4P81A

Structure of ancestral pyrr protein (ancorangepyrr)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
166
Chain Sequence
EKAVVLDEQAIRRALTRIAHEIIERNKGVDNCVLVGIKTRGIYLAKRLAERIEQIEGKKVPVGELDITLYRLVKGTDIPVDITDKKVILVDDVLYTGRTVRAAMDALMDLGRPSQIQLAVLVDRGHRELPIRADYVGKNVPTSKSERIVVQLSEVDGQDRVSIYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transcription
molecule keywords Ancestral PyrR protein (Orange)
total genus 56
structure length 166
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p81A00
3M3HA 1HMPA 1XTUA 5JSQA 1PZMA 1A98A 1Y0BA 4JLSA 1ZN7A 1P19A 4FYMA 2PRYA 1OPRA 2HCRA 1DQNA 2VFAA 1A96A 3OHPA 4RQBA 1BD4A 1NULA 3MJDA 1OREA 2JBHA 4P3KA 1A3CA 3ACCA 3H83A 4M0KA 5JV5A 1DQPA 1NONA 3LPNA 2FXVA 4ZFNA 4LZOA 1A4XA 5EUCA 1ZN9A 1TC1A 1TC2A 1VDMA 1I5EA 4X45A 5HIAA 4F8EA 1XTVA 4QYIA 1ECGA 1I13A 1VCHA 5KAMA 4P82A 4S2UA 1ECCA 1A95A 1D6NA 1GRVA 3EFHA 4OHCA 1A97A 4RADA 3GEPA 4M0UA 1UPFA 1W30A 4LYYA 4RHYA 4WMLA 3DEZA 1I0LA 4LZNA 1BD3A 3S5JA 1MZVA 4P81A 4P86A 3OZFA 1O57A 1JLRA 2YZKA 3N2LA 5IAOA 1QK4A 1XZNA 1QK5A 1ZN8A 3OZGA 4WN3A 3NAGA 1FSGA 4P83A 3GGJA 1IBSA 5BQOA 4P80A 2AEEA 4PAWA 5IPFA 3DAHA 4RAOA 2WNSA 4RABA 4RHTA 5BRNA 1QCDA 4IJQA 4X44A 1GPH1 1UPUA 1P17A 2JKZA 3ACBA 1U9YA 4QRIA 4QYIB 2C4KA 3QW4B 3ACDA 1ECJA 3KB8A 3HVUA 2IGBA 1JLSA 4JITA 5BQPA 4Z1OA 2P1ZA 2XBUA 1XTTA 3LRTA 2DY0A 2EHJA 1U9ZA 1DKUA 4M0PA 2JI4A 5K51A 1AO0A 1L1QA 4RHXA 1G2PA 1UFRA 1ECBA 1P18A 3DMPA 4RQAA 2H06A 1QB8A 2E55A 2PRZA 1L1RA 4TWBA 1XZ8A 3O7MA 2PS1A 4MB6A 2GEBA 5ESWA 3G6WA 2H08A 1O5OA 1LH0A 3GGCA 1HGXA 1I14A 1V9SA 5E38A 4PFQA 4LZAA 1BZYA 1Z7GA 4RV4A 4KN6A 1P4AA 1QB7A 1QK3A 4RACA 4RANA 1WD5A 5ESXA 5BSKA 1G2QA 1QCCA 1R3UA 4LYGA 4RHUA 4P84A 2H07A 1I0IA 1DKRA 5KAPA 1ECFA 4RAQA 1G9TA 1OROA 1YFZA 2JKYA 3MBIA 5HKLA 1DBRA 1G9SA 1STOA 1J7JA 1VSTA 1CJBA
chains in the Genus database with same CATH superfamily
3WB9A 4BAZA 1H6CA 5CTJA 4C30A 4EIWA 2WJVA 1SKYE 5ABPA 5SZIA 2ZKIA 2GNOA 2NP7A 4MJ3A 3PWTA 4WH0A 3OIVA 5LCXA 1YBAA 2QXYA 1NNI1 3HRKA 4YAJA 5A9SA 1NE2A 1VOTA 1XRNA 2MSLA 4QYWA 2B2XA 2Y1LA 9LDTA 3D2CA 2ZTHA 2EW2A 1ID8A 3IPXA 3BMOB 1HDCA 3K4QA 2RCNA 1GPKA 2JBHA 1B00A 1ZD3A 5FA6A 4YRPA 4BVJA 5F9FA 1E7RA 3VUEA 1CVLA 1LDEA 2ODEA 2HBQA 4GLJA 5HF5A 2C95A 2PNJA 1JNYA 1R4NA 4L5BA 4A0GA 3HHEA 4QYTA 2LKDA 4LE2A 4ZT7A 2FQWA 3HN7A 5KKAA 1SKAA 2V59A 3EIHA 4U7HA 4EGSA 1KMHB 2WMYA 4J6FA 1LI4A 2A78A 3L1IA 3PT9A 2ZIAA 3RYTC 3WQBA 2WHXA 4N76A 1X1CA 4P08A 4CIYA 1GG8A 5DHAA 5G0TA 1T15A 2FW8A 3DM5A 3GRVA 3OPMA 4IDFA 4P58A 4DQLA 4NLLA 1KZ7B 2C54A 5SZJA 4Y9RA 3EJ6A 4BFWA 3PC7A 4PAMA 4Q37A 1DUVG 3Q7RA 1V6CA 4MYCA 5ALPA 4KIJA 4BBJA 2X4IA 1NW9B 1A9ZA 2XYRA 4GXNA 2PSSA 2HM7A 4OGGA 2CV2A 1PYDA 5JT1A 1D9ZA 3TO5A 4PXYA 4QECA 3DBRB 2P4EA 5EAIA 3BVPA 1DXHA 1WHTA 2GLUA 3IUMA 4KI7A 4BN4A 3RTAA 4DCPA 4UOQA 1RRGA 4TWRA 1S2MA 2C92A 1JXOA 2ZTMA 3AEYA 4I0WB 2PBLA 1JJVA 3A6FA 4TS1A 5AI0A 4BNDB 4FB5A 1KO5A 4J0HA 3WGTA 3GNSA 4MR7B 4NR0A 3E53A 4WY8A 5TQVA 3E7DA 5I7EA 2QN2A 1CRPA 3H1GA 3NH6A 4D9KA 5KTSA 1Q15A 4Z53A 4KDEA 2RHGB 4EA9A 2W2VA 1BKSB 3PGJA 4IIUA 4PIVA 4BXOA 4HGOA 1WLSA 2PDAA 3G9TA 3QV2A 1BXGA 1KHTA 4QTUB 3X44A 1YF3A 3F4BA 1MPXA 4DNFA 2DHCA 1ACLA 1M1UA 2WBLC 3CW2A 5DE3A 4M7WA 3A2LA 1K66A 4NHOA 4I66A 5DNYB 4AX8A 2O3TA 3S2UA 4DIUA 4ZEVA 2AQHA 4Y8VA 1Z5NA 3B5JA 4P4NA 5ALVA 4LJ8A 3OT1B 5IABA 1PFWA 1I5OA 2QSZA 1KOGA 3FA2A 4GMXA 1W36B 4LCEA 2JLZA 1Z2DA 4PFQA 3O75A 3WLLA 1M0EA 4OB7A 2PRKA 2QN1A 4CLDA 1T36B 4RHUA 5K1ZA 1N8TA 2JFYA 3L7IA 4XVHA 3NEJA 3UC5A 1MOQA 5LL6P 1NWHA 5COBA 1MA0A 1P9OA 4L3OA 4UZFA 3K70D 5FTMA 5CFMA 2TMGA 2I76A 4NDAA 1CHNA 4IDEA 1M2OB 3JWGA 4F72A 1NYTA 4B45A 2GBFA 3UWSA 4HX5A 4PLWA 5A0TA 3FB4A 3UMRA 2L18A 4NOJA 2O54A 3I58A 1PV1A 1PZMA 4KLRA 5JRJA 3TE7A 3O8QB 2C57A 2GWRA 3AVWA 3BULA 2SCUA 3R6GA 4OAOA 2BH9A 2E37A 4TL6A 3RU2A 3G9ZA 5B7GA 3KZCA 3OEEA 4URFA 3A0RB 2ZSHA 4HLUC 4XWKA 5A4IS 3ONWA 1P4SA 1EM8B 1W2GA 5EVCA 2OCGA 4HQNA 3W5JA 1OB2A 2XYHA 3PLRA 3BMQB 1C7IA 2GZRA 3AKCA 3W79A 1COZA 1C41A 4M0KA 3WAKA 4H4EA 4KW7A 3QFHA 1OKKA 5FO1A 5HDQA 1ZUNA 2CWWA 2H1RA 1P4JA 5GONA 3M6FA 3WRWA 2ZE7A 3GWGA 1ADBA 2JF0A 2VF4X 2WZCA 3UAWA 4PG8A 2XQFA 5GWXA 1N9ZA 1M2KA 3UPDA 2C3UA 4H9GA 1VJGA 4LDNA 1FDRA 4BIMA 2OGZA 4DCMA 3JWEA 2CHFA 1F60A 4O02B 2W6CX 1DIAA 2XUJA 2GETA 4QDXA 1RLTA 3U1TA 1VJ5A 2D2EA 2CE7A 1HEIA 3TBHA 5FBZA 1UOPA 3ZH2A 2VPTA 1PUJA 3OC0A 3GLIB 3RJMA 1DELA 4FSXA 5C31A 4BQQA 4JI2B 1VIDA 4Z0PA 2PQ2A 2F8TA 2JL1A 3L07A 1M2JA 3B2EA 4RLSA 2OTCA 4QULA 7GPBA 5LQDA 2R7KA 1ND5A 4BZZA 5DN6A 3ZJ5A 1RYFA 4JEMA 3BWDD 3V7NA 1WXEA 2PGDA 2QGNA 3BWCA 1GZ6A 3PHHA 5CB4A 1WUYA 4JSRA 1CY0A 1LDYA 2RGBA 3TJZA 4C6TA 1GSOA 1JUDA 3RQSA 2P5UA 4DVJA 1U6JA 3OBIA 4F3RA 3DMGA 3SVLA 1D2NA 1OH8A 4OHBA 2XA2A 2HN9A 3PXGA 4YHHB 4DNXA 1E9RA 2B78A 3A4TA 1UP6A 2RH4A 3FPEA 3Q9LA 4YXWD 2AOUB 2BWJA 3DKPA 4N8DA 1FYVA 4JQYA 1OXKB 4OMUA 1XXHB 1TO6A 1R0RE 1YJXA 2EHJA 4RMJA 2VC2B 4URHA 5AFSA 2BEJA 5HJ7A 1T9AA 3MXTA 1LQUA 2AKAB 4HFJA 4IJ6A 5IKMA 3THXA 2RKBA 2GPBA 1I6WA 2DUNA 2ZSAA 4Y30A 3TB6A 4KMRA 1U1FA 1YMUA 2QN9A 3FDXA 3PIRA 1IG3A 4BLUA 3NG1A 3N1UA 3JQ6A 3PC2A 4IRXA 5IFKA 4LYHA 1EP3B 3QW2A 1XXHA 4L08A 3RK4A 4LRYA 3T1VA 1T9KA 1USUA 2QVLA 3H1AA 5LU8A 5DCUA 2P6UA 1YOBA 2NO6A 3IERA 4OIFA 3IDZA 3FMFA 5TEWA 4O63O 1PVOA 5ELMA 1QH1B 2B2CA 1JALA 1T8PA 1P7WA 2I66A 2N9UA 2D00A 3M33A 4XQ0A 2Z2XA 3ADPA 3VZSA 4AZTA 1T35A 2YRXA 1KIMA 4G8BA 1QIEA 3B38A 3LX8A 2XY4A 4MVWA 1E4OA 1SGWA 1I1QB 3FUWA 1FU4A 4ND5A 3G13A 4U2BA 3THRA 4B34A 4CM3A 4BB6A 3CNBA 4F92B 4PSKA 3UJHA 3FIUA 1FNSA 1ZZEA 3IHKA 5ANRB 2BGWA 2I2FA 1WPGA 2ETXA 1BCRA 1EP9A 1T0JB 1ZD4A 3CONA 1MO3A 2BKVA 2H4HA 3FHOA 4K46A 1LJLA 1EFUA 2F9FA 4AF7A 4ROTA 4DDHA 1OWLA 2APJA 1A88A 1AS2A 1KEEA 4LTMA 3VR4H 2ZG6A 2BM9A 5T41A 4GE3A 3TOXA 3FKSA 2PUJA 4ZPJA 1WXIA 4XA8A 4D45A 4EVIA 4KK3A 2OSBA 3A4VA 5CRIA 1W1UA 2CHQA 2MSEB 1YS1X 3DDSA 4XCVA 1DC6A 4B40A 3ZGYA 2VK4A 1LTHR 2O3JA 3G0GA 4GSKA 4EAQA 5AT1A 3UMYA 3R2JA 4Q4AB 1WKVA 1IZ7A 3PPVA 4GL4A 3ZE6A 1JMKC 5KX5B 4NU5A 4QHTA 3IV6A 1DL5A 2PFSA 4LWOA 4YYZA 3FJOA 1T6XA 1FFAA 4XVRA 2O50A 5AW7A 4U7DA 4LX0A 1BWQA 1E98A 1N4AA 1Q12A 2GSDA 4NAHA 4A3SA 2ZIWB 1RABA 4P4LA 3GW8A 1D6NA 5FP0A 3PU6A 4ZC8A 3NW9A 4QU8A 5BR1A 4ZYUA 3UW1A 1QZ3A 5IS2A 2GN0A 3AI2A 4HBZA 1PR9A 3O1HB 1WXWA 1UANA 3KTFA 1KSFX 3E5HA 1NP6A 2OAP1 4BE7B 3EXFB 3IYLW 2OV8A 2PH7A 1E2FA 4UTZA 1SQGA 2O1WA 4FOPA 4PW0A 4MRVA 2HSGA 4JN6B 1TZBA 5JVDA 1VSUA 4L2IA 4QBKA 1KFKB 2QVCA 2FRDC 3RFFA 1F1BA 2VYVD 3V80A 3IP7A 5EMHA 1VCIA 1I1HA 2A0WA 4QTXA 1JEQA 3H9GA 4AMGA 4D6YA 5AKHA 1QRUA 3NT5A 3NVDA 3RWOA 4K9DA 2W6PA 4EAAA 1TM7E 1UODA 2YRWA 4D5EA 3DWIA 4Q39A 1G8JA 1L7QA 3GGPA 3WL3A 1E1DA 1GKIA 3M49A 5KVVA 4JOQA 4LSZA 4PGAA 1KXJA 1HKUA 4TV8F 1EWKA 3UPUA 4J3FA 3KO8A 1XZFA 4PZUA 5EIOA 4LOAA 1OJ7A 1WY5A 2X8JB 4Q5IA 1O6FA 3B1WA 4JD5A 5AW1A 1T3GA 3KQVA 2QX4A 4MYDA 3ZHSA 3DB2A 3F47A 3HS3A 4TTSA 4X9XA 3GP3A 4BO2A 2P8JA 1J09A 2WILA 3M1LA 4IIJB 4DLVA 3Q3GE 1GKUB 4GPTA 5L8VA 4XYLA 4EB3A 4QVIA 1P39A 4HDKB 1G0NA 1M1YA 1NC1A 1QIMA 1BEEA 3QELB 4L74A 4ZQBA 3WGNA 2YHIB 3E61A 3RRMA 4QYXA 1KAEA 3QQPA 1M1ZA 4UDXX 5HRUA 2DPGA 3MSXA 3D5TA 2WIAA 5ICFA 3AV0B 4X00A 5AVXA 1WNTA 3B53X 4A03A 2PZMA 3LJKA 3UGKA 3P9SA 1JWLA 2ODQA 3W9BA 1ISSA 1CYEA 4QXRA 3BGSA 1OASA 2KLHA 5HDBB 1HDZA 3EPHA 4LYGA 1XTKA 1RCTE 2JVIA 5DM70 1GQ2A 2PVPA 2HGZA 3F7NA 1L4KA 4ZV4A 1PGPA 3OFND 4BP1A 4WOCA 2WQ6A 2V1XA 1K7SN 4L6AA 1VE7A 1M1YE 2YIVX 4PSVA 4LF5B 4H7EA 2TMYA 2RHJA 1PKXA 2DGDA 5C81A 2P7HA 3GA7A 4DCVA 2GCOA 3DKRA 3PDHA 2PS0A 2JGEA 1EI9A 3NKFA 4MUBA 1H22A 1E3MA 1A2BA 1BQ3A 1QMPA 4J49A 3ROXA 4H77A 2WUVA 5HFAA 2WOOA 2MYNA 4WLUA 3HYRA 2X0DA 1F2DA 1OBHA 1PYGA 1XNJA 2GD0A 2G1AA 3ESZA 5HA5A 5CG2A 5CG1A 1JL3A 4IAOA 3AM4A 3LX4A 1Z7YA 1GT91 2ECPA 3AHGA 1J0AA 1W85B 1CNEA 2ORYA 5D86A 5FUVA 5KNBA 2P9FA 5FBRB 1V35A 5CR9A 5TVKA 5A5DA 1ZA1A 4FXOA 1QS0A 3EH2A 4TTPA 2Q1SA 4L8WB 1VSVA 4HAXA 3WWZA 1ULBA 1O6ZA 3D8UA 1GTZA 1TYEB 4FN5A 5SZHB 4LOLA 2HU8A 1GPUA 2DVMA 3IAAA 4L4SA 5CB6A 3K32A 5AXCA 3A4MA 4YR7A 3MFYA 3LMKA 1DI0A 1LWNA 3BB3A 4I6JA 3GUYA 3FMGA 3JAWA 4P3YA 2QRNA 2WR8A 3R76A 2VKTA 3L1VA 2QXTA 1K08A 2BE7A 4JC4A 4W1SA 2R8ZA 3BXPA 5DSXA 3RTEA 2VIIA 3VNSA 1VFNA 2Q3DA 1CRLA 2VP6A 3NC0C 5G1OA 2IPXA 3K0EA 4P38A 3ZDQA 5D87A 5JXJA 4YPOA 3IUNA 3O0DA 3SZUA 4CMBA 4HB3A 3C6BA 3MS4A 2XTNA 3WKCA 3GGOA 1UEXC 4FE7A 1PFVA 5F7JA 1EUYA 2N47A 3N7UA 4DLYA 1T4MA 1TEZA 3JQ8B 2C20A 2A0YA 1GSIA 2ON6A 1PS0A 4QO8A 4CKWA 1DC5A 1KEZA 1XZQA 2G4LA 2WFLB 2YWFA 4MTCA 5LWQA 3ZZNA 1KP3A 4P98A 5KTYA 4B3MB 1XMXA 1XVTA 4GZMA 2EDCA 3BXGA 1MW8X 4DBVO 1YJBA 1UJMA 3HR4A 1DARA 1PZFA 4MRRA 1WSWA 3JQGA 1TM1E 3EVBA 2ZBDA 1EGQA 1KO4A 1FP4B 1NYQA 1SC9A 4QASA 1YR7A 1ZGGA 2GCIA 2VAMA 4COOA 4PC2A 2VSXA 1TDJA 4QOGA 4RVGA 2G17A 3MCAA 1RIFA 4NAUA 3C39A 2VPQA 3V1LA 1T8YA 2IF0A 2XUQA 3A9SA 4E7PA 5L4NA 2WWYA 1T25A 1TMGE 3K9WA 2B6HA 1AGXA 3LPLA 3PFFA 2HYIC 4EQZA 1Q2UA 1G66A 3LKVA 5EZ5A 2FWMX 5BUSA 3CLTD 3G6KA 1B8OA 1XU4A 5CLQA 3HADA 2OSVA 2H08A 5AVRA 2NUTB 1KAGA 1G2OA 2C88A 3KWMA 4HL6A 3R0JA 4EI2A 4PZLA 4OFZA 2GM4A 1DNPA 3IAM6 1HT0A 1RXVA 4OKIA 3CPSA 3OESA 1ML3A 1QK3A 1QIHA 4DARA 3IH5A 3R23A 5AVUA 2PGLA 2E18A 3A1SA 1A04A 1Q95A 1CS4C 1EFPA 2PCJA 1OA1A 4TKVA 4YJ3F 1K0UA 4FBMA 1F0KA 4XLZA 3CRRA 3CZMA 3WBBA 4DR5B 3KLBA 3H7IA 1QO7A 5HKLA 5EL0A 4U1RA 5LNK6 3H8JA 1EQ2A 4KWCA 4EW2A 2CYAA 2PU7A 4EFDA 2RIRA 2GM5A 5JVDF 4FFSA 5JPCA 1Z08A 5JZMA 3DF9A 4XEHA 1I7QB 4DDUA 1E1YA 1RR6A 3ZYCA 1U2TA 1ZIDA 4F60A 4F93B 5IAGA 4QUJA 1GQYA 1YIOA 1GRQA 3X3HA 1EG7A 4CNQA 4Z6KA 1DQNA 1L4BA 2VUUA 2X0JA 1A96A 3KJZA 2NVBA 4XWOA 4ZTZB 1U0FA 4HN4B 5JAOA 1DEAA 1RWOA 3JQAA 4NCHA 3DJYA 4DUGA 1RADA 3JD3A 4IO0A 4ZVLA 1XTJA 1O87A 5E9JA 4JLUA 3BIXA 3REQA 1DCTA 4ALKA 1QHFA 4NBLA 5C37A 1ISRA 3S7ZA 4ZFNA 4R1PA 3RRBA 1NVGA 4EF4A 1ZQ1A 1FU7A 3AFIA 1GADO 2P2LA 3PUKA 2Y1WA 4MUXA 1FS4A 3SHVA 5BSTA 3DLCA 4F8EA 1BE1A 3WLSA 5JH7B 4QOJA 1A8IA 1IZYA 3TPCA 2EF0A 1FPMA 3DPIA 3I1FA 1R0CA 5DNCA 2Q41A 3X2EA 4WBXC 4CQMD 1IHPA 2BW0A 2F43B 3BF8A 3G2QA 1GXSB 3LVBA 3Q41A 2OKCA 3M6WA 4KTTE 3WG9A 3B6JA 2NV0A 1GRCA 2XDQB 3BRWA 1MB3A 4WBSA 3NWOA 2R1TB 3CN7A 3NTVA 4C7JA 2R8PA 3NHSA 3TOSA 3UJAA 2IYRA 3WYEA 4ATNA 3P2YA 3AZOA 5ICEA 1JR2A 1U3GA 5HPYB 4YP0A 5K0TA 1I01A 1O57A 2TMDA 3ICOA 1HLDA 4U2GA 2R47A 1AB6A 1YQUA 1ZUNB 4P22A 5GOZA 3TNLA 3WQRA 2V7QD 2BFOA 1PR1A 1RHRA 2HHCA 3G8AA 1DPFA 2X4LA 1WSAA 3AIOA 4S2EA 1XL1A 4O1IA 1JG2A 1EWRA 2JIZA 2FZKA 1DO8A 3MXOA 3B78A 2YXDA 3DLAA 1I2ZA 4ZYZA 1Z0UA 3KYCA 3WHKA 1LX6A 1FDSA 1POWA 2V4UA 1JQEA 3JYPA 2FSVC 2H17A 4CEIB 1LUAA 1DTSA 4NX2A 2ZVQX 1N6PA 2H2HA 3C6XA 4LHVA 4WESA 4B6SA 4PZDA 2G9UA 1YKGA 3ISTA 5ALSA 1QAMA 1QGAA 4BZPA 2Z2JA 5H4HA 1Y5RA 2C5HA 3C5HA 3D8RA 4UJ5A 4WX2B 1PTJC 2F1KA 3OCJA 2CL7X 1NA5A 1EXWA 4GLFA 4AMVA 5MFZA 2WYOA 5IDYA 4LBZA 3PITA 1F5SA 2MWMA 1RCUA 1TW2A 4Z2YA 4IXMA 2JLVA 1KR2A 3WK6A 4POAA 4M9RA 4XLLA 1XZEA 2EXXA 1U80A 4G8CA 3UMCA 4UAGA 5IJZA 1QANA 1NT2A 4R41A 4EPVA 2NYVA 4MH0R 2GAJA 4U2CA 4DTCA 1M34A 4U0KA 3R5JA 4WHMA 1NY5A 1BEZA 4X1OA 4HJRA 3IIJA 4B81A 2YR0A 2JFNA 4CEHA 5K8IA 3JAKA 3NIWA 2GN1A 1FTQA 4GPD1 1A9TA 4CMJA 5CH8A 2O2IA 1SHUX 5JTUA 4DLKA 4PY2A 2C8VA 1GGFA 4B7AA 1QBGA 4F2GA 2O8NA 2BFEB 1ZAKA 2XKKA 1IUKA 3UJNA 1PR4A 5CDSA 4KXUA 1RZ3A 2O3UA 1YZFA 2SICE 2V74B 5HIMA 1TPYA 4LXHA 4AUMA 1JQKA 3EPLA 2QIPA 2QP4A 4CEJA 4RPJA 4DG8A 3L6DA 3MMNA 4IIXA 1BKYA 3LW8A 1UR5A 1CUDA 2PYZA 4BDSA 3ER6A 3KOZA 1Y81A 5C8YA 2FSGA 1ULSA 1Y5NA 3OPYI 4FZ5A 1RBZA 3PCTA 4CMAA 4DR7B 4ES6A 2RGAA 4WA7A 3DP7A 3H2BA 2C5GA 4IYJA 4ZI2A 3GFOA 1F9AA 3AR3A 3AR5A 1MOSA 2TSYB 3I42A 4TGLA 4NJMB 4F3KA 5IDXA 3D7SA 4WKBA 2XB2A 4HUJA 4MW7A 4NOLA 4HR7A 2OCDA 4J16C 4UPDA 3U4QA 4HDSB 4MIOA 3TM5A 2QM3A 1US8A 1G16A 2HF2A 3RSSA 3SYNA 4N8EA 4URZR 3U4IA 5E1OA 3VNRA 1L3BA 3Q8WA 4K9NA 4F06A 3RTBA 1D4AA 4L5JA 2JJMA 1UDXA 5K09A 2XGJA 2I1VB 2LRHA 4NDZA 5DM0A 4KAJA 1ONBA 5A5FA 4RH0A 3OUZA 3DZ8A 1RM0A 4M0UA 4FTWA 4LYYA 5REQB 1FYFA 4MEJA 4U7GA 2OQ2A 3JALA 3OWOA 1MZVA 2BP7B 3K5WA 1X6VA 2GAAA 1SUAA 3O9VA 4GGOA 5JI3E 4IRMA 4US1R 5EIXA 3KKKA 2V3CC 4E22A 2YZKA 2XGOA 3ST7A 1IRIA 4PGMA 4INOA 1ULUA 4BVGA 3KR9A 5AK6A 4BRWA 4DAEA 3JQ9A 1EK6A 1YUNA 2FMTA 2TMKA 3KDPA 1CEQA 1DIHA 4RBNA 3NTXA 1H5NA 4CQNA 5CCDA 2IYYA 2EF1A 1U7TA 1UDWA 3H04A 3MCVA 5IVIA 4NU0A 4JLKA 3I9LA 5DNUA 3HTXA 3OPYA 1ENPA 3S68A 3BD6A 5LPNA 1GZDA 5HFJA 4CTOA 1WDKA 2QNRA 3D5EA 3L02A 1VMAA 1GRNA 2GQ0A 4O0MA 3AUAA 4D4JA 5EEGA 1UOOA 4HGRA 3GELA 3WYBA 1FFGA 1P1HA 3HKDB 3PJGA 1Z7EA 1SNYA 5LLSA 1U3VA 3TQQA 1SQ0A 4MW4A 3VKGA 3B52X 4YY3B 1P31A 2ZR7A 3PDCA 2AZMA 3KKPA 3H5IA 3TRIA 4ZMSA 2D54A 1O97D 5JYBA 1ODLA 3E3LA 3SJAA 4M0FA 3AESA 2QB5A 5DGCA 4IMIB 5MDHA 4J0QA 1ZNYA 2PPVA 3ZVNA 3TR0A 4HAWA 4TWAA 4B3JA 4ZO9A 5FPTA 4DCTA 3WVNA 3N5CA 4U39A 2IXAA 4W7IA 3IEMA 3OZAA 3DBIA 4JGGA 4ZKDA 2QEQA 4TTAA 5LQCA 4WKNA 3OBBA 5BSMA 3LHIA 2WLTA 5EE1A 2CXNA 4NE9A 4ZOLB 3IXMA 4RU1A 4R2KA 1L5FA 1NQVA 3JQBA 4MO2A 1KETA 2V8OA 4KRXA 5J3JA 4LVNA 5E2IA 1UAYA 2DAPA 1EK1A 2ZJAA 3FDZA 3OZ7A 2CY0A 3Q3IA 4MO9A 4U9HS 4AJ1A 1OWMA 3RYIB 3ZIUA 3TMAA 4RTMA 1E9SA 3E81A 3P9ZA 1SY7A 2ZYTX 5A7GA 5LBTA 1WD7A 3RS9A 3A1WA 3L1HA 3AHHA 3HKCA 1J8VA 3FJYA 4EYOA 2E89A 1W1WA 1DT5A 3QP9A 1NBOA 1YCFA 2R9VA 1ZINA 5AJZA 3M3PA 5TRTA 3W3AH 5FOQA 1F1JA 3ZWXA 2WFAA 1DRVA 1DBSA 4OLJA 4OAPA 4F8JA 2EJTA 2QTAA 2Z6VA 4IQFA 4BX9A 3GPBA 4CKXA 3ZCQA 1XNQB 3TINA 3W5IA 1EESA 3TOVA 1YIDA 2VAPA 2QX6A 3EQZA 3QWBA 4FZ3A 2CVOA 2F3UA 4N12A 3RJ5A 4RQBA 1Q1ZA 3JASA 3M1YA 5HZGA 4FFVA 1MB2A 3FF4A 2ZGVA 3NJRA 4O2BA 4PPNA 2HHLA 1EFDN 3C4JA 2B30A 4JA2A 4D44A 1RWBA 2DOKA 2OE2A 5FOTA 1KYYA 2QTBA 1OR8A 3JR3A 1MTZA 2ODTX 3OCXA 4M9QA 5E6SB 1Q0QA 2I54A 2X7XA 3ZU4A 3HHPA 2IH2A 1YI8A 3ZWCA 3RUIA 4LF8B 1J5XA 1RYBA 1JKJA 3P0HA 2RFLA 3QXHA 1DAEA 1M0TA 1JBKA 2OV3A 3D1JA 3FZNA 2IRWA 3GQBB 3NVAA 3B9BA 1YC2A 3R3JA 4H3KB 1SPBS 4QYMA 4MX8A 1L7OA 2AR9A 4EYSA 1GFSA 2R60A 4UXHA 4YB8A 5CT6A 4LXIA 3SPXA 3W78A 4AYTA 1E1KA 4CUZA 1ZRSA 4LQLA 4DDMA 1ZDMA 5DBGA 1DAMA 4RTKA 1P2FA 3NPMA 5E4TA 4YP6A 4FEYA 2O2XA 4QYSA 3DTVD 1OCEA 3NJ4A 5I8ZA 4FWBA 1CDZA 1PQ4A 1Z12A 3PUJA 2GD1O 1FIUA 1PKEA 2WJZB 2B4QA 2JD0A 1A82A 1HE1C 4G9EA 4OQDA 3TF5A 1KGSA 1QYXA 3B85A 4YPFA 3W4JA 3ZKWB 4E5YA 1AA6A 3BMNA 3TRFA 4KJXA 5IK2D 4DPLA 2GKGA 4BUJA 3I05A 1PZHA 2A4KA 2GZ2A 4B79A 1CRQA 4EMUA 1P5JA 4P5EA 2BGLA 5FUQA 721PA 4JYPA 1Q7RA 4WZAB 3FHLA 2P41A 1WZNA 3D2LA 1JMYA 1LK5A 5KJ1A 2REOA 3NALA 3QOXA 4NXNB 5TGZA 1J2UA 3CINA 3FYTA 1X1SA 3W7VA 2FN9A 3DXXA 2B4AA 2PO5A 3ETLA 4KP7A 1M2VA 3TSAA 1F5NA 1MAAA 4IWNA 2OILA 3LYLA 4NG4A 3RBZA 4Q0MA 3SE0A 1LNQA 1M7BA 5DPMA 1A69A 1BU5A 2VOJA 2WG2A 4Y6LA 2RD2A 2NTYC 3HA7A 1FFEA 1FMTA 3JQ8A 3OEYA 4K9KA 2GCEA 2VRCD 2VJQA 3KE9A 4C6HA 4EH1A 2Y0EA 3R7BA 4P31A 1PIWA 4G1MB 4AY6A 2K5UA 1G21B 3BFXA 5FQNA 1YBMA 1L3CA 1Y7PA 1RKVA 3OJEA 1WCXA 1PTJA 4MB6A 2GKSA 1RU3A 5FPQA 3SYMA 2VDVE 2GA9A 3HI4A 4CIWA 2GK3A 3QVOA 3FPGA 2DJIA 4G26A 1MG5A 2ASEA 4ZICA 2CXHA 1QLHA 1E32A 2B61A 4Y1GA 3PK0A 4OOFA 4Z1MA 2E4XA 3G79A 1N33B 1I3OA 1PNQA 5A6VA 5DLDA 3EZFA 1UUFA 3RARA 3ZK7A 5B3AA 4BTEA 3R7NA 1ZD1A 5A5GA 3QQ5A 3VZRA 5BQXA 4BNFA 1DBPA 3BH6A 3MGAA 1OYWA 1NNEA 1AG9A 3O2SB 2ENWA 4IZHA 1ABEA 3LZCA 5E0KB 5I7OA 1NJFA 3TIIA 2IY7A 4QA9A 4BNXA 2A1UA 1H6AA 3NBMA 3WOHA 3V33A 4XDHA 1K8QA 3AKYA 4RHCA 3CH4B 4KFTA 4Q1VA 1OBOA 3DOJA 5F9HA 4J76A 4C1NA 1V96A 5FFNA 5HKKD 3HK2A 5BUCA 2Q1YA 1JP7A 1ORRA 3LE8A 1JIKA 2ZPUA 4LF6B 3L8CA 3BHNA 4PR0A 2HCTA 3EAQA 3KLNA 3MPUA 4GI7A 1SKMA 4LDZA 3CX7A 3FNBA 1CETA 1N2XA 4RFSA 4DG9A 5J2TA 2QSJA 1G8SA 3E9CA 4TWJA 3DE7X 4XUCA 4BNMA 5BOSA 2OO5C 3FG9A 3HSKA 1B4DA 2YJZA 4L07A 3AR4A 5IRCD 4MLDA 4YJ3B 5J4KA 1KVUA 2VNAA 1UPCA 4DMHA 3LWBA 3RBVA 2CV0A 4F71A 5L6MB 3DNPA 2FETA 1GRRA 1RIIA 4CMIA 3PNQA 1E3DA 4WMLA 3EXHC 3AB7A 4TTQA 3T3OA 3IJPA 3HUFA 4FYHA 2BE9A 3OZVA 3A9WA 8ABPA 2QYOA 1N0HA 1LBHA 1Q17A 1CK4A 3HYSA 4IMPA 5EY5B 3LZ6A 1DIBA 1O96A 1CUJA 4K8RB 4QARA 5LYYA 4AJPA 4UFPA 5KC8A 2AVNA 4KWHA 2PL1A 2MMGA 3I9V6 3MUOA 1WPQA 4GLBA 1NR7A 4B7ZA 4WK4B 2VNSA 3GCGA 3ZPXA 4KXVA 4UHJA 4LF4B 4DE5A 2JFUA 1OH7A 1DKPA 2E3JA 2WD7B 2DKFA 2BFBB 3AFOA 3GDGA 3HP4A 4ZT6A 5CMLA 2LVBA 4LDJA 5EJFA 3TVYA 2I3GA 1IDOA 3PICA 3WO1A 1MR3F 3X1DA 3GDHA 4RAOA 4JUCA 4E14A 3L7DA 5C8YB 4CMIB 4HRXA 1ISFA 4HI0E 3CB4A 2QY6A 4QG7A 3ZTYA 2GBCA 4L76A 1U7UA 2VUHB 3KT3A 2IQ5A 1P44A 2AR7A 1AV7A 3ZWAA 1KYTA 5LYJF 1M2VB 4MYSA 2JDIA 2H4FA 5BQPA 3Q72A 4ENTA 1NMXA 4Q6BA 1C3JA 1NUTA 2IXFA 3B3JA 1G5RA 4KN8A 4CIXA 3IT2A 4GKVA 4B6OA 1EVIA 2OVFA 3I2IA 1D2GA 3A9UA 1QHHB 4UC0A 1WPXA 4NC9A 3AM3A 4KSCA 1T8RA 3QX3A 1L5HB 1QGUB 4GC9A 4PRLA 3IULA 3AEKA 3SFTA 3V1TC 1QG6A 4KGDA 1Z4OA 3PFHA 4MVJE 3KZKA 5DEIA 4CODB 1FFBA 2CB9A 5KOJA 2VDJA 3BBLA 2F48A 4U7JA 3T61A 3CZAA 4AULA 2HA5A 4BC1A 3TQFA 1MO4A 4CM4B 1OH6A 3VPGA 4D82A 3O4JA 3R6DA 4R8MA 1S3SA 5E9QA 5IUKC 3QPVA 5L4SA 1RM5A 2GPNA 2QR5A 2R84A 4MV9A 3VPAA 1OA0A 3P9RA 4R1QA 1JEOA 1GVNB 1TT5B 2QP3A 3V4VB 3H65A 1OLSA 4YRTA 2R97A 4DMMA 1DDGA 2YUTA 4KN6A 2WI8A 1SB8A 2I6GA 3C3BA 2WJJA 4HKTA 4HNQA 4LXXA 4TWIA 1QHHA 4QPZA 4FZJA 4B3HA 4ARIA 1EP2B 5A3JA 1M83A 4BRZA 3BEOA 3NZEA 2A3RA 4OUDA 3AM1A 1KDPA 3LYHA 2WT8A 1R0BA 4UBNA 5MHTA 1UAGA 1DAOA 4LGMA 1RS0A 2WKWA 4J1SA 4MITA 4QEDA 4IW3B 3ET4A 4ZYVA 3AF6A 1MXHA 2QM8A 2ODAA 3HFGA 2VBFA 3U4AA 1QNLA 3F96A 4X84A 2XGSA 2H4XA 2YY6A 2X41A 5DLYA 1RI3A 4JX9A 3PYMA 1MJ5A 1RDFA 3A1DA 1DQYA 1JHYA 4WXRA 4BGVA 3EC7A 3AQ4A 2JEOA 3EULA 2B82A 4FYMA 4KQEA 2AOTB 3S1LA 1T5OA 2Z9DA 1TNDA 2P7IA 4BNKA 2RHTA 1OLXB 4YMGA 3CF0A 4RQUA 1MIOB 1K7CA 1Z5WA 2P3OA 3LBAA 1XZCA 4IILA 4MXDA 1T43A 4MW6A 5FWYB 3VX3A 5A2GA 4DV5B 2H00A 3L8ZA 2YY5A 4O2RA 4XGIA 4DANA 3HJHA 1IZZA 1UCFA 2PL3A 2ZPAA 1C30B 4YCMA 1RP7A 3BZBA 3TW8A 3ZBQA 4DOMA 3O3CA 4AG5A 5HCNA 3KJEA 3MW8A 1E6UA 2FX5A 4ZT2A 3A11A 2P4QA 3D8SA 3W34A 4M46A 1U2QA 4G1CA 4HB0A 4U2FA 5F5LA 1HA3A 4ACBA 3Q9SA 4IIYA 4DA6A 1UBMS 5KX5A 2G36A 1ONSA 4F45A 1QAQA 3GAZA 4LZWA 1L7EA 4F84A 3S40A 5JSZB 4FR5A 3WXMA 1MEEA 2WYHA 3MQ2A 3LZDA 3WB0A 5BWCA 3PDJA 4ZI7F 5KDDA 1GKYA 1SAYA 1HNWB 4C7KA 3GVPA 2ONZA 3SIXA 1KZ1A 2VVTA 4PLPA 3WNDA 1T1SA 2ID8A 3N2LA 4OU4A 3CUEF 4PGFA 4M98A 1LLDA 3FLEA 2CLKB 2X9QA 2HMVA 1UBCA 4HDRB 4ZEWA 1PDOA 3CIOA 3NWJA 2BFAA 1OT3A 3C7TA 3LUFA 1JDBB 4LW8A 4YJ2F 1B41A 2OOSA 4KIUA 5FFFA 1P1FA 4E5PA 2BN4A 2WKPA 1BWPA 1GN8A 2VYND 1EH5A 2BGUA 1KE2A 5BW8A 5ELXA 3DEHA 2IT1A 3FF1A 3BAZA 1BX1A 4AKIA 3RRXA 2V9CA 4DNPA 4FFBA 1ECJA 1VCMA 3RUHA 1W5SA 1TZMA 1ECLA 1XZPA 3IBCA 3RC7A 1VL5A 4ILKA 1J49A 1VKJA 2ZVPX 2DY0A 3CCFA 1G18A 3M6MD 3S2EA 3SSOA 2HFJA 2ZIUB 4J0JA 2AJDA 1XCMA 5GJWC 10MHA 4IUYA 3I9MA 4R8LA 1P74A 1NV8A 2DY1A 4GZ6A 2BM1A 1OVGA 3A14A 4OREX 4CQMA 4JCCA 3G1TA 4PYNA 4JSYA 5AWFC 3L5OA 2RJNA 4V02A 1HM5A 1F6DA 1MENA 4M49A 3KJFA 4Y9DA 5ADWA 4LXUA 4TV9A 4JBNA 5E4YA 2OZPA 5K0NA 3UK7A 1SH7A 2IHNA 4QLBA 3RC8A 4Y2VA 3I1JA 3KSUA 2BLLA 1ADFA 3ZH9B 4N41A 3FROA 2YV1A 4XB6B 3TZKA 1JMVA 1FTWA 2ZT5A 3EQ2A 3ITKA 3Q2KA 4UATA 5DASA 4JI7B 2J9XB 3TIGA 2ZUWA 4DC9A 1X7WB 4OL0A 4PU0A 3SHTA 2B8JA 1X87A 5D01A 5ICGA 2XOKD 1V1RA 3IUEA 3IOEA 2D2XA 4RZUA 3FPLA 3TLGA 1Z0ZA 3AU9A 3RS2A 1N5JA 3J80A 1MQAA 4Q4DA 1U3TA 1TFRA 4K2HA 1TLFA 2ZBRA 4PXAA 1Z38A 3C3YA 3GH3A 4ZJPA 2DFDA 1NUAA 2WJHA 3NHJA 1STOA 1FMLA 1W9HA 4OEHA 1SUSA 2BKUA 2FPPA 3DWEX 3RUFA 4K03A 1EJ6A 1ZMXA 1XLWA 2M98A 3AUJB 1X42A 3I2JA 1G8HA 2CF6A 2YIDA 4RZ2A 1YKSA 3G17A 5IN5A 3EGEA 3IALA 3ZKAA 1KK1A 4GEKA 4HQ0A 2OORA 1IYZA 1H6DA 3F8WA 4MW0A 3WRYC 2IS4A 3CUWA 3FUVA 2IYEA 4O08A 1OPXA 2BGGA 3KELA 3DVSX 3A1TA 1Z22A 5IH7A 4N1AA 1S8FA 2PZBA 3CHYA 3MJFA 1RJDA 4J1TC 1MH9A 4OCZA 1SVUA 1SOWA 2VF7A 3DAOA 5HZHA 4HLDA 1PLJA 4IH4A 2AF4C 1C9YA 3R0ZA 1JLKA 3V55A 1EGHA 3ZWPA 3V5NA 2NO0A 4LJLA 1QTNA 1Z4LA 1TZCA 1UBGA 2B5WA 2VXOA 4GX1A 4MUKA 1REQA 5LBIA 3TLAA 2R25B 4F5WA 5L51A 1KI7A 4R5HA 3P0JA 2O19A 1FVHA 4UBMA 4AB1A 8LDHA 4FYWA 4TX1A 4QUEA 3VH3A 6LDHA 1GLGA 1J8QA 4CCYB 4IJUA 2H5LA 1ZM7A 2GJAA 1CCWA 1RRVA 2FMFA 3NYRA 3UAXA 1UKCA 2A57A 5KNDD 1P2DA 1J8YF 2H8KA 3D4LA 1SVSA 1T26A 2HPAA 3MJ4A 4H08A 4ZOCA 3RV4A 3WWEA 4A2PA 3TN7A 1GCIA 2JFFA 4G41A 3EXHA 4NAVA 2QA5A 4OQ4A 4PS1A 4PCVA 5SICE 4E13A 4IIDA 1H9AA 3WMEA 3EVZA 3NTUA 4H27A 2JZOA 3IFSA 1UC9A 2J5QA 4GKBA 4CLOB 1E3WA 3H9BA 1QQ6A 1OZHA 1SOVA 2WG0A 3AT1A 4O0LA 3ICEA 1MBZA 3K53A 3KAQA 1T8TA 3HV0A 3KJQA 1NLFA 2X1HA 5DLPA 5ILOA 1ZSVA 1IJFA 5IAJA 5L3SA 1U0BB 3SZGA 4D2IA 4B44A 2WIBA 4FHCA 4NK4A 4FZRA 1JIUA 2ISCA 3DE4X 4BB0A 4JB8A 5FR2A 1FQJA 4BNDA 4WESB 4CM9D 4DSOA 1EINA 4R8KA 1PR5A 5F78A 1JPNA 1F51E 3RG2A 3KZXA 4YJHA 2RARA 2Y6UA 3EZ2A 2FWBA 3BQMB 4FONA 1I4LD 3B70A 1LFDB 1P18A 1VP3A 1TTPB 2WY2D 5D3QA 1RBMA 3WIOA 2XQIA 5AKZA 3Q9NA 3U9SA 4BAUA 4Q7QA 1WBBA 4ZN6A 2WWXA 2O3QA 4MICA 3RYCB 2P9ZA 5CCEA 1X15A 3C6ZA 3FFXA 2BY4A 3WK5A 1LX7A 3OOHA 1M5TA 3OLWA 2ZAYA 3C5CA 5T3UA 1IATA 2H1SA 1WABA 3L18A 5JNRA 4C7OB 4JZYA 3QELA 3JVIA 5C34B 2AMVA 3JWPA 5E9WA 2QD5A 5K8TA 2ES4A 4LDAA 4IYRA 3A9RA 1NE7A 2FZ5A 5EJ9A 5IWAB 4M0CA 3WLMA 4Y2GA 2QU8A 3NV9A 1AC5A 2A0XA 1BH6A 1T2VA 4ALLA 1YQXA 4YAGA 3F4LA 2Y0CA 4BVKA 5IXSA 4RHFA 5DRYA 4RGBA 5FOUA 3AFNA 1CUXA 3I8XA 4JKOA 4YECA 3W9YA 4X1YA 4B4OA 4AJNA 5FLKA 3NONA 3EWSA 1KNQA 4BEBA 1IHUA 2ZU0C 2H7YA 3G8YA 3OT4A 1ZXBA 4BOYA 1JQBA 3G5UA 4W5NA 1R5BA 1ZIYA 3RUPA 3CLTC 5IAEA 1IMJA 1K5DA 121PA 4ER3A 4XIFA 5LZ7A 1UXKA 5IJ0A 3Q3CA 4RVUA 2IUFA 1XZLA 1NBME 2HUNA 4V0RA 3QTLA 3VISA 2PFGA 3ORFA 3EVFA 3QLUA 1WOMA 4YC7A 2J33A 5AUOB 1QORA 2A1IA 3ZOKA 5HBRA 4DGQA 1UPAA 3GLGE 2C5LA 2ALJA 3N7TA 2I2AA 3QRWA 3IEPA 2XQJA 4W8HA 4ZP1A 4PNPA 3KQNA 1IHYA 1Z7WA 5C7YA 1VCHA 4G89A 4GM4A 4H3HB 2VRWA 1NYLA 2PRIA 3ZE2B 4DRZA 5F98A 3NM6B 4WOPA 4YRKA 3HNPA 2G9QA 3DC2A 2IZ6A 1XJQA 5E4JA 1KRXA 1DT3A 4JU8A 2A84A 4LJYA 5BMVF 3WWPA 1MB9A 2N1BA 3A25A 2QV7A 3DLIA 2ADOA 1TJNA 3WRXA 2P2CA 4KNWA 1ZJ5A 3LDUA 1PWEA 2FKNA 3TVDA 3V9AA 4CCWA 1ESEA 3EG9B 3CUUA 3GLGA 4A23A 1T5BA 3N8KA 2BGNA 1TCAA 3MCWA 2X5NA 1AXRA 4GOMD 2PT7A 1Q1AA 1P9LA 3WJAA 5GIPE 3QF7A 2D2FA 2HXSA 3UBTA 3DTNA 1N4DA 5D3ZA 3PNLA 3GXOA 2FXIA 3PGLA 1KF0A 2JFOA 1A2KC 3LVFO 4P0TA 3WY9A 3SHQA 1F2TB 1NNSA 2RAFA 1U4SA 2HA6A 3JZAA 3TSCA 4BGUA 3TLYA 3TIXB 5BV2P 3KQHA 3OTGA 1IQRA 4G37A 5CGZA 2FWAA 2WU3A 2E82A 2I2XB 4D25A 4WKCA 3ZCTA 3KZVA 1TM5E 3D7RA 1H1LB 2NSHA 3R8XA 4BWGA 3VRHA 3A3OA 4QEKA 1IUPA 4L16A 2JJYA 3FRIA 3UKOA 4Z3KA 5BO5A 3AZPA 1Q1EA 1KY2A 2P0AA 2VDLB 2Y9MB 4ZCQA 1NMEA 3M5CA 5T64A 1MAHA 3MMXA 4J2TA 4YP1A 1PJ4A 3U62A 3GUVA 1JLLB 3L41A 3PHIA 4QUKA 1YXMA 5HOQA 2WW8A 3PZBA 3CLKA 4GI1A 3PGA1 4RF2A 1U94A 1YVUA 3WGIA 2O0JA 1GG2A 3K8YA 1P1IA 1ULZA 3ONNA 2WSIA 4XSGA 4C76A 1TZ2A 3TBFA 4ZAZA 4FFBB 2I2BA 5IZ4A 3A1UA 4RTJA 1DG1G 3A28A 3AHIA 4F1JA 4GKKB 4GWKA 2DFTA 2G5GX 1W1IA 4AT1A 2P68A 1IXSB 3MUNA 4UD6A 2WT4A 4PV7A 1UZUA 4G4SP 2BM0A 1M54A 5AW6A 1IN1A 1QZZA 3MNFA 4JLNA 2BSXA 4RS4A 3FYUA 4QGFA 2BJVA 3P9IA 3PNSA 2UVPB 1XRLA 4R51A 3KEGA 2X9NA 1K88A 5BW6B 4EHHA 4ZVMA 2QGZA 1BRTA 3G68A 2HYDA 3TG2A 4M6WA 1V5WA 1AKYA 3LO8A 2W2NA 2CD7A 1RSZA 2BMAA 1WO8A 1Y9DA 4MVJA 5JLAA 4BS9A 1TQ6A 1PL8A 4Y7DA 1OI2A 4F12A 1FLDA 1NVBA 4YROA 3IAFA 1SZDA 2QN8A 4R3NA 4Z1MD 1UMBA 5C8XA 3U4QB 2YN2A 1IQUA 1Q19A 2I03A 3VR4D 5C3UA 4LK3A 3QWHA 2BCEA 4RJ2A 3UHOA 2FZWA 5T7BA 2J5BA 4XPZA 4MW9A 1IEXA 1CT9A 3UHPA 4MR9B 3KPVA 4R5MA 1ZU4A 2Q1XA 2BEWB 3HEAA 1X39A 3NRJA 3W5AA 5LXTB 4XWGA 3CZPA 4LJRA 2Y0BA 1SXHA 3O03A 4UZSA 4CMKA 1N0WA 2JLAA 3M9XA 3MJTA 3OLYA 3OFKA 4EUNA 3RUAA 2ZU6A 1KH1A 2J9GA 1KPHA 1AKQA 1RTTA 3DV2A 4NDNE 1GU7A 4XB1A 4A27A 1Z8FA 3PGMA 4A6DA 4K9RA 4R2JA 1JIJA 2A14A 3UB4A 4QJBA 1R27A 2PX2A 2XMSA 1IXRC 3DBRA 2P5SA 4FD2A 4K6HA 3TUIC 4BPRA 3CVJA 2HD4A 3S3TA 2OB2A 1JAHA 2HIMA 1A97A 2JIOA 4F3YA 3IEKA 3U3JA 3THYA 3M5WA 2JH9A 4ESEA 3GVIA 4R40A 3WSTA 4DLAA 5J4VA 2H85A 3AHJA 4HH3C 4KAXA 3IUBA 1DEXA 1SCUA 2FWRA 3UGQA 1SUBA 1CB7A 1X1AA 1P3JA 3LL7A 1V43A 2IVZA 4MK4A 2A88A 3LECA 1R0LA 4XRRA 3MGCA 2HLDA 2QRKA 5JLJA 2EX1A 4MI1A 3DUWA 2BD0A 2E21A 4O1MA 4WN3A 3SK0A 2W00A 3SG0A 3MTGA 4MAFA 4R8SA 4W9MC 4JJ4A 1WCWA 2AXQA 3I53A 4I55B 3ESRA 5EXTA 3NBQA 3ZNQA 2EJCA 2Q7XA 3A70A 3G0CA 2QLFA 3N2YA 1SKBA 3MB5A 2DWPA 1K3FA 2XITA 2ECQA 4CI0B 4QNNA 1OYYA 4ZEOA 4ARSA 3LDGA 4TRMA 1OLSB 2XZPA 3B9RA 3L7BA 3VBCA 1KEVA 4GZ3A 2OV1A 4KCGA 4K0KB 1M3SA 5E3IA 5JMOA 4NSNA 1FC0A 3NQ41 2HIAA 3C1OA 3EGDA 1Y42X 4ZYXA 4NOMA 1P2UA 2J0UB 1N6RA 1OXTA 3I0NA 3GMDA 1PQPA 3LT1A 2HOQA 3QU4A 3WA7A 3RG8A 3QLUC 4P35A 4WL0A 5TJ9A 4B87A 3NRBA 3W4KA 4BTLA 1SU7A 3AW8A 5J1TB 3WE7A 4D3DA 1N6NA 6ABPA 2J30A 1FVFA 1PG5A 3L1UA 2NPFA 3E7PA 4WNYA 4RO0A 1Z47A 1V2HE 4HDAA 2QLJA 3OQ6A 3E22B 2FPWA 1LH0A 1PDWA 1DQZA 2ZI5A 3OUTA 3GEGA 3WP1B 1CQJB 4MEBA 4DQ0A 2CHGA 2BBOA 4EF5A 3DPSA 5FUWA 5JISA 2R6DA 2YC2C 3GOHA 2PYDA 3N05A 4K2AA 3ETEA 4L4UA 3OH8A 4L57A 4RPLA 3CY6A 3SQMA 3WNZA 1DMRA 1WXHA 2MIIA 4R83A 5IM4A 1E9DA 5DNVA 4NK5A 1IVSA 4K6CA 1Y3DE 2GCGA 1R7RA 3VO9A 1LDGA 3ILSA 1V4NA 3D5QA 3RT1A 3V46A 1CZNA 3VR1A 4PZEA 4NS4A 5T4FA 1QGDA 2NV6A 3FPFA 3MRTA 2XIJA 4EHIA 4AFNA 5HS6A 1BH2A 1VSTA 3KQWA 4K1LA 4UAVA 1GV1A 2FK7A 4BV2A 1E6EA 2P9HA 2EKDA 2ZIZA 2AYZA 1A98A 3SZLA 1L5ZA 1D09A 4IGIA 2I5PO 1Z0JA 3K1ZA 4MGHA 5DGDA 5AQEA 4B7UA 2EFDB 3FOFC 3CF4G 2DTDA 3NUZA 3UMGA 2ZUUA 1Q74A 1CDEA 4NJEB 3DBLA 1M1YB 4WD3A 2JH3A 4B4UA 4V2UA 5CLHA 4HXGA 1MT3A 2Q3FA 3KUDA 3EWIA 1DC8A 2NQTA 2JHPA 1YOVA 2EEPA 2ZRJA 4IBOA 2VT6A 3RYFB 5JALA 4UARA 1E1NA 2AYXA 4FGZA 1NPDA 2X5XA 1DWUA 3OY2A 4MP8A 3WIDA 3ZU5A 2XT0A 4DV1B 3WIUA 1FP6A 1TUGA 1LZLA 4LOKA 2I7TA 2VNJA 1AHHA 3RVQA 3UXHA 5J4YA 2FRVA 3L8DA 3OTWA 1CY8A 1RPTA 1YBHA 3EY4A 1LRLA 3JYLA 2V6JA 4L4YA 2QQEA 1C0EA 5A1TA 1WVIA 4AS3A 5A7HA 1VE9A 2P77A 5CVCA 3G5MA 3G0DA 3K0KA 3OG9A 3N3AC 4IIHA 3X2FA 1N5RA 4X62B 4GM1A 1AUPA 1W0JD 3IS3A 2VHCA 4XFDA 3WJ1A 5DWQA 1JH8A 4G5RA 3KEOA 3PHJA 1C8VB 4PLYA 4KN5A 2PUFA 2QJFA 4IG4A 3KQTA 3ND7A 1GKLA 4R69A 1BAPA 3BJEA 2Q07A 3BMCB 2O2ZA 4G9BA 4EJFA 4KQCA 4WCFB 2F17A 4XUGB 3JZMA 1ZHFA 4HUQA 3ZQJA 3E7FA 1TAQA 2C2MA 2DE0X 2GYVA 1MB0A 1GN9A 3O8BA 2MR6A 1KVRA 1DRKA 3K6SA 1PFKA 3WYGA 4M9UA 1PQUA 2QYTA 4NJEA 5I51A 1U7PA 3VPBA 3TAUA 4MJ7A 4M89A 1UT5A 4KE6A 4O4JB 5E1DA 3KOMA 5DBHX 1EVZA 4MPRA 3ZDEA 4FUQA 1XNHA 3QLVA 1QG4A 1WG8A 3JS5A 1IDN1 2PWPA 2Q9CA 4RIIA 1RXWA 1ZOLA 4LC1A 3HJAA 4XGRA 1SVWA 1SKUA 4C20A 4DRYA 2CNBA 4G25A 1AO0A 5ALMA 4K87A 1RAIA 1XROA 1EDDA 3VSAA 3MILA 3TXAA 4C0BA 4FKMA 4WUVA 1SKQA 3MTQA 4AZWA 1E2MA 3FCYA 3KJNA 2ZYRA 2ADFA 2FEMA 2GF9A 2YHIA 2XBMA 4AXXA 4IQ4A 3BQ9A 2UZIR 3O8RA 3THOA 3CLVA 4BMCA 1U65A 1TJ4A 3BD9A 3LH5A 4WN9B 2A92A 3PNMA 1X8XA 2XXAA 3QZUA 3STYA 4B9AA 3OP4A 2IL1A 4HVLA 4N18A 5JSHA 5K8UA 3FWPA 3OF3A 4KO8A 4BLVA 4WGGA 1I24A 1Z8DA 1N9GA 4G1BA 5EWJA 2PX4A 2FEOA 3TDKA 2Y27A 4C7BA 2IX3A 1A8QA 1YS7A 2C4VA 2W48A 1ZH4A 1ZVQA 2IK8A 2LP4Y 1KS9A 3B51X 4MIEA 3ZIAD 3EVCA 4OQFA 2AX4A 1JNXX 2PKYX 4OHFA 3ILVA 4X85A 1SUEA 4D02A 1U98A 1E1RA 2P1DA 3FTNA 3HJBA 4FGJA 4CKBB 1YDGA 1CY7A 1Z6QA 2CMHA 3HB7A 5BMOA 3PNOA 4OM8A 3H18A 3KSRA 4KVZA 3KKZA 1Q7GA 5HIKA 3OHPA 1DJMA 2PL9A 2PR7A 3WRVA 4QBGB 2Q9BA 4N5MA 4KBFA 1XZAA 1B93A 1THMA 4M86A 3T7JA 3LC1O 4P32A 1G2IA 2W0MA 1Y80A 2Z3ZA 4PHFA 3TW4A 4G0MA 4MUJA 1QHXA 3CZ4A 4DDVA 1KI6B 1YZUA 2AFHB 2VDMB 2C2WA 3JD2A 1TXGA 2D0OB 3NHUA 1JIQA 3QX7A 5EKUA 1QG0A 1ORTA 2Q4BA 4C05A 4IXWA 4CCAA 3RO7A 4G86A 1M2OA 4JQCA 5BWLA 1IB6A 5LOVF 5H81A 1WV0A 1NG1A 3TE6A 3EIUA 1ZP6A 1EGMB 1QWSA 2BV3A 1E92A 2RK6A 4JNKA 4PLGA 3HL4A 5CM9C 4KC0A 4HEA1 1F17A 4FOTA 3LBHA 1GD1O 4MA4A 4G56A 4MHOA 2Q62A 4AJKA 1GLVA 1E96A 5AVSA 2GLTA 1UKAA 1VFPA 4ZQGA 4ZYWA 1JJBA 3LLSA 5THQA 2KSQA 2AHRA 2BEUB 4WEQA 1KMQA 5FTWA 2NSDA 2HXYA 1NFQA 4E32A 4OLAA 3AZQA 4L5AA 4L7QA 1LBQA 4R2XA 4RM2A 5EVJA 5JZOA 3FMPB 4EBBA 4PN3A 3G9XA 3GGJA 3V4PB 4GSYA 3R09A 2IPMA 5CLLA 5FUYA 2QXUA 2HU5A 1PZXA 2Y1XA 3T5GA 1YDMA 3EPJA 4G0YA 1AKMA 4WOJA 1A5TA 1FXUA 1O6BA 5DOZA 4RKQA 3NU1A 1FRFS 3I9V1 4HNHA 1N6OA 2WWRA 2VAWA 3CLRD 4N4AA 5I9BA 1DX6A 4L02A 4IV8A 1RC1A 2B9EA 2BTQA 1U7ZA 3EFBA 4NS1A 1SJ9A 5D3MA 4JLJA 3HCBA 1IQ0A 3H2KA 4RY8A 4AURA 2EDAA 1OXMA 1JR3D 3H1BA 5EJ4A 3ZHBA 2YZGA 2GA8A 2VUTA 3H17A 3N2KA 4Q9AA 5HS4A 4DSNA 1G21E 5MGNA 5EC8A 2ZJ2A 4XSHA 4X94A 2CJWB 5FWAA 3F46A 3H9CA 3MS2A 4TQ9A 4AS1A 4PG4A 4IIVA 2V7QA 2QD1A 4FIDA 2BFCA 3W04A 2IHTA 5TC4A 3GYBA 3L1KA 3QIVA 3QUCA 4FCTA 4WXHA 5DB4A 1MABA 5KIAA 3EMBA 4PLTA 3P7MA 5JI2E 5I9TA 2WVAA 1E1MA 2WUGA 3BQNB 3GYGA 1CR2A 3L0ZA 1U9IC 1P0QA 4Y6PA 3TRDA 2V6IA 4R81A 2PSHA 2WFMA 1Y8RA 4B0PA 5HM8A 2WIDA 4GH5A 4QDUA 2QR2A 3AESB 3K3PA 3BRWD 3K6KA 1XMJA 4OK5A 4RZIA 1OLXA 1IY9A 1R6DA 2AJLI 3LUBA 4FKZA 4BKUA 1FNMA 5L45A 2P9JA 2Y92A 4HOYA 3S8EA 4RFLA 3BGIA 4WZBE 3U2QA 1BWRA 4WINA 1H94A 2J45A 3D6FA 4QL3A 3QPDA 1JQAA 1NZJA 1S2OA 1LDMA 1ONNA 2IA5A 2FP4A 2QUHA 1KPGA 2A7XA 2O5VA 3DCJA 1I1NA 3OQHA 4QWMA 4U6QA 2YMLA 2XIQA 2ZYWX 1RAHA 2O8DA 3PF9A 3FLMA 5CFPA 4AO8A 1E3SA 1MP0A 3QE0A 2C99A 2YYSA 1Y1QA 1E7MA 3IC5A 5ILQA 2Q9UA 3DW3X 4QZVA 4GYWA 5K99A 1RJGA 3LOUA 4WKPA 1NAIA 4BE9A 3USES 1NQAO 1E9FA 4N7JA 2IHZA 3WR5A 2P8SA 1A5SB 2YV5A 4G5SA 4CTJA 3E3OA 2VUIB 2X8AA 4I1PA 3BIWA 3K9LA 2ZBQA 5IF9A 2UYQA 1Y82A 3M4ZA 2CT8A 3PT5A 1HY3A 1XTVA 4B8YA 1AOXA 3S81A 2HV8A 1LC3A 3K4PA 4C4ZA 1HNNA 5DW0A 1B0PA 1D4OA 2FSIA 4BMYA 3MCUA 1IBCA 4MA5A 1DX9A 2RHHA 1QHYA 4FJ2A 2O6HA 2UZ1B 2VDKB 3SVTA 3GFQA 2D0IA 2XHEA 4CIVA 1W8DA 3LCJA 2UUAB 1CSEE 1QSGA 2RHLA 1UT6A 3WWDA 1RWPA 1WCV1 2JLSA 1WQ4A 1L1EA 4P81A 4L9SA 1I4DD 1VLJA 4QDZA 1M2NA 1ZBDA 2O2SA 1CKEA 2WF9A 2GLXA 4MUAA 1KHHA 3DGEC 5DK6A 4PBRA 3UOAB 3W5DA 5KWEA 1CEYA 4I7EA 5K01A 2OBYA 4Z7OB 3EVTA 2VHTA 3S99A 2BISA 1N5IA 4RK0A 3T12A 2CCJA 3L5KA 1VGVA 1E4VA 2CDBA 2V58A 3VKVA 3CC8A 1CP2A 4RTRA 3PUIA 4J29A 3V4RA 1FNNA 3VNBA 1XC7A 2O8CB 1QM5A 1B7GO 2VXYA 3LFHA 4QGHA 5EIBC 3D6MA 1PZEA 3W5UA 3PUHA 1L4UA 1YDEA 1PUXA 2ZI9A 4FW8A 3O2NA 4RPIA 4ROSA 5KYUA 2FMKA 2Y77A 4JT4A 3BFPA 4X66B 4IICA 1KU0A 2JCYA 3VKHA 1R00A 2I6FA 2IYTA 2CNDA 3JD1A 1NR5A 3NPAA 2HJSA 3LP8A 4DCSA 2D74A 3T3DA 1GAQA 3HLTA 4V0SA 2F1OA 3UJ7A 3W1VA 3T7DA 3KCQA 3IPYA 1ODTC 4M9XA 3NGXA 1E2JA 3ONFA 3AJAA 3ZTTA 1DAPA 2IYNA 3NATA 1APBA 2XX3A 4CKCA 1ATIA 1SQFA 2AIRA 3GG2A 4O5AA 4DJAA 4JI4B 4OQPA 4OA8A 5EP2A 3LUPA 3OT1A 4Q05A 2XYVA 1V45E 3L40A 1O96B 4UVIA 3COPA 1Z7BA 2XT9A 1JTEA 4LZLA 4DQKA 4E11A 4R9SA 3MBOA 1PQYA 2JHCA 2FPXA 3C7AA 1VHWA 2VT3A 4N3GA 1EX9A 4D8WA 4Z4FA 3G7UA 1Z8NA 2AK3A 3QY9A 2FUNB 4EVSA 3JR7A 1MORA 4MV1A 5JCJD 1O94A 1HDGO 1LV8A 3WNBA 4RPCA 1YHZA 4TQAA 4UAJA 4PG7A 3FI0A 5MFPA 4QT4A 2A86A 3COYA 2VQ3A 3V2GA 2GILA 4XD7D 4ETWA 2JD2A 1ULAA 1DIGA 1VKZA 5HWSA 4E4RA 3CEHA 4FMBB 1HFJA 1JRLA 3TD6A 2PZJA 2QTNA 1ZL2A 4JQSA 1NGSA 2Z56A 4F5YA 4L73A 4HV4A 5AKGA 1SG0A 1VCOA 1WZUA 1CERA 1Y5MA 1BHSA 2VAVA 3UT5B 2QW1A 3T1OA 5IYZB 3L4BA 4F9GA 4YJKA 2OO7A 3O95A 5AVWA 2JARA 1FDTA 3GJZA 4V38A 5F1PA 2WVGA 2FJUA 4KPFC 2ORVA 3EGXA 2A59A 4KB5A 1PX0A 3ANSA 4RETA 3FPHA 1D2HA 5CK4A 1NL3A 2XDWA 5DN9A 1LFAA 2K87A 5HQTA 4ZRNA 3AOEC 4HUTA 1K06A 5KWIA 5TS3A 2ZSBA 3RANA 4AYXA 4IS2A 2JIMA 4ZCPA 1X7DA 2HK7A 5H1YA 4BL5A 4BX2A 2YKGA 1IG0A 2EYUA 1H2EA 2YWEA 4ARUA 5AVZA 1W46A 2GPWA 2JJ1A 5BT9A 4CLRA 1D6SA 2Q46A 4G07A 4RD0A 4CUKA 4C4XA 3AW9A 4DB2A 3QE4A 1DAKA 4J4TA 3VC2A 1UBEA 1WB5A 4EPTA 1SURA 1Z3CA 2N3ZA 2O2CA 3GRZA 3QVUA 4BO9A 3AV3A 3P8ZA 4FINA 1Q2XA 3W1WA 4C0JA 3ICQB 2VHUA 2W6OA 3BFJA 4G0PA 3ND6A 1F6BA 4KDFA 4CM8A 1WCIB 2GCNA 1KVQA 1XMSA 3GF4A 3QJGA 4OKNA 5BSUA 3ZUGA 3HA2A 2X5KO 2HTFA 3DEIA 1ZU5A 2P27A 221PA 1B0UA 1WY7A 5KDLA 1IOWA 4J2HA 2NM0A 2DBRA 2P2NA 3ECSA 2NUAB 2CXQA 3WKEA 2PWZA 4CI9A 1RMYA 1AK1A 2X4DA 3AI1A 3KD3A 4J90A 4EG6A 1IY1A 1KBZA 2F2TA 4E30A 2BRUA 4I4LA 2XUIA 3L2OB 1FCJA 1KH2A 3QV1A 4LKRA 1Q6ZA 4XCQA 2F67A 4DMKA 4EARA 4TS9A 4CT4B 3NHMA 1E2QA 5JQGF 1JKJB 5BR4A 4WZAA 4O1HA 4TKVB 2JIQA 3OEWA 3JWJA 4NE7A 1V5IA 3MPOA 4MRAA 2JJ2D 1XQ1A 2OCPA 3FCUB 3JQCA 1KI2A 2JI4A 1FXSA 1IY0A 2BFBA 4J0KA 3FGOA 3NHZA 2VYQA 2CSUA 3M6AA 2YWCA 3NYWA 2PV0A 3C3CA 2R66A 2CMFA 3B36A 5TY0A 3D3QA 4TMYA 2XE6A 2ZZKA 3H4IA 2IYQA 3G5TA 3MCTA 3MLBA 1ZD5A 4HNSA 2M6RA 4ESHA 4CKEB 1DB3A 4RXUA 1I14A 2YCBA 1S89A 4H1HA 4BGEA 1G41A 3K09A 4OX9B 2J9ZB 1WB9A 1MAVA 3HO1A 3ZE9A 5EPOA 4O33A 3EGWA 2NO5A 2I4MA 4HH4A 1Z5OA 2V0GA 2IEYA 4NZYA 5DI9A 1QE5A 3L7CA 3MQFA 4MUGA 2O0KA 3IT3A 4NYMQ 4QELA 5FBKA 3PFKA 5AM2A 5CBKA 2I9KA 3DV0A 3GJ3A 4XD7A 2AHOA 2PUVA 1XU7A 2X9GA 2ROQA 4REQA 3HWX1 4L8FA 1KQFA 2NAFA 1QVZA 3EGOA 2VDPB 4GW3A 2ZBPA 3V1YA 1B2LA 1HQDA 3EEBA 4LXTA 5AOAA 3AILA 4DC0A 2MSNA 2F62A 1M10A 1CJBA 4QUAA 3A6HA 3WQHA 4FHGA 3R4CA 5K3EA 5G4KA 4PCLA 1CDOA 1XQYA 2OBNA 2DH6A 2SKDA 3FAKA 3L49A 4QICA 5IK2A 1NVWQ 3IA2A 4HNTA 4HXFB 5AI8A 1KKMA 1U0SY 1OI7A 3DM9B 2XXJA 1QCYA 1UBOS 3EGXB 1EP1B 3C3DA 3K16A 4H2DA 3IPAA 3OO1A 4LJ7A 4D6XA 1I6KA 2UDPA 1UEJA 5TPWB 3ROKA 2QAGB 3QF4A 4O2AB 3VHXA 4D9MA 1G5PA 3GEHA 5IBRA 4UBJA 4O25A 1X9HA 2WWFA 4V0QA 4OXNA 5H3LA 4WCFA 2O5RA 3BK2A 2LW7A 2ZVJA 3EZNA 1PHRA 1VKNA 1FDUA 3IKLA 3PGKA 4QBFA 4D9EA 1EX6A 4F6LA 3LNTA 3E05A 3PSHA 4QPNA 4CM7A 1PD1A 4BLTA 5JSFA 1TQ2A 1E3LA 3ELYA 2VTKA 2IW3A 1R6VA 3RU9A 4ZPXA 4UNSA 4P5PA 5TEVA 4R7GA 1OGIA 1ULTA 2PEYA 3KTDA 2PD3A 1Y7LA 1BHQ1 1DJOA 2BT4A 2QP9X 2WSLA 7REQA 2D7DA 1NP7A 2V7BA 2K4MA 4YUAA 4LYEA 1FEZA 4OFBA 4RLHA 5IJXA 4DR3B 2HADA 5CH5A 5AVYA 1CVRA 5JPIA 2PJDA 3GZJA 5FPKA 2FZ4A 3AVYA 3H5OA 2HEGA 1CZKA 5DKFA 2CHVA 5K03A 3RK1A 1Z6XA 2OGTA 5ALOA 4RTPA 3LTEA 5PGMA 3HRHA 1WVMA 3BSFA 3DAHA 3W9SA 5JS7A 1X8KA 2KB0A 1TJPB 2AKEA 3A32A 4JLVA 3H3XA 4UE2A 4ZI7A 1B8VA 1R16A 4E1BA 1XEWX 2ZP1A 4AKTA 1XZKA 5K6AC 4Q9IA 1TUBB 1N36B 3OZIA 5K3SA 1ML4A 3JYNA 2XBUA 4E2YA 2D2IA 3D6JA 1ZMBA 1QLWA 3ZLJA 3AHFA 4XFJA 5LIRA 3SE7A 3FWHA 1KZGB 3AUYA 1OSNA 4P4SA 1RAAA 3C7DB 4LFAB 1KYVA 3B3GA 5SYMA 1FYXA 4KOAA 2QTVA 3U56A 5HK9A 1TAHA 4L78A 3BJRA 1WB6A 1WP4A 4Y98A 3RYHA 4I4NA 2Q6TA 3FZGA 3O91A 1BE8A 1Y6FA 4D4MA 3A6KA 1M75A 3KX2A 2XWPA 2WYWA 4NBWA 2DQKA 3NXSA 4B83A 3PRKE 3LK7A 3R7FA 3ROGA 4D42A 2ZS7A 3FNIA 5KBYA 4D3YA 2Y9PB 4FFWA 4DR6B 3Q3EA 1CX9B 3QVLA 4XPIB 4OB6A 1OWPA 1EVKA 1F4VA 2BMVA 4BN5A 3SM9A 1GGKA 3IELA 3EIQA 2B3DA 1MC4A 2ESRA 2GXQA 4KTVE 2R2GA 4RAQA 3TLXA 3HCOA 3I01A 3SBOA 4AJLA 4BV8A 1MT0A 4HG2A 1X7XB 3ZQKA 4RD6A 5K7SA 3ZIDA 3DZBA 2R751 1BJTA 4TTRA 4ETMA 1G3UA 4Q4HB 4UCQA 3BB4A 2NYRA 4N3NA 4RTLA 4J1QA 1NI4B 4HRVA 3PX7A 1WZCA 1ZZGA 4ZI5A 5CAEB 4DWWA 3G2KA 3M4NA 2PRYA 5CEFA 1ARZA 2IU0A 4B4DA 2ZQZA 4BE4A 3MB8A 4TSRA 1CRWG 1X14A 2H3EA 3RKSA 3WLAA 3X43A 2WQ7A 1I5RA 3C8DA 4D43A 1SUFA 1VE5A 1ZYUA 4MWDA 4DQDA 4EY6A 4X65B 4ENWA 2LKCA 2WD7A 4EPWA 5D7BA 1GSAA 4CM6A 4MJLA 1OHHA 3H2HA 1OF1A 5BW5A 1NN3A 2ERXA 1BE6A 3BOSA 5JCPA 4KDCA 4E88A 1NC3A 1VJTA 5KSPA 3B5EA 2POCA 2Z5GA 1XTBA 4QIHA 5FQOA 5TPZD 4JWTA 5ALYA 3LIPA 1D2AA 1GZ4A 2P9BA 1T9GS 3CWZA 3R41A 1GLNA 2FFHA 4IXTA 4RZXA 4DM7A 1XPUA 3OJFA 1HEUA 1QYIA 1RRMA 2H59A 3HA5A 3TUZC 1ISHA 1CR1A 1V8ZA 2ERYA 2GYWA 2PT6A 3H4VA 3X1MA 3NORA 4WFKA 2AC7A 2Q3BA 2ZYIA 3KUUA 2P9YA 3AWIA 4IHJA 2WUWE 3PKJA 1SA0B 4NBSA 3H16A 4R1UA 2HF7A 4TSFD 1J06A 2P4UA 1JLRA 1FP7A 3P0EA 3D1LA 2BRUC 2I7XA 3TQRA 4AKEA 4BKRA 3JVUA 1Z5PA 1XYVA 5EKDA 4R71A 5JUWA 3REFA 4DMUB 4ARVA 3THSA 2PLAA 1C7RA 4GMKA 2R6GA 3LA8A 3D8BA 3DWGA 3IAS6 5FNVA 1RI2A 1X94A 2OESA 1QYCA 2VCEA 2HJWA 2AEMA 4P3NA 4RY0A 3INNA 5L40A 3UXEA 4BXOB 2AN9A 2OXTA 2ZJOA 4QYIB 1NJ6A 3G8BA 3LP5A 3NCHA 4I08A 2B3TA 5D84A 2BKAA 5T8KA 3O90A 3AKZA 1RBQA 1U11A 4HPWA 3K70C 4P53A 1T8SA 1K89A 3HXPA 1Q3TA 5AOCA 5DOVA 5EOVA 4O4JF 5GMOA 5H82A 3RK0A 4YUYA 1KTVA 2X6TA 2O8EA 3L8GA 4LNHA 4V03A 4X92A 5DGXA 1G3RA 2W93A 2DLNA 3PX3A 3PRHA 1YB5A 4JJKA 1U1DA 4KXXA 2AA3A 3N2KB 3REQB 3AFGA 3OCUA 2HT1A 3ZU6A 3H1PA 1P1JA 4KXQA 3FJ1A 3BGWA 4KV9A 2CUKA 3ZW8A 2I6SA 2DQYA 2J67A 2YBDA 1ZRHA 1G3MA 1UQUA 3RIGA 4ABTA 3STUA 1F0PA 1N7JA 2CB0A 3FOAA 4JLWA 1K97A 1W36C 1WBJB 1R5OA 3HUUA 3FFAA 4LISA 2PIAA 3OU7A 4TN1A 4DUGD 5KQSA 2II6A 5E38A 4PPQA 1K3UB 4FMCB 1Z7GA 2W9XA 1C7FA 2C2OA 2RGNA 5JAZA 4YRLA 4HN2A 5JFOA 1AGNA 3CRNA 5CW1A 2C07A 2JANA 1Z07A 1XDWA 4JQOA 1ZVMA 4RSHA 1VL6A 4RPKA 4AKSA 1JI3A 4WFIA 4B31A 1WXQA 2JHGA 4MZXA 1FDWA 1C3XA 5AVVA 4CCSA 2OWDA 3PFWO 1NZFA 4NOKA 4GGPA 1VL2A 1IPFA 4Q4CA 2L69A 1RYYA 5EFOA 1IBKB 3AKEA 1KJIA 1FTGA 2PM8A 1GNSA 3E8MA 3FOEC 2Z6QA 3ZDFA 4FE4A 2NUTA 3JQ9C 3QLEA 4REQB 3GJ7A 4ONEA 1KH3A 4N40A 4YMIA 2C7GA 2DETA 3ZJ4A 1NOKA 1WDLA 3IHWA 2WOJA 3EQ9A 4OMCA 4JLMA 4LFBB 4KLNA 5HTOA 2F4VB 2NPIA 5KI6A 1CQPA 1GTSA 5GQSA 1O6GA 1OX4B 1U6IA 5JS6A 3K2IA 2BEUA 2AYYA 3TXXA 3ZHRA 4B6GA 3UV6A 1KO1A 3WYDA 3L6EA 1E4EA 1NNUA 4E21A 1JSXA 4GVLA 4TT8A 5DWDA 3DOCA 1GZSA 2FLKA 2GD2A 2GZ3A 1Y5LA 4H59A 3DE0X 2D8AA 3R0VA 4LMBA 2AOWA 4Z4HA 1CUIA 2GBGA 3DZDA 1SCAA 1V1MB 2J09A 4HSGA 5T4BA 1G8PA 1AZSC 2ISQA 2Q5EA 3COSA 2RE8A 1XEWY 1NW6A 1ECCA 2FUEA 2FPOA 3AEQA 3NV7A 4BQIA 3ANTA 4RADA 2ATVA 2YIMA 1TCVA 1L5QA 3NHKA 4RMHA 5EINA 3VZPA 3ZDCA 3DCNA 5CM8B 1I4WA 2AFHA 2C4WA 4IRUB 3SSNA 2GM9A 1I0LA 1K98A 1ETUA 3QPCA 4POOA 5TGTA 3CNNA 3PPWA 4Q3NA 3W5VA 1QRTA 2XGGA 2VZ0A 1I36A 5DULA 2CFIA 1PLKA 4IQ8A 4JKYA 2N75A 5ITVA 4QGSA 2ZB7A 2C0CA 3EEQA 2I4NA 2X4GA 3A31A 1TYCA 4N8SA 3V7WA 2IU3A 5JDIC 4FSDA 1UKBA 3UENA 1Z4PX 2FPLA 3ESCA 3DOEA 3U3RA 1SCKA 1P9WA 5HZMA 1ZJZA 1X7ZB 4O4HF 3K0FA 4M76B 5KTTA 2R5NA 2ZBEA 3TKYA 4EJ6A 1H1TA 4EKNB 3BH0A 2PGNA 3RABA 5A06A 3PF8A 2GVZC 1HE5A 2QL9A 3B8HA 4FILA 2GXAA 2QKYA 3T1HB 1ZGJA 5F23A 1FNCA 2ZITA 2C04A 2O2JA 3I45A 4G97A 1MO6A 3AVQA 4C0HA 3IBSA 2JHFA 1KYQA 1SBZA 1RZRA 1SWWA 3UXYA 1SCDA 1UT8A 3FYCA 4II3A 4UTRA 3AHCA 3G2JA 5LVAA 2UZ4A 1RHMA 2VJOA 2BI8A 1CFJA 3JAWB 5CPBA 3VC1A 5KCMA 1GDHA 1I8TA 2KE5A 2G9NA 2GMWA 4CF5A 4TXJA 3V4OA 3MMZA 3K8OE 1Y6QA 2DPXA 4I9FA 3ON5A 1EUCB 3HU1A 1NW3A 1WHSA 1KY4A 1NTRA 4ZAYA 4I55F 3U1VA 4BQPA 3G7SA 4RW0A 3BXXA 1Z6PA 2HCJB 3HP7A 1HYQA 4B35A 4OGLA 1O58A 5FOSA 5B55A 1EXDA 2AMLA 3PHLA 1JHXA 3HJUA 3IO3A 4PWZA 4CZ2A 1CUYA 3JPYA 1GTRA 3NEAA 4M8NE 3RE1A 3RJZA 5GJBA 3D6UA 4W5HA 4G0VA 2PG3A 4JS0A 5FBQB 3O26A 3B1XA 1X7GA 3ILHA 3DVLA 4XQCA 5E6UA 1RKXA 1UQRA 4H7HA 1K9SA 1PWYE 2WSBA 3CUSA 1KZ9A 4L3WA 1Y1SA 2W2QA 1V4VA 1JF8A 3L46A 4EDFA 5E1BA 5FORA 3KUKA 4RQTA 4CL8A 2A5LA 4G5HA 5A5VA 2P79A 5ECYA 2XNCA 4DAOA 3IBFA 2PRSA 1A4IA 4V0OA 5K0SA 2Q3EA 4FOSA 2G5CA 1CQIA 4QXQA 4S12A 4XJTA 3UFXA 1A9RA 2DUUA 4OATA 2R4QA 4RIFA 4IOLA 1O9BA 3VFDA 2UZ0A 2PMDA 4WASA 4E2FA 3P9CA 3OE1A 3GLQA 1VE3A 3V4LA 1N7GA 1U0OC 3FY4A 4DJJA 2E2WA 4MV3A 4EVQA 3JARB 2ZS9A 1YE5A 3W8NA 4RTSA 1YJ8A 1PD0A 4EHKA 1PBTA 4JASB 2WDZA 3LXUX 2QF7A 2HKIA 1CQZA 5C9ZA 4HVTA 2FB9A 2XMZA 3F5SA 1GOTA 5FNVF 1GZ3A 5KO2A 1PJRA 1KQOA 4DLUA 4HF7A 4INZA 1X2BA 2QLTA 5HKKA 1MGOA 1JGTA 4BFYA 1ACJA 2O2HA 4RWEA 3HACA 2XVMA 4TQUS 3VTFA 3M1IA 2XUZA 4OO3A 1Z63A 3VKWA 1VDMA 3OZWA 4AD8A 3N74A 1CLEA 2Y1FA 5ENVA 2RBEA 3F71A 2VBGA 2YNMD 2AS0A 3WTBA 1XV5A 4A91A 1EFPB 3ER8A 2J7PA 3EWNA 4A5OA 1KE1A 2IY9A 1E63A 1YMVA 3BMXA 3WMRA 4IIJA 4JLAA 3MRSA 5ESDA 2ZUTA 1N3IA 4K9SA 1NV9A 3H9QA 1ONPA 1VG8A 4OU5A 2BKEA 5KNBD 2C7QA 1LVHA 3IVCA 3JQPA 3QMPA 4A5SA 4QVGA 5FXMA 4YP7A 1LQ2A 2XKJE 2OAQ1 2FN3A 5K3OA 3LUKA 1ZICA 1ZOIA 3E7WA 1M1NB 4MULA 1ISGA 3AUUA 4CMCA 3R3WA 1XQWA 1TYZA 4JVOA 4NJMA 5A1JA 2YWJA 2XSZD 2IEIA 2PUHA 4PC1A 3HJTA 2IUUA 2AW5A 4ENVA 1PS9A 1U63A 2WMOB 1GDDA 1JJFA 1WF6A 4GYYA 1G8AA 2V98A 2VSNA 3OT5A 4UNPA 2JDID 2BLNA 2DWUA 4YMWA 4B9EA 3PEWA 2X8JA 3UY4A 4IUBS 2GM3A 3KG2A 3EYWA 1FB5A 4GRAA 1QPGA 3ITNA 3ZK8A 4U3JA 2PZAA 4LE1A 2X77A 1V7QA 3H5LA 3HVUA 5LZ8A 4HEQA 5E3JA 2FNAA 4P93A 3NASA 4B4WA 4FHDA 2Q1TA 5FAKA 3DFZA 3QXGA 4CM5A 1YS6A 2O0MA 1DC7A 2QMUA 3AVOA 4RDHA 5AXBA 3PUYA 5KVSA 3R3HA 1UM8A 1ZUWA 4HNRA 4HZUA 4TRRA 3N7AA 1OWNA 4MDEA 3AFHA 3PTLA 1CUBA 2WLSA 4ENRA 4I8DA 4G0UA 3HCFA 3QFSA 2BAGA 3IIIA 4TLEA 1GUAA 1SVIA 2JATA 1EFRD 4K3UA 4R98A 3NH9A 1DDOA 4ZD6A 4MQMA 4UEWA 3K9CA 3G6WA 4UOZA 1BROA 2FAXA 4XM1A 3WISA 2OZKA 1MX1A 3ND5A 4KQWA 1DXQA 5AJVB 3VNAA 5BY2A 3KU1A 1U1CA 2NO7A 2Q2WA 2VPZA 2DHRA 3O3OB 4LTDA 4D98A 2E49A 3QX8A 3FVTA 5I7VA 5L6LB 3OIWA 1G55A 1GL9B 3DBHA 4HWPA 5AJWA 3NXKA 5KTOA 3K6SB 5BMVB 3EXG1 3K6RA 4LSGA 3R7DA 1F3LA 3EA0A 2M1XA 4H17A 5F64A 2YMMA 4KVAA 2AI2A 4U5XA 3LKBA 1Z75A 3HO6A 3RF6A 3LY9A 3OKAA 3QY0A 3RRFA 1XN1A 1P72A 4BLSA 3OKFA 3JRXA 3KJHA 4L8LA 4F9FA 5CDFA 4XDZA 1H2RS 1NVTA 4QU9A 4BLOA 5D8DA 2CCGA 2LDXA 4DTIA 1J21A 4BZWA 4ZCMA 2DUJA 1T0HB 4RKFA 1ZSNA 1LVUA 4E6PA 5JROA 1KYIA 2VHXA 1WEKA 5IM4F 1YUMA 2H31A 2J4DA 2X22A 3DDOA 4YNBA 1A7UA 4BQNA 6NULA 1RKBA 3KB2A 1T1JA 3WMXA 3IUYA 4FX2A 4HDRA 5KU1A 2WWWA 3EA5A 1QP0A 2IBTA 3H0CA 1FBTA 2JGJA 2ZROA 3LM8A 1MQSA 4GMHA 4OK6A 3SQLA 1X1EA 3GFRA 2A3NA 3SC2A 1U1GA 3H6GA 2ZRDA 5A3RA 4I9NA 1XHFA 2ZUCA 1WCYA 3V7UA 4W4TA 3CRW1 3DMTC 5HE9A 3C24A 1S3FA 3HH8A 4IJWA 5BWNA 2XUPA 5K8JB 1E58A 3GCDA 4OSOA 2PKWA 2GPTA 3EMVA 2RJOA 1XR3A 3E5MA 1QH1A 5FNVB 3RD5A 1R6AA 5C32A 4M38A 5FI1B 3U80A 1RQPA 1SOUA 1KQNA 3ETGA 1D2MA 2XKBA 3VR6D 1JHUA 2VHYA 3DT9A 5BT8A 1JZTA 1WAMA 4Z9XA 3ZJVA 4GXRA 2R68A 3DT8A 2VEOA 2PRJA 5DYWA 1HFKA 4DG5A 4D81A 2WB2A 3QUBA 2JAOA 3UV3A 1YA6A 3EUAA 4FJ0A 1Y1LA 4B47A 2UUOA 3CFYA 1P4GA 2RC6A 3IE0A 3P52A 1IJBA 2R3SA 2RHBA 3WFZA 3F8SA 3U13A 3GI1A 1D2EA 1QF7A 5SYNA 1Y1KE 2SBTA<