4P7GA

Rat apo-comt, phosphate bound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
213
structure length
213
Chain Sequence
b'GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
molecule tags Transferase
source organism Rattus norvegicus
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
total genus 74
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7gA00
4FZVA 4P7KA 2JHCA 2V74B 2CMHA 3GRUA 4ZTBA 3GDHA 4MWZA 4C08A 1ZG3A 5KYGA 4HC4A 2Z6UA 3TKYA 4KIFA 1R74A 3G8AA 3M4XA 5FTWA 5HIKA 1SUSA 2QRVB 3P9NA 5CIYA 2G72A 3LHDA 3NVMB 4DM3A 1L1EA 2AZTA 4FT2A 3LDFA 2HV9A 1X1AA 1RI3A 3SX0A 3V8VA 3KU1A 4DZRA 4DCGA 4BP3A 1IM8A 4M36A 4C4AA 3PFHA 2PWPA 9MHTA 5FQOA 3R6TA 5FHRA 3P9CA 1RI5A 2ZW9A 1IY9A 3SSNA 3BKWA 5F2NA 1BOOA 4X41A 3FZGA 1EAMA 2YVLA 5KVAA 1AF7A 5GIOE 3HP7A 3MCTA 3JWGA 5U4XA 1R6AA 3UA4A 4E2ZA 2I9KA 3P2IA 2ZZMA 2P1DA 3C6MA 3I53A 1DL5A 1ORIA 4ER3A 3M33A 2ERCA 3B3FA 3THRA 3GNLA 4XCXA 1L9KA 3CC8A 5HIIA 5ICCA 2ZZNA 2Q41A 4HTFA 1IXKA 3EVEA 4HH4A 4PYMA 5K0NA 4ER7A 2GS9A 1G6Q1 3I64A 5F2KA 3DOUA 4GC9A 2P41A 3M6WA 5FQNA 3S68A 2GLUA 4MHTA 2IP2A 4KDCA 5K09A 3AXTA 3IEIA 1OR8A 1UIRA 4RTPA 3DXXA 3K6RA 1JTFA 3R3HA 4L7VA 3DMFA 5EGSA 1FJXA 2NP7A 1NW6A 1BKYA 1UFKA 2ESRA 4PYQA 4OBXA 1L3IA 3MTEA 4E33A 1SKMA 2AOTB 3MHTA 4IKPA 3G88A 2UYQA 5T64A 3K0BA 4PONA 2AR0A 4CKEA 2G70A 3CGGA 4C06A 5K0JA 1WS6A 2QE6A 4EVIA 3EVCA 5DTMA 2B78A 5HIMA 2P3QA 1JG2A 2B2CA 3HA3A 3LBFA 4X61A 3EEOA 2UZ4A 8MHTA 2ZTHA 3R0QA 3RW9A 3EVBA 1SUIA 5DPMA 2AN4A 2P8JA 5H02A 3AXSA 4HRAA 1JG4A 2ZWAA 5LQKA 3GJYA 5CVJA 4FSDA 1VP9A 1TW2A 4GQBA 5EEGA 5CVUA 3BWMA 4E2XA 4O29A 3FTFA 3OU7A 5F2OA 3LCUA 2NXCA 3GCZA 1F3LA 1XDUA 3LCVB 3NTVA 4EKGA 1XCJA 3KQWA 5DSTA 2GPYA 1WG8A 3LPMA 5HFJA 3BXOA 4C04A 3PFGA 2WA1A 2Y1XA 1JR4A 4A6EA 5C1IA 1BHJA 2PVCA 2PSSA 3E23A 10MHA 2XYRA 4HGZA 3DXZA 4RTNA 4PYOA 2FK8A 4OA8A 1ZKDA 2EX4A 2K4MA 2QRVA 2PX8A 2O0LA 1NV9A 3OE5A 1YZ3A 2OB2A 1YB2A 1I9GA 3LDUA 3O7WA 3UJ8A 3VC2A 4E32A 1RI2A 4PNEA 2DPMA 3UZUA 3TR6A 1EG2A 4ER0A 5HIJA 2G8NA 5DX0A 5LR6A 5FWAA 5E1DA 3B3JA 3LECA 1PJZA 3P71T 3GRVA 4PYKA 5C0OE 2IH2A 1M6EX 4PGHA 3P9IA 3VC1A 1AV6A 5KQSA 5FA5A 5LQRA 5CD1A 3C0KA 3EMDA 3UBTA 3LKDA 2ZBPA 3DUWA 2YUIA 1KP9A 2HWKA 5K05A 3IV6A 4WXHA 4C05A 2ZIGA 5EEHA 2IBSA 2XYVA 3P2KA 3B3GA 4MIKA 1Q0TA 2C7RA 3TOSA 5E1MA 2DULA 2NXJA 3EVFA 2OYRA 3LDGA 4YV0A 3QOWA 3OZSA 3DR5A 2R6ZA 3BT7A 3D2LA 4RVFA 1X1DA 4OA5A 1XXLA 4PINA 5CUQA 5HILA 4YUZA 2AVNA 3RODA 1TPYA 3R24A 3IHTA 1KHHA 3T7RA 2IFTA 3UJCA 3KQQA 2IBTA 2VDWA 2V7EA 3KPYA 1QZZA 5ERGB 4YV1A 2JHPA 3SM3A 3GXOA 4RWZA 1XJ5A 2XYQA 2XVAA 2ZFUA 3UFBA 3FPJA 4A6DA 2FHPA 4F84A 1RJFA 3L8DA 2HNKA 2OB1A 2R3SA 3EVAA 4R05A 5DSXA 2UYCA 5T6BA 2OXTA 4GEKA 5BW5A 4RVGA 5LQCA 3GWZA 3Q87B 4X63A 4RTMA 3RIEA 1YF3A 3AY0A 4OQDA 3VSEA 3LL7A 3OZRA 4ER6A 5ICEA 1KYWA 1TW3A 5DRYA 5EKXA 1NW5A 5EG5A 4QVGA 1SVUA 4RX1A 3UJAA 4YUYA 3TPZA 5DM2A 1P1BA 2VZ9A 4R6WA 5JUWA 4C03A 3P2EA 1WXXA 2H11A 1D2GA 4E31A 3H2BA 4NECA 5K8VA 2A14A 5EMJA 2XVMA 1NBHA 2YQZA 5HEKA 3GIWA 2YR0A 3NW9A 1KIAA 3OU6A 4WVLA 5EHIA 1EQAA 2PX5A 3OCJA 4RV9A 4P7GA 4RTJA 4PYNA 2OKCA 4AZSA 3PX2A 4DQ0A 2PGXA 4FR0A 4KRGA 3DULA 3G2PA 3Q7EA 4P7FA 4M37A 4PGGA 2P40A 3FPGA 1KPHA 4LWPA 2NP6A 4YMHA 3A27A 4FGZA 1X1BA 2P3OA 3HCCA 3KPJA 3TQSA 5EVJA 5FWDA 5EMMA 4F86A 4EQZA 1I4WA 5GOZA 2EFJA 4E30A 4R6XA 5EZSA 1ZGAA 1L3CA 2IDKA 4K6MA 2XBMA 3DMHA 3U81A 1AQJA 1AQIA 3CKKA 5D1NA 1N7IA 3OU2A 3BGVA 3FYDA 3TFWA 4YUWA 3UJ6A 1B42A 2YXDA 2G1PA 5FUBA 3OFJA 3KQTA 3QV2A 3SMQA 1KPGA 1QAMA 3PLAE 1WXWA 2NXNA 2PWYA 2AVDA 1JTEA 3G2QA 5JR3A 4M7RA 5CCBA 3PT9A 4GC5A 3HCDA 3GRZA 3TM4A 1XVAA 3ELUA 5E8JA 1M0EA 2ZIFA 4Y30A 1RJGA 3HM2A 1T43A 3OZTA 3BWBA 5CM2Z 3NWBA 2EJTA 4DA4A 1KXZA 3EVZA 2C7QA 3LX6A 3FPFA 5DM0A 4YUXA 3JWJA 1Y8CA 2GB4A 3PS9A 4GUAA 3G2MA 5M5BA 1ZGJA 2ZIEA 2NNWB 3HVHA 2I6GA 4OBWA 1P1CA 4IV8A 3C3YA 4QTTB 3BWYA 4GBED 2O07A 3HNRA 5IH3A 2P7IA 2BR5A 3ME5A 3DH0A 1NV8A 1SQGA 1XDZA 4FSXA 4KIGA 1EJ0A 1G38A 1FP2A 2AS0A 2F8LA 2H1RA 2LD4A 3G8BA 4ISCA 4XUCA 4PYIA 3TMAA 1G8AA 3E8SA 3QOXA 3KR0A 3T7SA 4YMGA 3FUXA 3MERA 2UYHA 5GIPE 5E1OA 3FTDA 1YFJA 3EGVA 5CCXA 3NJRA 4HG2A 3BZBA 4B17A 4E2WA 4E2YA 1SG9A 2GAFA 3LBYA 4FP9A 2G71A 2I7CA 4R8SA 4LG1A 2VDUE 5CVVA 3EPPA 3NMUF 3SSMA 3NDJA 3F4KA 3REOA 4DKJA 3C6KA 5BXYA 4AUKA 3GO4A 3MB5A 2JH9A 3B89A 4FS8A 3IYLW 1MHTA 1YUBA 1JQ3A 4QPPA 2OPBA 1H1DA 4Y2HA 3GRRA 3KQOA 3ELYA 3KR1A 3UJ7A 3G7UA 4CTJA 4GOOD 4BP1A 2IH5A 5CVDA 3OPNA 3G89A 2CWWA 1RI4A 5DRTA 3CJTA 3HA5A 2OZVA 5K03A 2ZSUA 5K0EA 5KS2A 1RJEA 2GA9A 3CBGA 2ONZA 3BUSA 2ADMA 3BWCA 3HCEA 4P7JA 2ZULA 5HZMA 3GRYA 1QAQA 4CXMA 1G8SA 3M6VA 3KKZA 3LSTA 3A26A 4RSRA 5EMKA 3SSOA 2B3TA 3FUTA 3KQVA 2YXLA 3TRKA 3PTAA 4OX9Y 3HTXA 3C3PA 5EIWA 5DX8A 2ZZKA 3UWPA 1O9HA 4EK9A 4AZTA 1NW8A 3UJDA 4QDJA 2VS1A 3KHKA 2FYTA 1JQEA 3NVKI 4X60A 2UYOA 5E8RA 2GH1A 5EMLA 3KQYA 4ATNA 5DLYA 3ERCA 3ELWA 1D2CA 2YX1A 2BZGA 3DMGA 5EKUA 5B1SA 4KWCA 1YZHA 5K01A 5HOQA 1R18A 4KW7A 4C07A 5DT2A 2ZCJA 1WZNA 1HMYA 3ER8A 4QQNA 5EC8A 1YFLA 3FTCA 3LGAA 2NXEA 3JWIA 1VQ1A 4DCMA 4MTLA 5LSAA 1VL5A 3I5UA 4PYLA 2IH4A 3HCFA 3FRHA 2PLWA 5E9WA 4QDKA 3ELDA 2AOUB 3A4TA 1PRYA 4PWYA 2YTZA 2JH8A 2B25A 2P7HA 4PCAA 2P35A 5BP7A 1WY7A 2IIPA 1VPTA 2PXAA 4DF3A 1RJDA 3BGDA 4V0QA 4DMGA 5G02A 4U7TB 3G5LA 3UJ9A 3FYCA 3KQPA 2FCAA 2JG3A 1R00A 5GP1A 2C7PA 4CKCA 3FUUA 3O4FA 1JSZA 2PT6A 3DLCA 2ZVJA 5GM1A 3T0IA 3TKAA 4G56A 5DWQA 1NT2A 3HA7A 5DXAA 3PB3A 3T7TA 2PBFA 3HEMA 2NYUA 5MHTA 1O9GA 3FUWA 1BC5A 4IWNA 2IGTA 2BM8A 2H00A 4F85A 3M6XA 4JXJA 5DTRA 4V0RA 1KR5A 5LQAA 4ER5A 3DP7A 2ZBQA 3MCZA 4QQKA 3SXJA 1P91A 1XCLA 3CJRA 2HR1A 5FCDA 1R8XA 4LECA 5EHGA 2I62A 3ID6C 3A25A 3A7DA 1O54A 5D1HA 4HTFB 1JG1A 4BLVA 1I1NA 3MTIA 1ZQ9A 3BGIA 4RVDA 4HSGA 3KPVA 2EG5A 2FRXA 3KPWA 2PKWA 2PXCA 2ZLBA 1NKVA 1JG3A 2WK1A 3P97A 4KDRA 1FPQA 1QYRA 3EMBA 7MHTA 5E9QA 5E9JA 1VBFA 2ONYA 4PIPA 5GWXA 5ICGA 2PJDA 3WSTA 4M38A 1R8YA 3HVJA 1NBIA 1JSXA 4CWAA 1KPIA 2FK7A 4AZWA 4E70A 1XDSA 5IKMA 5EIFA 3HCBA 4AZVA 2PT9A 4RTKA 3FTEA 2CMGA 3VYWA 2B9EA 1X1CA 3I58A 3SGLA 2AOVA 3CCFA 3JWHA 3X0DA 3DXYA 1XTPA 3NDIA 1EIZA 3TLJA 2O05A 1P39A 1SQFA 1X19A 4XUDA 4RTQA 1Q0SA 3EEYA 3LCCA 4IV0A 5FA8A 1NW7A 5FHQA 5DM4A 2AOUA 5GINE 3B5IA 4OQEA 3NWEA 5EQJB 2BR3A 2N47A 3LKZA 3SVZA 5K0CA 5LQJA 3GU3A 4QTUB 2ZWVA 2O57A 4GOND 4Z2YA 3THSA 4POOA 3R9XB 2OO3A 3FRIA 3KQSA 1U2ZA 5E2AA 4RTOA 4PCLA 1ORHA 5CVEA 2PXXA 1FP1D 4RVHA 5LQUA 3KQMA 4FT4A 4BLUA 2ORED 2AN5A 1V39A 3P9KA 3OFKA 5DXJA 2ZBRA 1MJFA 5FULA 3MQ2A 3KR2A 4YUVA 4BY9E 2BR4A 5EOVA 3EVDA 1L3BA 4EKIA 1G60A 2VDVE 4QVKA 4R8RA 5DX1A 5P8WA 3HVKA 4CTKA 4MQ4A 1JQDA 5EZQA 2HMYB 1NW3A 2KW5A 3BKXA 1ZHFA 3CVOA 3UJBA 4EMSA 1HNNA 1QANA 2BH2A 1Z3CA 3G2OA 1N2XA 2Z6QA 3UA3A 2PY6A 3HVIA 5K0GA 2QM3A 2YXEA 4BLWA 3A7EA 2HTEA 2PX2A 2C7OA 1VE3A 1F38A 3E05A 3FPEA 4LWOA 4GOLD 1QAOA 5K0FA 2AOWA 3EGIA 3MAGA 5LQNA 2EJUA 2IPXA 3E7PA 4X1OA 4XUEA 5K0BA 1FBNA 2IDJA 2JJQA 2PX4A 3M70A 5E2BA 4UOEA 3PVCA 3OE4A 4KVZA 4GOMD 3AWIA 2QY6A 3KPUA 1M6YA 5GM2A 4PYJA 2Y1WA 1VP3A 1VLMA 2CL5A 3P8ZA 3AJDA 1VIDA 4U7PB 5BW4A 3ER9A 4HGYA 2Z6AA 2E5WA 2PV0A 3M6UA 3HCAA 1UWVA 5T67A 3EGEA 2AOXA 2CKDA 2VP3A 3PX3A 4P58A 5E1BA 5KQRA 2FPOA 1DCTA 5C9ZA 5DM1A 3FPHA 5EPEA 3DLIA 1G55A 3MGGA 4RTSA 3ANXA 4AX8A 2WA2A 4CKBA 2AN3A 3EVGA 1RI1A 4GF5A 1D2HA 4YV2A 1EJ6A 1DUSA 3I9FA 1INLA 2AOTA 3B7PA 3O31A 3FUVA 2O06A 4H0NA 1N7JA 2JHAA 2OY0A 3SR4A 1NE2A 3ORHA 5DTQA 4QPNA 2P3LA 4RYLA 4RTLA 3DTNA 2BM9A 3GGDA 4PIMA 4RTRA 5ICFA 3V97A 5FADA 5K0LA 3G5TA 3KR9A 2QYOA 3TM5A 2OBFA 1KYZA 3CJQA
chains in the Genus database with same CATH superfamily
3U31A 3MK31 4KE8A 3A6FA 4KXXA 1LDEA 3GCGA 1UMBA 2WWWA 4BJ3A 1L5QA 1ZG3A 2P69A 3LK6A 1RZRA 1GCOA 1S2LA 5DMHA 4DTIA 3L6EA 2Z6UA 4I1VA 1P9OA 1QXSA 1EVJA 1A50B 2HIAA 4YRKA 2IEBA 3IXLA 4N6NA 3W2HA 4O8CA 5KYXB 2MSLA 1SC6A 2IEYA 2GM3A 5IJXA 4UVHA 1IWBB 1TCCA 3VZCA 2KM1A 3A1TA 3GLIB 3K1ZA 2F2TA 1V8FA 1TQ6A 5CA0B 3PV0A 2H2IA 4DCGA 1XD8A 2J6CA 2J7PD 2VKQA 1LI4A 3PFHA 1PYGA 1TM3E 1O6BA 5KUTA 3R6TA 5FO0A 4QM7A 4OHBA 1CY0A 3KSBC 3A3OA 2IBTA 3D59A 1C1XB 1HPLA 2ILTA 1EAMA 4O4JB 3L8HA 2ID9A 5KVAA 4OM7A 1RMYA 5KYXA 1UBGA 3KYCA 1XRNA 1CNEA 3I6BA 4ER3A 1ULSA 4ZIRA 4GPEA 2AZ4A 1KJ8A 4XCXA 1IZZA 2DUNA 2PZEA 3R3ZA 5HIIA 3T7EA 5HKKD 4GR5A 4XLTA 3RFXA 1IXKA 1Z63A 3GARA 1SEVA 2V7PA 4QBHA 3NHPA 2BFEB 2NYAA 2O8CA 4YJ2F 3TD9A 1Y8QA 4KDCA 4CMCA 1FVHA 1YBAA 3Q3GE 4O4HA 1J2EA 1NUHA 1TAQA 1EE9A 2YZ2A 2ZI3A 4RTPA 2DQZA 3N0VA 1H4TA 5DBFA 1I3CA 1RIIA 2PUWA 1AMOA 4Z0HO 1N6PA 3ZD7A 3LLSA 2A3NA 1OLUA 1SC9A 1G3UA 2J31A 1W52X 2XUIA 3ETCA 3H9EO 3LIIA 2RGUA 4U7WA 5DLQC 4O4HB 5ALRA 4E2FA 1VPDA 1COWA 1BE8A 4CCSA 5JDIA 4FI3C 5D5PA 2ZI9A 1LV7A 2ZE8A 2LUOA 1YVUA 1P5ZB 1W5SA 1Z18A 4EVIA 4WLVA 4FIDA 1K2VN 1MU0A 1JG2A 1UJNA 3KE8A 4NBKA 4WFIA 1E1NA 1EX9A 4RS4A 5IJAA 4R16A 2GGSA 1GPYA 4IJMA 1GFSA 4URUR 5H02A 1PQUA 3ADPA 4V38A 3KYCB 4RU1A 1QVAA 1X70A 1JNYA 4DLAA 4O4JA 4TGLA 1XQ6A 1S9HA 1NZDA 1QO9A 1J07A 1XJWA 2CXHA 3BCHA 3DOCA 3ANLA 1R6DA 3EGCA 2FHSA 3NOQA 5DSTA 5T6MA 1RWQA 2GPYA 3WK9A 1YRAA 3BXOA 2QLFA 5J4KA 3MMZA 2WF8A 2HDNB 4OHRA 4A36A 4NCBA 2FFQA 4IIHA 1V26A 2Y68A 1I94B 1TZKA 4FPXA 3QX8A 1I2DA 1N0VC 4MRAA 5IBPA 4EL0A 5B2FA 1ODJA 1GL9B 2J85A 1L4MA 2I4RA 1YA4A 1WHSB 4BLUA 1ONSA 5F5NA 1OB2A 2IQIA 4EH1A 5EJ5A 4EF6A 2EWMA 4OI2A 2FP4A 2XT6A 5WRFA 2BLNA 5CNJA 3X1YA 3MA0A 1JIUA 5IP5A 2VYQA 2RH8A 3FNFA 2ZPUA 5CJ2A 4FEGA 4ZO8A 2IHBA 3ABOB 3KM0A 1LK5A 4MLCA 1M6EX 2CXUA 3AY3A 3BM5A 3H4TA 4UNQA 4JX8A 4JI5B 2V98A 3UANA 1FNSA 1TAGA 1X7ZA 2P0EA 1Z06A 1L7AA 2FF5A 1N3LA 1XEFA 2VTEA 4UHBA 3VV3A 4DMFA 1RXYA 5AUOB 5BQXA 1JGTA 2UV8A 4FDUA 3G23A 5EQFA 2ZWMA 2LNDA 2XYVA 3P2KA 3T7IA 2XY4A 4RC9A 1Q0TA 2A5JA 2CUZA 3G17A 2RGBA 3GVHA 3H0CA 1I3LA 3I2FA 2OV4A 3N2KB 3PXAA 1G20E 2YV2A 3QIVA 4Q4LA 3ROGA 4EHLA 2AXEA 5DCLA 2HGSA 3CPHA 4EYKA 2W7TA 2ZBUA 5F12A 3CUKA 3HJTA 3P0EA 4FZ5A 2R6ZA 4A0HA 8ATCA 1HE4A 4Q1VA 4FWBA 3WK7A 5HKBA 2CE2X 1VB5A 1O8BA 1PJAA 3NHUA 3HY3A 4ZCSA 2XHEA 4CDGA 2C2HA 2AZXA 1YQTA 3GGCA 4KO1S 4CM8A 5HP4A 4CLXA 2IS4A 3D43A 3OKCA 1DJNA 1P6XA 3DHWC 3F8WA 4FQ8A 5A0FA 4Q1EA 2GJ4A 1M34A 1QZZA 3I3OA 3JQAB 4G1VA 1MO3A 1FFXA 4FMDB 1KBQA 4JVNA 4YDSA 4MUMA 1PZMA 3FGOA 1FRFS 1AS0A 3ZX4A 3IR7A 1NJ6A 2VQSA 3WLPA 1GSAA 4LZAA 3JATA 5DSXA 2X1LA 1J7KA 4ZEXA 5SY9A 2WF9A 1PSWA 1JAXA 4M7OA 4JBLA 3E22A 5HQJA 2NPFA 4ER6A 2QMZA 2Q6VA 1LWNA 3KEOA 1ZUHA 3OZCA 4MS4A 4QVGA 2ONJA 3M6FA 1UOOA 3BIOA 3DZBA 1I6KA 5AP9A 2YIDA 4EY8A 4YUYA 2J9XB 2GCIA 1YR2A 3K96A 5AM2A 4IUBS 2X8JA 3N2YA 4JP1A 3L7YA 5KYNA 5JRDS 2W71A 3KAJA 3O2JA 1BJRE 1JF8A 2WG1A 1NVMB 1LVGA 4MGYR 1JP7A 4XIYA 3MAJA 5CW1A 1NBHA 3MQFA 1T8UA 3NW9A 4JYPA 3K0FB 1RHJA 2FI1A 3ZLBA 3ZUGA 4YRQA 4MPTA 1B00A 4U6SA 1ZNWA 2PWBA 2R5FA 3PX2A 4P22A 4DQ0A 2BE9A 1HC7A 1VLJA 1JQAA 2ACVA 3ABIA 1QH1B 3B1XA 3MSCA 5JCJA 4C7XA 4ZI7F 2REBA 4M37A 3BSSA 1UJ5A 2H4ZA 2HGZA 3WICA 1PR4A 2CLMB 2EP7A 3CH4B 3N5CA 3MWKA 4BCCA 3PNLA 3MGAA 3CRRA 5DI9A 1OLXB 4G24A 4AN1A 1NVFA 2X4DA 3BL5A 4URYR 4ZYZA 2YHUA 3JD0A 5JAMA 4ZAWA 2Y9MB 4D02A 5HTKA 3BK2A 1X7DA 1UZNA 2JFBA 1KFBB 1VYHA 1E8MA 1AQIA 4JJ4A 5JDCA 5FTKA 2PBLA 3MMPA 2V3VA 2GZHA 4V24A 2PA3A 3RVNA 3ZDQA 1D03A 1HLDA 3QYAA 2XGGA 1GTL1 4CJXA 4FMDF 5AESA 1A96A 2PWYA 1JTEA 4UBNA 5JXHA 2GZ1A 5LOVF 4G8BA 5SYNA 4CEHA 2EBUA 1XVAA 1YQGA 4G1BA 1E2JA 1OPXA 2F8MA 4OXIA 4C0QC 4X5OA 3F1LA 1Q7TA 2G1JA 2VP4A 3BMQB 5JAOA 1KXZA 2CL0X 3EVZA 5D7NA 1FSFA 1NN0A 2LDXA 4EG8A 1ORVA 1QV6A 1TXGA 3QPDA 3ZHBA 3K31A 3U1VA 1GPDG 4LYYA 3T9CA 3ZCTA 2YRWA 2BR5A 5D3QA 5JTUA 2YICA 1PWXA 4BFVA 1I8TA 3VISA 1PT9A 4MQ6A 2F8LA 3WE7A 3EIOA 2CGEA 2C9ZA 3PQ7A 3LW7A 4OH1A 4UU1A 2NOAA 3MERA 3TIXB 1N3IA 1RXWA 1NY6A 2YHAA 1DIGA 1NP3A 3G2JA 2NU9B 5JRZA 2GFQA 3OUUA 2V7BA 3VDNB 5KINB 5CX1B 3L7BA 2BKUA 3ZLVA 3IAAA 1UC5B 3OPYB 3F4KA 4MLPA 4OFBA 4B6GA 5BXYA 1M2KA 3RROA 4UJ5A 1RPZA 3HUFA 1W88B 2CHFA 3CA8A 3H11B 1RYNA 1U0JA 1YUBA 1KY3A 3ADBA 5J5AA 1G8HA 3KCNA 1ULZA 5A9SB 3E3LA 3FSGD 4ZU3A 1CIJA 2WNSA 4GOOD 1GAWA 1P0QA 3FOBA 4MUEA 5KX5B 2WQ7A 1FCJA 1AGYA 1TJYA 3HCWA 1F7UA 1JHYA 1QIFA 2VWGA 1J1UA 3M89A 2OCLA 1L6IA 3F3MA 3FCSB 5DK4A 1D5WA 1QS0B 1ZUIA 3CBGA 5E7MA 1EFDN 1QBGA 5BR1A 4CIAA 2HA7A 4IDOA 3KQNA 1RNLA 1C0IA 2Z4TA 4NC9A 2BH9A 2XRYA 3AILA 3NEJA 5DWDA 4DRZA 3DMDA 2B3TA 2B6NA 2JZCA 4HBZA 3PIIA 5ALUA 2I2WA 2QQGA 2P91A 3JW8A 2HNAA 3IDAA 5IM4F 3ZI4A 2BUAA 4JJ8A 3CLTC 1YC2A 2POCA 4EK9A 5KNCD 2XCTB 3ESYA 4ZMSA 3EGWA 3RD5A 2WDPA 1BXGB 4WINA 2NUTB 2R1TB 1JQEA 1G21A 1W30A 3W3AA 4ARAA 2HDWA 3HRIA 5C7YA 3DBVO 3S2ZA 1RRFA 3LIPA 1J22A 3A4IA 4RD3A 3QEJA 3B7GA 2PZAA 3FLBA 3PQCA 1TJ4A 4I9FA 3TOCA 1LPPA 4QUDA 5CB6A 2UU9B 3EG9B 3O8DA 4KO2S 3ZJVA 1Y4UA 2P79A 3O83A 4I1YA 3VV2A 2HRDA 4MRSA 2PYIA 3ZJTA 3R9WA 4TV8F 4DQKA 5F5LA 1DC7A 4ZHQB 1E6WA 3H2HA 2VYND 4IHJF 4JQYA 4RY2A 3T15A 4U9HS 3DEFA 2DCMA 4HQNA 1ZM4A 3B20A 1P80A 1ZA1A 5FOXA 3D6NB 3AB8A 3FZQA 5CA0F 1Y3HA 4S12A 3FDIA 4GX5A 3CZ4A 3MCWA 1R6XA 3IELA 3KXLA 3PQ4A 3H11A 4ZJPA 3EC7A 5JEDA 5IUKC 1Y7HA 1M2FA 2GA8A 5AJWA 3C6ZA 3OPYA 2XWQA 3RAFC 1WTCA 2J8ZA 4M1KA 2IX3A 5DULA 3SDSA 3MWYW 1QONA 1DC3A 2WD9A 1E9EA 2BDUA 5I9TA 4DEXA 3RYCB 2PBFA 2IUTA 3VSBA 5NLLA 2NYUA 4DMUB 4PBRA 3S6JA 3TBKA 1NXSA 4GM4A 4HDNB 4JXJA 4RGQA 4UULA 5HKLA 1QGDA 3ZU2A 3ADCA 1FMTA 4AY2A 3DP7A 4YX9A 5LWHA 4MRPA 3NPMA 4IYJA 2H2HA 3VFDA 1UEXC 4MJ7A 4FN4A 4M1MA 1X9HA 2C9YA 3EIXA 4RVOA 2H7CA 1JKXA 3AVUA 2FG5A 4I3FA 2ZTLA 4X45A 3O94A 1XPJA 5EJ7A 2GD0A 3BGIA 2F3RA 5L53A 1EQUA 1QYVA 2ZT7A 3KUKA 4QBGB 1RKUA 4YK7A 4DPLA 1Z5VA 4ETIA 4AKSA 2YHIB 2WK1A 3KZCA 4KDRA 2XB2A 2H6EA 4RF3A 3NAGA 1JBKA 4E7PA 3FLAA 2DP4E 2X7XA 2MYPA 3S2GA 1R8YA 1GQSA 4RW0A 1JR3D 1Z36A 4W63A 4XWAA 5A6SB 5IAAA 1XJCA 3RKSA 3RKUA 3TVYA 2IU6A 5BY2A 4IPTA 4H7HA 3R9KA 1CETA 2A9JA 2V6FA 5DDIP 5IG2A 1G6HA 1GGVA 2QJRA 1IU9A 4ZCMA 3HZRA 3UKDA 2P3SA 4DSNA 1J20A 4EMBA 2O59A 3ZQ4A 2FVXA 1F2UA 3TLJA 3F78A 1W0KD 1X9IA 3UK7A 2GZDA 4Q3NA 1GRCA 1YGYA 3W5IA 3PFCA 3AW8A 2AOUA 4LX0A 4MRRA 1NN5A 2WW8A 1RHMA 2GF0A 1K7YA 2DPHA 4FZ3A 3SNKA 3TI9A 3TLYA 3Q12A 2FW9A 3SVZA 5J43A 5IS2A 2DQSA 2BSXA 5CFNA 3VA7A 3ORFA 4O2BF 1TTHA 1A4XA 1RMTA 2NSHA 3JQFA 3MRXA 3QUCA 2OD7A 5B4UA 3RS4A 1XX6A 2GESA 1PV1A 2GCNA 2ZREA 3QFFA 4RK1A 1DWOA 1RHRA 2QRNA 2EKLA 1Z4QA 3D64A 4TLMB 1G59A 2Q1SA 5LQUA 3R20A 4N3AA 2GO1A 1I0ZA 2COKA 2KLHA 2J9RA 3AM5A 2H4FA 2Q46A 2PRJA 5IUNC 3DAGA 4KXMA 2PS3A 1W6UA 1XTQA 3IDQA 1XVUA 3DBLB 3HP1A 4Y18A 3DZIA 1Z2DA 3ESBA 4DLVA 4L8WB 4UXJA 1O0BA 1PHRA 3ADKA 2C99A 5LA6A 5EPUA 4AG6A 2QM3A 3DVAB 5HDBB 3I9V6 1IE3A 1G6KA 3PWZA 2B1IA 2E85A 2PUVA 3AEKA 5AYVA 1NLUA 1DOZA 3AETB 1TVCA 1ZUNA 3GVXA 2HI0A 4D9NA 3BE6A 2WTBA 1CTQA 5CYOA 4A0FA 4LRYA 2V54A 5FTJA 1C8BA 4EJFA 3QVXA 3UK1A 1DTSA 4Z0TA 2W2NA 1N9ZA 3CM0A 2UYYA 1F12A 2ZJ4A 3F74A 3FWKA 1SBNE 1YJCA 3KPUA 4F2GA 5KSYA 1N5DA 5EZ6B 3TXXA 2JFXA 5JU6A 4P4SB 3KD3A 4MP3A 4BJ6A 1JH8A 1VIDA 4QREA 1M5RA 2Z58A 3I8SA 2D5IA 2JI8A 4WQMA 3D5QA 4E2ZA 4A26A 1OFUA 2HHLA 3DAPA 4G0WA 2XF2A 2WUEA 4MYDA 3RV4A 5THXA 2WHPB 4AX8A 4YV2A 1RI1A 4LC9A 4MEBA 4E5NA 1DFHA 4WA7A 3NDPA 4U00A 5DYNA 2I2FA 4RKRA 4UNRA 5C80A 3WGVA 3ZVLA 3B7PA 4ISBA 5IRCD 3OZFA 3DKRA 5LA6B 3GLSA 3I5XA 1N7JA 3IDZA 2QVGA 4E6PA 5K2MA 3ORHA 3OQBA 2CVZA 3GDGA 2NUAA 4CVNA 1BTOA 1P0IA 3M5PA 5TF0A 4EPRA 1LEHA 1FLAA 2MSCB 4RLQA 1Z4LA 4JBWA 3WO0A 1XF1A 4EW6A 1RWWA 1BMFD 4FWIB 4O2AA 3I12A 4KDFA 1KXJA 2QYOA 2XRFA 2OBFA 5F33A 5L6MB 1KYZA 1U8UA 5FOTA 1IEWA 3RSLA 3VMMA 3Q8MA 4C0XA 3KLPX 2JIRA 4P7KA 4URVR 3KKKA 3AY6A 1GFIA 4XFKA 4YWJA 3TXYA 4ZVMA 5FH9A 2REOA 2VFAA 1XLTA 1HDYA 3SICE 5G3YA 3UUEA 1H9CA 1UKZA 2BEUA 1PG0A 1WHSA 3VPSA 4LXYA 4GDFA 3SFTA 3E9YA 3HKBB 2GASA 4W8GA 2F1IA 2GM5A 4U7JA 3VC3A 4XIGS 4P35A 3B52X 1E2IA 4CIXA 3CT6A 3W5CA 3SVTA 4FT2A 2IS1A 1MW9X 5EJIA 4G9EA 4ZCPA 1F2UB 1GTG1 3MWFA 3SHWA 2O7SA 3B6MA 4EEZA 4M36A 5FPSA 1GAJA 1JFTA 1KZ7B 3PNYA 1KSFX 3EFBA 3KTOA 4DMHA 4PRLA 5LVAA 1I24A 2FOXA 2Z43A 2Z1MA 3HNOA 3WI7A 4L9SA 2I1LA 2IYTA 4OMDA 4BRSA 1NQTA 4DR6B 2QTHA 4A8TA 3PGXA 4L78A 1DL5A 4D4LA 2WFZA 1K75A 1N2CB 2ZUSA 4ZOEA 4EFNA 1L9KA 1JXQA 1WBDA 4QGBA 4YR7A 3QU5A 2RB5A 4FJ1A 1UJ2A 1W9HA 2E2WA 2PRSA 4K2AA 1DX4A 1JLKA 4R8MA 5CK4A 5AI6A 5DBGA 5AVOA 3WMGA 3TFOA 3B1VA 1RPAA 1WXIA 1G291 3IO5A 4I4TA 1LVHA 4G5QA 5EUQB 1Y1TA 1AZLA 4E5UA 1I5EA 2Z8YM 5B2EA 2OILA 1EDZA 2GN0A 3K9WA 1WDTA 2Q2QA 1IWPB 3OX1A 4UNIA 2HJHA 2J33A 1GPKA 3OQPA 2VF5X 4Y2GA 4X24A 5ABPA 2W2PA 2AOTB 2WTAA 3BRCA 3ORRA 5K3FB 3K0BA 3RIXA 2FETA 1UUFA 1QIMA 1K0UA 1QGUB 4G1FA 4ARVA 2F3UA 5DLEA 1YNOA 1JKIA 2JGIA 2Z4RA 1U2SA 2VDNB 3K0AA 3FBWA 2XEDA 1K63A 3FNEA 2P8JA 1T1IA 3DOIA 3REQB 1JG4A 2Q21A 1J0DA 4WZAA 1K88A 1K6JA 1A2QA 1KZGB 4EARA 1D0SA 4E2XA 1FNBA 2ZQYA 5JDCC 3VKWA 1K3TA 1CLEA 2BKEA 2VUTA 3CR7A 1PT7A 3DV0B 3H7IA 3L6UA 5I9MA 2PGJA 5HDQA 4W8OA 3FXAA 1TECE 1V5FA 3H2SA 4B0PA 4ZHSA 2A9PA 4OQQA 3FKSA 1EVZA 4ZYWA 4JLDA 2O6HA 3OJLA 3NGXA 1A82A 4CF6A 1JEQA 3PQ2A 3PEEA 4CMEA 1DMSA 3EZLA 1FDTA 2RGCA 2EX4A 2K4MA 1NC3A 2QRVA 3SZMA 3OLZA 4FYVA 3WMRA 1K4YA 1YVDA 3DF9A 1NV9A 1Y5LA 4OK6A 3Q8KA 4RVUA 2DR2A 3C7TA 3T6KA 4QRDA 1E20A 1NMZA 2NYRA 4GP7A 1U2PA 3EXFA 1ACJA 4NCHA 4C4SA 4N5LA 1F2TA 4AYTA 2R1TA 3CNQS 1MUUA 5BNTA 1V41E 4FX2A 5E1DA 1TFUA 2WUGA 4GD3Q 1ZISA 1F6BA 4AYXA 4K9NA 1E8NA 2YWFA 2J07A 5LQSA 1E9BA 1X7HA 4H3VA 4KSBA 3DV2A 2BGMA 5K05A 1T9GS 3MJRA 1HFKA 3DJFA 2YS6A 2X0EA 4YAGA 5BYAA 3U09A 1ZITA 3Q85A 1PQYA 5AXAA 5CT6A 2NZVG 4DIMA 4M0MA 1YRLA 2GBFA 2K7FA 1FFWA 3S40A 3B36A 2RGXA 2XSZD 4ZCQA 1TKRA 1NW9B 1Y8ZA 3G82C 5AVWA 3LVFO 4CEJA 1K6MA 3KP1A 3C8MA 3NHKA 3U39A 5F7XA 1L7QA 2DHEA 5ALXA 1USGA 3QBEA 3ZI7A 3COYA 5K20A 1G20B 4KR0A 5KX5A 4H60A 1PJTA 1H3FA 3G02A 2GKGA 2HPZA 2F67A 4S1NA 4BX9A 3NONA 3P2YA 4FBLA 3L1JA 5AHWA 4FNGA 4YVFA 3VPFA 2HA2A 5I4IA 4Q7JB 3WBKA 1DCMA 1ITZA 1V2GA 1Q3KA 1FOEB 1XP5A 1WOYA 1E1QD 4LBVA 4X7PA 2BGNA 1E77A 3A0RB 2OXTA 4FHGA 1ZWLA 1K7CA 3OURA 4TMZA 1KI6A 4JQSA 1KU6A 4NBWA 2PV7A 3DE0X 5IMBA 3ZQJA 4CT4B 5L51A 1WZCA 4LX8A 3OT1A 2ECKA 3PKIA 5JQGA 2PUCA 1XROA 2V9ZA 4XQ0A 4B6RA 1Z0KA 4DW8A 3KWMA 2ZT6A 3P96A 4RCZA 4B6FA 1IBMB 1YI0A 3PK0A 9LDTA 4MV7A 1CUZA 3CONA 2AL7A 2YYYA 4M9CA 2SNIE 3CUTA 1TZMA 2NO4A 3DWFA 4IQ8A 3ZWWA 4BPBA 3CVJA 1E64A 1S0UA 4WCFC 3ZBUA 1Z13A 3SKVA 3IR5A 2V9PA 5I9BA 3OKPA 4ZT3A 3DZKA 5HQ3B 2P4EA 3BHMA 1KIAA 3H1GA 4WXYB 5GV7A 3UK2A 3GJRA 4D57A 2DFVA 2HQBA 1M66A 2VKTA 3AF2A 3NHRA 1WABA 5JBQA 4DGQA 4FR0A 2X9VA 1EWVA 3G2PA 4WJKB 1GQQA 3UB2A 4C0AC 4FGUA 1QOPB 1B0PA 1K6XA 3WB0A 2OC4A 2F17A 2XITA 3GA7A 3BGOS 3KPJA 4H6WA 2BPOA 4E88A 1W0CA 3OCVA 3V80A 4FNMA 5CB4B 4X3OA 5IASA 2HPVA 4OOFA 1H6CA 4IDDA 1DDGA 5ILGA 4I1RA 5DNUA 1Z2OX 3ILVA 4I5DA 4YRCA 3VR5D 4A0QA 4ABTA 4AMGA 1IN5A 1ZGAA 3OMWA 2RG1A 5IC4A 3VKHA 1E94E 1YA8A 3OU2A 3RAEC 1W76A 5DMXA 3FYDA 3T61A 4EHHA 2A0WA 1CUFA 1OU0A 3F5QA 3RT1A 2BEJA 4KUEA 4R31A 3U2QA 3WK4A 5FUBA 2O2ZA 3PNBA 1A9RA 2EEZA 5FLKA 4RF4A 1U5BA 2VBIA 2W2KA 4D4HA 4BMNA 1C4XA 4GC5A 4YHHB 4LBZA 2IHZA 1DBVO 4RAQA 3KTAA 4G0PA 4GM0A 1UDXA 3H4VA 4JBYA 5P21A 3K8ZA 3S1SA 3GFPA 3BWBA 5CM2Z 2JATA 3V33A 2GTIA 3D0OA 4H0FA 4DSTA 4L5IA 3D3KA 4QOHA 3IB6A 1BVYF 3W4KA 2Z2ZA 2JCSA 5GAJA 2CCKA 1XZ8A 3V1KA 2JAOA 4RZHA 1NPTO 1RLIA 3M1IA 1TD9A 2Q9BA 4MUJA 4AVYA 4YUAA 1ABBA 4L9AA 2I3BA 4O0MA 2G25A 3ASUA 1CDEA 4MVJM 2ZJAA 4LWQA 4Q19A 3UTCA 1T3LA 3BWEA 4DG5A 3QOXA 4DB2A 1KY4A 2EIXA 3FCUB 3FGPA 4MYRA 1ZYUA 3T7SA 3FFTA 2AG6A 5MGBA 3OF3A 3OJXA 2A9OA 1K66A 2J3QA 4HG2A 4HVTA 4QG3A 3AKZA 2PMEA 3EPPA 2PR7A 4IJUA 2QQ5A 1YB7A 1NP7A 2V97A 4FFOA 5BQ5A 1CZOA 3C3AA 3DWGA 4Q48A 2VYNA 4XKJA 3RYIA 5HZHA 1GM5A 1SK8A 1Y7LA 4Q3LA 3STWA 4BO9A 2BGIA 4C2BA 4YEDA 1PZNA 5KNDA 3UQZA 3VC7A 2QTCA 4MWGA 4CTJA 4URZR 2AJLI 3L2OB 3K35A 2WYWA 1GV1A 3WL6A 2EKDA 3IS3A 1B8NA 4UDYX 5B36A 2Q5IA 2P4SA 3AHHA 3BMCA 4UFNA 4FMCF 4WMLA 3ECSA 1T8WA 2F48A 4G09A 2AN9A 4LCJA 3RYHA 2ONKA 2WFMA 5CM8B 2QGNA 3IB3A 1KQOA 1L7DA 1WDLA 3PEVA 4HYYA 3U7GA 3P19A 3OF5A 4LZOA 1AQ6A 2B92A 4WLNA 3ND8A 4MVJA 5AJTA 5NULA 4V2IA 3CEJA 3RANA 3U7QA 1XC7A 2OK8A 4EF4A 2YVUA 1DAHA 4DBZA 2JLBA 5JAQA 1UK8A 3WZ2A 3IKMB 4IJ6A 4WNAA 1N8SA 1XRRA 4K9SA 3MB8A 1F4PA 2QAGA 4MDEA 1ZVJA 4B44A 1A3CA 2VS1A 5JSQA 4JYZA 1FFEA 4YCLA 1JKMA 2C92A 1IJEA 3ZY6A 5DNYB 1L4KA 4ZV9A 3TZCA 1XB2A 3QMPA 3D7MA 3MXOA 3WJ2A 4AW9A 2W6ZA 3TUZC 3WHLA 4FSHA 4IS2A 2MHCA 5HOQA 5H16A 1P5JA 2J5RA 2Z5VA 1H94A 4H1TA 3KVYA 4J0IA 1H8HD 2HIHA 3F9IA 3IE2A 3LGAA 1ODLA 3OCYA 3L18A 4Q7EA 1WXGA 4EYQA 5HPYB 1VL5A 2I2DA 4M1YA 4RKFA 4G5HA 2PKYX 3NLLA 1YR9A 4RK6A 2GK7A 3KKPA 4B3GA 4IIBA 4PWYA 5ALNA 1AKVA 1CIVA 1OE0A 2JH8A 5AJZA 3AJRA 3IOBA 4LF9B 1CHDA 3E2IA 2P2GA 3QE9Y 2BLLA 5U1PA 3O9ZA 4KTTE 2OZLA 4G65A 2CJWB 2Q0QA 4ZPXA 1LX6A 2DY1A 4X8MA 3R4CA 2NV6A 2GJSA 1ZGGA 2PU5A 2C5BA 2WU4A 1WX1A 3H04A 3I04A 4F85A 4A8JB 4XGNA 1X7YB 2JF0A 1IXYA 1T9DA 2OKGA 1KH3A 2R1VA 3DLCA 3MOSA 5AKKA 2WTNA 1UCFA 3D6UA 3L0PA 4EP1A 3BFXA 4ZI7A 5AJHA 4MS1B 2IYSA 5A4IS 2WWHA 4PLYA 3JQBC 1U9IA 2X2EA 3MS2A 4CM1A 4N5IX 1QZTA 2I03A 4X7BA 4PZ0A 1BMQA 3T41A 4CMGA 3RPEA 5T5QA 2PUTA 3EK2A 2D7JA 3JQRA 3MCZA 3QY9A 4KXUA 2XTMA 2XTAA 4B4WA 1ISPA 1ZOSA 4C5BA 1E2DA 4OGKA 3HI6A 3MPUA 2F3TA 4C6SA 2ZRJA 4AP6A 3PC8A 3S81A 2JI7A 4YMSA 5TGZA 4L6IA 2OBNA 1SRQA 2D6FA 1WUHS 1EM8B 2WIGA 4HSGA 3JD1A 4R5MA 3STYA 2NLOA 2W6JA 1U7ZA 2ZDQA 1NT4A 1Y5IA 4JSYA 5EIAA 3RBZA 1W29A 3VZPA 4U7DA 2BTEA 4PNPA 1P9WA 2HT6A 4CODB 1KGSA 2W2LD 5EIFA 4C3VA 4G97A 4QGFA 4RTKA 4I19A 2I5PO 4YP1A 3X0DA 3DKVA 1XTPA 4QKQA 4N65A 1R8QA 5CA0A 2VDWB 3K4QA 1PNRA 2J0EA 3QU4A 3Q98A 1P39A 3GGOA 3SQMA 3R6WA 4HWSA 1SQFA 4XUDA 3BDVA 3KOXA 4RTQA 4LXUA 3U16A 3AFMA 3CH6A 5F73A 3CRQA 2GD2A 3WC4A 1ZD3A 3GEPA 3GVCA 3UXEA 1Q7CA 1TAHA 2HB6A 2PAAA 3C7AA 4V0OA 1YB1A 2BEVA 3RUHA 3B9PA 3DKIA 5IC5A 4XRGA 2UVDA 4V1CB 3AIMA 4P0TA 1B0ZA 2J3DA 2R85A 1FP1D 5TT0A 1IUKA 1MG5A 1NRWA 1O58A 2E37A 4F91B 1A9QA 1Y37A 1U7WA 4Y1RA 1J0CA 3O8OA 4ZEOA 1OAKA 4O0LA 3TEJA 4BN5A 4KVFA 2HHAA 3L46A 4PN7A 2PL1A 1LWOA 1UP6A 2PH5A 3ROPA 1XCOA 2PT5A 1GQYA 4HDRB 4YA6A 1JJBA 3ZVKA 2PJRA 3H8SA 2OYSA 3MWLA 3W06A 5G41A 3AVTA 1FRNA 1E9VA 4GXTA 4IQGA 2QJFA 3MXTA 1F4VA 2DUJA 2NSYA 3H8WA 3HVIA 1NYQA 3OFVA 1YAJA 3ONDA 1DRVA 4ZA2A 3WGZA 4DANA 1U1FA 2R6GA 2ISSD 1A5ZA 4D25A 1U0EA 4DCTA 2JAHA 4F8JA 3IKVA 1A5BB 3D0KA 1JHQA 3QG1A 5TRTA 5CDSA 1GQRA 1HRDA 2PX4A 1QLJA 3NHJA 3S27A 5KDOA 2BJWA 4I50A 4QECA 1B6TA 2J5BA 3DTYA 4UEJA 3QKSA 4Q9AA 4YNBA 5GM2A 4EPWA 5A6VA 1O95A 4TSRA 1NU8A 1ZOOA 1MC8A 4KQIA 1EUDB 2GEJA 1A8HA 1Y3IA 3P8ZA 3OH8A 2GZSA 3A05A 5SICE 3H2GA 1J23A 2Z6AA 4M8IA 1RXVA 1RHUA 1Z5GA 2Y99A 3DPSA 4MUHA 4B1FA 3OQNA 4WCFA 3P5BA 4YDHB 3WKAA 2WU0A 1DQRA 1KMMA 1H8ED 1JKJA 4OIMA 4Z8XA 4INJA 3U5ZB 4ILKA 2IYLD 2PLRA 3ZHXA 3RHZA 4DUGD 5E6RB 3K6SA 2J3EA 3FR8A 2NSLA 2VP9A 2Z3ZA 2VK8A 3O82A 4H3SA 4MS3B 4D41A 1TVKB 3DFMA 5BSKA 2OY0A 1W93A 2FE4A 2R8ZA 3WMFA 4KOAA 5HFAA 5KTPA 3LXMA 5B57C 2CJYA 1N5MA 5JVDB 4KMRA 4BYGA 1MB4A 4GR9A 1YIDA 3C4QA 1QGED 3OP4A 2P9EA 3U7FB 2Z8YA 5JSFA 1RC8A 3PGMA 1T3GA 4DPKA 1ZW6A 3A1UA 5LIRA 4IDQA 2BMDA 1T2UA 4NP6A 1W36C 3O8QA 3OZXA 4RSHA 5HTOA 2ZYUX 3FHJA 3D6MA 4PX3A 1ESEA 1FLVA 4DUPA 1AKRA 2H4WA 6AT1A 1CR0A 2XLCA 2GLXA 1JAIA 3O3CA 1Q1NA 2BHTA 4OX9B 1Y6ZA 4B7UA 1C8KA 4OP2A 4N49A 1M2WA 2Z83A 2W8ZA 4F5DA 4MKXA 1KR2A 2FE1A 3CQ9A 3OT5A 2QN8A 1LTHR 1R10A 3WLIA 4TKVA 3JRWA 5FWYA 2F4VB 1TZJA 4YWHA 4WSOA 2XDYA 1POXA 3E7XA 2XMGA 1L7OA 4R2XA 3RYTC 3SF8A 5BYJA 2DKOA 4MW9A 2ZR0A 3N8GA 1OLSB 1CPYA 1FQJA 4HDMA 3OBBA 3BIJA 3OUTA 2HHHB 4RK7A 3W9UA 3BFKA 1I32A 3L02A 4ZALA 4EPXA 3ZHRA 4DA7A 1R6AA 1AKWA 3FYUB 5IT9A 3NHZA 1FUEA 3GF4A 1QUFA 2QD1A 2BZ0A 1DBRA 4CCAA 1AQLA 1PGJA 4L27A 1LLFA 3NV7A 1T0IA 2XUQA 3EX7C 4DLPA 2OZEA 2FUNB 3IERA 2BN4A 3ZZ0A 4BNNA 1YQEA 2XTNA 3RTGA 3MTGA 5ICCA 4C20A 3EPRA 1PUXA 2C04A 2VDJA 4MOWA 5B6JA 4IEEA 2AJDA 3RRZA 3VNQA 3AXTA 2Q2OA 1UIRA 5AKIA 3K6RA 1XEXA 3KT3A 4MCJA 4IILA 1TF2A 4O4IA 2FEPA 1YRHA 2R8YA 4HFMA 4OL0A 3UHOA 3C6XA 2ESRA 4H7JA 4LC1A 4ZV4A 1SKMA 2X0DA 2QUAA 4RHCA 3V1LA 4OB7A 3FHCB 3NT2A 4WK6A 5KWVA 2AR0A 2VSQA 1N7GA 1NKTA 4QAQA 3QBJA 4KEAA 1BE0A 3EVCA 3D2AA 2BMJA 2BV3A 1D2RA 3WO1A 1NUTA 4BZPA 4WBNA 2B2CA 5TEVA 4CW7A 1SOAA 2ZU0C 4CMIB 1XZDA 2IZ7A 4V0LA 5BV1A 1EA7A 2F6RA 3AI1A 4MITA 3KLMX 1LPNA 4ACBA 3ACCA 5TPZD 2ZI6A 5K3DA 3U1TA 2QW1A 5JY6A 4K26A 3P1JA 3OQIA 1N9KA 1TW2A 1ISHA 5EEGA 2PNJA 1X39A 3LJKA 3FTFA 1CDOA 2DPLA 2NXCA 2Q0SA 4OUDB 4LHVA 2XH8A 1E66A 4MRMB 2G09A 3KQKA 4RPGA 2GCOA 1XWWA 2FZKA 1EUYA 2ZPAA 4BGEA 3ZTTA 3LC1O 4I14A 1YJAA 2CV1A 1CUYA 1SR8A 2XEXA 10MHA 4LF4B 1KEKA 2VF2A 2MYNA 4RTNA 4MICA 1HETA 1ZK0A 1E6LA 3VX3A 1PP4A 1QH9A 1T6NA 2ANCA 5CHYA 5IAJA 2DSTA 3ROKA 2YS7A 2WYOA 5H4GA 1NNI1 1ZL0A 3SEFA 4CFSA 3PENA 2V0CA 3ILSA 2GXQA 3B3JA 3LECA 3PWSA 3WYFA 5B1EA 3GP8A 4L2IA 5HM6A 4LRQA 3KJIA 3CB4A 2P9HA 5LQRA 4UHDA 3C0KA 1IQRA 4NBSA 3BF8A 2PZFA 4PQYA 3NCHA 3X1JA 4C6RA 4KYUA 4IJQA 3W6PA 3FBTA 3DLAA 4AY4A 2JIZA 2OGSA 2QZZA 2O4UX 2DULA 3KIPA 3LCRA 1K9SA 3OLWA 1HYGA 4HN9A 2AC2A 4HEA1 4NHOA 4F5WA 1E3LA 1XZKA 1MGPA 1BH6A 4ZT6A 1NBEA 4Z86A 1FRQA 5DLPA 1WETA 5K0SA 1ILWA 5F4BA 3H5LA 3JQ9C 1TLTA 1VIAA 2GBLA 1A9OA 1P9NA 1YOVB 3IHTA 1KHHA 1QTIA 4KLRA 3T5PA 1HXHA 1P2GA 2J08A 1DVRA 1Q7GA 4FZRA 1BEZA 1STOA 6GPBA 2QE7D 2YIJA 3JAWB 3OOYA 2REXB 1RACA 2JVJA 1WUJS 4ZOBA 1A8UA 3DFUA 1RBQA 3GLKA 2ZCUA 4PO3X 1GTJ1 1MNQA 4OQZA 2VTDA 3DNFA 2F1HA 3JQPA 4HNHA 1VJCA 5JC1A 2D2VA 1IIRA 4X63A 5D8DA 3GLGB 1ISIA 4D6YA 2VR1A 3IHKA 3HDHA 4CMIA 3VSEA 1V3TA 4FTWA 1E2PA 1P6UA 2HU5A 2PGNA 2F1JA 3CNNA 4KFSA 4NCKA 4W5HA 1IG3A 3OO1A 4HWRA 1SHKA 2P9JA 5CBPA 1W49A 1M6NA 6Q21A 1X13A 3CT4A 5DW3A 4GPBA 1A2OA 3TTVA 1XKTA 4WJLA 3OJCA 4YJDA 3EGDA 1WXXA 2A1IA 2TMYA 2EAUA 2D5BA 1RAHA 4I4LA 2LPMA 4MGKR 4MP8A 4CFYA 2XVMA 4IZIA 4U1RA 2ZJ3A 4JEMA 5I3CA 4H9GA 1QE5A 3NJ4A 3Q41A 4CGYA 4IH4A 3AB3A 4EA8A 3TZEA 1ZMRA 2F3QA 2CVOA 4KRGA 3PCXA 3H13A 4WOPA 5IARA 2QT9A 4DLZA 1MENA 5JY1A 1AX9A 4ID9A 1Z5WA 2O3UA 1X1BA 4EKDA 4HAVA 1ZVQA 4YRTA 3GLIE 5EVJA 1X77A 4Q9NA 1KE1A 3G1UA 1KZ1A 4DIKA 2NU6B 1PFUA 4EQZA 1I4WA 4XX1A 4KIWA 3TNJA 3C4JA 2D8AA 4NY1A 2WUDA 1Q19A 1ADYA 4PE5B 4RMIA 5KNDD 4YR9A 4J9UE 2R6CA 2FEAA 4M0LA 4YUWA 1VJTA 4H7PA 4OUKX 4MEAA 4JJEA 4R68A 4P86A 3OFJA 4TRRA 1IN4A 1Q6ZA 2GUGA 4KAJA 4WK0B 1ZN9A 1FNNA 2XD4A 2PZLA 2OV8A 2Q27A 1EZ4A 5KHOC 1I3NA 1T4CA 2I3DA 3IE0A 1PR6A 4I4CA 2Y0DA 3ZCSA 4CBVA 5AW7A 4ENQA 2Q9UA 3KRTA 1S2GA 1USKA 1UFOA 3VYRB 2RKBA 4RCVA 1E89A 1Q50A 2A9FA 1UKCA 4WN9A 4FLEA 3JWJA 2EKBA 3O8QB 4TS3A 1SBTA 5BT8A 3F6PA 1ZQ1A 2H06A 4R8KA 1P7YA 1C3LA 1OFVA 1E6KA 1IATA 3PZBA 1BHSA 4KXNA 3ED1A 3OIVA 4E1BA 3FIUA 1EJ0A 2LD4A 3D31A 3RTAA 4LF7B 1LW7A 2O2XA 3FMGA 4I08A 4PZPA 4ZVRA 4S2UA 4YT4A 4MS3A 4KZKA 4ZI7B 2C57A 3FSRA 4N4AA 4XSVA 1AKEA 2ZRHA 4R8SA 3GG2A 1T9BA 2G71A 1SC3A 2VZ8A 4KQKA 2VDUE 3GAFA 4JEUA 5EXTA 4ALMA 4QPJC 1PS9A 2GNAA 4Q37A 4Q4HB 2R86A 3FNGA 2JH9A 5EL0A 3G85A 2Z9BA 3U7IA 4OU4A 2B7LA 2P0AA 4YCMA 1BZYA 1H1DA 3JALB 3ZHCA 5JNWA 4TVBA 1RQ2A 4TRMA 3BXFA 4XD2A 2R44A 1UMCA 3GX1A 1ZNXA 2FZ4A 1NIPA 1Y4SA 1ZSYA 4KQEA 4XVCA 2DLCX 3RRJA 1ZJYA 3FYSA 5TR9A 4OVKA 3WRXA 4RA9B 3GZNA 3G68A 4H1WA 5CFQA 5IEJA 1JXMA 1UJBA 3ADOA 1P77A 2D2XA 4L5AA 3EEBA 1DO0A 3A26A 3L4JA 4REQA 3K70C 2I4LA 4QBIA 5LJIA 4MWBA 4KAAA 2XUPA 1VMIA 4DG9A 3WLQA 5JCOA 4NFLA 2LE0A 3GLRA 1CC1S 3B78A 2Q49A 4JITA 4UVDA 2EVWX 4ON9A 1MDBA 2J41A 3P0JA 5C1PA 4RMGA 3UJDA 4A15A 5KIAA 4DLUA 2ZTUA 3FWYA 2V4UA 1CP3A 4X92A 4FXOA 1OZFA 3L6CA 3Q7RA 1ZEMA 4TL9A 4ATNA 4M2LA 1MO5A 3NANA 2YX1A 1ZN2A 2M6RA 4INZA 5HRAA 2GF9A 3GEGA 5T41A 3AOEC 4RD4A 1LKZA 2Q9AA 1YCGA 4XM0A 3AJEA 3D4LA 2DC1A 4MVJP 1MLDA 5DT2A 3UHFA 2JIMA 2X4LA 4ZT2A 1E4OA 5IHXA 5LSAA 3JR7A 1KDVA 1YB5A 3P45A 3KSAC 4MI9A 2BHLA 5KQGA 3F8TA 4I4NA 1OIWA 4FMCB 1OTYA 3EEFA 3ZXUB 1NOJA 1IOZA 1JJFA 3C1UA 5D3MB 1GZUA 1EFTA 2AJCA 2IYZA 5GZ6A 1X80A 1U1CA 3W8EA 4PZAA 3P20A 1B23P 2NVWA 4IDGA 4A5SA 2J6IA 3IEPA 4B3HA 3CF2A 4JI6B 1NDHA 1VJDA 1NSFA 2O2DA 2Q7DA 2Z3WA 3GRFA 1XQXA 3BDIA 3G0DA 4HNAA 4YJ2B 4ZC1A 2JGLA 3QWFA 4K6HA 1KVTA 3AU9A 4KO4S 4J76A 3ICOA 4RORA 2B5OA 4TT3D 3FVQA 4W99A 3V32A 4Y2VA 4Q18A 2ZVJA 3KOMA 2AEJA 3NT5A 3D4BA 4UAJA 5C32A 1Z73A 4M21A 1GEGA 3C3MA 1X92A 4A23A 3P9ZA 2C31A 1HE3A 3TLKA 3CE9A 5ED0A 2M6KA 2ZANA 2Q3EA 4BN4A 4BO0A 2WD7A 2FQXA 3F6SA 5KTTA 1JT9A 3TNDA 3ZW7A 1L5ZA 1PYOA 1RM3A 1T2AA 2AK2A 2QEQA 2VPPA 1UWCA 4W5NA 1EK0A 3HBJA 5EHGA 1ZJ4A 4BRZA 2IHVA 3A9WA 2GZ2A 3PC2A 1Z6XA 3L4BA 4QT4A 1RXIA 3JPYA 2G1KA 1XTZA 2FRXA 4QJBA 3VXKA 4FDVA 2H18A 1Y7TA 2XE8A 4MS1A 1NKVA 1JG3A 1W44A 2D0PB 1T5IA 2ZXFA 3DEYX 3GT7A 4QHSA 2C2BA 3EMBA 3MG9A 4KPFC 3IMFA 1WCXA 3BD6A 5COBA 4KQFA 3H9JA 1GL6A 2BKLA 2ZK7A 3FDZA 3N59A 5CFMA 5ITZA 1UZAA 1C7FA 3ZUPA 1S8OA 2X2FA 1TEHA 3GLUA 1IIBA 4XDHA 3TSYA 5CNKA 3VDRA 4CMAA 3PGJA 5AVXA 1CS0B 3DXYA 4M9UA 2Y1EA 1FJHA 1THZA 4U8GA 2R4QA 1BG6A 1WCIB 3M6IA 1MC5A 4K0KB 3SF8B 3EWSA 1QGYA 1E1KA 3CSDA 5TSDA 3LKBA 1X19A 4R8VA 3AGQA 3X3HA 1WRBA 4V1CI 1ORTA 1YOBA 1SGWA 4FMPA 3KWJA 1SXJE 4QU9A 3WLAA 4OQEA 5FO1A 3E9DA 3IIKA 1WAMA 3FZEA 5FUWA 1SQ0A 3MINA 4DWJA 2PMDA 5LQJA 4CI9A 4ZGBA 1KVSA 1M2EA 4K1XA 3I5MA 3ND5A 4GOND 5KCMA 3THSA 1CUDA 1NVWQ 3KB8A 4XWWA 1RFGE 2HCFA 4R7GA 1MT3A 4FEAA 1U2ZA 1YS4A 3RE1A 2EC5A 3IULA 3RVMA 1JPUA 1GPNA 2HQ1A 3CX8A 3K53A 4BMZA 2F59A 2C94A 4CIYA 1SCNE 2RHMA 2Y92A 1KK3A 1PUIA 1NAIA 5I48A 2OG1A 2BOVA 2O8BA 5FULA 5C31A 4I5EA 1CKEA 1KJWA 3JVIA 3ES9A 3A1VA 5P8WA 1ZLYA 1GCIA 1QQBA 1OXKB 3EDMA 2B5WA 4OHKA 3HB7A 3I2GA 4MVWA 3UA3A 1YZVA 4C88A 2HTEA 1HYHA 2PWAA 2BSAA 1A0OA 3E05A 1U4NA 2YL2A 1R37A 3CG4A 5FL3A 4LWOA 5HCNA 2X6RA 3AM3A 3RAJA 4CIWA 1M8GA 2BGUA 3P2JA 1JKJB 2W0MA 4Y6QA 4DDKA 5I4KA 1Y1SA 4IDHA 4IHKA 4Q1FA 5E2BA 1J8DA 1FQKA 2FMIA 1KFCB 2FXIA 1E7YA 1FYFA 4AG3A 1BN6A 1CF9A 4F6RB 3IKTA 4LYJA 5G1NA 1JPVA 3QKIA 5AVSA 3COPA 4XGKA 3KG2A 2JA1A 1HFWA 1N2SA 3EZ7A 4DWWA 5IYZB 1JYSA 2WVGA 2AXQA 2Q4TA 5ITVA 1SCBA 1RS0A 1C1DB 4HTAA 4PFQA 3HL0A 5AHOA 4FE4A 5AHRA 5IPFA 1YZGA 4XYBA 3B5JA 3IAFA 1DC4A 2QRUA 5ERXA 4XB1A 4TLDA 2VDQB 1CZUA 1SU6A 3OCUA 4ZYTA 2B4RO 4CKBA 4QASA 3SSNA 2DFTA 4C3UA 3EH1A 4ZN6A 4KWHA 3AONB 2O1EA 5AM1A 3C5VA 4AWBA 1KWKA 1EJ6A 4BNFA 3DDWA 1INLA 4ZYXA 3K8OE 3T52A 5HCIA 4H0NA 4E1VA 3DTVA 2G28A 4H7KA 4IRUB 5JSHA 2VDRB 3MJCA 2LDBA 2Z2IA 3L1UA 5LQMA 2VQ3A 3K5HA 4BEBA 4J7AA 1WCV1 2AQIA 1DRJA 4GQIA 1Y1KE 2OHVA 4YJ3B 2VNHA 5DHTA 5ICFA 1BO6A 1SXHA 3KR9A 3O8OB 4XA8A 3ODGA 3FWHA 4D82A 4DXHA 2IY9A 3LQFA 2X2OA 2G08A 3ONWA 3G7SA 3E48A 1ETUA 2A5YB 2GJAA 2V74B 2XKJE 3RVLA 4U2GA 5DP1A 1DZIA 3BEDA 5HUJA 4JLMA 1V16A 2W9XA 2X8AA 3ASVA 3IUYA 2XVZA 4OP3A 3WGJA 3SKXA 5FFNA 4BNIA 1IN1A 5HF9A 3L0OA 3AMVA 1SUSA 3GW8A 1BGXT 5GONB 3ETDA 3L05A 3UMYA 4CKXA 4DM3A 4V2UA 2MINB 1WU8A 3C97A 2Y1LA 2JPDA 2IXDA 3PEUA 1JHRA 3EPHA 4DHEA 5FHRA 5KYUA 4IXWA 1KEPA 1U6JA 3SYLA 1X7XA 5B58C 4M9SA 5TQVA 1QHFA 3L0DA 3ZV7A 2IXGA 5KKNB 1DGQA 4D3DA 2QTNA 2JI9A 1S7CA 2XUDA 3FHOA 4NESA 4IMPA 1Y63A 5EXDA 2CXNA 1QKKA 3DE5X 5CDYA 1OTHA 2XUHA 3Q5GA 3SBEA 4CU2A 4E46A 3RUFA 3QUQA 5EP3A 3GEHA 1QFZA 2JNWA 1U3WA 2J67A 2CVPA 4JK3A 2Q41A 4GWGA 2HRBA 1KO4A 4KFRA 2L82A 4GX2A 1A7KA 3K4PA 3KZNA 2FMXA 1UZUA 2GN9A 1PJLA 2NXWA 3NUZA 4MEJA 4P36A 5FPYA 4I1IA 4DR1B 5JPCA 1XQ9A 2XZDA 2YDYA 1HG0A 4X8LA 4FC7A 1YB6A 1L7XA 2HMTA 3V42A 3DR3A 5K8UA 3CZQA 4NV0A 3DMFA 4PY2A 3SC2B 1H5NA 4NF2A 3HXOA 1E3MA 1EI9A 4E13A 1NHGA 3PYLA 1C9EA 4ITUA 2VJMB 4LDNA 4Q3DA 2OD9A 4PVCA 4R98A 2PRYA 2ZRGA 3U7RA 2CLHB 4LPKA 1SVKA 3MHTA 1TKBA 1EEXB 2Q3FA 4JENA 5BMOA 1H85A 2OQRA 2GI4A 1Z6AA 3AR2A 3FYUC 2QSUA 3TRHA 2AI1A 2VHZA 3CEMA 2VAXA 1SVWA 1NYRA 5E6UA 1J2RA 1U2QA 2Q1TA 2D1SA 1NXTA 5JNSA 2WUVA 2DFKB 3TLGB 2JDID 4IJ5A 2CLLB 2ZAMA 3ZD8A 5EWJA 3P0RA 1ZVMA 4FSDA 3INNA 2P65A 4GOXA 3R7SA 4C4TA 4ZQIA 4N39A 4Q02A 3LQRA 3IEXA 1F3LA 4XGIA 4IIGA 2YMLA 4AJ4A 4RELA 4HRVA 1ML3A 1UXJA 1U0FA 3A1WA 1VLQA 4PZCA 3A10A 4TLBA 1ZESA 2OCPA 4JEIA 4DGSA 4D96A 2IZ5A 1Q77A 1DPGA 5CHEA 3ILHA 5F1OA 1WZEA 1ZKDA 3QI2A 1U3UA 1T0UA 4PFJA 4HQOA 2FFBA 4F2PA 3B2NA 4FQ5A 1M7BA 3KUUA 1Y33E 1TTTA 1RQXA 4UZSA 3HKCB 3ZZ1A 3VU3A 1J8YF 3WLJA 1EQ2A 1MVLA 4F04A 4O4IF 2FUG6 1T9KA 2AE2A 1C7EA 2YXNA 1XDWA 3CZRA 1F0KA 1CJBA 3MD9A 5KVQA 3DUWA 3N0TA 3AF6A 4WOKA 3GQBA 1W4LA 3K9CA 4PSDA 4X0EA 4C05A 4KXYA 5EHXA 1ISSA 5HJEA 4D81A 1D4FA 4R01A 3RC2A 4OKNA 2PAFA 3TOSA 4IYRA 4RS3A 5K9ZA 1SXJD 2C1XA 1Z29A 1CJCA 4AWAA 3BULA 4LEIA 5C37A 4B3RB 4LHSA 1T8SA 1LDYA 1E1RA 1DKRA 4BGVA 4BOYA 2VPWA 2ZYTX 4YPFA 2IEZA 3CKLA 5JNLA 4YI5A 2ZSAA 1CERA 5JJKA 1GUDA 3U4AA 2AVNA 3NP7A 5FOUA 3R24A 3ZK9A 2C5FA 4F2DA 3BSYA 1L5HA 1U0TA 3NG1A 3LOPA 4QOFA 5EGNA 2GK6A 4RD2A 2V7EA 1OXSC 4HDSB 4XTCS 1ULTA 4JMLA 4LJ9A 2GYVA 3OTWA 3U4CA 4DMKA 3NBZC 2W00A 2JHPA 2FTKE 4OI4A 4RWZA 1USUA 1FFSA 3JSXA 4BX0A 4JQZA 2WV9A 2XVAA 1SVOA 5HQTA 3TSOA 3GAMA 3UFBA 3I1FA 2ZSHA 1JH9A 4O6VA 1D0IA 5D86A 2I87A 4IIJA 4NYMQ 3TMYA 3FBGA 3MD0A 2UYCA 1EHYA 3REQA 3WWDA 4DNQA 1NZFA 1L0BA 1TM7E 1X38A 1P44A 2QL6A 3FMFA 3L5KA 4NV3A 5AJYA 4OKIA 4LRUA 4OQDA 5CDGA 4HDOB 4BVLA 4BQQA 5ICEA 5EXSA 1PG5A 2PZKA 3M4ZA 3L7AA 1SBYA 2G0TA 5JH7F 5T4BA 2NWQA 4KFCA 1Q0ZA 3DVAA 1E0SA 4XX0B 1I4DD 3HFJA 1SVMA 4LK3A 5EZYF 1T0PA 1V9LA 4MHSA 4JI3B 3SHQA 2CVQA 3SKYA 4A1FA 3GGJA 1WCWA 1D2GA 1MB9A 2GVNA 1XVLA 3AJ9A 3D8BA 3F67A 2YOFA 3WGQA 4B9AA 3PR1A 3T9AA 4WEOA 1K3FA 1V1RA 3SEAA 1Y4DE 3QPWA 3HP4A 3LYLA 1P7CA 4EUKA 5JYCA 3PNOA 1TK3A 1YDMA 5AI0A 1XE3A 4OQMA 3PPWA 4OHPA 3HN6A 2PSFA 4ZO9A 4BVFA 1L4LA 3JVDA 2R8BA 2YFQA 3FROA 3HY6A 4CUJA 1C8LA 2XTZA 3LYHA 5F7OA 3IL2A 1C29B 1E5XA 2ZE7A 3A6PC 5ILQA 1UFRA 2BMFA 5FWDA 4L0QA 1WQ4A 1P9RA 1SQ5A 2IYYA 4MI3A 1YACA 1VHJA 2R6JA 4QOGA 5H70A 1WW2A 4FCCA 1F0PA 2XW6A 1HLGA 4I1OA 3F47A 1HZZA 1EBBA 5BWNA 5F64A 1SK9A 3VOTA 1M33A 1UC8A 1E1CB 2IYOA 3QPVA 4QARA 3E03A 4C9BA 1RP1A 3LYUA 2I4TA 4NNOA 4GYKA 1NQVA 2UYGA 1WOMA 2NT3A 3CNBA 1UQUA 4M8NE 4QBFA 3RRXA 3T9BA 4KQJA 3CUYA 3P9SA 4JBIA 1V0JA 3AQ4A 3GJ0A 3FVTA 3UG6A 3SI7A 1GCAA 3ZNQA 2CVFA 2FZWA 2ZIFA 3EAGA 4DQLA 1R4MB 1XJQA 3NOOA 3KJGA 4G41A 2II6A 1T3SA 2EG9A 1B8PA 1E61A 1AXRA 3DL0A 3E81A 3IQEA 5HRUA 3RB8A 1RYZA 3GJ5A 4FQ7A 1H1TA 3ZHQA 1JV2B 1LNQA 4BNKA 4D8UA 4UTPA 3E9CA 3UW1A 4Z9FA 3N28A 7YASA 5JH7A 4MGIR 2HA6A 2ZU6A 4XM2A 1RWPA 4J75A 1CB7A 1W47A 1QP8A 1W8IA 2GPNA 1A4UA 4MLZA 2D7CA 4OH7A 1AHHA 2O1SA 2P7IA 1VKHA 3OLVA 4INOA 1T4BA 2NGRA 3JU3A 4YV7A 5L40A 4C3ZA 2FW8A 1Z6ZA 1M9NA 1OFIA 3NYIA 1YDWA 2AS0A 4MP6A 4NV1A 4XUCA 4ALNA 3EUFA 4IAOA 3AUUA 2XB8A 4LV6A 1D2EA 3H99A 4NS4A 3CLHA 5EY5B 1G4AE 2H3HA 3WL5A 4GNKA 1G4UR 1JR3A 4I3GA 3H2ZA 4RK5A 3VZDA 4KZPA 1PBNA 3L92A 4NONA 2ZJYA 5DIZA 4EX7A 3ZGLA 1ANKA 1HT0A 3M49A 4B40A 4LW8A 2WHEA 1LBQA 4MQEA 4EBBA 4N0MA 1IY1A 3WBJA 4A8PA 3PPXA 1M5UA 4QTXA 3OJOA 3STTA 3V4RA 1MHTA 4W1QA 4QQRA 4V0MA 2R5WA 3JD2A 4FFRA 4GGOA 4OYRA 3TX2A 3Q6IA 4JZYA 3VR6D 1M1XB 1Z28A 3OJ0A 5D5HA 4Z8YA 3WIVA 2H85A 4BX8A 5G40A 3DMNA 3QLUC 1GGKA 4P4SA 2JFWA 3DEHA 5JD4A 2P5UA 5GMOA 4DR3B 1F60A 3R41A 2RGGA 1VMAA 4GKKB 5JS1A 1T5DX 4GHWA 1XZLA 1CLUA 1R4ZA 4OI0A 1RBZA 1KVQA 3CO0S 1Q5PA 4AU1A 1DUIA 5J5VA 3WYBA 3LSTA 4W5TA 1L7MA 1WPRA 2J5XA 3C3PA 3L43A 2OGWA 2XWSA 3UUWA 5IVHA 3FFWA 1T5LA 4H3HB 4R3WA 5H83A 1CV2A 4M7PA 2Y3IA 1TRHA 4I3HA 3UWPA 4IIXA 2G17A 1PK8A 2JFHA 3TGPA 3VHRA 4E94A 4YY3B 3BD9A 1BXGA 1QG2A 3QWAA 3TQIA 1VKRA 4UCWA 2ZTMA 4JLOA 3SZOA 4XRRA 4BVAA 4BV9A 2H08A 3F1KA 4C43A 3V9PA 1FE8A 1TC2A 1AKQA 3PHHA 4XOUA 4CG2A 2DT8A 1XTUA 4B3SB 4K81B 3NV9A 1QBKC 3PE3A 3THXA 2IEGA 3GEDA 2AD1A 4S1PA 2G9QA 4XR9A 3W04A 1T1SA 3B53X 5F35A 1KFEB 4HQ0A 4X6LA 2OE2A 4XWTA 4A0RA 3VKVA 1W5TA 4K9KA 5GONF 4HDCA 1W4AA 1XBTA 2PMKA 4BX2A 1C30B 1Y1LA 2AFHA 4PPQA 1PTJC 1G7RA 3QLUA 4RPJA 4ETNA 4BVEA 5BP7A 1IMOA 4J2HA 4NDAA 3MOIA 1ZFNA 3WAGA 5A71A 2EQBA 1DAKA 4E6EA 4B2IA 2B4QA 1U02A 1ZBDA 2VJKA 2VT2A 4JKYA 4TWBA 4W7SA 1C80A 2ZYWX 2H29A 1G5TA 1K3UB 2XOEA 4J49A 1VDZA 5ITWA 3UXYA 4OXYA 2O3SA 2WSSA 3PHCA 4OJYA 3ZJ4A 4CV3A 3N2IA 1PK7A 4J16C 1WCYA 1NI4B 1JU3A 5EE0A 4BQNA 4RJTA 3COJA 2GILA 4YRFA 2R7MA 3CE6A 3OZBA 4FGJA 5DYTA 3VTAA 3BE8A 7REQA 3R3JA 2B4KA 3T1VA 2CDRA 5ED4A 4EG5A 4MPJA 1E1YA 2C2OA 2HC9A 1YV9A 3BXXA 4ZI3A 1P91A 5FJIA 1NC1A 5I45A 1QFYA 2V4MA 1BIFA 2O0HA 4O1IA 1DOHA 2OXIA 3TLEA 5FDFA 4DV0B 4MQ5A 5TC4A 4B09A 1ZRHA 3O2QB 3GEIA 5CGQB 2YWXA 3ZLUA 4EGSA 5CT4A 1J0BA 1H9AA 1TGYA 2R00A 3KPVA 5FL7D 1UBCA 4IQ0A 5CJPA 2CXXA 3K20A 4O02B 3FR7A 2XMCA 5E9JA 3LT2A 4CEHB 2QAIA 2YOHA 1JJ7A 3M34A 3VPGA 2RHWA 3DHVA 4EG6A 5FI3A 3FA2A 5HIAA 3TD2A 4BZQA 5I3ZA 2FMTA 2RHCA 3I28A 4DBVO 1MX9A 2WLTA 4YCBA 1T8YA 1Z4NA 3C5EA 3WWCA 4LY9A 5IDWA 3J80A 4EZIA 1ZW1A 1QCZA 3NATA 1NBMA 3E58A 3DFKA 4CM9D 1V6CA 4JU9A 1IOWA 2ATVA 5SYAA 5FLEX 1EGHA 3H7AA 3VPAA 5CURA 2XUOA 4U3JB 5FA8A 1NLFA 3WNVA 1C7ZA 2BRUC 3O4IA 4OMFG 5KTNA 2CSXA 1L5WA 3JCZA 4X91A 1U2EA 5HS4A 3TLAA 4AB1A 1C3VA 3R3XA 4BN0A 3RBAA 2OHOA 3F73A 3UICA 2ASVA 2HK6A 3EC2A 1REQB 2XECA 3EODA 4RFLA 3DBRA 3M83A 1XNRB 4HXFB 4BATA 4MDFA 4RD6A 3TTSA 3QTBA 2WOOA 1U5AA 3OLCX 3KQMA 4FJ2A 3CB2A 3LWZA 5LJLA 1QO0A 5FP0A 1KKLA 1GG5A 2M2IA 1GDTA 2BGJA 4A5OA 4D3YA 5B37A 2YBEA 3L41A 2FCRA 1NVXQ 4KL8S 1NBAA 4PN3A 3FWPA 3K1YA 3LGXA 1R50A 4FGKA 5CVCA 1GPH1 2LV8A 3MUFA 1EXVA 3EZYA 2CJXA 2ODNA 2C2YA 3TECE 3CSSA 1N6NA 2NQ8A 2LR0A 3JZDA 3ZC3A 1Q1ZA 2BHNA 1QIDA 4DNFA 1XFAA 2HJGA 1A27A 3W77A 3OTOB 5ICSA 2ERYA 2VNAA 1UIMA 1GRVA 1M5TA 2GAJA 2WJWA 3GRKA 4L3WA 2FU5C 4MA4A 4QFBA 1KQNA 4BQSA 4FONA 4ERNA 3E22B 2VHTA 3UQYS 1IBRA 3LLVA 2OGUA 1FBNA 4JJIA 1W2WB 4J2TA 4F1KA 3FPBA 1A76A 1DAOA 1PT5A 4G8CA 3MELA 2PJZA 4ZTZB 1T1RA 4LXIA 3V8BA 4TRNA 4WLFA 3QTLA 4OQPA 1ILEA 5DN9A 1SXQA 1MZPA 4W9RA 2FEXA 1AC5A 1DI0A 1J9EA 3KYIB 2YW2A 721PA 1BVRA 1ST2A 5A7GA 3M6UA 1M34B 5JFOA 3TDKA 5T67A 4P58A 2J0UB 4QATA 4U4AA 5LYYA 4UTRA 4UE3S 2O2YA 2IU0A 1OJLA 3HE3A 4WZAE 1E7RA 4CF3A 1QU2A 4IFIA 4RV4A 4W5WA 5JO9A 4JOBA 4KNYA 2R4UA 1Z4IA 3OPYI 1P3JA 2OQ2A 1UBUS 1DUSA 3ZOZA 4YRBA 2B8EA 5C46F 2HIGA 1XMVA 2HJWA 4UW9A 2WT9A 2I29A 4HUQA 3HLTA 3HWRA 1R4NB 5DTQA 1FMCA 3JTMA 4LFAB 1TUGA 2CHQA 4GZ3A 4RTRA 1CQPA 1E9AA 1QH8B 4Y6GB 1JIJA 2XMSA 4C29A 1RCUA 5K8JB 2IP4A 2HMWA 2RMKA 3B85A 4EKYA 1NRJB 4UQLA 4X71A 4NG5A 1HNXB 5K8CA 2WOJA 3TLZA 4F3RA 2FFAA 4JR2A 1NVVQ 4ZTBA 4HNSA 4YP9A 2LCFA 3DUFA 3DEZA 2BEVB 3T9EA 3UMMA 3DONA 3EG5A 3TKYA 4YCAA 3W6UA 1C7IA 3MT0A 4IDCA 5BN4A 1QR6A 4FDMA 5CITA 2CJPA 2ODWA 5JECA 1QV9A 4WXEA 5I7AA 2CCGA 1QHYA 4G0ZA 4KE9A 3WLEA 1UBHS 3ISVA 4E5YA 4BAUA 2GX6A 3LDFA 1AOXA 4QBKA 2ZOSA 4P4GA 3TD6A 3V9AA 5J23A 3STUA 2IITA 3V4FA 2BISA 4C4AA 1TM1E 2C03A 4KCGA 1MTZA 2Q9CA 2V4ZA 1W0JD 2FSFA 4MKHA 3BKWA 1BOOA 3FZGA 4R1QA 1I14A 1RQRA 2I2BA 3PLNA 3Q11A 4UZFA 5LKAA 2VWHA 4CM9A 2SCUB 3F9CA 4DIOA 1E9RA 4C6HA 3HDYA 5CG1A 5A9TA 3IQHX 4KPGA 4MW4A 3QSGA 3WSVA 1FQOA 1KMIY 1MX1A 2YWCA 1OFHA 4RHEA 2Q3JA 2DUWA 1GNQA 3HL4A 3TG8A 4HLQB 4Q4AB 2GN2A 4RO0A 1WKBA 3PGLA 2QAJA 3VM6A 4LI0A 3EVEA 3QQPA 5FUYA 3QEBZ 1NPYA 1V1JA 2FFHA 2UZ0A 3G13A 1SZCA 3HCRA 3NRJA 4J6EA 3I64A 4MW6A 4NYJR 2TS1A 5F2KA 4MHTA 4A4DA 3KHUA 5K09A 5KSPA 2I91A 1V1RB 4QHYA 4WWHA 1MEEA 1ZCJA 5KKAA 1IOLA 2YNMA 4YO7A 4L7VA 4YMIA 1Z45A 3W8DA 4COOA 4H1UA 1GPMA 3QJ5A 2EU8A 1KI9A 2TECE 3M5CA 3PGKA 5U4QA 3NXSA 3QBVA 3PDCA 2ZR9A 1Y8QB 4JDUA 3X2FA 5CNIA 5JO0A 4R1MA 5K0JA 4MV8A 4CKWB 5D2CA 1ND5A 4AG5A 1F0YA 1G8MA 2DQ4A 1OXVA 3BXZA 4LGYA 4R71A 1SCUB 5HIMA 4J03A 1GT91 1HDRA 3BL8A 3EWNA 4K88A 3EEOA 1GP2A 2QSYA 1Q1EA 3JQAD 2QSZA 4FD2A 3D02A 5HUHA 1SOMA 1SUIA 2XBUA 2OHXA 4EUNA 4LHYA 3HBLA 4L3OA 1T34A 2M32A 3P9YA 2ZUVA 4NMXB 2EZUA 3SJ7A 3GCZA 3FCCA 5EP1A 4TYNA 1H5UA 1E3EA 3G5MA 1LRKA 5EIEA 2WRZA 4PICA 2OBXA 1FYDA 4W7IA 4F72A 8GPBA 3UMCA 4HDSA 1BS1A 2HSDA 2OUKA 1LQ2A 1G3IA 2V7XA 1E18A 2YVKA 1G3QA 3E23A 4ZAGA 1J4AA 2QMQA 4OB8A 4CNBA 1XVTA 4RKYA 2VRCD 3I0MA 3W1EA 2P9FA 3O2NA 2IUSA 2O0LA 5K51A 2AF4C 1G2PA 2E1PA 3KT0A 3PLAE 1XK7A 3UJHA 4XXHA 1CR1A 4ZFNA 1OX4B 4AXXA 3CNHA 3LF2A 2QD2A 3T4XA 5LR6A 3PHBE 1Z7WA 1UP4A 2QAGB 4CL3A 3AUYA 1D07A 3W6ZA 1TA4A 3E3NA 4W8HA 5E3HA 4UUOA 5AKHA 3QIAA 1C3EA 4DCVA 3A9RA 4DBLE 1FU7A 3ETGA 1T6YA 3FVVA 2HPHA 4I9HA 3PDJA 5H9WA 4D5EA 4GLBA 1B4DA 3F6EX 4AZ0A 1OPRA 2CL7X 4WXPA 3D2LA 1PEDA 3DDOA 1P0FA 4LY6A 2J3IA 4PINA 1APBA 1X86B 5JAZA 4IDBA 3AKYA 1HRKA 3O92A 5DNVA 3RODA 4RULA 1A2BA 2JI6A 3JSAA 5FPKA 5JTTA 1GARA 1M8JA 2ADOA 4FB5A 4QJ5A 4ZDJA 4YV1A 5B12A 1E2KA 2XSZA 4C7JA 2C4WA 1GRQA 1UBLS 3CF4A 3EXG1 5BV7A 1SC4A 1W88A 2I1VB 1XTJA 2ISQA 4OCZA 5TVKA 3RIGA 1H93A 4A6DA 2HSGA 2XCRB 2A1TR 1FMLA 1BDJA 1HDGO 3Q6MA 4FN5A 5FUQA 4BMPB 1Y5RA 2OBLA 3IUPA 5FPQA 2Q6OA 3TQOA 2CK3A 2X0IA 4C0SA 4HGNA 2VYCA 3ZJUA 3H6GA 5AJUA 5ALWA 2O7NA 1DBQA 2QOEA 2R00C 3H5RA 1RRKA 2QIOA 1U7TA 2P1RA 1GN9A 3IP9A 4OYLA 1I01A 2EX0A 3MC1A 4IIFA 1J25A 2H1HA 4FINA 1QPZA 3WK5A 3RHFA 2YJ6A 5JUWA 1KNQA 3PIRA 4RXTA 3O26A 4NECA 1DT3A 4US1R 1GG9A 1JZSA 1U81A 4H4CA 1T4GA 5B1YA 3LP5A 2WVHA 3OSUA 4PV7A 4DV6B 5JADA 3QMVA 5EJ6A 5MFPA 3KV1A 1D6NA 1HL3A 2OKCA 4JLKA 1S4MA 4WZZA 2FW7A 4MR9B 5EHQA 5JQWA 4FYIA 5LQDA