 3SMQA 1AQJA 3FTEA 2OXTA 1KR5A 2ZWVA 1L9KA 3EVCA 1AF7A 2I7CA 4FP9A 5K0NA 2AOVA 2PGXA 2QE6A 5HIJA 2ZWAA 1L1EA 2FRXA 5GWXA 1XVAA 4RVGA 3HCBA 3CCFA 5HIMA 9MHTA 3WSTA 1VIDA 2O0LA 4P7FA 5DM1A 3SSMA 4BY9E 3B3GA 3D2LA 3P9NA 5EIFA 2P8JA 3P2KA 2PBFA 5G02A 3OZSA 2YXLA 5DM0A 1BC5A 2ZULA 5EG5A 1R18A 2AN5A 3PB3A 1AV6A 4M36A 3P9IA 5FADA 2HMYB 4QPPA 3S68A 4GOND 2ZZKA 3FYDA 3HP7A 4DQ0A 3AY0A 2FHPA 1XTPA 2NXEA 1NW8A 3KU1A 4BP1A 2ORED 3VYWA 3TPZA 3P9KA 3HVIA 4X1OA 3EGEA 1VE3A 1XCLA 4QTTB 3IEIA 3FTDA 4EVIA 3FPGA 2PWYA 2OB2A 3GJYA 3O7WA 3EVEA 4RYLA 4RTOA 2IGTA 5EZSA 3OFJA 5EZQA 4KDRA 3UJDA 4HC4A 4B17A 5K0CA 1QAMA 1ZGAA 2H1RA 3G88A 5D1HA 5LQRA 5FWAA 4MHTA 2IIPA 2YXEA 3UFBA 1KYZA 1WG8A 2OZVA 2PT9A 3A7DA 2P3LA 2CMGA 1JG1A 5KYGA 2B25A 2IDJA 3ID6C 5CCBA 3C6MA 4RV9A 1JG2A 5EEGA 4PCLA 5T6BA 2ZTHA 3JWIA 3GDHA 3KPWA 2PWPA 2XYVA 4BLWA 2FPOA 2UYQA 3MTEA 2FYTA 3LCUA 3KKZA 3LX6A 5GM2A 4C07A 1EG2A 4PCAA 5K03A 5E9JA 2AZTA 3M6XA 4E31A 1ORIA 4DCMA 1RI3A 3E05A 3FTFA 3R24A 3BGDA 3THRA 1N7JA 3HCEA 4ER6A 4FT4A 4FT2A 2GH1A 2AS0A 1NV9A 3BGVA 1G38A 1MJFA 5EHIA 4OA8A 4PGGA 3VSEA 4GC5A 5K8VA 4X61A 3G7UA 2AOTA 1JQDA 2EFJA 3BKWA 3BKXA 2AOXA 3HEMA 3LSTA 3P71T 2OO3A 4U7PB 2Z6AA 5KS2A 4F85A 1KPGA 2AOUA 4LG1A 5DX0A 3GXOA 2P7HA 4NECA 2XYRA 3GCZA 2JHAA 2F8LA 1NW3A 2B78A 2ZIEA 3BWCA 3G89A 3PS9A 3SSOA 4HH4A 4H0NA 1RJDA 4HRAA 5ERGB 4P7KA 5K0GA 3GU3A 2C7QA 3AXSA 4E2XA 2P40A 3OU2A 3KQVA 4RTSA 1EQAA 3EMDA 5K09A 1XJ5A 5CD1A 8MHTA 3KQPA 5E8JA 3B3JA 3TKYA 3PFGA 2PX8A 1O9HA 2OKCA 2YXDA 1XCJA 4QDJA 2AOWA 3A25A 1DCTA 3KR1A 1EJ6A 1G60A 3EVFA 3DMGA 4DF3A 1KYWA 2EG5A 3MB5A 3BWMA 4QVGA 3ELWA 3VC2A 2IBSA 4PYMA 1WXXA 4P58A 3I9FA 3CVOA 3R6TA 1NE2A 4QDKA 4HGZA 4PNEA 4RTNA 2HV9A 1RJFA 2QM3A 3Q87B 3HCDA 4RTPA 5DX8A 4IV8A 3KPUA 3NVKI 3LKDA 3HA3A 4R8SA 5HIIA 4ER3A 3MGGA 3GIWA 1YFLA 4HTFB 1VBFA 3AWIA 2AN4A 2PX2A 3EGVA 3MCZA 4LWOA 4C03A 1F3LA 3PX3A 1FJXA 3HA5A 4PIMA 1TPYA 1M0EA 2ZW9A 3HCCA 4GQBA 2Z6UA 2XVAA 5FCDA 3T0IA 3B5IA 2IH4A 1NBIA 1T43A 3LHDA 1P39A 2VDVE 5DXAA 5FUBA 4UOEA 5KQSA 1NW5A 5MHTA 3DMFA 1FP1D 3E7PA 3ELYA 2ZZNA 5BW5A 4BLUA 2YX1A 1R74A 3M70A 2AVNA 5DPMA 4GUAA 2QY6A 4GEKA 4ER5A 1XDZA 4C06A 3UJ7A 2FK7A 2G70A 5F2OA 3EVZA 2OYRA 3NDJA 3UJAA 1AQIA 2Y1XA 2I6GA 4PGHA 3CGGA 2KW5A 1NT2A 4KDCA 2P3QA 2PXXA 3HVKA 5EMLA 1SQGA 3G2OA 1NV8A 3KR0A 3K0BA 1R6AA 1YUBA 2R3SA 4CTJA 5DTMA 5GIPE 4GOLD 2NXCA 4DMGA 2B3TA 3P97A 3IV6A 3EVBA 3VC1A 5CVVA 1UWVA 2AOTB 2B2CA 1HNNA 5LSAA 4R6XA 3KHKA 4YUYA 2BM9A 4XUEA 3G8BA 2C7RA 2Q41A 4YMHA 3OU7A 4OBWA 2NP6A 3HCFA 3M6UA 3UJ9A 2ZFUA 1NW7A 4X41A 5HZMA 1YFJA 1JTEA 4OQEA 3KQSA 1SG9A 1VP9A 3FUVA 2PY6A 3O31A 4FGZA 3FPFA 2BR3A 2OY0A 4DM3A 3AXTA 3FUWA 4M37A 3T7SA 1NBHA 1XDUA 2CL5A 3GRZA 3I64A 1IY9A 1JG4A 5FA5A 4GOMD 1VL5A 3C3PA 5FHQA 1UIRA 3DTNA 4YUWA 1F38A 3KR2A 1ZQ9A 2BM8A 2N47A 2G1PA 1G8SA 2H00A 1KPIA 2V74B 3LGAA 2AR0A 3DLIA 3LDFA 1X1AA 5GM1A 1ZHFA 4O29A 4YUVA 3OZRA 4JXJA 3FRIA 2PJDA 3C6KA 1VQ1A 3DULA 4GF5A 3SVZA 2P1DA 1IXKA 1QAOA 4C04A 5DM4A 3QOXA 2QRVA 3MERA 3NW9A 3PTAA 3DR5A 3NWBA 2HR1A 2PSSA 4FSDA 5CVEA 2IDKA 3ELUA 4PYQA 3ELDA 5E9WA 3G2MA 1WS6A 2ZBPA 3KQMA 1M6YA 4MTLA 2XBMA 2A14A 2HTEA 4M7RA 2DPMA 4C05A 1YB2A 4PYLA 1FBNA 3PT9A 1R8XA 1TW3A 1INLA 3L8DA 3O4FA 2P41A 2O57A 3CJTA 4RWZA 3R9XB 1Z3CA 2JH9A 5DT2A 5K05A 1VP3A 4ATNA 4X63A 3TRKA 3UWPA 2ONYA 3G8AA 5E8RA 3HNRA 4RTQA 3M6VA
chains in the Genus database with same CATH superfamily
3DNPA 2F62A 2KLHA 4JH0A 4N0QA 1XAGA 3I6YA 2HO5A 1E94E 2J41A 4N8DA 4ZIRB 1JR3A 1Z8DA 2C2HA 4X7PA 5SICE 2Z4RA 4BMOB 4MYCA 5D6OA 2BFFB 3B1VA 4X45A 4OUDA 1E2MA 3QVJA 2IIBA 1KDYA 2IV2X 3WHPA 3FZYA 1X8LA 2Y1CA 4KIFA 3KVRA 4B3BA 4DV6B 3BXGA 1N5DA 2FH5B 3EDYA 3EZLA 5HX7A 4KRGA 1WB4A 1T4BA 1QGZA 2XNKA 1G8AA 2F1HA 1AZTA 3RQSA 1HTTA 2QTBA 5D3MA 1Q12A 5TQ2B 1M5RA 4C7BA 1EM8A 3BE6A 3PBKA 3BHJA 3NDIA 5HS4A 1NVAA 4P7BA 3VKWA 1YOVB 3I37X 1UPTA 3RSCA 4OVKA 2OCGA 3FFTA 3KCNA 3MJ4A 4K28A 3W6PA 4OK6A 4CIVA 5JXIA 4EP1A 4P0QB 3NOQA 2OXRA 3OFVA 2JGIA 1CRPA 1Y4AE 2RGXA 2R48A 3W9BA 3PEUA 4DEYA 3TLCA 3HSSA 5DW0A 3UB4A 5LQKA 3OO1A 3ROEA 5CW2A 5DLDA 3TOZA 1G3UA 1X1TA 2B4AA 1GITA 2JEYA 4J90A 4IX9A 3TVYA 4A8TA 1QF7A 2A7QA 4JSTA 1O4WA 3L1VA 3USCS 5JARA 4DJEC 2PS0A 5LYJB 5KNDH 1C0KA 4NWIA 3GRPA 1F12A 4UHCA 1YOVA 3NEPX 5ALTA 3SVTA 2AXNA 2C8LA 1QDEA 4E21A 4M87A 1DJOA 4EPTA 4OHYA 5LQUA 2XE6A 1XDDA 1MAVA 2OUKA 2FUG6 4UJ3A 4XJVA 3T34A 3U2QA 4GKKB 1ID8A 1E5DA 2JHPA 4RDHA 1UWLA 2I4RA 3MOSA 3P32A 1QP0A 1YS1X 2H1CA 4DLNA 2E9SA 1SBIA 4PYJA 4RKYA 3RYHB 1C0PA 2WZDA 1CWUA 4M99A 4XVCA 1AHIA 1WETA 2VDWA 2PFSA 4P3NA 3EDRA 4GYWA 1RPAA 1AH2A 1QMGA 1SUWA 3EF0A 4HAUA 3ON5A 3PRKE 3D3NA 3SSNA 4A36A 1Y7LA 5YASA 1WKBA 1HTBA 1OR8A 1GG8A 1OV4A 1U3UA 3BMXA 3GJRA 1JXAA 4V3BA 3LDAA 1AKMA 5A1TA 5JMWA 1EFVA 2CF5A 3L06A 3UMFA 3QPBA 1Y8QA 1MA3A 2JC3A 4DAEA 5BWBA 1QHEA 3RBAA 4HQNA 4D25A 1GQOA 2C9MA 1FL9A 2G5PA 1TJPB 5ICFA 1AOXA 4HNRA 4K8RB 5LIPA 3EAFA 2Y93A 3OEED 4AL4A 2R5NA 1JIQA 1G8MA 2RI6A 2WT4A 1U4SA 1RQLA 2Y1EA 2XAUA 3ECSA 4FYPA 3F1LA 3VPCA 5A4KA 1AKWA 3OUZA 3LKVA 1R4NB 3LPCA 5AM2A 2IS4A 1XJCA 3JD2A 2ACVA 1LBQA 5KTNA 3H2BA 4BUCA 5LQCA 1GA4A 3WS7A 1SVWA 2YOFA 3KLOA 3T6KA 5ECYA 5B4TA 1GFSA 1A76A 3AJ9A 3NHAA 4F4UA 4EB0A 3CN9A 4R8VA 5T3UA 4JP8A 5IXYA 3A1UA 5CG1A 2WF5A 4XTCS 4Y2PA 1QQ5A 4RETA 2O06A 3IURA 2GF0A 1NXSA 3QY9A 5JS1A 3T1VA 4WFIA 5JR3A 1M83A 3NTVA 2JI7A 4QFCA 2UYHA 1NUUA 2NYUA 2B30A 2W6PA 1PUJA 4IV0A 1XPOA 2A0WA 2H2GA 4L74A 4AG6A 3ULKA 3EHDA 3F71A 4ZREA 3UA3A 1T3LA 4E2WA 5T7BA 1V71A 1D7OA 1NE7A 1OB5A 1RQRA 1N4DA 4I55A 4C2AA 2V9ZA 4C3UA 3FIJA 1X7YA 3COWA 3NHKA 5LXTF 4QT4A 2K7ZA 3QYJA 3H7AA 3AM3A 3P0FA 5CIWA 5ALXA 3WYEA 3PDWA 1AD2A 4CQMD 3EVDA 1XA4A 1USKA 1ZO8A 3F7TA 1U28A 2XJ4A 3FSEA 4JLAA 3WISA 4YT2A 1UQTA 3LX4A 4EKDA 1K2VN 2CLOB 2IL1A 2QZZA 3M4XA 2XLCA 4FEGA 3TFWA 4F1WA 2OAGA 3JQ7B 4FC7A 4DSTA 3I4LA 4E7PA 3ILSA 2ZATA 2IPNA 3R2JA 2JJMA 5I9LA 1LPNA 3DLHA 2P0EA 2VPYA 2GTHA 3FCAA 2WVJA 1R15A 2BY4A 2HX1A 5JSUA 1I1QB 3L01A 4RK1A 2BC9A 3ZXIA 4ZU3A 1RYFA 3ZQKA 1QZUA 5B1YA 3B6EA 2YV1A 3T3OA 2YQZA 2YOHA 3OQ1A 4F3YA 4NH4A 2RC5A 5FFFA 1C4XA 2VIIA 4DSNA 4FCWA 4URXR 1DUIA 3Q3CA 1HFKA 3GUYA 1Z0ZA 5F5NA 2BKVA 1KHTA 3JQGB 5EYPB 1N34B 4P1ZA 3FPJA 2XDWA 4R54A 5KX5A 3RADC 1OWMA 1W35A 1LNZA 5DBIA 2UAGA 5B3KA 1FYVA 3BXEA 5BMVB 4NU5A 3QG5A 4BO5A 3LX8A 2VP3A 2QVXX 2ZRMA 3NC0C 3PCTA 1JEJA 4FINA 4P7GA 4RNDB 3WYCA 5ELLA 7REQA 1SULA 1R6UA 2XNDA 4REQB 3O8QA 3QX3A 1EGAA 2OO5A 4OSPA 3FBTA 1D6JA 3FNFA 3CTPA 4D42A 5HQ3A 2JLQA 1FFEA 1C9EA 4ZVVA 1CPYA 1Z29A 3ZH2A 3SS9X 1LS6A 3PFWO 2AUNA 3N2NA 3E2PA 2AFHE 5AQ1A 5CVDA 2OHIA 4YCMA 1L4KA 3AF1A 4ER7A 1CEQA 1NXWA 4ZCQA 3MXOA 4OU4A 4AF8A 3H5RA 4JKOA 3C70A 1N75A 4DNXA 3KWJA 1YS4A 1ZEJA 1SNYA 3RLFA 5LBTA 2CJXA 1DT3A 3O4RA 1RAIA 3ZPXA 2H1HA 1OQAA 3AHHA 3AB7A 3VOTA 1BEUB 3SYRA 3U4IA 1FXWF 2XRYA 4JKYA 1O1YA 2WWHA 4BNTA 4E07A 4AJ4A 4DV3B 1X7WB 2B1RA 1JPVA 3WMXA 3ZY6A 2QI9C 1T8UA 5AM4A 5FR2A 2ZJBA 4RD3A 2XUHA 2QN7A 4PYKA 1O2DA 2VPPA 3D81A 3OJFA 2C5EA 2R11A 4JI0B 1QYXA 1BWRA 1YA8A 4Y2RA 2WA1A 4MVJH 1SEPA 2KB0A 2VTEA 3HA7A 4H31A 2V98A 5HYVA 2ZSJA 4TWBA 3BFXA 4PPNA 4XLZA 2VBFA 4GECA 4W8OA 4UJ5A 4ZWNA 1GN9A 1V3QE 1I24A 1T36A 2VDJA 3CR8A 3MTQA 3UBTA 3FDZB 4W5JA 3IV9A 2BR4A 2AZDA 2QTGA 3DEJA 1IMOA 1UBRS 4EW6A 1FMFA 1FJHA 2HIHA 2I2FA 1EX7A 5KYWA 4LJRA 3BE4A 2GAFA 1YJCA 2JFPA 3GP3A 4GPD1 4MV7A 1UC8A 2CYBA 2QD1A 3GLHA 4L95C 2G09A 1CLUA 2FTKE 1JHQA 2DFTA 1W94A 2W8BB 4C5CA 2ZJZA 4M0EA 2CYAA 4AYWA 2UZAA 4NJEA 1W8IA 1M1ZA 1XZNA 3N5CA 4M9CA 3AEXA 3SFZA 5K3CA 2AOVA 1UXHA 2JIZD 4BFVA 1WZUA 4DS3A 2I2XB 1TUEA 3CZ5A 2B4TO 3L84A 2B3DA 1ST2A 2VI5A 1N1DA 3DHYA 3FVWA 4IUDS 1D0SA 1SVKA 2WV7A 2VHZA 2ZRCA 3CCFA 4LCEA 3SC4A 3WSTA 1NDQA 3TSZA 2K6GA 2JIDA 3MJSA 2CK3A 4LK2A 5AVSA 1KZ9A 2KHZA 2FWBA 3ZDRA 1PR4A 3GLQA 2XT0A 5IP5A 5DM0A 3N76A 3EEQA 3C6YA 3U1BA 1BC5A 1N9GB 4QOEA 5ALRA 3L6OO 3QSGA 2KBFA 2VJMA 3I4CA 2ECFA 3OOJA 4UNQA 3V34A 2A5JA 3H83A 5FADA 4DA7A 4DMKA 3FYDA 1KWGA 3LM8A 4LJ4A 2DH5A 1FU7A 1MB9A 2YV2A 1XLUA 5ESWA 4EATA 5ADHA 4ESEA 5B55A 4MDYA 3CEPB 3C5EA 5BYAA 3LHIA 3EGEA 4BV8A 3O0DA 3B48A 5CFRA 2OC4A 1QDLB 4Q4HB 2E4WA 2IYUA 1FSSA 3IOCA 2JFUA 2PRKA 1FBTA 4IXMA 4R2WA 2IGTA 3IPCA 1L7VC 1KJZA 3TH5A 5JRZA 3IPXA 5KVCA 3ED5A 5LQRA 1J42A 2ZUEA 2OZVA 3PC3A 4ZVMA 2R2AA 3RIHA 2B98A 2IDMA 4TTRA 1TB4A 3ID6C 3F4LA 4GXTA 3C6MA 3UK6A 4CMIB 2VHXA 1B15A 1X39A 2OCYC 2WUEA 4MP3A 1N0HA 4YDRA 4QQ8A 4XAQA 5FF9A 4PO1A 3BF7A 2BKXA 2MHCA 4DCVA 3BHNA 1TJ4A 4MYUA 1JIIA 5FJIA 5GM2A 4B46A 5A71A 2GD1O 2QOEA 3K0HA 4P35A 1U0EA 5AJXA 1NYTA 1TIBA 2W0MA 3ZHSA 4E31A 2B82A 2VPXA 4DT1B 2PJRA 1WW3A 3RU2A 4OHXA 1D6NA 3A2LA 2W43A 2FKNA 4GDMA 2W98A 4ER6A 4FT4A 2R6FA 1B3RA 1Q21A 4U6SA 3GLHE 4UW9A 5JWHA 3ORRA 4R2LA 2B5WA 5ALZA 2QXUA 3RS8A 1ZCBA 3PGLA 4EGCB 1T9GR 3MJTA 3TAXA 5BYJA 3BKXA 4MUYA 2AOXA 5AO9A 2NO7A 4NC9A 2HLDA 4A92A 2Q29A 2I91A 3PXDA 3Q7IA 1M8FA 3MCWA 2CFRA 2GK3A 2ZT7A 1OYVA 3NKVA 1TZMA 3H4MA 3PC8A 4MWCA 3S7TA 1NW3A 2AE1A 1E1CA 2D1QA 3BWCA 3PS9A 2AC4A 4MULA 4QNRA 4HRAA 3HFRA 2Y1GA 4CT4B 2QI9F 5BQ3A 5CDYA 2QJTA 5LOVA 4P3YA 1SUDA 2PRSA 2HRZA 1Z4MA 4DIKA 4IUBS 4WK6A 3T1HB 3S1LA 3UOGA 5CD1A 1RBYA 3KQPA 1GNQA 3ADKA 3BYZA 5KVVA 1DCTA 2KPOA 3VR5D 1L4LA 2M32A 4ENPA 2GXAA 4C43A 3L41A 3B9RA 1Z0IA 4QAQA 3C87A 5F9MA 4Y6QA 1NFRA 5JMOA 3AW9A 4NIMA 4F45A 2XIQA 4UZSA 3M49A 3KT8A 2IWRA 3UYLA 2QAGC 4BQSA 1T9KA 3HH8A 1MABB 3NM4A 3OQIB 5BNZA 2XB8A 4JL6A 4HUQB 2E85A 1NBMD 1RXEA 2Q45A 2Y8EA 3EASA 1OCEA 3M1LA 1MAUA 3MBOA 2ATXA 4FOSA 3WRYC 5KOJB 3FGZA 1GCAA 3OESA 5G0TA 1IZYA 1XNRB 4UEKA 3HRHA 3LCJA 5JLAA 3NBZC 5TQJA 4BTVA 1PVOA 2A30A 1YT5A 1IONA 5HS6A 3T0FA 4OG2A 3QMWA 4RDCA 4YMTA 3IAS1 1ZK4A 1FJXA 1RKBA 4MVJF 1KY3A 4YNBA 1GZDA 1WPQA 5JFGA 3U5ZB 4AN0A 1C7FA 3QOYA 3C7AA 5CX4A 3LT4A 3I62A 1YVRA 1JDJA 3DMDA 3ENKA 1JMKC 4MQBA 4BNWA 2CMKA 2RGAA 3O8QB 1W1IA 4NYJQ 1U0BB 1E7MA 1ODTC 2D1SA 1N7GA 2I2CA 3E7PA 4Q9IA 3K9FC 1NBEA 1X14A 4YONB 3GRFA 5TV2A 1OVGA 1QRTA 4ETWA 2WJYA 2RJOA 1FX0B 5FWYA 3ANYB 3TLAA 1K4MA 3COPA 4DCNA 2XWJI 3BB3A 2DQ4A 2W6NA 3QF4A 4DMFA 4C06A 3AMVA 3U0VA 4LMRA 2Y66A 4MUEA 3NDJA 3VGJA 3KUCA 1WULS 2I6GA 3SM9A 4L9WA 1IJEA 1MX3A 1Q44A 2H9IA 1E20A 1LTKA 2A9PA 3E53A 2H0AA 1YV9A 4MVWA 4WGGA 4BU1A 4CM9A 6ADHA 2WWYA 4EY4A 1U9YA 3C39A 4YPVA 3LZDA 2GLTA 4KG7A 3VH3A 4EHHA 5DK6A 5GIPE 4GR5A 1U7XA 1JYFA 4GP7A 5KMGA 2IHNA 4NZNA 2X7HA 5DHRA 3GP8A 4LZPA 4YUYA 5FOSA 5L3SA 4U9HS 3VVBA 2Q1XA 4M88A 4OBWA 1TVEA 3HCFA 3AGQA 1NVVR 4KRFA 2NP6A 2TMGA 2YXPX 3TEMA 4IDAA 2CE2X 3Q7QA 4G67A 1WQ3A 2AFIB 4KMRA 4QRHA 4X3OA 2OY0A 3S2GA 4IW3B 3BSFA 3DLAA 4CEJA 3O0TA 1OW3B 4QBGB 1SIBE 3K0SA 4G41A 3I64A 1X80B 4ZCLA 2B1IA 2K7FA 4Q3AA 1VL5A 1M7BA 4O5OA 3W5AA 2W6JA 2J0UA 4J16C 1PWHA 3SYMA 2N47A 2GN1A 4GNRA 1L5HB 5FOVA 2X2OA 3DLIA 4R2XA 1GUBA 3NTRA 4MMXB 2NT4A 1E3LA 3VV3A 3H2ZA 2B4QA 2I2DA 3VNUA 4F3RA 3VVLA 1BMDA 3F3SA 2ZSAA 1V3VA 1GCGA 2P1DA 3QXXA 4UBLA 1D2MA 1LC3A 1QAOA 2C2MA 1EDOA 2YNMD 1BS2A 3AR6A 3QOXA 4BNVA 3FI9A 4PS0A 4KGZA 5CT9A 4F9FA 2A9OA 4N8SA 6CHYA 5DI3B 1NR7A 1T1RA 4XPIA 4ALNA 2JVIA 5CH8A 1NLYA 4N5DA 2J6BA 4YQEA 1GL6A 4X1KB 4ZRDA 2NQ8A 4U7GA 2J31A 1OVMA 5GOTA 3ZY2A 4C2BA 821PA 2CUKA 2A14A 3QEKA 4M7RA 2DPMA 3FJOA 4DMMA 4GM0A 3GN2A 1MCZA 3FYUC 3KV1A 5HK9A 5LLSA 1XMPA 4FX5A 5EQDA 1COZA 3ZDXB 1D7AA 1Z3CA 2FSVC 2VPZA 1U9CA 3PGJA 4HFNA 4YB8A 4YRFA 2Q3MA 3UHFA 3ZVLA 2ET6A 2Q5OA 5TPZD 4L2IA 3STVA 2P4HX 3DE4X 5E6UB 3WKBA 1EDBA 3IMCA 5TR9A 1V1RA 5HRAA 4MR7A 4XA8A 3CLSC 4UUBA 3MS4A 1CEXA 5K8TA 4P4NA 2OD2A 3AF3A 5K3EA 2H1WA 1AUOA 3D5TA 1WXWA 5EHQA 2QVLA 4D3DA 3LY9A 1NMZA 1P7WA 1V7QA 1WUIS 3PDCA 1NBME 3I83A 4JGBA 1PSWA 1QPBA 4KLZA 3LWZA 3SD7A 1TQ8A 2NSLA 4ZYWA 1RWXA 3RJZA 3IERA 3D6MA 1I5RA 4JYPA 3RUFA 2O1WA 4EVSA 1EVYA 3VU8A 1L5ZA 1X3SA 4MB6A 4IFTA 3T5AA 1BTOA 2XX3A 4UM7A 1PFKA 5LBUA 1DL5A 3EBLA 4RHTA 1A8IA 2NZUG 1P8AA 1II8A 3RROA 2HD4A 3LX5A 2KMLA 4PYIA 4OXNA 3SQMA 3DVQX 1GGEA 1ADGA 2BSAA 1JR6A 3MAGA 3UN1A 5ENVA 3BORA 1GD1O 4R3WA 4WY5A 4F6RA 4WW0A 3GJ6A 3U3RA 2LDBA 5EMHA 1QB8A 3TZLA 1VGRA 5ALMA 2CHUA 5DE3A 2XWSA 2VSQA 1E92A 4H7DA 10MHA 3R9KA 5DP2A 3HWRA 2MSKA 1G5PA 2H1SA 4KXMA 4L8VA 1PUIA 2I7XA 3GNSA 4P08A 5KSOA 3FE2A 4K6HA 1EQUA 4EG5A 4ZK6A 2YYSA 3B7PA 1RYYA 3L05A 4M8SA 4XCXA 2GYUA 3CJQA 3UWOA 4HL6A 1HBJA 3CPEA 3W5UA 3M83A 3RYIA 4QGFA 2DULA 3USES 3WZLA 4YAIA 2AGVA 3M1YA 4GRDA 3E3OA 4C4XA 1Q0UA 1WJGA 1ZL2A 4DWWA 3PNKA 2IXFA 4I9UA 4LHZA 3D6UA 3LVQE 1SPBS 3LXUX 3B53X 4JJAA 5E1MA 1V96A 4ZA2A 3SLGA 4CM3A 2EL9A 6AT1A 1EFDN 2ZRPA 5COQA 4R6WA 2IF0A 1O08A 4QGAA 4E33A 2P6UA 4AW9A 3J81k 2P6NA 4K9RA 5K4HA 3LGXA 1E5TA 5GZ1A 3VU9A 2R8YA 1TNDA 3U17A 1QU3A 3QVKA 4WA7A 2YCBA 2I1LA 3JVUA 3TLGA 3CVYA 4GR4A 5ALNA 4UVDA 7AT1A 1UDBA 3GROA 5F78A 2JLWA 3I32A 4TYWA 1WUJS 3TLYA 1NLFA 3Q8XB 5DTRA 1DIOB 1ECGA 1M76A 1ZGCA 4R68A 4CCSA 1IHXA 3F2IA 1NUHA 1Y5IA 2W6JD 3M3DA 4ENWA 3FOEC 4CF4A 5CJPA 1Y8AA 1Y80A 3AI2A 1PVDA 1QS0B 1H6AA 2AG8A 4FHZA 4M49A 5KDLA 1DEAA 1LRJA 5KTTA 1SXJE 1M2KA 2UYGA 5I7VA 1KYTA 5G1PA 2ISQA 4JVSB 4N01A 2WVGA 3OC6A 5JHGB 2C95A 2GGSA 1SH7A 1TCCA 3F1KA 3HJRA 3HUUA 3MILA 1AVTA 3GCDA 3UEOA 2DPXA 4IPTA 4Z7OB 3O8DA 3LC0A 3MA0A 3TM5A 1A4XA 2C3YA 1O5OA 3OH8A 1PZXA 4UBKA 4ZQCB 1COWA 1M34A 4ZOBA 1GY8A 2HWYA 4ZXPA 4IJKA 4QUAA 4Y1RA 2XUZA 2Q4TA 4CMEA 2D2IA 3D43A 3DZFA 3HNPA 4KLRA 3JQPA 3JW8A 1RAHA 4HYYA 2NSJA 2Q3DA 4EPXA 2CKDA 4UUNA 4LNUA 5AOBA 2BMAA 2RHBA 2GA9A 2ZBQA 4C4ZA 3KZMA 3Q3VA 4GLOA 4ZT6A 4C7XA 3A32A 3C8MA 3ONDA 4NE7A 1P5RA 3VYTB 4EX7A 2NO5A 4OF4A 1O6CA 2H63A 2EERA 4JEMA 5A9TA 5KOYA 2Q6TA 1M73E 3O3NB 5FFNA 4RZ2A 3DXXA 3V7NA 4BS9A 3RUIA 4BC0A 3T5BA 1RM4A 4YJHB 3FSJX 1NN5A 3AIIA 3EXEB 2QIOA 3KJGA 1EXVA 3PG5A 2H1IA 5B7QA 2L69A 2R00C 3LQ1A 5DDIP 4V39A 1CUDA 3GGSA 4D0LB 3NPMA 2LD4A 4KQIA 2RG1A 4JYMA 2O2JA 1KI7A 1JHOA 1YR6A 5DLQC 4IDEA 3I6QA 3TYXA 3KT3A 4BB6A 1C7JA 3FYHA 2VHVA 2W70A 2ZJ8A 2PSEA 1YRBA 2YY5A 1GPWB 4E70A 4PLHA 3ZZTA 3HS3A 1SBTA 2GEKA 1Z25A 2XT9A 3V8BA 3R75A 2ZJ5A 2MSWA 4WXMA 4XWGA 3LCVB 1JG3A 3FHJA 5F7OA 4YUAA 1THTA 2EDAA 1YUNA 4KVZA 4JKIA 2IUUA 1Z88A 4NYMR 1DAEA 1QHSA 1AT1A 1W1WA 2MSEB 3CEMA 3QVUA 4IMPA 3JR3A 3QFRA 4OAOA 1GZHB 2IYTA 1W0CA 4R05A 3WL7A 1J0EA 4CVNA 3NTXA 4ALJA 1J56A 4L57A 2I29A 2ZXFA 3MCAA 2Q99A 2Y2UA 2YJ3A 4CV1A 5JH7B 4F96A 2R2GA 3SIWA 2IH2A 1DZIA 2V6JA 4XJTA 2XMRA 4A03A 4P3XA 1L4BA 4J49A 1KK2A 3GAZA 3CKMA 1J2YA 5JSFA 2UUCB 4WACA 1Z18A 4DCPA 2Y6VA 1D2CA 1VC2A 3NUGA 5CPFA 1JDZA 4J0FA 2WILA 2YUTA 1J9EA 3LPMA 4HK4A 2XUKA 4I46A 3JY6A 4MQMA 1M7GA 2FJPA 3DHEA 3L0ZA 4YEDA 4EG3A 1GAJA 1AUVA 1LU9A 1OBFO 2QRKA 4Q3KA 4E11A 2PV0A 4EKGA 2ZTVA 2AWNA 2LW7A 3KJXA 3MELA 1JALA 4Y6GB 1NI5A 3RUPA 1FRVA 4I1OA 2Q5HA 4LHXA 3CVXA 3DCIA 2IEDA 1PLKA 3QFSA 2BFPA 4FFMA 3L6DA 1NP3A 2OSBA 4GOOD 4L4ZA 3SX0A 3VI4B 3ZR4B 3JQAB 4J0GA 4MRMA 1VBMA 1EFCA 4DWOA 1DBIA 3UCEA 1ZL0A 2AKYA 2Y1KA 5CA1F 2C8KA 1DAHA 1C14A 1K8QA 1Z2CA 3DZGA 3ZJYA 3C3YA 2VA9A 3L6UA 1K5HA 4GL4A 1XDWA 1VLHA 5AH0A 1TKRA 1U8TA 2BBSA 1LBHA 1VA5A 1WDKA 2ISCA 3FETA 4WUTA 3EA4A 2ZI4A 4GEGA 4Y6PA 2I8LA 1M10A 2NACA 3WXBA 1SOWA 4MPPA 4MQ5A 5JSQA 2HBQA 3JYLA 2HRCA 4MV0A 4HT3B 4EKYA 1QFMA 1MNQA 2XMDA 3DLBA 1HYGA 3ZYCA 1A72A 1O6FA 1WZCA 2PXCA 3OMXA 3GJTA 1COWD 4GX2A 1SELA 1P5FA 4JI1B 2D0OB 1KP9A 3DHNA 2J33A 3HK2A 3OIWA 4WCFB 1BE0A 1YB6A 4U7FA 4AS3A 4C20A 3QVTA 1JVNA 5BP7A 3GJ8A 4I5EA 3A3KA 2RHLA 3SJAA 4G4GA 4DY4A 1R5JA 5A7HA 2W2TA 3K9HA 3LUCA 2GBLA 3WHIA 4DUPA 2QAGA 3QLUC 3R6GA 2FPRA 3FPKA 4LY6A 5AKYA 3U13A 3LUFA 3RRMA 3RVJA 4HX2A 2R85A 3MT9A 3OCZA 3T3EA 3V3TA 1UAAA 1TFRA 1QPZA 2IVFA 4TMXA 3QXGA 1ZU5A 3AEYA 3NATA 4P53A 4JI3B 5JI3E 4J3JA 4AUEA 3IUJA 3SSMA 3B3GA 3MS7A 4YT4A 1J0BA 3TG8A 3CB4A 4PLTA 1CIJA 1N32B 2BCJQ 1XE3A 2IYWA 4TTQA 3L4EA 4KACA 3D7MA 4IGAA 1Y8RB 3WRVA 1PGNA 4BECA 1KZYC 4HNUA 2AN5A 3KKLA 4V1CA 3P9IA 3U3OA 1FMCA 1E9VA 3TJZA 1W48A 3QJYA 3D6JA 1US8B 4GOJA 4Q7LA 5ARCA 4I81A 3OMWA 4J03A 2HFJA 5A5GA 5K3FB 2RK4A 3RJMA 3P9KA 3DQZA 4PPFA 3FTDA 2ADFA 1PE0A 1ULZA 4BO8A 2IE0A 5EPUA 3EVEA 1ESCA 1UKCA 2EZ4A 3WWYA 3N5KA 2HA3A 4AG3A 4QHTA 3NORA 3G8DA 1XEWX 3TINA 3MJVA 4HGPA 4YX9A 3UFXA 3H86A 3R3UA 1S3GA 4UNIA 3L46A 4I1PA 2JIBA 1CZRA 2HA4A 4LGCA 1VJ0A 3ST7A 2FEOA 5H3LA 1CV2A 1DIBA 3DPUA 3G8YA 4PBTA 4HVCA 5K6AA 3QKRB 4RLQA 3STWA 1RTKA 1B8UA 1SCIA 3LBAA 1I94B 3LX6A 2YWJA 1TZJA 4B4VA 5B36A 4HMQA 3ETCA 3LLCA 4L22A 2QVGA 1A5ZA 5DWVA 1CSEE 1SVNA 4MS3A 4QXQA 1FYDA 4BKQA 4QKQA 4UTNA 1ZGZA 4Y7CA 1ZESA 1GFIA 1CK4A 2WJ3A 4HQOA 3KQLA 1OH7A 1ADBA 3QTBA 3P45A 4IIYA 5FBVB 1T5BA 3DBLA 4KFRA 4RMHA 4FM9A 1LQTA 3D3JA 4J76A 4W5HA 1G291 1JQDA 2EFJA 4B71A 1R8JA 5LR6A 4H4DA 4NCHA 2OO3A 5LUAA 4HS4A 1E58A 4OJYA 1X80A 1RS0A 2OCDA 4XI9A 1R0WA 2QNRA 3PVSA 4Y1GA 1SUBA 4QREA 2F8LA 4YT5A 3E5HA 5MFZA 3MPOA 1KF0A 4IIJA 1VPWA 2ZYWX 1LUAA 4EO4A 3U09A 4RZUA 1BZYA 1Y6FA 4E4YA 2QN2A 1J7JA 1H0HA 1V8BA 4GSLA 1W96A 5AM0A 4KZPA 5FOXA 5J2TB 3WP1B 4QHYA 3LHKA 2OKCA 1MOZA 1HORA 2CNDA 1Z83A 2AOWA 3SZLA 1HLDA 3B82A 2QHXA 1SD2A 4AO8A 1QTNA 4J9VA 3IQGX 4J0QA 1OWPA 5CNJA 4AZ0A 1U2SA 3KYJB 3V33A 4NOLA 1U31A 3U3ZA 4B4KA 2Z9CA 1MAHA 3ML1A 4DMLA 3TG2A 1P9RA 1Z2NX 5ITZA 4KX5A 1HE4A 4M86A 4QDOA 1JLSA 1DJNA 1ESDA 3GEIA 5CR9A 1EEXB 1RDFA 3ZD9A 2J09A 3RJ9A 4ZAZA 3QU4A 5G0UA 5KVQA 1KTVA 1P2TA 4K8OA 2PZFA 3ZU4A 4GYYA 4UTOA 3GA5A 1EP3B 1E3IA 4D9NA 4P4GA 1Z39A 3WL8A 3AB3A 4ZXFA 1JQBA 4K6CA 1DMSA 1QRDA 5KOHB 1AKUA 4KLAA 5BN3A 3D8BA 3WWEA 1A0OA 5CB4F 2VNJA 2H4YA 1UKBA 2IT1A 5LVAA 2CHFA 3IUSA 1PJBA 1U8XX 2RARA 2WF7A 3NT5A 4IHQA 1L7PA 5F64A 4OX9B 1EP9A 1M6VB 1YJBA 3NHBA 4LFBB 2PBRA 1P7ZA 3S2SA 3AOEA 2LIVA 4O08A 2O23A 2YHAA 2G70A 2X6RA 3OX4A 4UTXA 3FKSA 3JAWA 5I7WA 2OGZA 1H4QA 5CMLA 2Y1XA 3WMWA 2KW5A 2Q46A 3DO8A 1JFFA 2W6QA 4I1YA 5KPJA 2E3JA 4XSGA 3Q6IA 2OQIA 3KR0A 4OY3A 1EUCB 1R6AA 4RH3A 4J7UA 1NU8A 2R3SA 1SXIA 2SNIE 2Q3HA 4CTJA 4GOLD 2WIAA 2L17A 1DJQA 3ZQ4A 2LRHA 4LOKA 2AX3A 1U1EA 4F38A 1HNZB 2W8ZA 2YN0A 5LZ4A 1KZ1A 2NZYA 2WTNA 5K1ZA 3VKVA 3FOFC 1AK2A 3AF2A 4ZPJA 1NVBA 1Q84A 1Z6YA 3MT7A 4M1MA 1MN6A 1TOAA 1U7ZA 5E3JA 4A15A 5D5QA 3O31A 1HG1A 4IIHA 2QSJA 4MS4A 4UEJA 3SHVA 4G0ZA 2F1IA 5LOVB 5AKKA 3T7EA 4TKUA 3LOPA 1ZH6A 2IITA 3D6AA 4WNAA 3R7SA 5K4GA 3IBYA 4UPDA 3WNZA 1A8HA 1UPFA 4S1OA 4OOEA 3WQBA 2WHYA 2Z2YA 1WPXA 3DDSA 3L7OA 3CCCA 4BLRA 1CFJA 2I3ZA 1G8SA 1T8RA 3I04A 3RYIB 3R0VA 2AR0A 4HGQA 1FLNA 2IA5A 4DC1A 1DQNA 4MI9A 3OZRA 1CIVA 1KOFA 4EPVA 1WMBA 3DFIA 4BBZA 2FVYA 4GF5A 3IE0A 1B00A 2GBLC 2Z4SA 4RK7A 4TRMA 3THYB 4P36A 5AKJA 2QRVA 2GFQA 4Q05A 3MERA 1PFVA 2E37A 2MSLA 4CLDA 4JU8A 5HKBA 3PTAA 4FDAA 3NWBA 1EVIA 1VZ3A 1ENOA 1FUEA 2JLUA 1OHHD 2FWIA 2J5BA 4HZUA 1BQ3A 4RZSA 1E9CA 1CR4A 1V1JA 3WRXA 3UXHA 3WVNA 4LVCA 3V4VB 2HK7A 4PZPA 2A4KA 2QROA 1WPGA 1KFJB 2OV2A 4TXLA 5L7WA 2Q6OA 1MJGM 3PR1A 1CDZA 3K9LA 1E61A 5DM60 1SD1A 3S2UA 3MTDA 2AA3A 1JHMA 1L6RA 1UPUA 1NVXQ 1ZM4A 2ONYA 3GX1A 3LQQA 3PPVA 1HSZA 2DLDA 3TRKA 3PC4A 4Y2HA 5LZ9A 4FFNA 5HIKA 1G2PA 4R84A 4Q4AA 2I54A 3V2GA 3R40A 1FTGA 3O95A 3TIVA 4D3XA 3N2KB 2RE8A 4I9GA 2GQ0A 3B2NA 3V1NA 3H2HA 5BSVA 4MUFA 5DLYA 1DBQA 1H65A 1HDGO 3HEBA 2C4KA 4KV7A 1DPFA 2VWQA 1JAXA 2O2HA 1Z6PA 3C0KA 3ZHYA 2R84A 3Q10A 3EQ7A 4TLBA 2GRUA 4WXPA 2I3BA 5JJBA 1EESA 3KJZA 2OZLA 1CY2A 2ZE8A 4I7EA 3KD3A 4NV1A 4Q4JA 2QUJA 3TBFA 5K0FA 3R8CA 1PEKE 3FKSD 3DCYA 1Q83A 3PZBA 1VPTA 2COEA 2AHRA 4CETA 4QX6A 1RC8A 1WZ2A 3ZJ5A 5IBQA 3P9CA 2RG7A 1YR7A 4O4IF 3PNYA 3MFQA 3S81A 3O4HA 4DKJA 3FM9A 2X3YA 3IEUA 2QTLA 3ZLVA 3A27A 5A4DA 1N3BA 1OXKB 1KIFA 2A9QA 3IIKA 4JROA 4U2KA 4KR6A 1W4BA 3CPHA 1J5EB 2RGEA 4EK9A 1C0IA 3SE0A 2C57A 4YTEA 5JD6A 5C81A 3W7AA 3O92A 4YAGA 2GFIA 3WP0A 5KNDD 4FE4A 1QK3A 1V39A 3TNFA 1XKTA 2XNSA 3C3CA 1T5TA 4DG5A 5CURA 4QUJA 1O95D 4DLSA 3F6EX 1M6WA 3L6EA 5DLPA 3PHIA 3QOWA 1TLFA 1H8HD 3SG0A 1FTSA 1NNLA 5GP1A 4DARA 3D8NA 2REQB 1Z5ZA 2LKCA 1D2RA 3TI7A 4DLBA 5U4XA 1BU8A 3V00A 1NQXA 1EWVA 1UPBA 3DC7A 4NULA 4BMPB 1R8SA 2AFHA 4BNDB 4DILA 5EJ5A 4U7DA 3T41A 5IKOA 3JYQA 3GPCA 1G21E 2BBWA 2VLIA 5K6AC 1VJDA 1OJ7A 2EG9A 3HPQA 3IJ5A 5JSHA 4PSUA 2O3TA 3QZUA 1L5VA 4ND8A 2YNMA 4YHBA 2PKRA 3N8DA 4XUCA 2X2FA 5DSXA 1EFTA 3BQNB 5SY4A 1Q7CA 3Q15C 3RRZA 4TQAA 1ZGHA 5ALUA 3GQBA 3Q7EA 5JNVA 1HDIA 1DBRA 2OZEA 2V59A 3SHQA 4NONA 3FCYA 3FPHA 1H8EA 4L4YA 3UTCA 5ELXA 2QZJA 4US1R 3T1QA 4Y67A 5DHQA 3D6HA 2RH8A 3DHVA 1BHO1 5BPHA 2AT1A 2P9GA 2YV5A 4Y9UA 3TQHA 1G21B 1IOZA 3WDSA 1UT6A 3WB0A 3HWSA 3SC6A 5T64A 1QCZA 4HX5A 1G55A 1E9BA 1PBNA 2XE4A 4YIHA 3R0XA 3A6ZA 3ZCXA 5A2QA 3UAGA 4L08A 4E51A 4RFSA 1NRXA 1WOYA 1Q0ZA 1ZM3A 1D03A 2I2WA 2AJLI 1AKRA 4FHFA 3D4NA 5L51A 1KKUA 3O74A 4B83A 2A3NA 3F3MA 4NBSA 5SY9A 5EJ8A 2G80A 5FPKA 3UMYA 2UXDB 3AEQB 4W7HA 4F9TA 1NMSA 1JFSA 3RASA 2UZIR 2ZT5A 4L51A 5KJEA 2O2IA 4OFXA 3NDBB 3JAWB 3A1SA 1T5IA 5K8CA 3BGOS 2O54A 3ZH9B 5FPSA 4FE3A 2PUGA 4HEQA 4R9VA 1KMIY 1R9JA 5H81A 2FZKA 4KLNA 3LLMA 3RAFC 4QD3A 2GCIA 4HAVA 4R2JA 2NM0A 4Z4HA 4F4DA 2JGNA 4FYWA 3H5AA 3DAGA 1E7QA 2N42A 3QMPA 4L0QA 3SF8B 5IK2D 2K2WA 1FDSA 2B8TA 1QE3A 2WSIA 3BWYA 1XTZA 3A37A 3WTCA 1AB5A 1MJHA 3DFZA 3CRW1 1PEYA 4IGKA 4MRNA 4E32A 1Z62A 5BV8A 3IL2A 4U2GA 5LP6C 4N48A 2UV8A 1GIAA 4MO9A 4TKVB 2JJ8A 1MB2A 1U6KA 3VC7A 4OHZA 4WXHA 2JLZA 4KC0A 3RV4A 2OC9A 3QFFA 4H7PA 1T35A 3ECAA 4IMRA 4JIMA 2WU1A 4WOJA 4AYTA 3VA7A 1TO1E 4A23A 5DYGA 2HK8A 1HF3A 4ZO4A 4WFKA 1N6KA 5A9SB 3JAMA 2HT6A 3EJ6A 2QV0A 3U31A 3BXPA 3R3ZA 1QANA 2AG0A 1T26A 2J0EA 4HTFA 3RG8A 2I62A 5IXSA 4F7DA 5KQLA 4AJ1A 3D7LA 3H9UA 4G9BA 1A9QA 2W6IA 3JQEA 3N7UA 3OEHD 1IBKB 3T52A 4RUKA 2BGGA 1FPMA 4WGFA 3BXXA 1W25A 3O21A 2CNWD 1ZGJA 5HKAA 2WHPB 4Q3DA 1BW9A 3GT7A 2QX6A 4BRUA 3ET5A 1KK1A 3HSYA 1US8A 1LA2A 5I7RA 2VXBA 1C1XA 3A3NA 3D4BA 3F3KA 1YIDA 1DCFA 2ODAA 3AY6A 3BTSA 3T3PB 2DLCX 5CXSA 1YJAA 1EX9A 1K7XB 3HDVA 4C08A 4DKXA 2YMLA 5K0SA 3NHMA 3FMFA 5BOSA 2BFBA 4Z3KA 1JEEA 2V1UA 3TF5A 3BIWA 4O2RA 5F5LA 1L7RA 2NU7A 3VX4A 1I10A 3KG2A 4FNOA 1QH1B 3MSXA 1PCXA 3AWDA 4G5YA 4KW7A 3B6ZA 4H3SA 4C7MA 1JEDA 3AHGA 3A6KA 3I9KA 4JHLA 1ZBDA 1X9GA 3IJRA 3LS2A 4EEZA 2XAAA 3BICA 5GOZA 3G0HA 2W58A 1Q7GA 3O2SB 4R8KA 1N6IA 5K3OA 5K6TA 1XVIA 2BLNA 3V2HA 1XTRA 1B6GA 5G4LA 4TT3D 3CVUA 1DQSA 2RAUA 3KR9A 1JVBA 2HQRA 2NU7B 1E1DA 2A1IA 1BCSB 1AS0A 3A4NA 4IDPA 3V8QA 5BSWA 5EZYF 4CL2A 4WOKA 4AS1A 1GQQA 7ABPA 2PD4A 2Y0PA 1ND6A 4WWHA 3QV1A 2PQ0A 5JZBA 1H3EA 1DWOA 1J2JA 3FUCA 1BIFA 2G0AA 3ZXSA 1IRIA 4D99A 5BUQA 1FRQA 4CL0A 1XVUA 1K7YA 1UEJA 4C9BA 3ZDCA 1Z0UA 5AK5A 1XX6A 1UJ4A 1LNSA 4L78A 3MAAC 4GLBA 4P3KA 2J6HA 3KKOA 4B2YA 5B2FA 4FR0A 1E4EB 2J07A 4V0MA 4Y3UA 3ZJ4A 4OO3A 1DMRA 2ECPA 3E9DA 5KAPA 4QASA 4GBJA 4LMAA 3EPPA 2YBEA 3M4NA 1LDEA 3UV7A 3ZBUA 2SICE 1M2VB 1QK4A 3ROZA 1SOAA 3SQOA 1EINA 1XMVA 4FHCA 1LK5A 1KY4A 4N9QA 1JDVA 8ADHA 3OPNA 421PA 1WBJB 4J8PA 4BBAA 1A2QA 1QVZA 2Q0XA 1K6JA 3A4IA 1AF7A 3LZ6A 4H0CA 4RY0A 5DW3A 4PG5A 2C1ZA 2RBKA 3WB1A 1WO8A 4CKWA 5BQXA 4DZZA 1S2IA 4EPRA 2Y0DA 4RCYA 3IB6A 3S70A 4PR3A 2IS6A 4TTJA 2O0LA 1C3OA 1BXZA 2PVPA 3MAJA 1HZJA 2ZXEA 1JFRA 3DW3X 2MT9A 1ORTA 2D1TA 3K53A 2BM1A 5HCUA 4Y18A 1JKMA 1XZDA 4X24A 3OP4A 4HWKA 4HRXA 2XGOA 4DADA 2OILA 1UWCA 3BK1A 4IIBA 1NPTO 4CEIA 1KRXA 3I6BA 2GCPA 4PE5B 4ZYYA 2C5AA 5BYKA 2P2SA 3AY0A 2FHPA 4J94A 3KT6A 4LC0A 5BSHA 1C3XA 1P5JA 2V7GA 1REQB 2ORED 2CEAA 3G2JA 3KKEA 4KQHA 3U44A 2WM3A 4QJBA 1T2VA 2ECQA 3UTDA 3ISTA 4XQCA 2R4UA 5IVDA 3B1ZA 1E0SA 1NNSA 5BSTA 1JU9A 1KQOA 3QVLA 3WL5A 1HYBA 4KR0A 2M98A 5TT1A 1QAMA 3P52A 2JPDA 3LTEA 4MHTA 1XMIA 2BFCA 2Y9MB 2WZBA 1RAFA 1XEWY 1BAPA 2VNSA 3OBBA 2RBEA 4YMLA 1U81A 2B25A 2X0KA 4UOZA 5DIFA 3B78A 3ZGYA 3NS7A 2I99A 3UXEA 1SXJC 4PCLA 3TAUA 3U4QB 3GPBA 3DL7A 2F1RA 5COBA 4BXOB 4XQEA 4Q34A 4ALKA 2FYTA 3RE1A 3I28A 1ETHA 2M1XA 4CG3A 2CF6A 4IJVA 4OSOA 1IN5A 5CCDA 4NZPA 1H5QA 2KQUA 3TJMA 2ZE6A 1L5RA 4YAUA 4D26A 2UUPA 5T4HA 1OTHA 1QHHB 3QU5A 2VP6A 5KYYB 3TQOA 4N7MA 2WB4A 5HZKA 1B3BA 3DE7X 3I45A 1QO7A 5AIAA 3AEQA 3G7UA 3ROKA 4BVAA 4I3HA 3HEMA 4AD8A 4HV4A 5EAIA 3BEOA 1U02A 1H94A 1V6SA 2NTEA 4HH1A 5AHOA 1R0ZA 2WW8A 5FTNA 2G1JA 1SFRA 1CB7A 4L3WA 3F5QA 4PNHA 5DWDA 5IAJA 1MC1A 3A11A 5CM9C 5KKNB 3JQAD 3GU3A 1W36C 3CW2A 2C58A 1ZX1A 1JR3D 1AM4D 3AF4A 4A16A 1PV2A 1GGHA 3GFSA 3OQOA 2D74A 2ORIA 3CUVA 2R7AA 5FBHA 2IU6A 4HDOB 5FOTA 1P81A 2XZPA 2E4UA 1EJ6A 3E1KA 2AYXA 3SDZA 3ZXYA 4CM8A 3WGGA 4XWOA 4FW8A 2Q8QA 3G79A 4UBMA 2X0RA 2N1BA 2VZ8A 2V1XA 3QBEA 4NZYA 3W34A 1G8KA 2B21A 1E1KA 2FEPA 1MAWA 1GUYA 2IRWA 2AF3C 4HNHA 2XMSA 1E6WA 1UM9B 4R83A 2QM3A 3PUYA 4TZTA 2BEWA 2PH3A 3RAPR 4AMVA 2HH9A 3S8YA 2YV4A 2II6A 3GRCA 3DKKA 2HQBA 3OTHA 1JIKA 4JN6B 5G0WA 4HTFB 3ONVA 4OYHA 1VBFA 2PH1A 3CE9A 3NIBA 1Y7IA 4X54A 4YFYA 4ASUA 2G4LA 1G1AA 1XTTA 4G0NA 3BN3A 3SKYA 4QLAA 4EHBA 1Z6ZA 2JATA 1FMTA 4R16A 1KBOA 4YO7A 3K5HA 2E55A 4U00A 3O1LA 2XECA 1UBJS 1X3LA 3C3AA 4HBGA 2P4QA 4J6EA 1P39A 1GL7A 4NU6A 2DMRA 1Q3KA 4M0PA 4N5MA 1E96A 2EKPA 5FAXA 4EG6A 1FSGA 2X8AA 3SEZA 3CB2A 2WUDA 1N57A 2Q27A 3O1HB 4H7KA 5C1DA 4X62B 1GQYA 4S0ZA 4FFBA 5BQFA 4QYMA 4IR7A 1EUQA 1FDTA 2IKSA 3UB2A 4MV5A 3UW3A 3TQFA 2JLCA 3ZI0A 2RAVA 2PPVA 2P3QA 4R81A 1RWPA 1UZNA 1VFPA 1AKNA 3RH0A 3G2OA 4W99A 3RUCA 3K30A 4JEHA 2Q49A 4Z4FA 3D0QA 3ZDBA 1RAAA 4TWAA 1BA3A 3T0GA 1YKFA 3EGCA 1AUQA 4ZYVA 3D3QA 1QIMA 1U90A 4R6XA 5IG2A 5LSAA 5AI6A 1R5BA 1CY8A 2BRUA 2WWIA 3JVEA 3PQEA 2IV7A 4H17A 1U7OA 2GDJA 1M8JA 3OZXA 4XB2A 5B4VA 4GU5A 4KL8S 4XYLA 3PU6A 1SG9A 2PY6A 3ZHQA 1KJNA 2AWOA 4IQGA 4FKZA 3RFFA 1UANA 2NYAA 1Q2UA 1R6TA 3FUWA 3LYAA 1B6SA 2G3YA 4RCVA 3U37A 2WKSA 2CLHB 4MUMA 1KZ4A 1X0XA 1XK6A 4J7CA 4R1TA 4XLLA 5EE0A 5FA5A 2J9FB 5HHTA 3C3PA 2X1VA 3BPSA 2Q62A 5ANRB 3TTUA 2JD2A 2W9XA 3R9WA 5CAEA 2LWIA 5DN6D 1LB1B 1V25A 1O97D 2AFHB 3FGNA 1AK1A 2DBYA 5CIQA 4B7CA 1RIFA 4ZCSA 4F71A 3RIYA 2COUA 3SVZA 2XTMA 3WFJA 4AB1A 3UMCA 2H3HA 4NOMA 3R9XA 1WR8A 4I0WB 1YAHA 4G8BA 1JWBB 4TLCA 3VKHA 3NEYA 2XD4A 1ZH4A 3BIXA 3FTQA 1YRWA 1FSPA 4DNFA 1ZZGA 1QVAA 3FNIA 5FTMA 4LYAA 4TX1A 3U9LA 2HR1A 3B3AA 1PR1A 2O8VA 1PIWA 4GXRA 4LMPA 3RS0A 3ZWYA 4PYQA 3ELDA 1W4LA 2V6IA 2NO1A 5ELMA 1V9LA 2YHUA 4UDXX 1TQ4A 3P2MA 3GJZA 4C0WA 1DEHA 2C77A 1Z4KA 2X1HA 1UAGA 1UQUA 5PNTA 3JRWA 5BN3B 2WTAA 3C97A 3OECA 2PUEA 1RKQA 4QXPA 1BVHA 2VDQB 3A6PC 1S8NA 4ZPXA 2BGRA 1N2CB 3QYPA 4D81A 4QOGA 2H06A 5HTOA 4AN4A 1J25A 3OKFA 4G0PA 4GICA 2G36A 4ARVA 1AURA 3K09C 2NAFA 2VP9A 1EP1B 2ZJOA 2V58A 4DZTA 5LMCA 1L7EA 2DKNA 3P2JA 1CY7A 4H1VA 3VHRA 4E14A 1I4OA 1ZUHA 1KI2A 2HWUA 2OOKA 2QW8A 3B20A 1BE8A 4IX1A 1XU7A 4KR7A 5BURA 3PJGA 2C7OA 1P61B 4YBRA 1KARA 5KVSA 2QRUA 5E7IA 3U19A 3PXAA 4DPLA 3NO4A 1U4NA 3C98A 3Q3HA 4IG9A 4DGQA 1TMYA 2OVFA 3C3BA 1KETA 3VTFA 1VGVA 1XD2B 4EQ6B 3AHFA 2QTRA 3I73A 3N8GA 1V5FA 5JAZA 4OTZA 4M1WA 3LQKA 3QI2A 1XJ0A 4PLFA 4IFIA 5CJ2A 2HA2A 4QPNA 4MQ6A 2FP4B 5CT5A 2ZAOA 5DSZA 4AUKA 3R5HA 3M4YA 2BHLA 3FCOA 3ZK9A 5C8VA 4JVOA 1G5RA 4Q9AA 3OQPA 4FHDA 3EZ2A 3LECA 4TZKA 1TKAA 4NARA 1A3CA 3O1JC 3ZOZA 4RKQA 2BEVB 2YS7A 1J1ZA 3M9LA 4IH4A 5G3ZA 4I4NA 1C1DA 1C8BA 3K92A 4ZAVA 3ROMA 3MRVA 2QXYA 4LBYA 4BGVA 4UCWA 2F55A 1ZCJA 2J32A 3K3PA 4RVNA 3AUSA 4DT1A 2PLFA 3S2FA 3ICCA 4QNMA 2AW3A 1C4WA 1YI0A 2OPHA 4P4SA 4B6FA 5FL3A 1G4AE 4GQIA 2OM2A 4KIJA 3WOHA 3I42A 1AHPA 2CNNA 3ANNA 1JDSA 3B1JA 5T4FA 1MBZA 3OI7A 1OLUB 3VBEA 3VX3A 4WLUA 4BV2A 1H69A 3O03A 4HDRB 1NNI1 3AYXB 3F67A 4HNAB 4CLEA 3BHIA 3EYWA 3DC2A 2FW7A 1BXGA 3UJBA 1T9ZA 1EGMB 5AM1A 5FO0A 3UAXA 3ZVMA 1SPXA 4Q3EA 3VUFA 2PU7A 1ODCA 3L0BA 4MW1A 1M1UA 5K3AA 4BEVA 4RBNA 4C4YA 1O87A 2FF5A 4JLVA 1MEEA 4HDQB 2MJLA 2ZDQA 4J43A 1GHTA 2Z9BA 3GRUA 1Y6ZA 2OXCA 4TQUS 4X0EA 3JR7A 3C48A 3OZDA 4Y9SA 1D2GA 4MVJA 1M2OB 3N7AA 3K2QA 4R9SA 4W1QA 5I8ZA 4YXWA 4BMDA 2C8VA 4YCLA 4JVLA 4FMCF 2ZRQA 4QBIA 1PWZA 1JGTA 4HFMA 4TLDA 1WHSB 3HRKA 1P6XA 2V9CA 4MOWA 5A6VA 1RQ7A 5I7UA 2F8MA 4YRNA 2RHJA 3R3SA 1LW6E 4M9QA 3LC2O 3SN6A 1X74A 2EW2A 2X40A 4YJKA 2ZAIA 1KOJA 1SEVA 2ZDHA 3KS9A 3LL7A 4CCWA 1OH8A 1EUYA 5CRIA 1N2XA 1EWYA 2D5BA 4UM8B 4UUOA 3T61A 1C9MA 2J5XA 5A3RA 2HEGA 1WLYA 5M04A 3C8DA 1ESNA 1ZW1A 2G83A 3F98A 3RC9A 5HKKA 2I22A 5D5HA 3SDBA 1VDMA 3W3ZB 5BVHA 1GRQA 4Z4GA 3F97A 4D98A 3ZIAD 3VM6A 3M34A 3QEJA 2WNIA 5J1SB 2FDRA 2YR0A 2WKQA 1GADO 4IXDA 2J1LA 5D5PA 2WMOB 3JQ7A 4NEGA 5CYFA 4G97A 2XCRB 3QGMA 4E15A 4H35A 3SE7A 2F6RA 5HKKD 4A73A 1T5HX 3JQ8A 3N07A 4NYJR 4U02A 2FEAA 3L2OB 3S27A 1HETA 1XALA 1Y3IA 1DBVO 5FTKA 5JNUA 4D8VA 5AI4A 3K5IA 3V7YA 5IJZA 2CD9A 5CDFA 1G2IA 2OCBA 1FNBA 1RLTA 2IUFA 5HE9A 5LLTA 1W93A 5KDOA 1IPEA 1WDTA 2BZGA 4O02B 1LDMA 1CETA 4EF4A 3OLXA 1WQ4A 1U28C 3DXZA 3F7NA 4LDZA 2RB4A 2NU8A 3GJSA 1E2IA 4REOA 1NJ8A 5LNK1 1Q7EA 4R7TA 5JQGF 4EA8A 5L4NA 4NENA 4CUZA 2O8CB 1KSHA 3T06B 3GK3A 3BJRA 3NVMB 3LV8A 3OPVA 3G7SA 1NJGA 3ORFA 1RWKA 4G56A 4NNOA 4X5OA 1MXFA 3GGOA 3MTAA 2R4QA 3S29A 3UGKA 1XZMA 4MWZA 5LQSA 3RHZA 4M8KA 4U7JA 2OCAA 5CVUA 4IEIA 4REQA 2XUDA 1ZMXA 1WXHA 1LS1A 1MG5A 3E61A 2IFTA 2NVUB 2J0QA 4FFVA 4Y9RA 1YQGA 1KBQA 4BB0A 5JROA 2QP3A 3IPLA 1E3MA 1YKSA 4NTZA 1W47A 4JB8A 4QDZA 4R40A 4BZWA 2XB2A 2UZ0A 4DCTA 4TL7A 5LA6B 2XWQA 1CCWA 1JLMA 3MRTA 1XLTA 3NYWA 4QTZA 3E3MA 1M0TA 1XEFA 1RJGA 2H2DA 3KWFA 2H17A 4NDZA 4ID3A 3ZWCA 2OA0A 4TROA 4BYGA 3KQTA 1E2GA 1DFGA 5BR1A 1KWKA 4RPIA 1TVKA 5I7EA 2BMFA 3CF6R 2GPYA 2VJBA 3LW8A 5HF5A 4ALIA 4LVUA 5B58C 3ETJA 3H9BA 3WLEA 1CQXA 4LXIA 3GLGE 2PGOA 2R1VB 2BSXA 3OOSA 2GAJA 4GH5A 3VO8A 4A0GA 5JVDF 3T95A 3FWZA 4FOPA 1MW8X 4EGJA 1BQEA 2DYKA 1EK1A 4JL8A 1WSAA 3PFKA 4CDNA 2GD2A 1JPJA 1TVCA 1NI4B 4EAAA 3EIQA 4OHMA 3K0CC 2O8FA 4CTOA 3AQIA 4P22A 1JYEA 1PR5A 1UAYA 2JZCA 1CDOA 1MJGA 1S1CA 2Y1WA 1YI1A 3FVTA 1RLUA 4QGHA 3AJAA 1U7UA 1NW6A 4X3CA 3ZNQA 2V5AA 4DB2A 3MUNA 4X6YA 1IUKA 3OUUA 4AIIA 1YZ3A 5BN4B 4EFLA 3LLVA 8AT1A 1Y4ZA 5IDYA 5JCJA 3WNDA 5REQA 2QD5A 3MD0A 1VE1A 2CMHA 3GFVA 1CUGA 3OOWA 2NUAB 1V6CA 2CDCA 3MGCA 5JT1A 2Z56A 2FQQA 2I3AA 4Q9DA 3W4JA 4FU0A 1EIZA 1L5YA 1NBWB 2QX9A 3PD7A 4N0EA 1W36D 3FUUA 4DHEA 1V4BA 1T9BA 3IUNA 3L8MA 1XV5A 3AEZA 2VCEA 2HLDD 1B26A 3NGXA 4FGJA 2B9EA 4BKOA 1Z7WA 3V6LA 2GJKA 3HWWA 5KC8A 1Z6XA 3BD8A 3JD4A 2ZM5A 1LWOA 2HXSA 5ALEA 5C31A 1RZUA 1X1RA 2P35A 1M5UA 3A4TA 1Y3FE 3BWBA 1RXSA 2HQ1A 2ZYSA 4HTAA 1GXSA 4TSRA 3U7QA 3VH1A 2FPPA 2OM6A 3QX8A 3LT2A 4GWGA 4Z5XA 2I2AA 3UY4A 3NWOA 3V8NA 4RD0A 4WLOA 1HT3A 1J23A 1GFZA 4FMBB 2AFVA 3A1NA 2QG4A 3SK0A 4QFMA 2GX6A 4O4JB 3OC0A 1YR3A 5FB3A 1RWOA 1HDEA 2D54A 3A6HA 2C97A 2I6SA 1PJ2A 2VJLA 4GD3Q 5GZ3A 2D0DA 1J8VA 4J2OA 3T3IA 4GMHA 3Q3IA 3D2LA 2CMDA 2GI4A 3HUEA 4HDCA 4JEUA 3N70A 1CY0A 1DKNA 5EIFA 4QGSA 1H0SA 3IOEA 2YXLA 3T9FA 1OWLA 1RVDA 3PNMA 4IILA 4YRPA 3VR4H 2J45A 4UMDA 1MMFB 2AE2A 2GDZA 2PUJA 1OPRA 4BWGA 1X87A 2AJDA 2PS9A 2QRPA 1IN7A 3ZEAA 1BCRA 2GKSA 2RIPA 4M6WB 3S68A 1KEVA 4DQ0A 3FGPA 1HNXB 1EK0A 3UOAB 3X3HA 4JDUA 4BP1A 2KJQA 1EG7A 1L0BA 1NUAA 2J48A 2VO1A 3AONB 1VCNA 1P44A 3L7NA 3QA9A 2WPDA 3HNOA 4P5DA 5ALQA 5AOVA 4B4WA 2DBQA 4BZXA 5JYEA 4QO8A 3SZMA 4FYYA 4EY5A 4LJ7A 4ZO6A 3L0DA 3U7HB 2P90A 4N3NA 4ZT4A 4URFA 2CNLA 1FNCA 2UYYA 3S5UA 2Z5VA 1FDUA 2EZ8A 2FZVA 4HC4A 3IRVA 3D0KA 1GKKA 1LWNA 4PW0A 3OZWA 5K0CA 3ZWBA 1NVMB 4F7WA 5C4GB 1KYZA 1RWQA 2PT9A 2J87A 2ATCA 5ECGC 4MUAA 1NVVQ 1K3UB 1TA4A 3MXTA 2O8DB 4CKXA 3EHEA 4GI1A 1VG8A 4BNXA 2HMWA 3JWIA 2DJ5A 5CNKA 5IJXA 2WTEA 3KPWA 5ALIA 1KOGA 3AH8A 3OE7A 3GUZA 4ENQA 5B4UA 5CA0F 4LN1A 5CNIA 2PAFA 5KTMA 1DARA 1QO9A 4MV3A 4X6XA 2YN2A 1HL3A 1PS0A 4E3ZA 2IY7A 2VK4A 4YRCA 3FPLA 5BOVA 3QE2A 2A88A 2V7QA 3R5SA 1FTWA 5J4LA 3I05A 2GCOB 1CJTC 3ZLUA 1DKOA 3ACBA 3HA2A 1TCVA 4DYVA 5A5FA 3FY4A 4OQLA 1I2ZA 4MVJD 4PHGA 4QJ4A 5C52B 3LLSA 1FFXA 2EJCA 2VNIA 1CQIA 2WF8A 3FWNA 1J1UA 3WYNA 5H9WA 3HQ4O 1DKLA 1N33B 1RIIA 1QQAA 4TKZA 4A4DA 3GXOA 1VPLA 3AR4A 3IQZA 3Q7TA 4B0OA 5IF9A 3U60B 4ARAA 4B7UA 5EXEA 1BVRA 3PXCX 1JLLA 5SYMA 3UJ3X 1U0RA 4H59A 5L6LB 3CONA 1PJLA 1KP3A 3S55A 2DERA 1FYFA 1LDYA 3AXSA 2H7XA 4RTSA 3K73O 1LY1A 4YP5A 2GZ1A 3W78A 4F2GA 1W4RA 1UDAA 3AHEA 5E8JA 3RFVA 1GZ3A 2JI6A 3PFGA 1XCJA 1T4GA 2R47A 1U98A 1QWSA 2EG5A 2YJ4A 4D82A 2XQVA 3N8KA 5AHRA 1WXXA 3OKAA 3PD1A 5LP6F 2I2BA 3E9ZA 3KOYA 2JLXA 3ZBQA 1CEYA 3MLBA 2NU6B 3VO1A 1EVZA 4QA9A 3WB2A 1V9SA 5HP4A 3MJEA 1ISMA 2K87A 2WQ7A 2O8BB 1NPYA 1JIJA 4LF8B 1P7CA 3RQIA 1CQWA 3EDOA 3DAHA 2I9PA 1FX0A 1X8JA 1V6AA 4X85A 4PLGA 4EENA 1XU9A 2C4WA 3QLVA 2XRMA 3K9QO 4UDOA 5BXQC 4MGZR 4BGEA 3ZD7A 2AEEA 4J91A 1KO7A 3CZRA 1KSGA 2GKOA 4B0PA 3F6CA 3QLVC 3HCCA 3KKQA 4DBVO 4AMBA 1CF4A 1YVUA 4X8LA 1ZAYA 3HXLA 4QBTA 2YIJA 3GUHA 3SJUA 3UCFA 2AG5A 4NBRA 1ADFA 1QHFA 2VJQA 3KCQA 2DVMA 3T5TA 4BO3A 2O8BA 3ELYA 4QNNA 1U7HA 1JIUA 2OFXA 1RU3A 2HCRA 4MPDA 4OLJA 5A4FS 2VSOA 4KR2A 1E9FA 4C7VA 1OBHA 3WLMA 4J0HA 1JUDA 2PU5A 1OPXA 2ZRIA 3PQ8A 5ADWA 1MH1A 2R62A 1TM2A 1XNHA 1V3UA 3I8SA 4UXIA 1USUA 4O2LA 5F2OA 1DV1A 1FXUA 5GV8A 4F46A 4PGHA 1DNPA 5BUCA 1I7SB 1XKQA 1R8QA 1V47A 3ZQUA 4D9JA 5IUNC 1A9PA 3JQBA 3KEGA 3EPHA 1YKGA 1Y34E 1TRHA 1HE2A 2OHOA 2OGTA 3OY2A 3ZHVA 1ZP6A 2R6DA 1J2UA 2P4SA 5A5EA 1LF0A 2Z57A 4OXKA 1SIWA 1JJVA 1ZEMA 4X6UA 3N7TA 2J0UB 1RWNA 4KH1A 1Q7RA 4QEDA 5DOZA 3R7DA 2IXAA 4FIZA 1OFGA 3ZLJA 1YRLA 3DDCA 5JAPA 2C0PA 2ERXA 2HNBA 2C5SA 4QBFA 4JENA 1V16B 2HPZA 4HLUA 3RS7A 3IPAA 4OGGA 2QMEA 3T3HA 2FE1A 4FGZA 2D4HA 3SLRA 4C6TB 5FOUA 2J4CA 5DI9A 2X13A 3TNJA 4OAPA 2ICAA 3LPNA 3CNOA 4GZLA 4YRBA 4H6WA 4XWTA 1A71A 3L5OA 4ROSA 2REXB 4FIDA 4MI3A 3REFA 4JV5B 5DTJA 2E21A 4DTCA 1UIRA 3DQQA 1P1FA 1F38A 4RHCA 1Z0KA 2EP8A 2OENG 1CF2O 2VQDA 2WM9B 3Q85A 2NZ8A 4OKIA 3UANA 3BMQA 4EZBA 2NZJA 1QH9A 3ZHOA 3A04A 3T7JA 1XBTA 5CA0B 4W5OA 3HJFA 1YC5A 4ZYZA 3VU3A 2J0VA 4WD3A 3WL4A 1OFVA 2ANCA 5F1OA 2PJDA 2Q7DA 3TLXA 4QM6A 1JJ7A 3L77A 1VPDA 2XR1A 1H93A 3QYFA 4K26A 4O0MA 4YRGA 3U7QB 3CX6A 2XIJA 4A8PA 1L4FA 2BIFA 1P2GA 1GTJ1 3R41A 2PSSA 3VPAA 3W8NA 3IUQA 4I9HA 1N2SA 1DXYA 2AMVA 2ZQYA 1NNEA 3DXFA 1H2XA 3UNXA 2W2NA 1J8DA 4KQGA 2V45A 4AWAA 5TY0A 4D4IA 1C2YA 1H2BA 3ICOA 1A7KA 1CUIA 1R8XA 1QONA 4R1QA 1DINA 3NH6A 3RRJA 3W2GA 4BGDA 2FFBA 4ENTA 1RAEA 2XMGA 4HNQA 4XIGS 4CCYA 4N65A 3K0AA 1MVNA 4P98A 2AC2A 4MIOA 5JDCC 4AJHA 1H2HA 3EZYA 2ID8A 4D97A 5HCNA 2A1TR 1TEXA 1Y7PA 3O1IC 3UIEA 2GASA 1P9OA 1KO5A 1T91A 3UK1A 2F43A 2QVZX 4OX9Y 1FTYA 3DXYA 3WI7A 4E4TA 3NGLA 4ZT3A 4UCQA 3DA8A 3PTLA 1XLWA 4TWIA 4ZZ3A 1IK4A 3B36A 2AD1A 1CT9A 4TMTA 2R6R1 3OZCA 5DHUA 4G1EB 4M3NA 1TI7A 2ZAGA 2ZRBA 2CUZA 2JF0A 3MUFA 5JBQA 3EXIA 1RRCA 4QPJC 4TZ0A 2O3UA 4K03A 5HK8A 3TL6A 4INZA 4A91A 3DMYA 1P7VA 3ZCVA 1JA0A 2O7QA 2QP4A 4MJLA 2ASEA 2C5LA 2LCFA 4KKVA 3ZHBA 2PR7A 1TZBA 2IUSA 3DGFC 4PC7A 5MDHA 4PYOA 5KJ6A 1OD6A 1YVPA 4B7XA 1ZR4A 4JASB 2ZIGA 3BDIA 3TRIA 1L7DA 4ZDKA 3NKFA 3EPLA 4I66A 2R751 3IVCA 4DB4A 1ZVMA 1ES9A 1O94D 3JVDA 3FKQA 3N2GB 3OCWA 4M9UA 1YK0A 2IQ5A 1NFQA 1QOZA 1Z5UA 3BDVA 2J3MA 3I2HA 3LRPA 4QTUB 1PTKA 3V1LA 1XKXA 1N2ZA 3G0IA 5EXDA 4IXWA 2BMWA 3UYKA 1G8GA 2ZTMA 3WBFA 2FSVA 4FONA 1HRDA 2NU8B 4CMCA 1BJRE 1CRWG 2BZSA 3T5PA 1Y7HA 2QM0A 1G9TA 3PNQA 4PFKA 4RGQA 2IPOA 2NXJA 3R3JA 1JR2A 4EECA 5F2NA 1UMCB 3AY3A 3BS4A 2X6QA 4WNAB 4DZRA 4HG2A 3ROPA 3G13A 3G7NA 1K89A 3A6FA 3IH5A 3BUSA 4C6RA 4EB6B 5K8JB 1DFIA 5EI5A 2ORWA 3O82A 4CODB 2OBLA 2DECA 4G5RA 5K0BA 3KFLA 2HMAA 2N75A 4A26A 1DEKA 2NYVA 3L92A 5E4TA 5H80A 3DHWC 3AP2A 4HLDA 3QUBA 1USVA 4LRTB 4NNPA 4A3SA 4BRWA 5GONB 2UVPA 2YUIA 4TTSA 4GT1A 2YCLA 2ZE7A 5AKXA 3TCNA 1UPCA 2RGCA 2VJNA 3STYA 2QRVB 3TMYA 4BDSA 3TOVA 1WMSA 2XF8A 4M0CA 1TUIA 5LA6A 4AIRA 1TU4A 4U7TB 5F51A 4MUKA 2I4NA 3RRXA 2CHEA 4M1TA 4E08A 1RC1A 4GL2A 2TSYB 1T5LA 2VUUA 2WKWA 4ZT5A 3TSYA 3WYAA 4Z2YA 3PJRA 1SMKA 3PVCA 3OF3A 4NR0A 1AGNA 3UAVA 5IH3A 4XJXA 3HC7A 3D5EA 3SC2A 2HLHA 4HEJA 4YLGA 5BMVA 4ZHQA 3P9SA 3OQIA 4Q1CA 4P93A 2V8BA 4PONA 2ZKIA 2IY9A 2HREA 5FL7A 5KWVA 3RABA 3C8UA 4DPKA 3BMNA 1V41E 4KGVA 4JR2A 3S1AA 2WJPA 1GPJA 4RJ2A 1TLTA 2PLNA 2XLBA 3QXSA 5TPZA 2EF1A 3MFYA 5I9MA 3RTCA 5J47A 1GPDG 4RTJA 2G1UA 3TOCA 2AV6A 3OTGA 4KNWA 4B3DA 1WABA 1HTWA 4Y0AA 3D8RA 3RSHA 4MV8A 2AEMA 2YWHA 3QWHA 3GR6A 1VLMA 3NHWA 1W5BA 4FNMA 4GBGA 5AJUA 1KOLA 1KYVA 2MOKA 3QKSB 2ACEA 5FHRA 3VR3A 3WNQA 1JDNA 1V5GA 3T9CA 3GZNB 1SGWA 2A2ZA 3SX4A 3L6RA 1NYQA 3IT3A 3OD5A 4O4HF 5M2QA 4E2FA 3BD7A 4Q9KA 5IDXA 2OZLB 1UZLA 4KK3A 5HJEA 1DAIA 1THMA 1V5IA 2AJBA 1PZFA 1XZLA 2H5JA 1J07A 2GBIA 2IEGA 2PCJA 2LZ0A 3F5DA 1X7WA 5IYZB 5M5BA 5KQMA 3N39C 3FDFA 5KPDA 2D4AA 3I2IA 1DO8A 4Q1EA 4ND5A 2X6TA 1R0CA 3VSBA 1A9TA 4B35A 1M2FA 2HNKA 2RH5A 4D8YA 5FUYA 1CFZA 1CUYA 1H6BA 2ADOA 3NC1C 2WG2A 3E9EA 4JC8A 1UFVA 4EPYA 1CRLA 4QQNA 1GG5A 3O73A 3FDZA 3T3MB 2C4VA 2CZGA 1BXGB 1AS3A 2JFWA 5HILA 3GOHA 1OJLA 2O0MA 1F6WA 2X7JA 1W75A 2VJCA 5HVNA 1NI3A 5BPFA 1R9NA 3FPEA 2IZOA 1PL0A 2VQSA 2FW1A 2AQHA 2DM6A 4XYMA 3ZWAA 4G5FA 3FZQA 5TQVA 3V8EA 4AYXA 3O38A 2W8BA 1YNSA 4O4IB 2W83A 1PK7A 2PL3A 3IAAA 1DKRA 2QLNA 4FFOA 4HQKA 1LSSA 1RW4A 1T1JA 1TYZA 1L5HA 4KBYA 1QH8A 4D3FA 2HJWA 3ZE6A 2ZB8