4P80A

Structure of ancestral pyrr protein (ancgreenpyrr)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
177
structure length
164
Chain Sequence
EKAVVLDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNKVTVGELDITPLVKGADIPVDITDQKVILVDDVLYTGRTVRAAMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLSEVDGQDLVAIYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ancestral PyrR protein (Green)
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
total genus 50
structure length 164
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p80A00
2VFAA 4QYIA 1A97A 4P82A 2H07A 1AO0A 2H08A 1DQPA 1ZN9A 4TWBA 1U9YA 5ESXA 2JBHA 1TC2A 1P4AA 4Z1OA 4RQAA 4M0UA 1A95A 1P19A 3ACCA 5HKLA 1I0LA 2PS1A 5BSKA 4JLSA 1O5OA 1O57A 1OPRA 1IBSA 5JSQA 2IGBA 1I14A 2AEEA 2P1ZA 4RHUA 1Z7GA 3OHPA 1GPH1 1VSTA 5JV5A 1R3UA 1GRVA 1LH0A 4M0PA 3O7MA 4FYMA 1DQNA 1WD5A 1VCHA 3OZGA 1ECFA 3G6WA 2XBUA 4LYGA 5K51A 3MJDA 1QK3A 4QYIB 4KN6A 4RQBA 3QW4B 3DAHA 4PFQA 1A4XA 5E38A 2GEBA 1QK4A 3H83A 4RAQA 1I5EA 2WNSA 3DMPA 4LZAA 1ZN7A 1G2PA 4RABA 4WN3A 4RANA 1QB7A 1J7JA 1D6NA 4RHTA 1TC1A 4X45A 4X44A 3LPNA 1NONA 4IJQA 4PAWA 2EHJA 1I13A 1BD4A 1ECJA 1UFRA 2DY0A 3ACBA 1QCDA 1QB8A 2H06A 1JLRA 4LZNA 4RADA 4ZFNA 1UPFA 1CJBA 3HVUA 4LZOA 4RHXA 1BD3A 1XZ8A 4M0KA 1OROA 5BQOA 4P3KA 4OHCA 4RAOA 5BRNA 1P18A 1A98A 1ECGA 1YFZA 1G9SA 2JKYA 4RV4A 4RACA 4LYYA 1XTTA 3GEPA 3LRTA 1XTVA 1G2QA 5ESWA 1G9TA 3DEZA 1QK5A 3OZFA 4JITA 1I0IA 4WMLA 2FXVA 1W30A 3EFHA 2JI4A 4P80A 4P84A 1XZNA 5KAMA 5BQPA 2HCRA 5IPFA 1QCCA 1HMPA 3S5JA 4RHYA 4S2UA 2PRYA 1HGXA 1BZYA 3M3HA 5IAOA 1DKRA 1U9ZA 1FSGA 2JKZA 4P86A 4F8EA 1ZN8A 5EUCA 1A96A 3GGCA 1Y0BA 2E55A 4MB6A 4P83A 1DBRA 2PRZA 3KB8A 5HIAA 1NULA 1JLSA 1UPUA 1A3CA 1MZVA 1ECCA 1ECBA 3N2LA 4P81A 2C4KA 5KAPA 3GGJA 1V9SA 1DKUA 1VDMA 3MBIA 2YZKA 3NAGA 3ACDA 1L1RA 4QRIA 1OREA 1P17A 1XTUA 1STOA 1PZMA 1L1QA
chains in the Genus database with same CATH superfamily
2OV4A 3WWDA 3C4VA 4R1OA 4LK3A 3G17A 2BKXA 1WY7A 2EX1A 1G4AE 3NTUA 5JPIA 2VOJA 4GX5A 1E3MA 4OU5A 1Q83A 3U1VA 2G63A 1T1SA 3CLHA 2HGSA 2VF5X 3RF6A 2N1MA 3NT4A 1Y8QB 1NR1A 1UBOS 1YQTA 2VBCA 3ACCA 3RUAA 3W5HA 3ZWNA 1IONA 5BWLA 2PZMA 4ZTZB 4JJ7A 1T5BA 2OWEA 3CCFA 2E85A 2H1VA 1XXLA 2BY4A 3TZCA 1CT9A 2R6FA 1SZPA 3C7DB 1R0CA 2ZRLA 3KYDB 4O63O 3DDOA 3H3JA 3HV0A 2NUPB 1RWOA 3SZUA 3ZZMA 2I3ZA 3EMDA 1GZ4A 2C7OA 2FTKE 2QTRA 4JJEA 1XQYA 5AYVA 4TS9A 3RVNA 4EB8A 1XTPA 3A06A 5FOXA 2QAGC 3N86A 3OZVA 3ERCA 2AMLA 2VHUA 1XJ0A 4DLXA 1R8JA 1SD2A 4A0RA 4EKNB 1G64A 2R60A 3A7EA 5E38A 4NZOA 3W6UA 4DA0A 4X00A 2BD0A 2C9OA 2WMOB 5CVDA 1AA9A 2YBDA 4ZI7B 5EJ8A 3IUBA 1Y1LA 3IMCA 4W9RA 4G0UA 4ER7A 2IPMA 4AL4A 1P60A 2QDXA 4RVDA 1TYAE 3LUJA 3NIGB 2C7PA 3KZVA 2GKGA 3FOZA 4M88A 1GQQA 4IHQA 1UFRA 2QRMA 1AS0A 1QIDA 3IC5A 3RUCA 4AS2A 2H06A 3LNCA 1IHOA 1T9KA 1PU2A 3PIIA 4KRYA 4UBNA 4UVDA 1IHDA 4RK7A 1G4UR 5AOCA 5DM1A 2IS1A 2NO0A 3SM3A 4KITB 3PS9A 1GPLA 3UV6A 4IY1A 4MRPA 1UDBA 5JNUA 2IZ7A 1YQUA 3Q85A 3K35A 3RRJA 2XUZA 3JD1A 4PGMA 4BNLA 1KU0A 3V2GA 3LY5A 4R51A 1W0JA 2A0FA 3THWA 1D7OA 1MB9A 3RC8A 2C9ZA 4I46A 2QQFA 4MUYA 2WKSA 4WDRA 3Q1KA 2JHGA 4KSCA 1P73A 2AG5A 4GXTA 5CT4A 1N5LA 5EESA 3SQWA 4C22A 3R6DA 2W6QA 3IFSA 4FFMA 4LA4A 1PIWA 5HRCA 2DRIA 2ZXUA 4JNCA 3ZD8A 3H2GA 3KELA 3I8SA 5EZYF 4CMAA 4KR2A 5JAMA 3N3AC 3HFSA 4IIGA 4G2NA 1FJXA 1A7KA 1KS9A 1NI5A 1O97C 5K4GA 3MOIA 5AJWA 4AJOA 1J2YA 5TEVA 4YI5A 1MABB 1F8GA 3BIXA 4YJ2F 4OLAA 3V4VB 1ZMXA 3GFTA 4ON9A 3QITA 3GUCA 4DOMA 3IS3A 1H94A 2FFBA 3REFA 1F5NA 1JA1A 4EUEA 2F9MA 3BMXA 4GVXA 5DTIA 1QRRA 1J2EA 1MENA 1R6XA 1AG9A 4YFYA 4GZMA 4DB4A 1GGFA 2GXSA 4UATA 1L4MA 2K2QB 3O1LA 1GZ6A 1RIFA 5AKXA 2XI4A 5JARA 1I5OA 5IUKC 5EZ6B 1ZX1A 2M9MA 3HCRA 4ZMRA 5D86A 3NHLA 1YOBA 3PKIA 3M9XA 4CQMA 4CQNA 5HK8A 2B3DA 3HL4A 3L92A 4DR4B 4OFZA 5AT1A 3P1JA 4Q19A 3RVLA 4ZZ1A 3INGA 5EMNA 3JSXA 3U3JA 4GPAA 4TMZA 2WIDA 1OV6A 1C30B 3K5WA 2XCTB 2CNLA 3TLMA 5AW0A 1GNTA 4QYSA 1P4AA 1EFUA 1NBAA 2N47A 1MOQA 4UTOA 4U7HA 5GQSA 4Z1OA 5BNTA 2QPOA 2VS1A 1M5TA 2GBLA 3C43A 4ACAA 5F9MA 1X14A 3DLTA 3P9ZA 5E1OA 5JECA 4ND4A 4L2IB 4FU0A 1SCDA 1GEGA 2CLDX 3NHAA 1KE2A 1JHUA 2HIAA 2NXNA 5JV5A 3KD2A 1ETHA 2IYXA 1ADJA 1JHMA 1YCDA 1OCEA 2FPPB 2EWWA 1F7VA 1SCQA 1XZHA 3K0EA 3L77A 3MJHA 3OZBA 4MRSA 4BEWA 1ZR2A 3EZGA 3DVLA 3JQRA 3WSWA 4C1BA 4G0WA 4XB1A 1QG2A 2HJVA 2H9YA 1R16A 1A4XA 4F9EA 3HZRA 4DIDA 1XAGA 2A2ZA 5EJGA 4RJIA 5C37A 3F4BA 4FN4A 4OQLA 4D9JA 3OM1A 2JLZA 2EZTA 3SFZA 3ZGVA 4RPHA 3E18A 5EJMA 4KK4A 5JD4A 2DJ5A 1NJGA 1HORA 2OOSA 4JB0A 4ZT2A 3GT4A 4FCWA 1PW7A 5BVGB 1B93A 3NWPA 3AXTA 3QX3A 4B7AA 4YUAA 3ZBQA 4MS3A 1SUAA 2VNHA 4D26A 2O5EA 3EMBA 1RBQA 4MV3A 1NP3A 1SBZA 1E94E 4M37A 2A57A 1EHCA 4LJ8A 4HN4B 2ZBRA 4LE1A 3LUDA 3E5HA 2Z6AA 1IBCA 3PT5A 4MP6A 4HGZA 3SLKA 5KIAA 1T9BA 4NMLA 5HBRA 1OC4A 1Y7PA 1GO2A 4YAFA 3ZNOA 4TKVA 1P1FA 3LLCA 2ZT5A 4X84A 3U7EB 1CJMA 1OH6A 2VTDA 4KLAA 3WBKA 5KQGA 5D6NA 2EEPA 3RUFA 5BW5A 2HSWA 3EH1A 3OUTA 1JU4A 1J5PA 2QSZA 5EUQB 1HI9A 2YHBA 3OLXA 1VL5A 1E9AA 1FVXA 2QHXA 1Z4OA 3VH3A 5LBUA 4ZT6A 3RYCA 3W5BA 5BT9A 2GYUA 4HDKA 4RVHA 4K87A 4HNRA 4KGDA 3WGUA 4ZYUA 3PRJA 2LIVA 1S0UA 2X8AA 1K1EA 4YV7A 4NXMB 4B09A 1I9GA 3SOZA 1V7ZA 1G3IA 1GYRA 3OF5A 5K09A 2WD9A 2GDJA 4HB3A 4CI0B 1PLJA 3I4FA 1TZKA 1P80A 2WSSA 3BDVA 2IIPA 3P2YA 3TIFA 1GUZA 4AP6A 5DB4A 3VTFA 2C3YA 3VR3A 2PEZA 5T41A 3O47A 3K9CA 3OPYI 4B46A 3DYIA 1ECBA 5AICA 5DYWA 3F8SA 1JDVA 4BV3A 4QPJC 4DCGA 1TKRA 4I50F 5ECYA 1OA0A 1VI6A 2C9DA 4O2LA 3AVVA 4KQGA 1PP4A 3MQFA 4QRIA 3CLVA 1UAAA 3MJ4A 5CFOA 4PQEA 4ABTA 1OXMA 4IIYA 1E9CA 3KHTA 4J4HA 4ZCRA 3UJ6A 4ZU6X 1E9DA 3T1HB 1UDCA 3J7AC 4UEWA 3P4UA 3H18A 1ECPA 3IT0A 2F1IA 3UOGA 1BDHA 4ER6A 4P4LA 4UUPA 3PICA 3ZKAA 3MLAA 5LIPA 1LLFA 4AKIA 2ATEA 2I4LA 3GH3A 1R12A 2HIHA 1PNOA 2DGDA 3NP7A 1LW6E 4B76A 2XMBA 4XIIA 2G08A 4DR5B 4F2WA 3W78A 1AHNA 2VZ8A 1CEXA 3OIFA 3UC5A 5JZBA 4CTKA 2B7CA 4TXJA 4M9RA 1TJ3A 4MO2A 2JC3A 4NBRA 4JY7A 4YNBA 3HN6A 4X24A 4XJVA 2G1PA 1U8ZA 2AOTB 1VKRA 1KPHA 2J07A 2ZJ3A 1K3FA 3ILXA 2ONYA 4BRWA 4E5VA 3AZQA 5KNCH 2WJ4A 4GQIA 4KV9A 5ADUS 1Q1QA 1U0HC 4PICA 3RGGA 1A2BA 3LP8A 1UM8A 3FGZA 1JMYA 1N78A 4J16A 2PUWA 2Y27A 3CPEA 3Q3EA 4PLHA 4QGGA 2W58A 1QYCA 1ESNA 3C1OA 4YGYA 4B47A 1F8YA 1H2EA 3EULA 4HNHA 3OC0A 4J9VA 1FYEA 3GUYA 1RP7A 4LRUA 2HXYA 2JLCA 1QDLB 4NU5A 2X1LA 1G2PA 2JGFA 3UT6A 4DR3B 1E2LA 1AQIA 1J7JA 1SUFA 2E1PA 3Q9SA 1CSEE 1EDDA 2P5YA 1ICIA 1XD2B 3QBJA 4QICA 1XCOA 1SHKA 1PWHA 1FFHA 4I8XA 4V24A 3TR5A 1B1CA 4B3BA 1CIVA 1NQOA 2Z5VA 3VU3A 1EVZA 4KPYA 1IJFA 3OEEA 1UMKA 1X7YA 3SJ7A 5IT0A 1XZMA 4XWTA 3D8NA 5I48A 3RIEA 1H0SA 3ND5A 4PPYA 2CFOA 1B26A 4AY4A 4JMLA 5AOVA 2AA3A 1CQZA 1CDDA 1Z6ZA 1M34B 4E13A 1I6KA 2QGZA 4AJJA 2GZ1A 4QQFA 2Q4RA 4C21A 4EZIA 5HJ7A 4EFLA 1BMQA 1LBQA 2I4TA 2Q4OA 3HBNA 3MJFA 1YZGA 2OUIA 2C07A 3QBDA 4X1OA 3Q3VA 1D2AA 3F97A 1DELA 4UEOA 1D9XA 3PDIA 4V1CB 1ZIYA 2X3FA 3JYLA 1NG1A 4WW0A 4E5KA 5KJ6A 2VBGA 2NUAB 1JAYA 2D7DA 1P4SA 2ASVA 2Z2IA 3AHJA 4N5DA 3RYHB 4A6DA 3ZEAA 1YFKA 2J48A 3K0CA 4HNSA 1P77A 4PLWA 3W0LB 3LW8A 1SG0A 3BX1A 4MB6A 3SSAA 5FTKA 4R1MA 3OQPA 5J2UF 4YHHB 9ATCA 1FJ2A 5ICCA 1I7NA 4ZEVA 1K86A 3M6AA 1G21A 3N3BC 4DT1B 5T7BA 2WM9B 3KEGA 3NDJA 1RWNA 2PWPA 3D4NA 1R74A 5GONA 2XOKA 5CXUA 3SYLA 1K3TA 2VN8A 3B3QA 2DCMA 3JQ9A 2LRHA 3UH0A 3A2NA 2I3BA 1EK6A 3TQSA 3UOAB 1H3EA 1PLKA 2YR0A 4E4TA 1EUQA 3KC2A 1AKVA 1HNNA 1L1QA 2P30A 3KO8A 1GUYA 2BOVA 3QVLA 3CPSA 4KLCA 5EKDA 3LA6A 1OI2A 4RPLA 1S7GA 4CG3A 1A9TA 2EBWA 3H97A 4A0QA 3ID6C 4IFIA 3TW8A 4CMHA 1EBUA 3VU9B 2I99A 1ZINA 1MR3F 2P4SA 1ZVMA 3MBKA 2PGLA 4QUJA 4Z9FA 3AVYA 1UP4A 1L4HA 3K1YA 2V1XA 1FDSA 5H80A 2QLLA 1L8QA 4PTYA 1E89A 1L4UA 4JX9A 4Q1EA 5BSKA 1VJRA 1KDRA 3GDWA 1FPQA 1XTKA 3I4CA 3R3UA 1FVFA 3BF8A 4E5PA 3NRJA 1KP3A 2ZYSA 3BFPA 1PWXA 2V8BA 5CLIA 1HDIA 3PQ2A 1Z06A 4N5NA 2WYIA 2Q99A 1E1QA 1KEZA 4E70A 3GLFE 2QX7A 1IVNA 4LNHA 1XQ1A 4G5XA 1M8JA 4HTFB 5TNXA 2XUPA 3PDJA 4G07A 2YZMA 3A32A 3IIKA 2Y4NA 3EDOA 5JJCA 1OIXA 2UZ1A 3ADCA 3FTFA 4G41A 1W1WA 4RF4A 1YB7A 2Z3ZA 1LLQA 1EXDA 3BL8A 5I7VA 1T1EA 1Y4AE 3K9BA 4Q1BA 3UB3A 4MI9A 2PCLA 1Y4SA 3O94A 1ZOPA 1RBMA 4L0MA 1OI4A 2FSFA 4RK1A 3FDZA 1IBRA 5TPWB 3GG2A 1CR4A 2OHGA 1IUNA 2VDWB 1Z0JA 3L82B 3FFBA 1WKCA 1TC1A 2BV3A 1ZZGA 4IOMA 2XT9A 1X2BA 5AJUA 3LL7A 3IVGA 5EUBA 3PHGA 3TLGB 4CLHA 2PKEA 5AW9A 1CVIA 4BKQA 4B44A 5D84A 1YAJA 4RY0A 2RC5A 2VF2A 4MV4A 1B1AA 2RHBA 4JEIA 2EU8A 2EGUA 1LBEA 2VAPA 1OLSB 4KFUA 4K8RB 4CGYA 2QG4A 2ZYVX 1U63A 2OQVA 2AVDA 3I5MA 1HNXB 3Q7IA 2XCOA 3RSQA 5I7OA 3NW9A 2JRCA 3IVMA 5E7JA 1VSUA 1FS5A 2IHZA 3GAZA 2HTEA 2ZJ8A 1TQ6A 2ZS8A 3UXMA 5DBFA 2JIDA 1W85A 3AW9A 1KIMA 2XZTA 1IEXA 5DTJA 1RFLA 2QVGA 1L5GB 3QSGA 5IAKA 4I2NA 1XVVA 4F3NA 4P80A 4WZBE 2B34A 3BSFA 3FLEA 5EINA 4KO8A 3UXHA 4RVSA 3V8RA 3AUSA 5LP1A 4NCBA 5CYPA 5DYTA 2Z0MA 4JJKA 5EP3A 2GPTA 3K0HA 3DFUA 1LNSA 3FA2A 2EWVA 3QVVA 3TTVA 3EG9B 4GDFA 4UFOA 4FS3A 1T0JB 4IVNA 2HO4A 4HAXA 5L3QB 3DBLB 1JLKA 1U8EA 3I30X 1TM4E 4Q9JA 1SU8A 3DBRA 2G28A 1Y82A 1R27A 5HQ3A 2ZATA 2A5DA 1VMDA 1U81A 4C08A 4PRKA 2NZ2A 1N5DA 2FRVA 4FWBA 4PLTA 1R0YA 3MLBA 5D5QA 1F7UA 4FNAA 1PHRA 1Q16A 4J0IA 2CFIA 3KS9A 4RHEA 2JLWA 3A1EA 2E4WA 2F48A 1EFDN 4XQEA 1JH8A 2BSAA 4KXQA 4ZQEA 3GY0A 4LVCA 5G4KA 5LYJF 3RE1A 2GLXA 3IPLA 3EWNA 5A4IS 3DUWA 4BU0A 1X7XB 3OQMA 3S2EA 4M8IA 1Q21A 1XTUA 3CVJA 2J9ZB 5JAQA 1UQUA 2I0FA 4PQFA 2WQ7A 4RXUA 2DQSA 4MGIR 4UUOA 1PG2A 1FYWA 4R3UC 4DR1B 2EBUA 4Q47A 1LI7A 1ZJ6A 2DHCA 3RJ5A 3KZNA 4JR1A 1Y3IA 1CTQA 3CONA 4OQQA 4YAEA 3TZ6A 2EDAA 3V4FA 3ZWVA 5H3CA 4DMUB 5E4TA 3HU3A 4BO3A 1UWLA 2O7RA 2ZROA 2KS6A 4FZ5A 4NZMA 4CLEA 4PC6A 1LBTA 3V8EA 2PKRA 4PNPA 1E3TA 5DW0A 4Z3OA 3RSCA 1XEWX 1SXJB 3Q8KA 3DLPX 1NJ5A 3L7KA 3C5CA 1AS3A 1KE1A 4K6GA 1PJZA 3ZZ1A 2B8EA 2HRRA 3R76A 1E7YA 4NNPA 2WKWA 4GP6A 2Q3EA 2XXJA 2F4NA 3M4JA 3T06B 4LQDA 4YP6A 3SGLA 1TMYA 4B8YA 5JVDF 2WMNB 3O21A 2O07A 5GV7A 3OTQA 2BP7A 4OXQA 3ROZA 4UFPA 3DZKA 1Y1QA 4IWXA 2ZPTX 3GV0A 3OIWA 1C41A 4HZIA 5TVKA 5I7SA 1CR0A 3BH0A 2F2TA 2XCLA 5TQVA 2H16A 1XQ6A 4LMBA 5K3EA 2AMYA 2YXNA 3TTWA 3NHBA 2POQX 5DGXA 4L8FA 4A8JB 4D0LB 2ZRDA 3IVAA 4EHIA 4ZALA 2UUAB 4ETIA 3VR5H 2D5CA 2ZITA 3A6DA 2RI1A 2WT8A 1SK9A 1OXKB 2ZTMA 3F90A 1TXGA 3VVMA 3T52A 1PE0A 1FU4A 3UWDA 4ERXA 4FFBA 2VTKA 3CF0A 5TY0A 1RLTA 3N5CA 5ED0A 2H5JA 2QPLA 3PTLA 4AF6A 1ZCJA 4IIDA 1UP6A 1SPXA 4PM4A 4Z2AA 1XGKA 1HETA 3S7TA 3VKFA 5K4HA 3KE9A 2BUBA 1T2DA 4M7PA 5CNJA 3SF8A 3AUYA 3WLRA 5COAA 4F91B 5CIYA 3V2IA 5ISMA 1SUWA 3ZE7A 1LWOA 1HNWB 4GU5A 2DUUA 4AWBA 2WJVA 1L7EA 3FPAA 3WHIA 1ZMOA 1PQPA 3V4RA 1NHWA 5JO9A 2ZYTX 2B4YA 2VATA 5I9NA 2C20A 3O95A 4QUAA 2WE8A 4ND8A 1CF9A 1D0SA 4TX1A 3VMMA 1KR5A 2OC4A 3WDSA 4V03A 2ADMA 2Q5HA 1HEUA 4M22A 5G41A 2P7HA 3RIMA 4TT3D 3GRYA 4JEMA 2D00A 3ZH2A 4BNIA 4EJ0A 1NXOA 1NJ1A 1I6WA 2YIVX 4EQZA 3O82A 3IP9A 4HXFB 3UV3A 4ZOQI 2ZZMA 1K5HA 2BEJA 5GOTA 4DCJA 2GFQA 2WNHA 4AQ7A 3W2FA 1R5BA 1RXWA 1QGZA 1YKSA 1KMHA 1WCV1 3IO5A 3K6KA 4ZVTA 1Q3KA 3WL4A 3ZE0B 4D3DA 4P4TA 1VPWA 1HLDA 1Z4MA 3OZIA 4GE0A 1ZM2A 5AW8A 1M7GA 4FOOA 1HQCA 1HV8A 5KTMA 3JS5A 5GIPE 1C3JA 2SICE 4MW9A 4WVFA 2C96A 3AF6A 2G25A 3IP1A 1SOMA 2XMSA 2QG6A 3CH7A 3IVXA 5C0OE 4BHTA 1TUEA 5DTRA 2LCIA 4J29A 3RYTC 3QIVA 5JISA 3V4LA 3KYIB 4AICA 3DS8A 3KK0A 1GTJ1 3ICPA 4LPSA 4YYEA 3DW1X 1AZTA 1DWUA 2CYAA 3BULA 1FNMA 5ALKA 4OXNA 1ORTA 2ZDQA 4MPDA 3UBTA 3EVCA 3LBIA 1JLLB 2E5FA 1I2BA 1T5HX 5B30A 4YPOA 1GPJA 4MV1A 1TC2A 4RD4A 4Y6PA 5ALVA 2FEAA 2AV6A 1JAHA 3IAFA 5F21A 2P69A 5J5AA 2GJ4A 3M5PA 2DFDA 4GPBA 1WXHA 3HBMA 4AW9A 4AJ4A 4JLSA 4BRUA 5H7XA 5KHOC 3TXXA 1Z6AA 1ZHOA 2PNJA 3RVKA 1E6KA 4RTMA 1JQLB 4JP2A 3VZBA 4D79A 1VZ2A 2DG2A 3QXHA 1PG0A 4G89A 4PV7A 4W4TA 5FOUA 5H9WA 1QONA 4BE9A 2XBMA 1O6FA 2NV6A 1T9DA 2I87A 2OGWA 3KEQA 4WOKA 3T3EA 3ZU2A 4B33A 5MN4A 3WTBA 4H1UA 1V16B 1MB4A 4AUEA 4OKNA 3VVCA 2OG2A 1I2ZA 2XDQA 4RNDB 4NIMA 3RBVA 4Q9NA 3V2UA 2C99A 1U3UA 3MUEA 3W1EA 1H1TA 3B5IA 1CDZA 5IX8A 3LCJA 2HJGA 4NOJA 4RKEA 3LF1A 1D03A 2ILVA 1II8B 2C8LA 3G88A 4UAJA 4BKUA 2XCRB 2ZKLA 3NDRA 1GGNA 2F59A 1OBHA 5SY6A 4GOJA 3D6HA 5BYKA 4G8DA 1SQFA 4X95A 4B9EA 3JCZA 4ZI7F 3KVNA 4Q4JB 1A9XB 1KEEB 5JQGF 1OF1A 3ICCA 2VHTA 4WZAA 1PFGA 1JFFA 3FVVA 2DFNA 3A26A 4KJXA 3P0JA 4X1IA 5JANA 3C24A 3EQ6A 5FUQA 2XODA 1E7WA 1VBKA 2PZGA 3KE8A 3UMBA 3VVLA 4DJAA 2G36A 4MQBA 3QZUA 3KB1A 4V0SA 3M9LA 2OV2A 2BZ1A 5ALPA 5BT8A 1P2FA 1GNPA 2GK6A 4JLAA 3UATA 2C7QA 1H8HD 2NOAA 2BZSA 4R81A 3P0HA 3M82A 1JTVA 4Q3OA 3GP3A 1GCOA 1Q7CA 2FSGA 4CNQA 3UWKA 2A59A 5BV8A 4MDYA 1BKYA 1SC4A 2G5PA 4X60A 1W0KD 2Q9UA 2G9ZA 1LDEA 4TRNA 2G07A 3E05A 5AVRA 1QF6A 1PJTA 3CRMA 5HIJA 4EJ6A 4NZNA 3NHPA 1EP2B 1XU7A 3G9QA 4KOEC 2VQ3A 3C3PA 4UTRA 3DHNA 1YDMA 3MS7A 2COUA 1HZZC 3KVVA 2GTPA 1O54A 1RXYA 3SJCA 1I30A 1Q50A 4NOLA 1IOWA 4AKGA 2Q1YA 3BVPA 1L5YA 1LDBA 2FZLA 3DR5A 3IB3A 5EERA 1W52X 4O4HA 2A94A 2NU6A 4WY5A 2JH3A 3VGJA 3DT8A 3VH4A 4TYPA 4FONA 2XYGA 1SD5A 1FQJA 2UVPA 2YOGA 3OZWA 1WY5A 1MUUA 2ZJYA 2HREA 2VSQA 3LG2A 4LV8B 4WOBA 1JBEA 4TROA 1UMCB 2X4DA 4Z6KA 5DCWA 4YCBA 4YJ3B 3DLAA 3ZGNA 4MVCA 2WU1A 4DJEC 5JWRA 2HK8A 3FB4A 4HQRA 3GCDA 1XLTA 1IQPA 4I4CA 4C0WA 5CVTA 1U0LA 4F56A 4MJXA 2CMHA 3K16A 2ZBFA 4OJMX 5FOQA 2CXOA 3D2CA 1G8PA 5JNLA 4IGEA 4MWDA 2FN3A 3SIPA 1UL1X 1ZN9A 5TPZD 2OCBA 2W8BA 4MMXB 4MITA 1Q2XA 5IW8A 2OK7A 2GESA 2J1LA 2KSQA 2WDPA 3CEAA 5EJ4A 1P6QA 1B41A 3NCHA 2AC4A 1GLVA 1UXHA 2EFDB 3JZIA 3PQ5A 1OYWA 3G0CA 4LWQA 5DDIP 3LK6A 2AQIA 4IEEA 5HKLA 4DN6A 1U2EA 2FFRA 1Z33A 5C7LO 3HUTA 4DXAA 4ILKA 4MZXA 4QGBA 4E7PA 4ENTA 1S3IA 2FRDC 1EM6A 4HGRA 4H31A 5KNCD 4QPNA 2MOKA 2YMLA 1R0BA 5EIAA 1WRBA 3AUTA 2RHDA 3F8WA 4NZZA 2GHRA 2BMEA 1HF3A 2I4NA 3EZLA 3SAJA 1JTEA 5K8IA 4YS6A 4FGJA 4Q1CA 1M2EA 1MOSA 4MWTA 4CCAA 3O8OB 1ZGJA 5CIQA 2GJKA 3SIRA 5F7JA 1XNHA 2Z8YM 3T3MB 3WY9A 2ZJ4A 1UT6A 4DLVA 1RAGA 4NKRA 4ENRA 5F7OA 1WWKA 5AHKA 4HVTA 1X9GA 3KOZA 4A23A 3T5BA 3UJBA 4HF7A 5I6DA 1UBSB 2GJ9A 2R6ZA 3QSYA 5KHLB 1XEAA 4S1OA 3RRYA 5EJ6A 4YWJA 1U0SY 4GOND 4AQDA 3JYQA 4OCZA 1H2FA 1CDOA 1E96A 4EGFA 4BNFA 2AOUB 4X1YA 4DLBA 1YGYA 1YDFA 3KVRA 4NG5A 4IO1A 4KQWA 4U4AA 4ZO7A 3O8RA 3COSA 3QUQA 1ZH4A 3C15C 3M5DA 4FINA 4H16A 2PWZA 1XAJA 1RRCA 2DUMA 2VCYA 1PV4A 3E2IA 4Z1MA 5DV9A 3HVUA 1UKAA 2XB2A 1BH2A 4Y1RB 5CT9A 5JSHA 1EFRA 1P18A 4UC0A 3EW7A 1BXZA 1MAWA 3LFUA 5AW6A 4PNZA 1V35A 1AM4D 2Q7DA 3E03A 1G21E 3LX5A 3AYXB 4BFZA 3K4QA 5I8WA 3NVAA 3VHRA 2J09A 4NNOA 4DV7B 2FR8C 3R6TA 2W0MA 3U7JA 4L5IA 4V3BA 4EARA 3Q72A 1MW8X 1DBPA 4Q4LA 3BD8A 2AEMA 4ISBA 4FOTA 2DQKA 4BQRA 5BQPA 2O3TA 2HRBA 1X39A 4CI9A 5JJLA 3HWRA 1BVYF 1KVUA 2XTAA 3JWHA 3K92A 3PFIA 1CJTC 3A2KA 3I62A 3OJXA 4G4SP 4NCNA 3TSAA 3M1AA 1NP7A 3MWEA 2VNAA 1K4MA 4GQAA 2B0CA 3D5TA 4QOFA 5DM4A 4B31A 4CF7A 221PA 1R4NB 1P1HA 1H4SA 1E3WB 5KTSA 1COZA 5F2KA 1WDKA 3JAWA 4P1ZA 4S3MA 5JJIA 3UT5B 1AXGA 2E82A 5LMCA 4FFPA 5ETJA 3N7UA 1E6UA 2IU3A 4MGKR 1AZWA 4NFHA 2PEYA 4L5AA 2WM2A 5KTNA 2LV8A 1VIAA 1GWNA 3UV7A 1JEYA 2P3LA 4K0RA 2J3QA 4L9SA 4LE2A 1R6DA 3IAXA 4GKJB 5IN5A 5JFGA 5A4MS 1EDEA 3P8ZA 2FUG1 1XDBA 3DMTA 3MS4A 4FXPA 2AX3A 1I4DD 3A1CA 3RSOA 1ISMA 1ZBDA 3WYCA 2QY6A 2VHYA 2HV8A 2X7XA 1RLIA 5SYAA 3HDQA 2D2IA 4LZLA 4IDNA 5A06A 4C0HA 3V7FA 3D3WB 1YOVB 5BN3B 2G06A 5IBQA 1P1BA 1CVLA 1G5FA 4DGQA 4UE2A 2XT6A 3AESA 3CO0S 4NXNB 3GXBA 1SM4A 4MS1A 1K6EA 1P6XA 4OKIA 3IGFA 3JQ6A 5D87A 5K8VA 1TU0A 3ZQ4A 4RH3A 3GRZA 4PGGA 2GHIA 3WHKA 4GYKA 2P1ZA 4M9SA 1Z7GA 2V1UA 3CKLA 1JPJA 1HE4A 1KK3A 3LOPA 3UG6A 5JADA 2DBVO 2ECFA 2ZB7A 2ZYUX 1OLXA 5FUYA 2V9PA 3RD5A 5H02A 1NL3A 3DZJA 1M33A 4EUKA 3S2ZA 2MINA 5FUMA 5TT1A 3MXTA 2VQDA 3U48A 1W9MA 3PUYA 2KLBA 2QRUA 3JV7A 4X7PA 2H52A 2OO3A 3AR4A 1JEQB 4M21A 4OYYA 2J6HA 4PO1A 4Q02A 3IE1A 1WZCA 1BYUA 1K06A 4BTEA 1XDSA 3GW8A 3HXMA 4MVJG 4OP2A 3DE6X 3O3MB 3NHSA 3K1AB 4LXUA 5IC5A 3VDRA 4B3MB 1RQPA 2X15A 2GBIA 1LI4A 3BWCA 3FJ1A 5ILOA 3FCCA 3JD0A 2I62A 1XRLA 5CH8A 4BRSA 3KTFA 5FBZA 1K0FA 4ITRC 4D9HA 4QJ4A 3U4GA 1CQXA 1HT3A 3EFEA 5JYBA 1EE9A 1PG5A 4LJKA 1G38A 1V4VA 3GARA 2YY5A 4R41A 4B85A 4BMNA 4TQUS 2CCKA 4O5OA 2F3UA 3OU7A 2DH6A 5IAGA 3G6KA 2CSUA 3WA6A 2AZ4A 1JVBA 1KVRA 3DKKA 3HJNA 1QV6A 5FPKA 1P0FA 4XGIA 1F0PA 4US0R 3OJOA 1WG8A 1SKMA 4NPAA 4P4SB 1E4EA 2OM6A 2EKLA 2Q5QA 4ZHQB 6REQB 7ADHA 4DRXA 4LYYA 2YIJA 3PEWA 1AVTA 1FDOA 4YQYA 3WGLA 2W2KA 3TRJA 3NEJA 3EIQA 3R6GA 3AO0B 5JBIA 2QYSA 1W6RA 2G88A 2JI4A 5A5FA 3PQCA 4Z7JA 3CUWA 5H59A 2XCIA 5HR5A 2FRXA 2A67A 2HDWA 2Y1GA 5ALJA 1IVSA 4C01A 3VKHA 4LK2A 2H2AA 3EEOA 4YRTA 2F1RA 1LS1A 4FR0A 2UU9B 3MWDA 4WPGA 1KSGA 3RJ9A 3ZWBA 4MK4A 4AMBA 2W6OA 4N03A 2Z9BA 3IMKA 4I1VA 1JRLA 1RRPA 4PIVA 1CX9B 1PJSA 1SIUA 2HSJA 5K7SA 4MICA 3HNRA 4KIGA 4QQKA 3VSAA 5GINE 2AJCA 2ZS9A 3E7PA 3OTGA 1IQ0A 1UKBA 2R7KA 3DGEC 1Y7TA 3NJ8A 5HFAA 2EFGA 1NSYA 1DT3A 3OMWA 1L5SA 4IXMA 4DA7A 2Q0XA 3BA6A 1H9AA 4NENB 2FF5A 2Y0EA 4HUQB 1HO3A 3UO8B 4C7VA 3VHXB 1SG9A 2WA2A 1G1AA 3I0ZA 4JSTA 2FU5C 4F11A 1R8QA 2PUBA 1TK2A 2NVOA 5AUQA 3IEVA 3IELA 3D1VA 5GY7A 2PX5A 2MHCA 1QZZA 2CLLB 3HN2A 3ZGOA 821PA 3QVMA 1KSFX 5HUHA 4D0GA 1AO0A 3L0YA 3LDHA 3CY6A 1VSQA 3LYAA 3G85A 4W7IA 2P9CA 2X1HA 2OYCA 5CXSA 2H2DA 5JY1A 6ABPA 1E3SA 5AOBA 5L7YA 4BS9A 3T9EA 1DAOA 1XQ9A 3AR3A 3V8PA 3DBHB 4GOLD 5DMXA 4UNRA 2I4MA 3RVBA 1WW2A 1SCKA 4B2IA 1SVIA 1UXJA 2B9EA 3R0IA 3SXPA 4Z7NB 4LYFA 5HRAA 4LYHA 4W5TA 2IGBA 3USCS 1X1SA 3F9CA 1QAOA 2NP6A 3AHCA 2I22A 4TMVA 4LTNA 4RXMA 5K0GA 1DEXA 3X43A 1QORA 5CG1A 2F55A 2WJWA 2E4VA 4JC4A 5AKYA 2OR3A 4EGAA 3MMPA 1W581 1VCHA 4Q03A 5EUMA 3WP0A 2CBGA 4FYKA 4HDCA 4XWKA 5HOEA 4MKGA 2HD4A 1QTQA 4M6WB 4N5HX 1KSJA 4X0EA 4ZOBA 3KV3O 3CWCA 3N8HA 3WGNA 1FW8A 1LJLA 4B87A 1BU8A 5K8TA 2VPYA 2L82A 4CDMA 1LLDA 3DE1X 2X0NA 4JKYA 3CNQS 1V45E 1WQ1R 3MMZA 1LA2A 3PFCA 5BNIA 4R5MA 2X0RA 2LNDA 1G63A 1OAOC 4HADA 3C8ZA 3PNLA 1T26A 4FGWA 4UHBA 2ZTVA 3VR5D 1S02A 2BF7A 1Z17A 2GTIA 2JIZD 2I1VB 2PZEA 2ZSJA 4I66A 4QJIA 3QX8A 2FSVA 4JLPA 4CR8A 4NBKA 4IVPA 4JBHA 1T4CB 4BCDA 3PHIA 4C2TA 3HI6A 1DLIA 5FLXA 1L4KA 2OV6A 2W2QA 4CM8B 3IKJA 1GYQA 1G8FA 3OOWA 1H8EA 1UC4B 5FULA 3GLFB 4DEVA 4CNBA 1Z37A 2FPMA 2D5LA 4UTNA 2GN9A 5HCIA 4UBIA 1CD5A 4FMCF 5EC8A 5C5DA 1NTOA 3MWJA 3FNBA 2G70A 1JQBA 5AVZA 1EGMB 3QLVA 3WL5A 5LQDA 2IYWA 5FO1A 3QX9A 3BJRA 1QRDA 1FDWA 2GEVA 3FGNA 3VISA 5KC9A 3A1TA 4KQXA 3CVXA 4MZDA 3IE0A 3ET5A 3T34A 4G25A 4MGYR 1FX0B 1P3JA 5LZ9A 4XXHA 2Y1FA 1IZ7A 2X2PA 3EFOA 4TQ9A 5I4IA 2BGTA 4E2XA 2EJUA 2EX0A 3KQHA 4M1YA 1P2DA 1OXVA 4JJ8A 4MVWA 1ZGCA 4U9HS 2WD7B 1PJ4A 5KYYA 1QPZA 1ZVVA 4ALMA 1DB3A 4MUIA 2P9GA 4Z7OB 2ZYIA 2IYLD 1E1YA 2ET6A 4RHFA 3JATA 3DMHA 3C48A 2JCBA 3IUYA 4FMDB 3ZBTA 9LDBA 2LKDA 3G2OA 4HL6A 4PRYA 3ZE1B 4TYNA 1YB5A 5EPEA 4F3TA 1MH1A 3AC0A 4MWCA 3KTOA 1R15A 3OE5A 3NOVA 3KKLA 4DBZA 2J0SA 1N1GA 3OM8A 5JDCA 4HH0A 1EPUA 5F1OA 3W7AA 3V8NA 3VR4H 2E0IA 2ZIZA 3RSZA 2QI9F 3ELWA 3T7EA 2OBBA 2YOHA 4CV2A 3LT2A 2JI6A 3PJGA 3VOSA 2WIBA 3GGGA 5ICMA 1NLUA 1RZUA 1NQWA 1SA0B 2D0PB 4FJ1A 3Q5DA 1FTSA 4NAUA 2Q2WA 4QDTA 1E5VA 2YUIA 5JZMA 1J5EB 1PUXA 2NAFA 3LCCA 2OQRA 2GJSA 2PT6A 1Q0ZA 1DO8A 2R6GA 1FQKA 3E9EA 2C5GA 4U7FA 1Y89A 3ABSB 4B75A 3LVFO 1TZJA 5ADWA 4NYJR 4BQQA 3NUQA 2P4UA 1R7RA 4QIHA 3W06A 4PPFA 2P3SA 3DWIA 4R2HA 3MAGA 3CBGA 3KAQA 1IOZA 2DCUA 1QOPB 2PQ0A 3FAKA 3KU1A 2GN1A 5F52A 5KPDA 2UXDB 2ZWMA 1SUSA 3E58A 3W34A 3O83A 2ODTX 3ODGA 2DUJA 5DGDA 3AG5A 2XGSA 1XNJA 1P0IA 1RXCA 2GA8A 3QOWA 1JJFA 3IHKA 4D8VA 4WZAE 5KYXB 2OZVA 1Y6GA 3D4IA 3IQZA 1H2RS 3RKRA 3B2NA 5I47A 3JQGA 1Q22A 1MG5A 2UZIR 3UB4A 3HKDB 1VJ0A 4DY4A 2AI1A 4K9DA 4EHJA 1DCTA 2HBZA 3K5HA 3LYLA 3OY7A 4QX6A 2Q45A 1XJQA 3AKDA 3QUSA 4FW9A 4JT8A 4BN4A 1UKVY 4DCMA 1DJOA 1XPOA 3RG8A 5TIIA 1TLLA 2VPZA 4CHTA 4ZANA 1L7AA 4UM9D 1RJ9B 5L95A 4GKKB 2JLVA 1O6ZA 4EY8A 5G0TA 2Z4RA 4ZEXA 3W5UA 3ENZA 1Z13A 3GPIA 1UDXA 4CKZA 3JXEA 4BQNA 5LQMA 1COWA 1EIZA 4F2GA 1NVWQ 1E20A 1UJ5A 4Q66C 1KR2A 1QH8A 2GKSA 3KYJB 4E51A 5GTDA 2MYUA 5IABA 2GJAA 1KBZA 3N76A 1FY2A 3EGXB 2DT8A 3BJZA 3T9DA 5LMUB 2TYSB 1OPXA 1EDOA 1HDCA 2GD6A 4YAOA 1E3QA 1KC3A 2QLNA 2BHSA 4IV5A 1LPNA 1GZ3A 1O9HA 3G3EA 1HSZA 2GPAA 1YFJA 3AEKB 4LHXA 5KKNB 4PSUA 3O8DA 3BXXA 1VHLA 2V7PA 4PSKA 4QG7A 2D0IA 3OQIA 4MHSA 2QX9A 1KY5A 5JSYA 2R5FA 3VMFA 1U0BB 2P11A 4FE7A 3PQDA 1FDTA 4LY6A 4E5DA 1JI3A 2HC9A 1L0BA 3IUSA 4YEDA 2Y92A 4ZMBA 5FNVB 3BAFA 1R4MA 1SELA 4DQVA 1F38A 4A4DA 4JL8A 4XGKA 4E2ZA 3GGOA 4MB0A 3L7YA 1VKZA 1U2QA 5CYGA 4HTAA 1NN3A 2QRQA 5KTKA 3A1NA 5FBLB 1SQSA 1P5HA 2AOWA 1DIOB 2AE1A 2AXPA 4GBJA 4Q0MA 2XZOA 1U8YA 2R79A 2E55A 3UK7A 2XE8A 3I6BA 1MX5A 3P20A 4IW3B 2W93A 2WTBA 2CXPA 1FF9A 1P39A 2YFYA 4KUEA 2LCFA 2L19A 1AQJA 3PI6A 3ROFA 4WH0A 1TA4A 3N0TA 5H3LA 2JARA 2A4KA 1KTIA 2NPIA 2FPLA 1FLDA 4AG5A 5H82A 2QMEA 3BXZA 1DKUA 2YJNA 3AKYA 3GMSA 3JASB 4G36A 4OEHA 2CFCA 4OIFA 5T5QA 2M6LA 4E4YA 3WLEA 3W1VA 1RE1A 1UT5A 5HKKD 3OOEA 1O94D 3LA8A 1PZMA 3X1ZA 5ITZA 1RHMA 2PY6A 3JQ7A 3LX4A 2ORVA 3UMSA 4INZA 2G9NA 5DN6A 2YQ5A 4EAQA 4MTLA 3BQMB 1O96A 2K2WA 2CB0A 4IV8A 2R8YA 5CUQA 4BMCA 4AFNA 2IELA 1UWCA 4A8TA 4EHAA 4ZT5A 3DEHA 2XWSA 4LF4B 3HBJA 4QXOA 4OQPA 1XE3A 2HPHA 3P97A 1W1UA 4Z4QA 3C0KA 1I0LA 3EH2A 4OGWA 3P9PA 1KWGA 3JW8A 3GJSA 1HLFA 2Q6OA 2WJ3A 2HDHA 4UNNA 1ND5A 5JAIA 2XMZA 2HA4A 1NVXQ 3JRNA 2BFEA 3IILA 4N82A 4Y9SA 3TSWA 5M2QA 2OXCA 2QAJA 1KHTA 4UUQA 1SU6A 4GL2A 4EW3A 4EJSA 2GI4A 2J3DA 2GZHA 4V0QA 5SY4A 1XMOB 5LMNB 1L7QA 2V9CA 4L5CA 3SSNA 4IBOA 3WK8A 1YFLA 1VMIA 4DIFA 2E4AA 2VTEA 4GBED 1PDOA 5MN6A 1I4OA 1O03A 4TSKA 4CT0A 2CFTA 3WGJA 3M6UA 721PA 4JASB 4LTMA 3GZTB 2HDOA 3ZD9A 3HO1A 2Z58A 1DO0A 1B8OA 1DMSA 1N2IA 1ULZA 4UPVA 5K8LA 1TE2A 2IW3A 2QTZA 4TKZA 2FP4B 1IXZA 3R7LA 3OJ0A 2F1JA 1HYQA 3L7LA 1XXHB 4FDVA 2H1OA 2VRBA 3FMGA 1KZYC 2MR6A 3CNHA 3KFVA 5L53A 2V0CA 2BEWA 3HZOA 3A6LA 3UYLA 2GWHA 4DVJA 2PD6A 2WD8A 3QELB 3KLPX 3B89A 4FEEA 3D8HA 3OHMA 4FXOA 1U2GA 3JD3A 1LK0A 1Q12A 3WB0A 3IBYA 3O8QB 1U2ZA 4HX2A 4NEQA 5EJIA 2VHQA 4ZT4A 3LSTA 2JH8A 3B6KA 3SX0A 2BR4A 1VE5A 2Z2YA 2HA2A 3CJTA 3U4AA 3BOSA 3IQDB 4EJFA 4EHFA 4F72A 1Z2AA 3D0QA 1WP9A 2ZQYA 3HKBB 1TEZA 4W9MC 1JXMA 3LAWA 2IEAA 2VA8A 3F0TA 1NP6A 3O1IC 4YB8A 4PZCA 4MWBA 2R11A 1H05A 3GD5A 2LD4A 3O4RA 1E61A 2JAWA 2MT9A 4WIAA 1NOKA 3SQLA 3ROXA 2XE7A 1K27A 3OESA 4NBSA 4PZEA 1WJGA 2NO7A 4B6FA 5JLJA 3IH5A 4RTPA 2QN3A 4B6PA 2O8VA 2XQVA 1M2VB 1S2NA 5HK9A 4QEZA 3NHZA 1QH0A 4B6QA 2GB4A 4BDSA 4P3NA 2ZJ1A 3AR2A 1WB9A 4C7XA 5B7PA 1W59A 3ICVA 3H9CA 1AA6A 2PLNA 4GOKA 1FMTA 4W6ZA 3LD9A 3K6SA 3V7UA 4YO8A 3BCRA 3NC0C 1KO1A 3AHFA 4MINA 5AKJA 3C98A 3LDUA 2Z6QA 1IWOA 4AZSA 2ZDGA 5DK6A 5JJKA 2QZJA 4ABYA 3TW6A 4HQOA 3UAOA 1VJTA 3N2GA 3ONWA 4G26A 1ATIA 2WIFA 3IUNA 3O75A 3TCNA 5ALFA 5HDBB 1G291 2GRAA 2AC2A 2HV9A 3NH9A 4MQLA 4UQOA 2ZE7A 3HGMA 4YECA 4D9NA 4YJ3F 3JAMA 1J8FA 3T0IA 5CA1B 5K0EA 1PEDA 3BCHA 1UMBA 2PVCA 1GUDA 1G5HA 2P0YA 3DA8A 4QXPA 4XARA 5EP1A 4M54A 3VHLB 2HXSA 3VA7A 4ZK2A 1K2VN 3QVOA 1R0SA 3EIHA 4D2IA 4BKPA 1TIBA 1E77A 5FUBA 1W0JD 4HO1X 2ZJAA 4ZVQA 1RRFA 4P58A 2Z98A 4AIRA 9MHTA 4Y2VA 5G1PA 4MUJA 4G1VA 4IRMA 5JH7B 3OM9A 2UZ4A 3H4TA 5DBHX 3NQ41 1DC8A 1XB2A 2ETVA 1X77A 2E4ZA 2V96A 4CKEA 5LQKA 3LO8A 2VG8A 4OB8A 5JCPA 1YZUA 2A7XA 2JGJA 4WLVA 5KTOA 2D2EA 5H5JA 1M2NA 1PR6A 2YZGA 4M0LA 4MI1A 4OI2A 1GKUB 1NXVA 3AFOA 3QUAA 4H4EA 3Q8WA 6GPBA 3PFGA 1PEYA 3ECCA 3PC2A 3LX8A 1D04A 4J0QA 4MB2A 1RAHA 1T3TA 1ZCAA 2IC5A 2DT5A 3N8IA 3QVGB 4CV0A 4EB6B 5CLGA 3AVXA 3OZCA 4AO8A 5B1SA 3V8VA 2VHJA 2O0LA 3MLEA 3PHLA 5BSMA 4D42A 2D3WA 4IICA 4LSWA 1OU4A 3D6JA 2BN4A 4PR0A 4J6EA 1ZJ5A 1MRZA 1Z7EA 2DPGA 2TMYA 4C4PA 3PD0A 1AJEA 2XQFA 1VB5A 3MT9A 4HK4A 4EYOA 3ZJUA 8OHMA 2ZIGA 5KJ1A 1JLRA 4MV9A 4CQMD 2ODBA 4XX0A 3DZCA 2HMYB 5G3ZA 1LLUA 4I8IA 4HR7A 4DM4A 1OFVA 2W2NA 4XYMA 1LEHA 1X74A 2XQJA 4FCVA 2QRVB 4HVAA 3WAGA 4DV2B 4I5GA 4QVKA 3I42A 4IH1A 4NNJA 2HU8A 4MQFA 2R65A 4L3WA 3NKFA 3S70A 3ZW9A 3WLLA 5GM2A 1VBNA 2WIJA 5IMSA 1EFVB 1YR6A 3D31A 4ATNA 1JG4A 2NXJA 5E1BA 4O2BB 2QN8A 1CEQA 1YZFA 2A86A 4UNIA 5KAMA 3T0FA 1UBGA 4DQUA 1YL5A 4NMHA 4EUSA 1QCCA 1JFRA 3ZY4A 5DNUA 1YQQA 1V1RB 3E6AA 4XQGA 3T5GA 2F3TA 1DAGA 2PD4A 3IO3A 4K2HA 1H22A 1QIEA 4JU8A 1EP9A 3CX8A 3HB4X 3EODA 1KMCA 3ND9A 4UZFA 5HVNA 2DFVA 1Q0QA 1Y8AA 1ICEA 2Q6IA 4URWR 1YJAA 4C6TA 4CV3A 1RAEA 4E31A 1UAGA 8ADHA 1FYVA 1SWWA 5FA6A 4XVCA 1M6WA 3VR6H 2DLNA 3JU3A 3M34A 2A0UA 4PU0A 4HNVA 4NCHA 3DZFA 3JQAA 1L4YA 1RYFA 1ZU4A 4XIJA 1GRRA 4BO7A 4PLVA 2O14A 3T7DA 1LWNA 3I1IA 1P81A 2CBXA 3U39A 3NIBA 2I6SA 4MVJF 5LZ5A 1QP4A 3KJFA 1E5DA 2MJLA 3KZCA 1P91A 4I4LA 2FJPA 1TM5E 1LVUA 4J2HA 4Q34A 5FF9A 3U7GA 4QBFA 2WT9A 2EOAA 4N5IX 5D7BA 3GUUA 3OX1A 2EL7A 2PSEA 3HR7A 3D3NA 3M6WA 4FOLA 5I51A 3KKZA 1BXRB 1EWVA 1IE3A 2CXSA 2YJ4A 3O3NB 1L5LA 2A58A 1SXIA 3G8BA 5KWIA 4C2AA 2FOLA 1V6CA 4ZAGA 2IY7A 3FLAA 1TAQA 1BRTA 1TEXA 4NR0A 4BFVA 4I7EA 4P38A 4OUKX 1PZHA 2ZIXA 2ATVA 1H23A 2OK8A 3I0NA 1Q11A 3PB3A 1ZLXA 4DRZA 2NQ8A 2KYRA 5FCDA 1QWOA 1R50A 4G1BA 4N3AA 3D4BA 1HX7A 2B4TO 1PS9A 1XTRA 5KWJA 3L49A 3KSDO 3L7BA 1TZ2A 3OHPA 2J0QA 1LH0A 4GM1A 3P4XA 4KXWA 2XMGA 4ZI5A 1R0KA 4JGBA 5DLPA 5U4XA 2IPNA 3SJUA 1GVHA 4G1EB 4GMKA 3HKEA 4MEAA 1C4WA 5BY2A 4F06A 3NI2A 1QIFA 2AQHA 1US8A 2GRUA 1Z28A 3DE4X 4GSLA 1JNYA 4KW7A 5FEMA 4XR9A 3K9QO 1CQJB 3RSFA 3W77A 4A82A 2WSSD 4TTRA 1GDTA 3BKXA 5TQ0A 3SYTA 4DTIA 1Z9BA 2X77A 2GM3A 3VR3D 1L7BA 4D44A 1UM9A 3QMVA 5HQTA 5E2BA 1OFTA 2WT4A 2HCJB 4NATA 5A9TA 1C3OB 1D6NA 1I2MA 1Q1BA 2QM3A 1ONPA 3JQFA 4B3RB 4PAWA 4WX2B 2FCRA 1WXQA 2RAPA 3BKWA 2P2SA 1YC2A 2EGGA 2GDZA 1JXQA 3W7VA 3OEHA 3GA5A 4KLNA 3ZZTA 3R6LA 4JQCA 3EPRA 5AK5A 3TLCA 4R0MA 3UJ9A 2YV1A 3NIDB 3ZJ5A 3AH8A 3K31A 4YRSA 1WV0A 1KDOA 5JATA 1YJQA 3HUUA 4XJXA 1ESDA 4D57A 5L3SA 3H2BA 5KMGA 3PJFA 1S1MA 3VC1A 1F51E 3OQVA 4PCAA 4OLBA 1WDLA 1T9HA 4HYEA 1WTAA 2HXGA 4GECA 3ZKWA 3WYGA 1DCMA 1GDDA 4GXNA 4U8GA 4UBOA 5AHRA 5F1KA 2EIHA 1TVKA 2DUNA 4TS1A 3PI7A 4RF5A 4U9IS 1KJZA 3BRWA 3MRVA 1SUDA 2O8FA 2Y1LA 2BFFB 3FIUA 1KL7A 3DHYA 2OTCA 3WLIA 3SZLA 1Y98A 3F9IA 1BW9B 1ENYA 2QPAA 4EGCB 4KQMA 3OCWA 1HFJA 4EENA 2NZJA 1BKDR 1ST2A 1KY3A 1QZTA 1VJ1A 1T8TA 3TIVA 3O1HB 1IN6A 1FFAA 3ND7A 3PKZA 3GGCA 4NJEB 5DNWA 1O94C 4D0NA 1XC7A 5K3FB 2BAGA 2I76A 3S5UA 4HLUA 3REQA 4ZVPA 5TEWA 1MVLA 3IODA 4G2TA 1Z5WA 1OHHA 1KTVA 1VBMA 2REXB 3VR4D 1BOOA 5KNLA 1X2EA 1K9SA 1JIXA 1JSLA 4RV5A 3SQOA 2IF2A 3N39C 1YS9A 4XM2A 2C8VA 3P9RA 2PZFA 1T6BY 2J3EA 1R18A 3HR4A 4XGQA 3ZV5A 1XMJA 2C58A 1HL7A 2Z1NA 3ACDA 1AF7A 3OEED 4NV0A 1VXOA 3HSSA 1Z16A 3K0BA 5DBEX 2AE2A 4XB6B 3QEMA 1NVMB 4JSRA 1KYWA 4LDNA 2QRGA 3CIOA 2H59A 4M8NE 2ZWIA 5JUWA 1GITA 1NWHA 1G3QA 2HLDA 2ZEJA 3RG2A 2WSLA 4GT1A 5SYNA 3L1IA 5AVYA 2IS6A 2VEOA 4OQNA 1I6LA 1LF0A 3TO5A 1E1CA 1TM7E 4CKWB 4DDKA 2OE2A 5K3OA 2YX1A 2X5NA 1N34B 1O0BA 1JSZA 2WJHA 1GCUA 1WMAA 3OEWA 1L9XA 3W9SA 1DWOA 4UBJA 3U4QB 1BWRA 3F5SA 3I8OA 1L8OA 2N3ZA 4IIHA 4C2UA 3CQ9A 4ZK6A 3UT0A 3D0RA 5JSFA 1R3UA 3DAYA 3PX3A 4PZPA 1JHRA 2DSTA 4F8JA 3N8GA 2PH7A 4AMYA 4D9GA 4F12A 3EGEA 4H35A 4BV2A 4KTVE 4Y9UA 1DRVA 3ROKA 2DR0A 4KPUA 2QSUA 3OZGA 2CSXA 2BI8A 1D2NA 3HJBA 3KQSA 1ODKA 4M8SA 2DWQA 2AR9A 2EAUA 2JGEA 4JP1A 4MUNA 1WB4A 4RYDA 4DPKA 1RAIA 3R75A 1YIAA 3VO8A 4F9FA 4JLVA 4OMUA 1PWEA 3V00A 4U2BA 1H5NA 3VNRA 4MIEA 5EZYA 1XCGB 3ZQJA 4F3YA 5EJ9A 2PMDA 3DTYA 4TXHA 3NDBB 1T4MA 1PV2A 3DHWC 2GSDA 4BLPA 5HW0A 2KLHA 4XCQA 3AP2A 3HPRA 1OW3B 4Y2JA 4R83A 4DA9A 2VTBA 2FJ0A 3I1YA 4YJ2A 2XOKD 1QZUA 1TYBE 3LPNA 2PBRA 3RW9A 1HOTA 2FK7A 1YB6A 2PMKA 2VZLA 5D5HA 1P4JA 4TWAA 5CJJA 4AD8A 5CBPA 2G5GX 3Q2IA 3T3OA 2GXQA 3I9MA 2C5HA 3QHPA 3RVMA 1JSCA 3BSSA 5CEJA 4YT5A 5FB3A 3KTAB 3C1TA 4MUKA 2HF7A 4ZFNA 1E8DA 1JKFA 1RHUA 3KXIA 5C8YB 3OZXA 8MHTA 5F2EA 1RC1A 1L4EA 1NMZA 5I01A 4W5WA 2W7TA 4OO3A 4S24A 5J40A 4Z1MD 5JT1A 1MB0A 1CHDA 1DNPA 1S2GA 5JBNA 2WJZB 1NBHA 3D43A 1XT6A 5LOVB 4Q37A 1H3FA 4NZPA 1XPRA 1ZS9A 4QUIA 1MNQA 1J9ZA 5DULA 3V2HA 3D8RA 4NYMQ 2NTJA 5BN4B 4ZJZA 3KEFA 1UPAA 3HLTA 1XLVA 2GS9A 2MYNA 1C9DB 1TQHA 2AB0A 3CJRA 3B3JA 1U8CB 2BZ0A 1Q0LA 4WERA 4JCCA 1VYHA 3DXXA 2H4FA 2A7QA 3DTVA 1QQ7A 4EG5A 2AT1A 2VRNA 3BXEA 1E1QD 1WM1A 2P4QA 3FDFA 4ZDKA 4XM0A 2QD2A 5IP5A 5HUJA 1PR1A 5M29A 1TL7C 1C1DB 1NYQA 5DP1A 1LQUA 1KKLA 2ZRPA 1JJVA 1U5BA 3ZNPA 5FH9A 5JD6A 3PJRA 4GW3A 4ENUA 2YCLA 2GZAA 3TRHA 4UZEA 7YASA 3QNMA 1SC6A 3TUJC 1ZJYA 2C9MA 5FI5A 2WPNA 4KAJA 4W5OA 2YWCA 1CUEA 4BL5A 5TXGA 5IVHA 3EARA 1KXJA 4MS4A 1IAQA 3GUZA 4HZUB 3AY7A 3GWZA 3CZ9A 3ITNA 2BGGA 2Q5OA 2XWJI 2NUAA 2R0QC 1CQWA 1CPYA 3NJ4A 4EG3A 4FS8A 2QVXX 2P1DA 3GROA 1V9SA 4FEGA 4KBFA 5CH5A 4HAUA 1T13A 2FZWA 1OYVA 3VDQA 3HS3A 3GN1A 1VYUA 5TC4A 2ZAIA 4YI3A 3ZNQA 4L8VA 5BW4A 5KNBA 3LJKA 5T8KA 1CVRA 3KG2A 4F4UA 4PS1A 1Z25A 4NL4H 4WTOA 4EG7A 1TKBA 4ZYVA 5B2EA 1WOYA 2NQTA 2OVFA 4KWHA 3RAJA 1ILEA 2ZUDA 3COJA 4AY6A 3IEXA 4PZUA 5FX2A 4FP9A 5F2OA 2X9LA 2B9VA 2IDZA 3BL6A 3DZGA 3PUHA 3CMCO 4ARCA 3VNVA 4GFDA 1RQXA 1E3IA 1J99A 1NX6A 2QZ4A 5JYEA 1IY1A 2BSXA 2CDNA 3A9VA 1U8XX 2I7VA 3R0JA 5JCOA 3KCNA 3ML1A 2E21A 2IZ6A 2FN8A 3JYHA 4B4KA 2IQ5A 4NOKA 5FV7A 2PBLA 1FTQA 2GYYA 5E6SA 1CR1A 5G40A 4L85A 1KGSA 1PJ8A 2V8OA 2VDVE 5CRIA 1RPNA 3NVDA 2JG3A 4YVFA 3LECA 4O4JB 1OR8A 2FDRA 1TK3A 1FPMA 3CT6A 2L69A 3OPVA 4B84A 4RZIA 3H87A 1K7FB 3UMRA 1SN7A 2V0NA 1D0VA 3BHJA 5L40A 3R3WA 1W5FA 4C6RA 1N57A 1II9A 4H1TA 1TQ8A 2H1IA 2JJ1A 3WO1A 1JW9B 2Q2OA 4LZAA 3CU5A 5EGNA 4NICA 5FP0A 5I9MA 3K0FB 3U44B 4FDUA 5KYUA 2VPXA 4AK9A 3DZBA 4B73A 2ZCUA 1RBYA 1TUGA 5FKJA 2EJCA 3NEPX 4OGGA 2DQYA 1AUVA 1X92A 4MPPA 2ZR9A 3YASA 3TB6A 5AIAA 2WJJA 3EIEA 3TQOA 1J56A 3W6PA 1N9ZA 2CNKA 2VJKA 4LGYA 3W6ZA 3WMRA 4ZDJA 2OFXA 1AKWA 1TF7A 2XD9A 4L51A 4S1WA 4ENPA 4MKRA 4I50A 4O1MA 4QREA 1OROA 3FR7A 3PPWA 4UTZA 2AQ8A 3LV8A 4UBMA 1WIWA 3RFVA 3RWMB 5ALIA 1D4FA 3E9RA 2X0FA 2MIIA 3RVQA 1NMQA 3FOCA 4JHLA 5IANA 4NU8X 3N8KA 3QLUA 4WVLA 3SEFA 3EY9A 5IVPA 4ED9A 5AKIA 4OAPA 2AQKA 4IWYA 1P3DA 1MC5A 2IXBA 1AGNA 1JU9A 1NQXA 1JB9A 2B78A 1P1JA 1SBTA 2H9IA 3O2SB 2C78A 4WNAB 4UOEA 4CM5A 1ZIPA 1IZZA 2H4HA 1VPLA 4MQEB 5B58C 4LRYA 3PYXA 4UULA 1W44A 3QBTA 2YH2A 4WE3A 1QR2A 3G13A 4EGQA 3ZGXA 3MB5A 3NPMA 5IKMA 1U2DA 3EXHB 3NASA 3SEQA 4AXBA 1KI8A 2XGOA 2N1BA 1IEVA 4MR7B 1MCZA 3BMQA 4WI1A 4QFBA 3EPLA 1FLNA 3CKYA 4WBNB 3E27A 5FNVF 1U6KA 2R62A 4L4RA 5CVEA 4H7PA 1Q2UA 2INGX 2Q4DA 2OO7A 3AWDA 3B3FA 4LHYA 1JR3A 3NM6B 4Q1AA 2B1RA 3OJFA 2J4CA 4K9SA 2PS3A 4BLVA 1CV2A 1UPUA 2B1IA 1HYEA 2D5IA 1ECCA 2NX2A 2W37A 2RHCA 3NBMA 4XUEA 3IAM6 4TUYA 5EYPA 2A3RA 5K0ZA 5IXYA 1X8LA 2V9ZA 2X4IA 5LWQA 2JLYA 1DJQA 4JLKA 1GZUA 3SPXA 3H65A 3QKTA 4R7ZA 1M1ZA 1T5LA 1X0XA 4LBVA 1XDWA 3SNKA 1G3RA 5EIBD 3SSOA 2VHCA 4D97A 1WZ2A 4L27A 2X14A 4QU0A 3TRDA 1T6ZA 4OYHA 2JFOA 1XBTA 1XWFA 2IIBA 1NNUA 2OZLA 4MNTA 5HKOA 4DJDC 4UKDA 1LSJA 1IH8A 1TF2A 5HPYB 5JXGA 5LJIA 3RSLA 2WZDA 1IC6A 4D6YA 3AJ9A 621PA 3TAXA 2QX8A 3K32A 4BNDA 1ADFA 2W8BB 1DOAA 3I2KA 3IALA 5I4BA 2JFXA 3PWSA 2GHQA 4KOAA 4D5EA 1QAMA 1G5TA 3H86A 4I4TF 4D4IA 3KXPA 5BN1A 1KI2A 4MULA 1IUKA 3DO8A 1DKQA 5LB4A 2WWVD 4WZ6A 1RTKA 3Q2KA 2G72A 4IYRA 2PX0A 5CTAA 4WNCA 1TW2A 4GPD1 5T3UA 2BUCA 1ZOLA 2CVHA 5AHXA 1TB4A 4YH1A 2WVHA 4FX2A 4DCSA 4X63A 1Z2CA 2Q9AA 3L02A 2BR3A 2P2LA 3E4DA 4PAGA 4PIMA 4QBGB 3F5DA 3CRW1 4ZAVA 3ZWWA 2J3IA 1DJLA 2C54A 1IMOA 3FZGA 2AI3A 4FNOA 4KIJA 5TMDA 2IZZA 4K6KA 3TE6A 5AFSA 5K3DA 3JVEA 4WOJA 1OGIA 1Q6ZA 4OOEA 3HXTA 1W5EA 3L0CA 3LQRA 3ROQA 3FPCA 3PPVA 1F4VA 3DZ8A 4ZRNA 5FBHA 5F2NA 4NULA 2I7TA 2O1EA 1K9VF 2ISQA 3ME5A 4OK3A 5H83A 5J2UA 4U6QA 1J8YF 2IYNA 5ITSA 5LQNA 2W0SA 1X7ZB 4HX5A 3WLSA 4BGDA 1ONNA 2OSVA 2WF9A 4LZJA 2YXDA 2YNMA 4Q48A 2FUNB 3CW9A 2H2HA 3UPUA 1G20A 4IWNA 3R3JA 1CY4A 1GA4A 2QL9A 1CG6A 4JAVC 4RFVA 3OPQA 4S1PA 3K6JA 1XYVA 2JJMA 3C74A 3DVAA 4BP8A 3JSAA 5AKEA 5JS8A 1U02A 2X7HA 1P3Y1 2D2VA 3WYEA 1FQOA 4CF3A 1F0YA 4E32A 2IPLA 2KM1A 2R4TA 2B61A 2O8EB 1NXWA 2P9ZA 1O8BA 1WUKS 1T1IA 4GI7A 2L0XA 4LRTB 4OLHA 1OLUB 4UQPA 2K4MA 4RFSA 1V3VA 5ALDA 3WLHA 4OU4A 3WK4A 4WESA 2YW9A 3RS2A 5K1ZA 5LA6B 3OE4A 4IUYA 1E2EA 1GKIA 3FYUA 3GLVA 5HXAA 3GYGA 3AVUA 3TD2A 3OO1A 3OSZA 4UUAA 5JI2E 3INYA 4KUGA 1ZD4A 4HQFA 2YWXA 3A36A 2AZTA 4URZR 2O1SA 4BO4A 4BVBA 5BN5A 3U19A 1R4ZA 4TLLB 5F4ZA 3KUDA 2FN7A 4JROA 1GVNB 4ZYLA 3MGCA 1DUVG 1REQB 3LVBA 1IEWA 4GX0A 3QPCA 5UKDA 4BO5A 3W5CA 3OH8A 2UUCB 1HTTA 2O4UX 4AU1A 1FFBA 3BZBA 1YZVA 1Z73A 1XP5A 3AVTA 2ONKA 5BYBA 3C1AA 4LZZA 3U3ZA 1EA7A 3EOBI 3LS2A 2CLMB 4CM3A 1YC5A 2BHTA 2NVUB 3LIIA 3UMMA 2YMQA 4E88A 3H04A 1ZUNA 2BFMA 1MU0A 2WJ6A 3GCWA 3PC8A 3NONA 1FTNA 4OL0A 4IDFA 4RLFA 4EHNA 3TR6A 4DUYB 2X23A 3GLHA 3R40A 1HC7A 1VLVA 5DWDA 2ZBPA 4UXIA 4ND5A 4IYJA 4M4SA 2PBZA 4MKFA 3IPAA 2CHFA 4L76A 3ZUGA 3ZLUA 2ZBUA 5FLYA 1TADA 2OQ2A 1TKAA 3EXFA 1OT5A 3PXDA 4YLGA 4RYLA 2ZJFA 1ZH6A 3K0CC 5HILA 1MD9A 1VIVA 3FDJA 1R8XA 4MDHA 2D1TA 3RAPR 4ECAA 5LD2C 5H70A 1FBNA 5CA1F 4MS1B 1FFCA 5LIRA 2V74B 3CE9A 2FB9A 1EG2A 1VMKA 2WUVA 3SLRA 3GLQA 2H1CA 4RTKA 1JJAA 1POWA 1ZD2P 1LVGA 1O5TA 2O2DA 2KQUA 3NANA 4KQ2A 4OSOA 3ZNNA 3L4JA 2FE1A 1TI7A 1C2TA 2WEKA 3U80A 5EIXA 1XSEA 3C6MA 1RAAA 3FG9A 4RMNA 1U9IC 2ZRJA 3OD5A 2ECOA 4QDZA 3VSCA 2AXEA 3JQ9C 4KO1S 3UJ3X 4DLAA 3RODA 2HRQA 4BWGA 5JH7F 5BWMA 1E60A 5K51A 4AS3A 2W6ID 5HKBA 1SIWA 4Q7QA 2Q8PA 4QXAA 3DV0B 5IKPA 1C7EA 4DRYA 4OA8A 5FWNA 3SI7A 4LCEA 1U7PA 3FKQA 2NO1A 3WNVA 3BPSA 4F92B 2MYPA 3KDAA 3MWKA 5CW1A 5ALLA 3R8FA 3IQGX 2BTQB 2GR9A 3KPUA 4YASA 3EIOA 5ICSA 3OKPA 4AIIA 1H5UA 3DF7A 1YASA 3LUAA 1J90A 2I7XA 2YJ5A 4L74A 4LY0A 4ZAWA 4P3PA 5SICE 1P62B 3T8YA 4YRMA 3H5IA 1KI9A 1DXHA 3FCUB 2X0DA 1PFUA 3NYQA 3RRNA 3OPYA 3ZY5A 5B3LA 3OFNA 4LZNA 4N6NA 1QP0A 1XP8A 4LZWA 4LMAA 3IT2A 5TB5A 1SO8A 4FCTA 2QP9X 3COWA 2JFBA 3GZJA 3L3BA 4PFJA 5FFFA 2GPJA 5B3AA 4CVNA 4DLKA 5C32A 1W5AA 1WXXA 2I03A 3HJRA 3A9CA 3H9QA 3RR2A 3W5VA 3D6AA 3UFXA 5C52B 1JDJA 4LV5B 1WCIB 1NVAA 3T7RA 5L4NA 1V9LA 1PYOA 5TE9A 1UZAA 2W2KB 2WRZA 1JQDA 1XZJA 3FPSA 1PVVA 3BXGA 3ZHSA 1OX4A 4HFMA 2W4IA 2X9NA 3G23A 1VFPA 1VCNA 3D8SA 1D4AA 2C97A 4PC3A 1X0VA 1UBJS 2HSEA 3PE3A 2WJPA 4UE6A 3L5KA 4JX8A 5B1DA 3HDJA 4NC9A 4IZOA 5JXWA 2VAVA 2B8NA 1TGYA 4O2BF 3W8FA 4X64B 3OQ1A 2HB6A 1P7YA 2WFLB 1W2WB 4RF2A 3V7NA 4DWVA 1K8RA 3GRAA 3GLKA 1II0A 1KU6A 1UFVA 1A76A 3A6HA 3ESQA 3L8HA 4QDOA 5CEEA 1WSAA 5AO9A 3NEYA 1WO8A 5JVDA 3HVJA 2OY0A 1Z88A 4HSGA 4QUBA 2GEJA 1CBUA 1XVAA 5KAPA 3RQIA 4MUEA 1Z0UA 3GMIA 1JPVA 1NNEA 3WK6A 2VK2A 5DNDA 4W8GA 1BFDA 3TLKA 4CMEC 2AFIB 1CJVC 1J33A 4DSOA 2JH9A 2C0QA 1K6MA 3AL2A 2H8KA 1Q74A 3G5MA 3OU2A 3G8YA 4LRXA 1E66A 2SECE 3KQMA 1VA5A 3KUKA 5E6RA 1GA6A 1A77A 2J6IA 4F0JA 1PBTA 3EF3A 1LV8A 2D0DA 3BWEA 3GGSA 4M98A 4F3RA 5BNZA 3EBOA 1YUBA 3DUFB 4ID9A 1ZCZA 1X7WA 1A2QA 1FP4B 1EFRD 4U7TB 3UUFA 1YSCA 5BURA 4CCSA 1GD1O 2CBZA 3MOGA 1VXRA 1RABA 4JUDX 1ORWA 4DY6A 4AUMA 1P2UA 2VHXA 4JDUA 3A8TA 5J5VA 3TX6A 1IMJA 3DC2A 5CB4F 1OIWA 1NMSA 3KZOA 4HQKA 1GGMA 5FAXA 1O9BA 1RM3A 1HQDA 2EP8A 4P98A 1OBOA 3ESYA 3JWPA 1XWWA 3VTAA 1QH9A 2DWUA 3BMCB 3PC7A 1AUOA 3ESZA 5KVQA 1Y7IA 2V7VA 3ZU6A 2OYRA 4TVSA 1N3LA 2PMBA 3WYFA 2VDUE 1T3LA 5JAOA 3NHKA 2HYDA 1IHYA 2BDEA 4GI1A 3I23A 3BMNB 5JDIA 1CP3A 1NKVA 3HGTA 2HSZA 3LQ2A 4MSUA 3E3MA 1T5DX 2C1XA 3ET4A 4EUHA 2Q3DA 4F4HA 2O7VA 1Q0PA 4JK3A 5KB3A 4OHXA 2QUKA 4EVSA 4C0QC 3FPFA 2PTHA 2WNSA 2XNJA 5LNK6 4MPRA 3PC4A 4Y2SA 4UXHA 4A6XA 4GRAA 4L3VA 3A6ZA 1M6VB 1NKSA 1W75A 1CJCA 1A9QA 2QM7A 4IQ0A 4PPGA 1QX4A 2GHTA 2OL4A 2XRZA 2IBTA 3A6GA 4RELA 3NHUA 2GBFA 2PUHA 3QKRB 1SB9A 5DHUA 1D2RA 2CXNA 1RRGA 3PBKA 2DJIA 1RHRA 2Q27A 1UAYA 5F7ZA 3RPEA 4EMUA 1EESA 2AS0A 2F3RA 3WI7A 1EAMA 3C3YA 1D8AA 2WABA 3TLYA 4C87A 5GWXA 5IM5A 2PMWB 1QZXA 3MN1A 3F1KA 4Q3AA 2JAHA 1WCXA 2IZ5A 2JHCA 1ZA1A 3HRIA 3K2BA 4PGHA 3W9UA 2E5WA 2R48A 3ANMA 2DHDA 8ATCA 5DMHA 5TSDA 3H2KA 1ZCFA 1ZR4A 3PXEA 2DAPA 2VP9A 1W4AA 3BWXA 4IDGA 4WMLA 4QOJA 1RM0A 1YCFA 4HDNB 1UDAA 4I4NA 1TVEA 4WEOA 4YGXB 4P3OA 5I9TA 2IYFA 2Y3IA 1IRIA 1DX4A 3T9BA 3B70A 3M3HA 1PEAA 2R6CA 3V5NA 1OZGA 4N0PA 4PX2A 1V37A 3DYBA 3G2JA 4GUDA 4G0QA 4LV6A 5EIBC 5BV7A 5JFTA 2OXEA 4Y0NA 2WSYB 2A0XA 1KDPA 4ZOEA 3AUXA 2XQGA 1QRUA 4KO4S 1GRQA 1E7MA 1Y8QA 1JT2A 3DDNA 1P7WA 2JGDB 2VPTA 4K86A 2WBLC 1ZIXA 1U04A 1V48A 4HJRA 4F5EA 4CPDA 1ETUA 3EJWA 3I76A 3OJLA 1JQ5A 1NV9A 4NDNE 4O59O 3O03A 5HS6A 8ABPA 4G1CA 2PFSA 4U39A 2QJTA 4MCIA 3KYDA 2FXIA 4IG4A 1AB6A 2NUPA 3PD1A 2J32A 3HUFA 4WJKB 4YCNA 2M2IA 1X15A 3OBBA 1YNSA 2O3RA 1ODTC 2GZ2A 2JBWA 2VH5R 3H9JA 3LSYA 3PXBA 5BMVF 3A6KA 3G2KA 4R6XA 2VYQA 5AD1A 1CUAA 3KPWA 5DHAA 2RKBA 4OB7A 1O1YA 1SUIA 1TT5B 2Q3JA 2VWPA 1KMIY 2ZGVA 3BUSA 1OZ0A 3RC7A 4NPHA 4ZI7A 3E7XA 3EIXA 1VRCA 3BJMA 4FYJA 3UKOA 3WNCA 4G5YA 4KEAA 1YZLA 1EB9A 3U7QB 1T0BA 2OO5A 1IZYA 3O8LA 4ZKEA 1ZD9A 4GC9A 2A3NA 3HJAA 3K1ZA 3M4ZA 4CJXA 3UMJA 5AW3A 1CJSA 1QOQB 4QGFA 1OGJA 5CFPA 2WUFA 3B6EA 1HY3A 3O73A 3VOBA 2EP7A 1G7SA 2VPPA 4GLOA 1AV6A 1RRKA 5CD9A 1NM5A 3G2QA 2AOVA 4D4HA 3MCAA 1YJBA 1UCFA 3OT4A 1N25A 2QM8A 3KVYA 3O7MA 3A2LA 4FW8A 1KZ6A 2P91A 2YV2A 4TQAA 5J23A 1E8NA 4D46A 2IV7A 1WV1A 2GZDA 3FSGD 5FHQA 3TQFA 2ZP1A 3FFAA 1JLHA 4OUDA 1CUWA 2XW6A 4Q7JB 4EW1A 2I7CA 4ENVA 2O7NA 4TYMA 3LKBA 3ZI7A 4J3NA 1O8CA 4LYEA 3OQOA 1VG8A 5FFMA 1GZHB 2A0YA 1QIMA 3DTTA 3TRFA 4D82A 5JI3E 1P2BA 1GSIA 5THQA 2AHOA 2WAMA 2RGCA 1LV7A 1MX1A 2R47A 1F48A 2DSNA 2B69A 4JJFA 4KWCA 5EG5A 1V2HE 4K26A 1QH8B 4I1YA 1VLLA 1HTWA 1W49A 4ITUA 4EOGA 4G23A 4RTJA 4Q00A 1QX3A 2ZRKA 1XD8A 3G9ZA 1O89A 2K87A 2R8XA 2XAAA 3HADA 1O95C 5CVJA 5DOZA 4BBPA 7REQB 1NI3A 1MABA 1EBBA 1JB1A 1K75A 3K1JA 5BXQC 2PUFA 2AN3A 3AOEA 3M1YA 5FTMA 3EIWA 5FQOA 1YR2A 2V03A 2OILA 3DFZA 4CV1A 1LDYA 1DUIA 1GGHA 1K7XB 1WTCA 3H8VA 4X65B 5G2OA 1U9JA 3QGMA 3L7OA 4JVNA 1DPFA 1Z8NA 3B5JA 4LHEA 2JD2A 1U0GA 4LI3X 3DHVA 1SB8A 5C8YF 3DW3X 3T95A 1HFEL 2OP0A 4XA8A 1E2DA 3HL0A 3WXMA 3MUNA 1F14A 3IP6A 1T36B 4GZ5A 4D7AA 1ZA2A 3QP9A 3OF3A 4ESOA 3SQXA 2NXCA 2HGZA 2O3SA 4GOXA 1UPTA 4N18A 4LDRA 5D85A 5HCUA 3V3KA 4IZHA 3ZXUB 3L6RA 4IRUB 1LPMA 1U4NA 4KMMA 4M83A 5B3JA 4Z53A 3PEYA 3S2IA 2I65A 4H1WA 1C30A 3TK1A 3WQHA 4BNWA 4EHKA 2FFQA 2VT7A 5F7XA 2XNDD 4RKYA 3KPJA 3U5TA 4O25A 2B1JA 1FL9A 3RVSA 2CYBA 3DZDA 3T38A 1JFLA 2BCGY 5AJXA 1XTIA 4L2IA 4H1HA 4G0MA 3R0ZA 1O87A 1XPJA 1ORVA 2TSYB 3FN4A 1X8XA 2H7YA 4FT4A 3E1KA 4RMGA 1NV8A 2RGGA 1G19A 2NWQA 3KQQA 3PEUA 3GBSA 1PFKA 2FPPA 2YZ7A 4B0PA 2FDXA 5E3JA 1RIIA 3O9VA 2CVFA 3TNFA 3HB7A 4P4GA 3UW3A 2VR1A 4D3YA 1H8ED 1LRKA 1YV9A 3PA8A 1FA9A 1NUPA 1HE2A 3BK2A 4TQGA 2FG6C 1WL8A 2D1QA 3QEJA 2Y93A 3OZAA 2XDAA 5DGHA 4BQIA 2WWGA 3GR6A 3NCTA 4OLJA 3RRMA 2R25B 3HCAA 4WBSA 2QTGA 5KU1A 4ZOLB 1E1DA 1OAAA 3DKPA 2ZJZA 4JI0B 3D8BA 3EGWA 4HGPA 2EERA 4NJOA 4RD2A 5BVGA 4KQFA 2PS1A 4OJNA 1T9AA 4MWGA 1CNEA 3UHJA 2P62A 1OE0A 1OPRA 4Q3CA 4YMGA 1GV0A 2AJBA 4JGGA 1D5CA 1O6CA 1P44A 1WAMA 1X19A 3L40A 1DX9A 1W87A 4M1OA 4EF4A 4NLLA 3QXJA 3ZJ4A 4PCLA 5KJCA 1AKRA 1KC1A 1NW9B 1D07A 1FYDA 1DQNA 1T25A 1R9GA 3HYNA 3R5FA 4LPKA 5GJVC 4DV1B 4B3CA 1IDOA 3FCYA 2QVZX 4CQLB 2WJIA 2I78A 4IQ4A 4JVSB 1FSZA 4PBRA 5BYAA 4JXJA 5EKSA 3CRRA 4AX4A 2BISA 4PG8A 2XVXA 2LP4Y 2Q5LA 4OFWA 4PZ9A 4AY5A 1P9LA 4ZC8A 1Z36A 2UZ0A 1U5CA 1QB7A 4O4JF 4X5OA 4DXHA 3CSUA 2QY9A 2RGRA 2ADOA 2BE9A 4BB5A 1WETA 2ZT8A 1SCIA 3IAAA 2EHJA 2X13A 3ISTA 4C06A 1Y33E 3ZIAA 3A05A 2P68A 2ZR8A 5IS2A 2JI7A 4IJUA 2K5UA 5FBRB 2WUDA 1N4AA 2PUDA 4DE5A 4RVNA 4WCFB 3SHVA 4DIKA 1L1FA 3C8MA 3B52X 3F1LA 2WWWA 3F2IA 3G5LA 2FWIA 4LOJA 4XUDA 3DWFA 1BE6A 1XZCA 2XF8A 3CLSD 3ZWAA 5CB0A 1GADO 3EXIB 4DLTA 3PXAA 1OY1A 2NYUA 1L4FA 1XDGA 4DIEA 3HDTA 2PR7A 1HXHA 4YCSA 5LQUA 3CXUA 4XQ9A 4YCMA 2HZ7A 2W2MA 3DEZA 4YXWA 2PFKA 3DCNA 1C2YA 2OXFA 1C9KA 4YJGB 3TQIA 4K81B 2UYHA 4R2KA 1Z0DA 4HYTA 2Y99A 1X9HA 4ROSA 3V4PB 1AGPA 1RWXA 2JLRA 3I9V6 3QVKA 5T4EA 3B2QA 4EYGA 5JG7A 1U6IA 4WL0A 4HNTA 1GTG1 1VMAA 3GLHE 4EJMA 5AVXA 3BT7A 3BIFA 3GJQA 4DMRA 2C59A 2ZRGA 4FR2A 1CJKC 2QUJA 3PGMA 2XV1A 1GPWB 1KO5A 2R1ZA 3AEQB 2PAAA 13PKA 1RCUA 4IDEA 4R1QA 2F17A 2FKAA 1Q44A 2RHWA 4XCXA 3RFXA 4Q4HB 2UYQA 2ZJ0A 1XA3A 1ULAA 1X1EA 1Z4PX 2B0JA 4UZSA 4FBMA 5JCZA 3EGCA 3RI3A 2A9PA 3SS9X 3R24A 4J1SA 2DVMA 3Q12A 3LX6A 4PQGA 1CUCA 3AI2A 1MA0A 1WHTB 3HVRA 2Y1OA 1XN4A 4A92A 2AOTA 3EVFA 4WGFA 1RQRA 1QM5A 1T15A 2R7NA 5LDGA 4PYIA 3L0OA 5D00A 2EW2A 2FGKA 2HI0A 5DCLA 2OHFA 3ABRB 1MFPA 1E59A 3CEPB 1NT2A 3LBHA 4BKOA 1DJNA 3R7SA 1YBAA 2W6NA 4BWVA 2P9QA 1P5FA 4QQ8A 4G0PA 4DJJA 3TW0A 2Q5JA 2Q4TA 2VWGA 4Y2TA 1C1XB 1H6DA 1UC5B 4I1OA 4PYKA 1AO3A 3UXEA 4BNYA 5DEOA 4HQ6A 5EIWA 5HBGA 2IH4A 4TM7A 5GGXA 5D2CA 4OXRA 2IYVA 3QXXA 2B30A 4MEBA 4RDIA 4AZWA 4ER3A 1XD2A 2GN0A 1DTSA 1GAEO 1QAQA 2XYRA 3F47A 3GEDA 4G0YA 4NOMA 4TLAA 3ZDQA 3FJOA 3ZDXB 4QE3A 2FPXA 3F46A 1DFGA 3NZEA 4EJ2A 1CETA 1E98A 1C0LA 3QFCA 4YK7A 3DT9A 3AQIA 4QA9A 4WXRA 3HSKA 4JB2A 1IU9A 4MA4A 3A3YA 4R0VA 4ZARA 1M9NA 1ZW6A 4A10A 1DADA 1B6TA 2PD3A 4EO9A 3RLIA 4N9QA 4QQRA 1PJAA 4CKEB 4D8WA 4BGEA 1M34A 1L7XA 3UOWA 1F4PA 1UP7A 4I2VA 1I0ZA 1ECFA 4JA0A 1Y5IA 4XW2A 1NQ5A 4B17A 1SVWA 4BIMA 3DMTC 1T9ZA 3IAHA 4RQBA 3LQKA 1H2WA 4G4SO 4H4DA 3N2IA 4I3GA 4BBJA 1KQGA 2QBYB 1BCRB 2XUFA 4S12A 3DOEA 2B37A 2OB2A 4FOSA 2GXUA 2DPYA 2G04A 3BZWA 1YIDA 1ZK0A 2FSIA 5CT5A 4J7UA 4IG9A 4GMDA 2X1VA 4GRIA 2CD7A 1P7CA 2Q4BA 2AIRA 4GMGA 3E3NA 4KQCA 4RHTA 1TYCA 1YK1A 1KYVA 3CKKA 3WKEA 1AX9A 3E22B 4I9GA 1CUBA 3RYHA 1EWQA 2Y1WA 3ORYA 1RPZA 3AL0C 1RADA 2ZSIA 1XROA 3O38A 1G8AA 1HE5A 3FHJA 5KNBH 1MO3A