4P84A

Structure of engineered pyrr protein (violet pyrr)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
GSNEKAVILDEQAIRRALTRIAHEIIERNKGVDNCVLVGIKTRGIYLAKRLAERIEQIEGKPVPVGEIDITLYRDDLSVTSNDEPLVKGTDIPVDITDKKVILVDDVLYTGRTVRAGMDALMDLGRPSQIQLAVLVDRGHRELPIRADYVGKNVPTSKSERIVVQLDEVDQNDRVSIYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transferase
molecule keywords Bifunctional protein PyrR
total genus 53
structure length 180
sequence length 180
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p84A00
2WNSA 4M0UA 3GEPA 1BD4A 5ESXA 1ECJA 4P3KA 4P86A 4MB6A 1BD3A 1OROA 1XTTA 1G2QA 3HVUA 4Z1OA 5IAOA 2PRYA 1DQNA 1QCDA 4LYGA 4RAOA 1A3CA 1WD5A 5KAPA 3LPNA 1I0LA 2JKZA 1OREA 3OZGA 1R3UA 1J7JA 1G2PA 2H07A 5JV5A 1QB7A 5BRNA 4RHTA 1JLSA 2JBHA 4P84A 4QYIA 1HGXA 3H83A 4RANA 1FSGA 5ESWA 1P17A 1DBRA 4FYMA 1ZN7A 4RACA 2AEEA 2XBUA 1P4AA 1PZMA 2JKYA 1A4XA 2EHJA 1STOA 3ACDA 4LZOA 3LRTA 2H06A 1ECBA 4ZFNA 1IBSA 5E38A 4P82A 1CJBA 4PAWA 3GGCA 4WN3A 3OHPA 2P1ZA 1G9TA 1I13A 5BQPA 2DY0A 3O7MA 1QK4A 2HCRA 1D6NA 3MJDA 1XZ8A 1JLRA 4PFQA 2FXVA 3MBIA 5BQOA 1ZN8A 4QYIB 4LZAA 4RABA 1I14A 2PS1A 1OPRA 4TWBA 2YZKA 1Y0BA 1P19A 3DEZA 4QRIA 5JSQA 1I0IA 2GEBA 4P83A 1XZNA 3KB8A 1A96A 1VSTA 2H08A 3NAGA 1A95A 1O57A 2C4KA 3ACCA 1YFZA 1TC2A 2E55A 1O5OA 3M3HA 1L1RA 4X45A 4RHXA 4X44A 1NONA 2PRZA 4P81A 3ACBA 1I5EA 1GPH1 3GGJA 4IJQA 4RHUA 1MZVA 1QCCA 1XTVA 1A98A 1V9SA 4OHCA 5BSKA 1QB8A 4M0PA 1VDMA 3QW4B 5K51A 2JI4A 1U9ZA 1HMPA 4M0KA 1DKUA 3DAHA 4P80A 1LH0A 4WMLA 4RAQA 1ZN9A 1DQPA 1GRVA 1AO0A 4RHYA 1ECCA 1U9YA 3OZFA 1ECFA 1UPUA 3S5JA 1BZYA 1Z7GA 1QK5A 2IGBA 4RV4A 4JITA 4RADA 3N2LA 5HIAA 1G9SA 1L1QA 1QK3A 4LYYA 2VFAA 4LZNA 1ECGA 1VCHA 4RQAA 1UPFA 1UFRA 3DMPA 5KAMA 4F8EA 5IPFA 3G6WA 5HKLA 1P18A 5EUCA 4KN6A 1W30A 1DKRA 4RQBA 3EFHA 4JLSA 1A97A 1XTUA 1NULA 4S2UA 1TC1A
chains in the Genus database with same CATH superfamily
3BF8A 4E09A 1PGPA 1J9GA 3H5RA 1OCEA 2P9EA 3FUTA 5JH7B 2AFHE 1GR1A 1W1WA 4YJFB 1KR2A 4CF4A 1D6MA 2OQRA 3FB4A 5MFZA 1Q1GA 3JQDA 2R68A 4LJLA 4EYOA 2JRCA 4CODB 5F5XA 5ALFA 5AICA 4LBWA 1Y9ZA 3JQPA 2C7BA 4OHMA 1QQAA 5CVCA 3ZE0B 1YOBA 3KBBA 2J3HA 3ZK8A 1M2WA 5IARA 1T8PA 2I6SA 1XGKA 3LUBA 1ZG3A 4WVLA 3AU8A 2Q5FA 1CQXA 1EJ2A 1K0UA 4JC0A 4RQTA 4CM9D 4BXOB 1TK9A 4NK5A 1XP8A 5A05A 1JG3A 3BIFA 2MSWA 3H05A 4NJEB 4NSNA 5ESWA 5KDLA 4YRIA 1RXIA 2WSYB 4N5HX 3PQCA 2AMLA 3Q9UA 4TLEA 1IN5A 3D6AA 3MD0A 2PUFA 2R8ZA 1OPXA 1WNTA 4P3PA 5BURA 2BDTA 2PL5A 2LDXA 4LXIA 3OP4A 2Q8PA 1JHRA 3CLTC 2FOIA 2FWJA 3WNCA 2RAUA 4X6UA 4BNVA 1H69A 3EQ8A 4IHAA 1GA6A 1XTRA 1N2SA 3MWEA 3OHPA 4N9WA 5AI0A 5TPWA 2HSDA 2VAMA 1IH8A 1ORVA 2ADOA 2J5XA 5ALDA 5CX1B 4GBJA 2HA5A 4EJSC 3ADOA 1KZ1A 4YO7A 3GO4A 3OCYA 1H2BA 1YDEA 2VS1A 3B2EA 1JEAA 1NU8A 3HH8A 1TUIA 3KZXA 3O1HB 4MKRA 4PZLA 1E2PA 1X94A 2X3UA 4CU2A 5JS7A 1LFDB 2XQFA 1OLOA 1FNMA 4ROSA 3T95A 2WKPA 3VSAA 3BWVA 4QBFA 4UM8B 4EHDA 1MC5A 3DAPA 2NZ8A 3HZZA 3LKZA 3QW2A 1RYFA 2R2AA 3A8TA 1SBTA 5DTQA 1MF7A 4YBRA 1Q1ZA 3UAYA 2GRAA 4URZR 3DTVA 1J1IA 1PGJA 4G67A 5TQVA 4KN9S 6GPBA 2CJYA 4E32A 3IALA 5C4GB 3G8YA 1X2EA 3P52A 3CBGA 1E7RA 5ALZA 5JEEA 4ZGGA 2P35A 2X9LA 1L5RA 3AI2A 2EEPA 4J76A 3DNMA 2ZUTA 1I0ZA 2AFRA 1EQAA 3G02A 3TE7A 3WQHA 1I6LA 1P7ZA 4TTJA 4AJOA 1KI6B 4QUKA 3EPHA 1K88A 2G82A 3A05A 5TEWA 1O54A 1ODSA 1PGNA 5GM2A 3WHLA 1V7CA 4BO4A 2AG0A 4KXMA 2O06A 3EZ6A 4H1UA 1XZKA 2X4LA 2JJYA 1S2MA 3NKLA 4LYYA 1MJFA 4NQRA 4H6WA 4ARVA 3W90A 3KFVA 3SOPA 3VNQA 1CWUA 1CRZA 5IJ9A 4JI0B 5F52A 3ZDBA 4TS1A 2D5IA 1AY0A 3A9WA 5JNTA 1NXTA 1GNQA 1YE8A 3FWYA 3ZWCA 3WGTA 2FN4A 3KEOA 5BOSA 3TLGA 3HXPA 3E3MA 1EWKA 1X39A 4Z7NB 1JJBA 2WINI 5BNZA 3LZCA 4BO2A 4ZQGA 5AVZA 2H1SA 3ZU4A 3BJZA 5CA1F 1GQFA 4LY0A 4RENA 1CJMA 2RGAA 1R1DA 4HY3A 4NZMA 3FDFA 4QUEA 1C7QA 1RC1A 4XJSA 1C8VB 3BMOA 1QHGA 2M98A 4IV8A 3PYLA 4L5CA 4MRMB 3OFJA 3LOPA 3INGA 3P2IA 3OD5A 3PTZA 3QX9A 1KJYA 3GVXA 4RA9B 5FB3A 3QPBA 1NMQA 1GUBA 1GUDA 3JYOA 1CYEA 4MV5A 3ZBQA 2O6LA 4A3SA 4EG0A 5CAEA 4KMOA 2Q3CA 3OPYI 1KMNA 1ZYUA 4XWWA 2QUKA 3KYCA 2GXSA 4JNKA 1QO0D 1DRKA 3H2JA 3L0OA 4ZARA 3TRHA 3PPYA 2AFHB 3SSOA 4RM2A 4DIMA 5EJEA 5L3SA 2ZROA 3JQEA 4EB8A 4P93A 4ZJPA 1K5DA 3SC2A 2VHYA 1R8JA 2VAWA 3PKJA 3QITA 4M99A 4X1YB 3SNKA 1CUXA 4RH0A 4RCVA 3AZPA 5EQTA 3V1YA 5CP8A 3GT3A 1EINA 3VNAA 1YMVA 1ZNZA 5ADWA 4OJQA 2Q3HA 1U2DC 3VYTB 5DYIA 2AOUB 3TVYA 3UUFA 1YQTA 4ALJA 2ECQA 3DNFA 3QH4A 4L27A 1YIAA 2AMFA 3AXSA 4M9CA 4KSBA 2YCLA 3HGQA 2CN1A 4PYRA 4BO9A 3S55A 4YAWA 3N2IA 4IVNA 3FG9A 3G3EA 3O3NB 2YZMA 1JDZA 4MR9B 4B6OA 1PWEA 3V2UA 2W2KA 2ZETA 2OUKA 5EUBA 2TYSB 3O2SB 2IEDA 4Z9XA 2OAGA 3S2IA 1KI3A 1SBZA 1JB9A 3INNA 5KDOA 2HSEA 4RJLA 3AYZB 2W58A 3M9WA 4O4HB 2NYRA 4FUTA 2QAGA 4CIYA 2H1OA 1DFHA 2YRWA 3TW6A 3KXKA 1JDTA 1R4MA 4DCGA 3TH5A 4YUWA 1W75A 4MPTA 2XZTA 1ZSYA 2BGMA 3SXPA 1C4WA 1CEQA 1N8NA 2R96A 3JTEA 4NBRA 4EYEA 5BMVF 2N47A 4PM4A 5JIBA 2DUUA 3L1IA 4GKKB 4JC8A 4U63A 4FYKA 2K7ZA 4Y0NA 4UBMA 3BA6A 4K6KA 3VVCA 1O5OA 2GSDA 1WSBA 3PHJA 5AI6A 4JJ7A 1UDWA 4PPFA 3KSRA 1IYZA 5AP9A 1ULHA 1BROA 2QQGA 2C1EA 1JLLA 5C18A 5IHPA 3KTAB 2B5OA 3IP5A 4Q34A 3IO5A 1SGWA 5AKIA 2GF2A 1X42A 3N8GA 1JXOA 1SB8A 4CF5A 5LYYA 1KHHA 1QG0A 2BZ0A 2G8NA 4HQRA 4LDNA 3J7AC 2JHFA 3AR2A 1L4BA 1PNRA 1PT9A 2OCYC 3MS4A 5J2UA 3QLTA 1V4BA 1MXFA 1DX9A 1ZD4A 3GI1A 3L0ZA 3MTDA 2PCJA 1Z5OA 4OKIA 4IDEA 1HBJA 4ZT2A 3UGJA 1COWD 1S2GA 1TTTA 5E1OA 1E3TA 2ETVA 3F46A 5GQSA 4JITA 2PMKA 2YNMD 4F92B 1U98A 1JKJA 5K8IA 5BSTA 5JSFA 1OFTA 4INAA 3K16A 4DMFA 1LWNA 2I2CA 1OU0A 2VT6A 4GNKA 4W82A 5T3YA 3NT2A 4G0MA 3WDSA 3CE6A 1ZJYA 3EASA 3EBOA 5HKLA 2DR2A 4HDSA 3D4NA 4JJKA 4QL3A 3LPAA 5I4IA 2BVNA 4B3BA 3L7CA 1A97A 4O4JF 5JJBA 3ZJ5A 2OK8A 2DC1A 4TLLB 4AF7A 1W4BA 3IVXA 4A8HA 3QPAA 5LJIA 1V25A 1WCIB 1EP2B 3B52X 4KQKA 2KS6A 4PC6A 4X90A 1VJ0A 3URKA 4AIIA 4D3SA 5HYVA 2DXIA 2G4VA 1UWCA 1THZA 3GAAA 4KI7A 4OGGA 1RFLA 3CLVA 1U5AA 1FDSA 5ALXA 1AUQA 1BOOA 2YNMA 3OPXA 4UMVA 5IAOA 2A30A 2W6ZA 4KYUA 4LSZA 4Q1VA 2NLOA 3OX2A 4AZ3B 1AH2A 2X19A 5EIHA 3H4IA 4FHEA 4CCAA 3DWEX 1M1UA 3PUXA 3T38A 4CMJA 2OO3A 1QJCA 3KAPA 3OOSA 4JC4A 2BOVA 4TN5A 3GJQA 2H0AA 5F51A 3TCXB 4F72A 3JASA 1I2CA 1YE3A 1EDZA 1V39A 1WKBA 2I03A 2JBHA 3MTIA 4PV7A 3H6GA 2MR6A 3AEQA 3FPGA 3ER6A 1T25A 1J9EA 2RCNA 5T8KC 1CRQA 2ZRGA 2IH5A 3U9LA 2C59A 2QQEA 1E8NA 1EZ4A 3LO8A 5CNIA 3BFXA 2Q5CA 4L7QA 1A9RA 2V7BA 5AVOA 5B2EA 3IPCA 3T52A 1JLLB 4TYPA 5DYTA 1YBHA 1KFJB 3N3AC 5GP1A 2Q50A 2VRWA 2XQJA 5IKOA 4C7BA 1CY6A 2EJWA 3K9QO 1TL7C 5JXHA 1HEYA 2XTZA 1O2DA 3FYSA 2XZDA 5DX8A 1RS0A 2FPWA 5EKSA 3OBBA 1OB2A 1G20A 2D1QA 4OA5A 1L2TA 3ZVLA 7ABPA 3PJGA 2XNHA 4G85A 3ZWVA 1V1MA 3ONEA 4MI9A 2FSGA 4QXAA 3UMRA 4UQPA 3ZHQA 3PWSA 4KZPA 2GVDC 3DVRX 2I3GA 1PDOA 2EERA 4Z0HO 3DVAA 5B37A 5C52B 2QN2A 2VYQA 3JAKB 1ZGHA 3KK0A 3GVCA 2A0WA 4Q9JA 4LJYA 4QOGA 1S1CA 1SCBA 2OD2A 3THWA 1S2DA 1R9NA 4TTPA 3BHMA 4LDRA 2EWWA 2P2SA 2QTFA 3FCCA 4Y2RA 2CHUA 2D2VA 4D9HA 2VPWA 3OOWA 3ETNA 3K92A 2ZULA 3PC8A 4MV6A 4DDKA 1P1CA 4B33A 4PR3A 1F2UA 1XZEA 1JA0A 3OMWA 3OX4A 1DEOA 4LOIA 2P11A 4Z3OA 1SUDA 3DMDA 4FS3A 4Q39A 2ZQYA 3KPYA 2JGLA 3VNVA 3R0ZA 1NXXA 4HEA1 1YUBA 4E21A 3KLBA 3ZKAA 2P30A 4IJQA 1NMYA 2IX3A 1DBSA 5KTMA 1Z3IX 2N75A 5A3SA 3UGQA 1U8UA 4B3RB 5EJ2A 4G1BA 2CLCX 2CVFA 3ZWDA 4ZZ1A 4V0LA 2QN1A 1SHLA 1P5FA 1L3IA 1Z16A 2GBIA 5JWOA 1SKUA 1XV5A 1DXQA 1EBUA 4BP8A 3ENZA 1DQPA 1X74A 2IC5A 2PSHA 2WA2A 1YZYA 3BWBA 1X9IA 3PGMA 2G3YA 1NAIA 1DIAA 2MSCB 4D2IA 2IIQA 2BM8A 4C21A 4TRJA 4N8SA 2YZNA 5CYFA 2BGKA 3V33A 3DPSA 3LUDA 4CR7A 2XAAA 3F71A 5KIAA 1QK3A 2HPAA 4CMEA 2ZCUA 3VHRA 3GYBA 4LPKA 1PAUA 5KNDD 3AQ4A 3EVAA 3V7NA 4MS3B 1Y6FA 4PXSA 4JHLA 5IBPA 1U1FA 2WOOA 3OQNA 4A6PA 4B32A 2GM4A 2QJWA 2GCNA 3Q88A 3MIZA 4WINA 5A9SB 5BN3B 2JJQA 2WP8J 1CHDA 4WY2A 4QPJC 1ODTC 5HTKA 1MHTA 2WHPA 3BSFA 1E79A 4G0QA 4M0UA 2HRBA 2G0TA 3OEWA 5FNVA 3SU8A 1U8FO 3GDOA 4EYGA 3CT4A 2JA1A 1DO8A 4H18A 5IKMA 4Y9RA 3TZEA 4HUJA 1G41A 3JVIA 1PV4A 1XSEA 2A78A 2QN9A 3V48A 4CLXA 1X7WB 4IQ0A 1E2UA 3SQXA 1A3CA 3I52A 4F4FA 4OVKA 2JATA 4WWHA 3BCRA 3Q72A 5BR7A 1LDBA 4AJ2A 1MTOA 2BL4A 1JEQB 1R0CA 1U4OA 3O93A 4EW1A 4F2GA 5IJ0A 1M7GA 3AT1A 2HKIA 4RD6A 3MFYA 3LHKA 4TLMB 4QPPA 4ABYA 3JWHA 3L05A 3PNKA 1M5TA 3K31A 2YIVX 3VYSB 1BMTA 1EX7A 4PGAA 1L1EA 1IN4A 2PPVA 1IHPA 1J2TA 3C3KA 3V4FA 4BU0A 1R6XA 4Z4GA 2HV9A 3MTQA 3CF6R 1IXRC 5F73A 5FA5A 4QGSA 5JTUA 2QN6A 4JA2A 2JFHA 3ETCA 4GMXA 4E1VA 1V2GA 1LPBB 2FSIA 2I4OA 2OGUA 2VDKB 3F3SA 4IIGA 4LMBA 4MOWA 4Q4LA 1M0TA 4XOIA 4YV1A 2QJTA 3CVUA 3ETGA 3P9CA 1EVYA 4IJMA 3UMBA 1YHZA 1UKAA 4HP8A 2FZKA 1CE8B 3GGOA 1T5SA 3LP5A 4LCEA 3O47A 5DGDA 3FPBA 5AXCA 5HFNA 4MWDA 4AG3A 1AC5A 2AN1A 5JBIA 3DBHB 3OZTA 3UYKA 1A71A 1CUVA 1T3ZA 2I80A 2DP4E 4L9WA 1HZZC 1UCFA 1QKJA 3DZDA 1ZL0A 5DHAA 3M1YA 1CFJA 4HATA 4YCAA 3TQQA 2Q2WA 1OFIA 2YXDA 1KVUA 1WXHA 1LRJA 1SUAA 3RADC 1YO6A 3C5HA 1GZ3A 3O8BA 3COSA 1AQYA 3LDGA 2QUBA 5TS3A 1JAZA 5K2MA 4F5EA 4CIVA 1GTMA 2I0FA 2QBYB 3OT1A 4YP6A 2P6PA 3WBBA 2GRJA 5I6DA 2AX4A 3OWXA 5FAKA 2PBRA 2VPTA 2VSFA 1LSJA 3TQCA 4CQMA 1C3OB 3IE0A 5HG0A 1DAPA 2ZS9A 2ALJA 2GS9A 2H2IA 2QTHA 1HRDA 3KOXA 1LXCA 2X9VA 4M7PA 3UM9A 1MJHA 2ZTLA 3DL0A 1B4DA 4E22A 2EGUA 4F6CA 2D2XA 3DXZA 4UTOA 4H2DA 3TVTA 2K7FA 4RWZA 3HU2A 2A59A 5HF5A 1Q2UA 1FXWF 4BECA 4QU9A 1VFPA 2BKAA 3N5KA 5SZKB 3ZNPA 2BF4A 2YWEA 1VKRA 1JIUA 4E3WA 3FLBA 1HLPA 2GD1O 3GLIE 5F35A 1PI3A 1Q1EA 1PJ3A 1TPZA 3HI4A 3RVNA 2HM7A 4ZMRA 2EOAA 3D8SA 3KR1A 3TPFA 2WHYA 2GCOB 1UJ4A 1R00A 1UQTA 1KYQA 3D5TA 1TT5A 4YJ2B 4KE9A 3D2LA 2J87A 2X4GA 3FSRA 3HPQA 3IPAA 2H2DA 1BCSB 1FYFA 1Z0SA 3AOEA 4ENPA 3ZHSA 2VXBA 5K3EA 4KXLA 2PJZA 5HS6A 1VL2A 2L2QA 1IWPB 4X6XA 3I0ZA 5SZJA 3SEZA 1MFZA 1ZLXA 2XB4A 3DT8A 2UUOA 1FDRA 4BC0A 1O87A 1P9OA 5BN4A 1AUOA 1NURA 1OAOA 1GUFA 2VPZA 3HU1A 4M9UA 4RK1A 3T3MB 3TXAA 4BJ5A 4E2FA 3H2GA 2WQZA 1SUWA 4NP6A 1QVRA 1EJBA 4YCJA 1VBKA 1GZ7A 2AVNA 2FPPB 1EWYA 1DBQA 4PQYA 2X9NA 3OEYA 3H5TA 3PDHA 5C1DA 4IJVA 1A27A 1O96A 1P9RA 1Q7EA 3C8HA 3PP8A 4KPUB 5K4AA 1P7PA 1XJ5A 2PX6A 2PY6A 2YWGA 2P2DA 3K1TA 3KQYA 3LVBA 4IJKA 1MN6A 3ZDYB 2IYUA 3N0TA 2Q9BA 3IA2A 3O8OB 1PZXA 4NBNA 4QLOA 3NDJA 4QUHA 1YBVA 3L93A 4IRUB 1JJAA 2B8NA 4CLRA 5CVJA 5J3JA 1G3RA 3MJTA 2GNOA 3HO8A 3NV7A 2AJTA 3B38A 3T5MA 2O8BA 4QOEA 4OUDB 2ZYGA 3UV7A 3ZHBA 1FQWA 2EHJA 3DWGA 3OQIA 3OZAA 5AVUA 3KFXA 4HDMB 4YCNA 2C4MA 5A03A 4K7JA 4MIEA 3IRUA 3P9SA 1GPBA 3HJFA 3P7MA 2JCVA 1ODCA 2C2WA 1NVEA 1WMBA 4YROA 2O7NA 3G2KA 5C7YA 4F2WA 2J9FA 1M34E 1QIDA 4EPYA 1P4RA 1K63A 2Q2VA 1DLJA 3L7JA 3MJDA 4IOLA 4WLFA 2J5RA 1XTIA 1FPMA 1SXJD 1VIYA 1GGNA 1JAIA 5L7YA 3ZBPA 3HTXA 3FAZA 4IXTA 3G23A 2FFJA 1RFGE 2DM6A 3S1LA 4DLBA 2BFEB 1K97A 4CFSA 1BCSA 3ZTWA 1YB5A 5T6BA 1D1QA 5DP2A 2HQBA 4LWZA 5DM0A 4D8VA 2XMZA 3V3KA 1TA0A 2OP0A 5CH3A 5EWLB 4CV3A 1V11A 4EHFA 4J0GA 3WXBA 3X2EA 3MRVA 3C7DB 2GM5A 2DMRA 4OHYA 5FOVA 2E55A 1CQWA 2R6HA 1XJQA 2WHQA 3JQ7A 3N2NA 4JXJA 4IILA 1UBOS 1SOAA 2GHQA 2O0KA 4HB0A 4BVAA 2J3KA 1M33A 3LT1A 3RS4A 4YLYA 2ODQA 3V2IA 4L2IB 4DLYA 2W2XA 1NVMB 1OX6A 4WCVA 1ISSA 4E6EA 1D0SA 1NT4A 2MSLA 3QUAA 4ZT4A 4JB0A 1OYWA 3WGVA 1WLSA 1ZH4A 4UPEA 1KWGA 3UPTA 4ZYZA 4P5EA 3W78A 1G1AA 1DOAA 1H6BA 1I2DA 3ADPA 4BO0A 1GJRA 1UKYA 2W2TA 4RHYA 2I2BA 5C1IA 2YMMA 4JBHA 1KNXA 2I4LA 2K2QB 4KG7A 1KMHA 1ULTA 4W8HA 3M9XA 2VNAA 3K05A 2GN0A 1BVRA 4I9FA 3RHSA 3Q4GA 4FE3A 5B3AA 4BKRA 4E2YA 4DEYA 5K05A 3F73A 1LUAA 3TSOA 3IPRA 4LBZA 4ALIA 1OR8A 1VSBA 4LXQA 4K9QA 5EJ5A 5IF3A 1IZZA 4LFAB 4COKA 2CDBA 4WCFC 3IV7A 1GFIA 2PWYA 5AM1A 1Z5WA 5CFNA 2DE0X 1C9YA 5B4UA 3LCJA 3ICCA 1TT7A 2GXUA 4COOA 1B14A 4DTIA 1ITZA 5BSRA 5A4DA 2NXEA 4E5UA 4TRRA 3WGUA 3L1VA 1RRFA 2LNDA 3PGXA 3PL5A 1UADA 4KWHA 3JARA 1WBBA 1DC4A 3AEKA 1H5NA 4CKBB 2OORA 1GA4A 3PI6A 4LOJA 3JVEA 4UTPA 5CAEB 2O3QA 5FTKA 2MYUA 4A9AA 1L7BA 4AICA 1YR9A 4PIMA 2PPLA 3CT6A 3RYFB 5JW6A 3NM6B 3K6SA 4J0IA 2QVCA 5A4KA 4LK3A 1YE5A 3QQ5A 3HA5A 3KPJA 1Y33E 1Q6ZA 1F0NA 3N05A 3Q2OA 3TRIA 2J0UA 3V1UA 4MW2A 5IH7A 1QC5A 2GK6A 2BFFA 5A4MS 1ZKMA 3LT2A 2E3JA 1Z4PX 2FV8A 2I1LA 3ITKA 3KYJB 1AT1A 4UNNA 1IN8A 1PTJC 1TIKA 2LIVA 2WYVA 3G5MA 3R6DA 5FWXB 2F9FA 4ENSA 1UM9A 4IVRA 2WJVA 4J0KA 5ABPA 2WEKA 3NALA 1T9KA 4J90A 4A8JA 3EHEA 3O8CA 3RAFC 2CNOA 2ZRIA 2VYFA 1F3LA 3SSNA 1LNSA 4N5DA 4HLDA 3WQSB 4V1CA 1I3OA 2QL6A 5EIXA 1W5AA 3VJKA 4IXMA 1PK8A 1ESZA 4L16A 3VO9A 4MGYR 4YT8A 4O02B 1SFRA 4Q9KA 3B3QA 4RK0A 2DHQA 1A77A 4DR1B 4RSHA 1PDWA 1T0JB 4HH1A 2UZ4A 4LY6A 4XB1A 4CKCA 1AS3A 3RG8A 4AY5A 5DLPA 1W4AA 3H8JA 3OQVA 5BYBA 3QLUA 3AP1A 2EX4A 3L4SO 1P19A 4FEYA 4I55A 5I7OA 3G0BA 3RVOA 5D1NA 1C0PA 1TW3A 4UDOA 1W581 2OFOA 5IULC 4NBUA 3KKMA 3W8RA 1XF9A 4R5MA 1T2CA 3NETA 4F6LA 4EO7A 1OZHA 1ZNWA 3NBUA 1P29A 2I8CA 1S6YA 3OE4A 1G5QA 2PQ6A 1X8XA 5FX2A 3GN2A 5HPYB 1CUGA 4TMZA 3P94A 1ZD1A 2PFSA 3JARB 4U0KA 3QFFA 1C14A 4D0NA 1QSGA 4ZQIA 3RCBA 1BGXT 4BY9E 1E2EA 1Y81A 5KINB 4D26A 4FGSA 2INGX 5M3BA 2QHXA 5AUPB 1F7UA 1PT6A 2ZE8A 5TRTA 2D2IA 2R6R1 3IEIA 3JYPA 4ME6A 2JANA 4U2BA 3BXOA 5FPTA 3TTWA 1FUEA 1YR8A 5L3ZA 4AYWA 1C0IA 3IMKA 2H6EA 5CYOA 1XQ9A 1Y37A 3STTA 2AUMA 2OT3B 4JJ8A 4IMRA 4UUOA 1JQAA 3BDAA 1YFJA 4P53A 3LZ6A 4PO8A 1F51E 3PNSA 3T0GA 4ETWA 1N2CE 4DC1A 4ML3A 1PYGA 5D86A 4JVSB 1T1RA 1TM4E 4I6JA 3LD9A 4BQEA 4F3YA 3WTCA 1W8IA 5KTOA 5KNLA 1KOLA 3ZHOA 1KQPA 3ZX5A 1E3WB 1V3VA 5FUWA 2ABWA 5HKOA 1H4TA 3NPMA 1T35A 5KB3A 2FDCA 1H3EA 4TPKA 4H35A 3ZHYA 4EKEA 1P7WA 1YC5A 1E9RA 1H2FA 4O8CA 1ZD2P 2P27A 1QYDA 3A3YA 3INTA 3FVWA 4TZKA 1PD0A 5JSUA 3HBNA 2CCJA 4UXHA 4G4JA 4BQIA 5THXA 4RK4A 1P6XA 2JLXA 2XGJA 3CEAA 1F1BA 2PMWB 4A7PA 1EFRD 3OZRA 3KSAC 4M1QA 1GSOA 4NQZA 3NEPX 3S2SA 2G0AA 1ATZA 4MUBA 2JGJA 1FFHA 3CZ9A 4QUDA 3IIKA 5JV5A 1JJIA 1IXSB 2HRCA 4MTLA 4DR5B 2PJRA 2Y1OA 3OAAD 3O1IC 1BC5A 1KJNA 3P20A 4BKPA 2FPRA 4RGVA 1KDYA 2Y67A 2O1WA 4UULA 3DKKA 4PCUA 4NCBA 1RAHA 1UBSB 3DBHA 3F67A 1O08A 1G3UA 4XI9A 3JQ9C 1K8QA 2GERA 2IYQA 1KI1A 3QNUA 4WZBA 3NFRA 2BELA 2AH5A 1I2AA 1ZH0A 2B8TA 5EXTA 1EFRA 3ULKA 5CG1A 3R6TA 4FLFA 4MI6A 3WKBA 2B3TA 3QJYA 1G20B 4RBNA 1UOEA 2J07A 3I73A 1U3DA 1UP7A 4PLPA 1F0PA 3PC4A 3PLRA 3ZIDA 4MUXA 3TUIC 2UUAB 4NYIQ 4O4IF 3MHPA 2HBQA 2B34A 2JGIA 1C1DB 4MA0A 3M34A 1XU9A 1W4RA 3H65A 4DCTA 4OQXA 3EGDA 3BZBA 3KTOA 2JBAB 4YQZA 1YMQA 2JVJA 4MVJD 5B6PA 4C43A 5GZ1A 3HCDA 1E6EA 3LXMA 4MO9A 5K0FA 4PSKA 3RTCA 4OBBA 1JDPA 3LHSA 1M1XB 2Z43A 3NDRA 4V38A 3RKSA 4LE0A 3QSGA 4QLBA 3LPDA 3HL0A 2DB3A 3M3PA 4UM9D 4FNAA 2RGXA 1AB6A 3UJAA 1M6HA 2I2XB 3NHUA 3OF2A 3IR5A 4GM0A 4OGLA 1Y8CA 2BCGY 3C85A 4EG5A 3IA7A 3IBTA 2XUQA 4RU1A 5CBPA 1O9HA 5TS2A 4YV2A 1W5TA 2A5JA 3PFWO 1QVAA 3CX7A 2W2MA 1NM5A 3IAHA 2Z4TA 4UNIA 3KQLA 5DHQA 2R85A 5DYNA 3B3JA 2AHOA 3GQVA 3HPRA 1PU2A 1RBYA 3DV9A 5EPOA 2XB2A 2WAMA 4A36A 5DBIA 3EZ9A 5BSFA 3SOZA 3STXA 4G0WA 3NHFA 1IQ0A 3X3HA 4I55F 5AOAA 4PG5A 1G38A 1OGJA 1P5JA 5HF6A 2FPOA 4GZ5A 5DNCA 5HIJA 5HIAA 2D7DA 3NIGB 4QO7A 3MUFA 3VGJA 3CZCA 4R81A 3VR2D 1XL0A 3RQIA 1C3VA 1MJGM 2YC2C 3FLMA 5CH8A 5IMSA 1PSWA 4GR5A 1N2CA 2NYVA 1N57A 3FJOA 2JLZA 5B57C 2VP0A 3CPSA 4JLSA 1EAYA 3KAKA 3JYQA 3LS2A 1J97A 1JXAA 1UMCA 1F60A 2NQ8A 5GVRA 3VR3A 1E1NA 2C5FA 3U2QA 2I3BA 1V71A 4ZGBA 4KPYA 3K73O 4CIWA 4MDFA 1BXZA 1Q7CA 1YL6A 2W6OA 4JX9A 3D02A 3ZU6A 2V96A 2WJWA 4R3WA 5C32A 1GY8A 4IP0A 4R2WA 5EEHA 1U7WA 1KK1A 1VRCA 2A35A 2XVZA 3HLYA 4IZ6A 1ZOOA 2PFKA 3G49A 4R8KA 4UNQA 5AO9A 5KDDA 2YOGA 4FYPA 1I2BA 3FMVA 1FNSA 1Q77A 3BEDA 1U65A 2GK7A 1RI5A 2RGBA 3F78A 3E8SA 3I9V6 2VSNA 3HCRA 2A5GA 2J3QA 1MD9A 3NATA 4PX3A 2GPBA 5JS6A 4ZVOA 2QSZA 1XN1A 3HN2A 3OD1A 3DOFA 1BIFA 2BFMA 1KY3A 2ZAYA 3JXEA 4K81B 4ABTA 2M32A 3ZJVA 2Z2YA 1T8RA 4OQMA 3F5MA 4TXMA 2QXUA 2FMKA 2AEEA 2IXEA 4MYTA 2ERXA 1P74A 1H8HD 2YXPX 3CEJA 1TVMA 3CUUA 3O3CA 4P4UA 5JLAA 3DDOA 1XEWX 2UZ0A 4QUIA 1ND5A 3LQ2A 4YMLA 5ED0A 1SELA 3AUSA 4TV8B 4DYHA 3LYUA 1PQ4A 3PUKA 1YS6A 1E3DA 4Q1AA 3VR5D 3R5KA 3RU9A 1E2NA 3ZVRA 1G6OA 5U1PA 5F1OA 1FW8A 2OHJA 4F4DA 1EVEA 3A32A 5A6SA 2FSVC 5BYAA 4V1CI 1O95C 2P3QA 1I7QB 1KEVA 3PIIA 3A1DA 4W8GA 3A6EA 5BWMA 2XWQA 2VJMA 1Q0ZA 5B1HA 1KZHA 1JG1A 4TL8A 5HOQA 1V47A 3HQ4O 1MX1A 2X7XA 5JNRA 6ADHA 2OHGA 1TMOA 5F2KA 2Q5JA 4Q7EA 3V8PA 1TK2A 3MRTA 2AR7A 5BWBA 1YIOA 3TRDA 1RXWA 1RRKA 2D1RA 1SIBE 4MRNA 1Y9AA 3USES 1N5KA 3V97A 2QDXA 1TQHA 5CBKA 6ABPA 2PD4A 1TCVA 2J7KA 2NV2B 4I1IA 1HFWA 2CVZA 3ZLTA 4KQXA 3OHMA 3A2LA 1R0XA 2BM1A 4FFVA 1Q21A 1WF3A 3ZBUA 1KMIY 2JCSA 1KYTA 2EL9A 5LB2A 2YQ4A 4Y2XA 2X8WA 5FOXA 1KZGB 2FUG6 4FS8A 1II8A 2WTBA 1ZK1A 2ADFA 3DB2A 4LYFA 4WLEA 4WLVA 3T1NA 4I3HA 2GDZA 3TEMA 2REQB 2YIMA 4U7GA 3OE5A 1A98A 3C3CA 4W99A 2BF7A 3SEFA 4YMUA 2FHSA 3W9BA 3KYDB 3IEXA 2JI4A 2VQ6A 2W48A 5LMNB 1JG7A 4CV1A 3V8VA 3K0EA 1UJ2A 3O73A 2Q0QA 2O1EA 2Q1SA 3E03A 3K8OE 4O33A 5AKGA 2QI9F 3A6HA 4G2TA 2ZTSA 2JBWA 3STHA 4UHCA 1ZIXA 4FGLA 4UATA 3MIIA 3E0XA 3SDBA 3VO2A 4A5SA 4F6RA 4HVCA 2QLJA 1QX3A 3L6BA 2IP2A 2JDID 4EO9A 4F2DA 2RJ3A 4I1PA 4CL2A 2AN5A 3O2NA 3RF7A 2IS6A 4Q05A 1XCMA 2C2HA 5CNJA 5K3FA 4F3NA 3ISVA 2XTJA 4WBNA 1FL9A 2WBLC 4WBNF 4UMFA 2FPGA 2EZ8A 5EE9A 2XMCA 2FFHA 3TZCA 1RYNA 3COJA 1P5HA 2F17A 2R65A 2ZUCA 3A6ZA 1A9PA 3MTJA 3U3OA 3G17A 1QWOA 3U81A 3IOYA 5LBIA 2D0IA 1Q91A 1Z62A 4A6DA 4RESA 3C2QA 4M89A 5WRFA 2VZ9A 4CQMD 4HTFA 4FFRA 2V6GA 3M8KA 3Q8MA 3H42B 1DTWB 3V4ZA 1WRBA 4IO0A 5KJEA 4GYWA 3UJ7A 1APBA 4EZBA 3K1YA 3ICVA 2PWZA 4DWWA 1YASA 1T9GS 3BMQA 1YGPA 2WW8A 2WT4A 3GFFA 3K15A 5E6SA 2VJOA 4OP2A 2FUCA 2AFIA 1TF2A 3JQBA 3QXCA 4EVIA 1DIHA 5JMOA 3KPVA 4REQA 4C4OA 1BXRB 2YQ5A 4XGQA 1SHUX 3SHWA 4NI5A 1ZM7A 3QHPA 4U4AA 2CHGA 4DA7A 5DGCA 4DMGA 2PFGA 3EMKA 3PQFA 2OK7A 4YP5A 3N2GA 4QPCA 1YZQA 3CSSA 4IYRA 4ZJYA 1G21B 4YAIA 1TAUA 3O83A 3HVRA 1P1BA 4HQNA 1XRNA 2QPTA 3EGOA 3BWXA 4AK9A 2BSQA 3T12A 4D81A 4DRYA 3DJYA 3DF7A 4ESOA 2XODA 4ZYXA 3IIEA 3AXTA 2YVUA 4Y9SA 4EEKA 1U5BA 4BKOA 3R4CA 4N47A 3GDGA 5H83A 1DE0A 2QTMA 1I9CA 3W0LB 2QENA 1LBIA 1ABEA 3SZRA 3A1NA 1GCOA 1SA0B 3CUKA 3V6MA 1DI0A 1DTSA 1N9GB 1SBYA 3SR0A 1A9OA 1WQ3A 3N2KB 4BMCA 4C01A 1SVMA 4L75A 5AVYA 2HSJA 2PMCA 3LPLA 3VMMA 3FWNA 1QKIA 4DSAA 3CSDA 3EOBI 4QT0A 1DKNA 2ZU6A 3OWOA 4P0PB 1RZRD 2Z1MA 1E2QA 4ZOLB 3CURA 3QBTA 5BPHA 1X8KA 1E7MA 1B43A 3TO5A 1NF2A 5H68A 2HJHA 4PC3A 1X70A 3ZV4A 3M4YA 2PGLA 2ZDQA 3MXTA 3I1JA 3S2GA 4BL5A 1EHIA 3II6X 5HJ5A 1J49A 2OAQ1 4QECA 2PX4A 3MVEA 4OAQA 5AJTA 2HFKA 1T9GR 2IE0A 1TJ4A 1BKYA 2HZ7A 2ISCA 3AUJB 4FVTA 3TN7A 4BQRA 3CVXA 1PR5A 5CLJA 1U2TA 2H1HA 2P5UA 3DM5A 1J25A 1N0IA 4LRXA 2HDHA 4L3VA 2M2IA 5IKXA 1I7NA 4TSKA 3X2FA 2VJNA 3SWWA 3T54A 1J2YA 1O96B 4W5TA 1EEHA 1FSPA 3U4IA 1C3JA 1TZJA 1E7YA 2O1XA 2EW2A 3ESZA 4G26A 4YALA 5C5IA 5JEDA 1MO5A 3OLYA 4ERXA 2E4XA 5D6OA 4FTWA 2G1KA 1BXGA 4I5EA 2HAEA 4BGVA 1P0FA 1WL8A 2UYOA 5B5SA 3G6WA 5J58A 4KNWA 1O6FA 1V8PA 1XYYA 1KE1A 2VNJA 3CIOA 2ZT5A 1LF5A 3JY6A 1M1NA 3E27A 4ZTBA 3ZJUA 3UKJA 1XA0A 4CM6A 5CGQB 4D4LA 4M0MA 2QL7A 1YB7A 3I0NA 4IMPA 3WICA 1ULSA 4KQ2A 4DCJA 4GICA 4CE6A 1PFUA 3AI3A 2KPOA 1DPFA 1JZTA 3KAQA 5HJ7A 1NASA 4Q7MB 1UBTS 1IU9A 1CTQA 1W5FA 2IHBA 3TAHA 4FMDF 3ZS9A 4YP9A 1T3LA 4AWBA 2I6GA 3ENKA 4BRZA 2VK2A 2XD9A 2GXQA 2OM6A 4TT3A 1FCJA 1JQKA 4WT7A 4XPIA 3HU5A 1NP3A 2DAPA 5EQDA 5KAPA 2VYVA 4DBZA 4NCKA 1BMDA 1QQ7A 2Q1WA 1ZMXA 3U7HB 3GLHA 3OFNA 1NC1A 2CYBA 3K4QA 5AJVB 1BX0A 3G88A 5AJXA 1G8YA 2I1WA 2P1RA 3C7TA 1FQOA 4OOEA 4YAFA 2XUGA 4MMYB 1C7JA 4PC1A 4YRLA 4ZO8A 1TCBA 3U7JA 3WL3A 3ZV6A 1FNCA 1G4HA 1KAEA 4AJPA 1JEYA 2IP4A 5LJLA 2OB2A 2PZAA 2F43B 3WMEA 1B6SA 2FQXA 4DNXA 1N4AA 5CD1A 1E3SA 1ZUD1 2CC2A 4EAAA 4UCXA 4HLQB 3AETB 4P0QB 2W2NA 1PUJA 1R66A 4M2LA 3L9WA 4OSOA 4RS3A 5HIMA 5TDHA 3RVQA 1NJ1A 5F1KA 3CB2A 3SFTA 2Z8ZA 2EIXA 1RP1A 1CNFA 4EUKA 1G20E 5EKUA 2AG6A 4JLAA 4FFLA 3QSYA 1Q92A 1IIBA 4M9RA 5IC4A 1E6CA 3B8EA 3NAMA 2NU9A 4IHJA 4RZUA 5BV7A 1N6LA 3GQBB 3KDAA 5IHXA 4KR6A 1Y4DE 1SCUB 1F6BA 3ZLVA 3CG4A 1RM5A 4ETIA 3R74A 2AQ8A 2I76A 3D3WB 4DCCA 2ZRCA 2DFNA 1KZ6A 2BTQB 3DE7X 2XNJA 2VJKA 2CXPA 4ILKA 4L28A 2DKNA 4UAUA 10MHA 4IJ5A 1XZQA 3I5XA 1KETA 4J2OA 1O94C 1CZRA 1RBZA 1VL0A 3DFKA 4MS4A 4QRDA 1NBHA 2FP4B 3MWYW 4FEAA 6Q21A 1J0EA 1Y7TA 1DAEA 2C77A 1NUHA 1JJFA 1H6AA 1DS6A 3FE2A 3MTGA 4OI4A 4YMGA 5JAIA 4BFTA 3AR6A 2NVWA 3D0RA 3PNOA 5DEIA 4IGAA 1NUPA 2UV8A 1KIAA 5ILQA 4BKMA 2DERA 1SVOA 2ET6A 5IJXA 2VTKA 1YJAA 1V1RB 1D2AA 5EKTA 4ZZ0A 2FPLA 3MQ2A 2CVQA 1T8WA 2PZGA 3WLLA 2O5VA 2WSLA 5FOUA 1SKAA 2E9SA 2RHTA 3DXYA 5HP4A 3RFVA 2Z98A 3QBVA 1ZS9A 4ZTUB 1E5TA 1VHDA 2NM0A 3TMYA 2HF2A 1MDFA 4F8EA 1MW9X 1Z7YA 1WUJS 3H11A 4IKPA 4YJ3A 1OV4A 1ZO8A 1DT5A 3B5EA 1D8TA 4GHWA 1WXWA 2LUOA 1I3LA 1W46A 1E66A 1TLFA 1ZN2A 2Q8QA 3A2MA 3GVPA 3EUWA 3S4YA 1FEZA 5FOSA 5KPDA 1CX9B 3EA0A 4ISBA 5KS2A 2A5DA 4ITRC 3B1WA 5E6UA 4Q9HA 5I7RA 2PUTA 3K0SA 1JFTA 2VTBB 4PU0A 4QAJA 2XNDA 3PQ4A 3HCEA 2CVHA 1IONA 3LA6A 1R9JA 5LB4A 1ENYA 4GBED 2QGFA 4RD1A 5FWDA 3RU7A 4K9PA 2C2GA 2J6BA 4GX0A 1EK0A 2LZ0A 5BUCA 2OM2A 4OLHA 1E5DA 3AOEC 4BV9A 4GECA 1DAOA 3AINA 4FZVA 1P3JA 5JVDA 2EZTA 2F1RA 5EJAA 2V5UA 3GIDA 5CT5A 3PDJA 2P6OA 5TEVA 3ZZUA 4YCCA 4X00A 1YFLA 1ZMRA 2CV2A 3FCYA 5CCEA 4L5IA 4GOND 4JD5A 4W7IA 4XR9A 4FLEA 1J33A 3F7OA 3W1EA 2A4KA 4Z4IA 3P27A 3O95A 3WISA 1RQ2A 1GGMA 2C5AA 1C2TA 3B1KA 3G8BA 2H4YA 2JRLA 1O5IA 4IHJB 4U7PB 5FULA 1Z2DA 2NU7A 3GBVA 5DH9A 1FDUA 3OF3A 2YZ2A 4YDSA 5I9IA 3KKQA 4KFTA 1JNYA 1E3EA 2IVFA 3IUSA 3IUNA 3UB3A 1Q12A 1PW7A 1GKIA 2G83A 3QMVA 4MCIA 5TC4A 5TXGA 2UDPA 2G9VA 1M0WA 1NLYA 2UZIR 2XOEA 3D7SA 1MFPA 1FXSA 1P4GA 3TIFA 5IN4A 3R0JA 4CNBA 4JGIA 2EV9A 1QB7A 3KSDO 5HVNA 5AW3A 1NI4B 1B15A 1DJMA 1QVVA 1CJTC 1E3IA 2DULA 2GR9A 2V59A 3BSSA 2VHQA 1GTJ1 2W2QA 3FZYA 5LD2C 4ENVA 1Q0HA 4YO8A 2QX4A 1ZBDA 1JSLA 1I36A 1JHXA 1E2HA 3CTPA 5G4KB 4ZOAA 4IFTA 4CI9A 1NNI1 2OYSA 3D2AA 5B53A 1L5OA 1TMKA 4B2LA 4BP1A 3TEJA 4YCSA 2AKEA 5JJIA 1RTTA 2QLNA 2QT9A 5HF8A 3G2NA 4A8PA 2UU9B 3ZY2A 5FYQA 3VU9B 1WSWA 2C7GA 2XEDA 1NF9A 2NZWA 3JWEA 1OA1A 1K2VN 1GDDA 3UHPA 4PAWA 1ZMBA 4G5HA 5EHXA 3FFXA 2CSXA 2BR3A 4RVDA 1JHYA 2AE2A 3MQFA 2KYRA 1T4CA 4D0SA 4B6JA 1U9IC 2GD0A 1V2HE 1MB0A 4YRTA 5K8TA 4BC1A 3VR1A 1GNPA 4JUDX 1P6QA 5TR9A 4G01B 1X1EA 3FNHA 4Z51A 3PCTA 4U2KA 2G06A 4NJOA 3A9TA 2Q7OE 1ZU5A 4WZ6A 2G72A 1L4LA 3HJNA 3UT0A 1F06A 3F1LA 2GN9A 2ICAA 1N8TA 3GWGA 4PS1A 5FUYA 3W6UA 1ISIA 4Q7LA 2JLAA 3GDWA 1I94B 2C83A 3H4MA 3H2KA 3PXDA 5EC8A 3VUEA 3PUYA 1HT3A 4WCDA 5GIOE 3OMLA 4OJMX 3O8LA 3B1YA 2RAPA 4P83A 2BMDA 2PM8A 1IZ9A 3EC2A 5GV7A 3QPCA 5HKKA 1O9BA 5K3SA 1NJ6A 3KQUA 2AIRA 3F5SA 4EEXA 3UCXA 1RXSA 5FL7D 5JQGB 1OXVA 3DAGA 4ZCPA 2I6XA 4F6RB 1JSXA 2JLCA 3O2JA 4TUYF 1WUTA 3LT0A 4FDLA 3I6QA 4NLLA 4YC7A 3SD7A 3ZWNA 4AX8A 3C7AA 5DP1A 3DZIA 1NXWA 3DFMA 1Q3TA 2IUSA 1XLTA 3KJNA 4JBNA 4UHEA 1GD1O 1F8XA 3ZU2A 2CE2X 2WKQA 3I04A 2QVYX 2AX3A 2C84A 2GZSA 1WMEA 2Z58A 5HFAA 3IKMB 3KEGA 3RLIA 1YJ5A 3V8NA 3X1XA 4Z2AA 5IM4F 2XXAA 3BOSA 4GW3A 4UTRA 1ZIDA 2WYHA 1TAQA 4Y98A 2WD7B 3GLIA 1B2LA 1USGA 2FZ5A 2R2GA 3EIUA 1N3YA 3MWKA 3X1MA 2C61A 4EGJA 4NKRA 3IB6A 3ZWWA 3IVCA 5ARCA 4HZUB 1SCAA 3OQ1A 2HK7A 2J4FA 1H0SA 5KX5A 1RLMA 1UPCA 2P2GA 4F7DA 5K5EA 2O2SA 4X0EA 1E5VA 5H59A 1RADA 1FTGA 2VJCA 3EFEA 4QHSA 2L0XA 4L22A 5K20A 3BGDA 3PI7A 2G5GX 4RE5A 3DXFA 4HNSA 5FLEX 1XCJA 3FMOB 1L5HA 3ZKWB 4YI3A 3QZUA 4NPCA 3DCYA 4KW7A 4PPGA 1NPYA 1E0KA 1KFCB 2QTTA 1NU6A 4QOHA 4R8MA 5JYDA 3GX1A 1T4CB 3N0RA 1U3TA 1XTTA 1UZNA 4C6TB 1IMOA 4MI3A 2XB8A 3LQKA 1G59A 4EM6A 2IHUA 4U5QA 5FRDA 1D6SA 4O0LA 2ODPA 1W2HA 2LKDA 4MW9A 4PO3X 2QRVB 3REQA 3RT7A 1Z9BA 1W44A 2BP7A 4KQWA 4YJ3F 5D3QA 4A8JB 4KAXA 2GXAA 1IN6A 1DGQA 1U2SA 1CUZA 5JPIA 3EPJA 3VOSA 4CDMA 1IG3A 1WB6A 4IXNA 2H8GA 2W6JA 2CVOA 2QZSA 3P9YA 4LX8A 4O0MA 1B1AA 1KJ9A 4PNZA 3VHQA 2BEWA 1IJEA 2Z2ZA 4WOJA 2AZTA 3DBRA 5BUQA 3IOBA 4I8XA 3CW2A 1TZBA 3W6OA 1BMQA 2E5FA 2IDKA 2W11A 1EWRA 1HSOA 1XDUA 3A3NA 4XD7D 5DBFA 5EMHA 3NAQA 1FUKA 1BO6A 1NP6A 3KKPA 4G9BA 4IV5A 4B2YA 4O4LF 3SZLA 1XPOA 4LX0A 1V6CA 4Q9DA 3DM9B 3F8SA 3HRIA 4DG8A 1E32A 2A9OA 2Z2IA 4MAMA 1SIOA 4G1MB 3X1DA 3G13A 1PLLA 2W8BB 3AEUA 3CJRA 4YNBA 4Z8YA 2I78A 3TLMA 2ZW9A 4BEJA 2AW3A 3E9NA 3IBSA 4K87A 1W4ZA 3FCXA 2E4WA 1XNHA 2VZEA 4G4GA 1P9WA 4Q6BA 4UHKA 2NSLA 1J8MF 1KORA 3LGSA 1DV2A 1OTHA 1B8PA 1DWUA 2OFPA 4M4SA 2WQ6A 4K05A 2QRUA 1I14A 2JFBA 2XRFA 2ZJOA 1PR1A 4OQQA 1REQA 5D85A 3HDGA 5ALLA 2QLFA 1J6UA 1GO2A 2YXNA 1ZBQA 3RPEA 5TQ0A 4LXYA 3PZBA 2MYTA 2PKEA 2A6PA 4NPAA 1U0TA 3L77A 4XUDA 2LP4Y 2OXRA 3IKLA 2XA1A 3LY5A 2JAPA 1Q7RA 4NHOA 4QU8A 1L5KA 3OJWA 5KCZA 1ZI6A 1E1RA 1Y8ZA 5A4AA 2MSNA 4HGNA 2PL3A 3ZHCA 4JLOA 5IS2A 3I9LA 8ABPA 2FXIA 5JNWA 1I80A 3VO1A 1XCGB 3UMMA 3DQZA 2CL7X 3CJTA 1UFVA 3O4HA 4PE5B 2GO1A 4X20B 5ES3A 1T9BA 1U9ZA 3ZUGA 3TW8A 1A1SA 4KVAA 1SEVA 2P2NA 2ZDGA 4XWYA 4UDXX 3L0IB 3RWBA 1JL3A 2BFPA 1ZGCA 3M4ZA 3DKIA 4CN9A 4DMUB 1CZUA 3RARA 1RWNA 4A0GA 4C3ZA 4ZT3A 4C03A 1K98A 1M2OB 1K0FA 1YZ3A 1MKYA 2GCOA 4GKJB 2QEQA 1JFLA 1K7XB 3BK7A 4QREA 5EJ7A 3P9KA 5U4QA 3CWQA 3UOAB 3EXEA 2SICE 4KWTA 2HLDA 4PRLA 1P2VA 4ZCTA 5BVGA 1U04A 1WDTA 1V45E 3L6DA 3IT3A 5HIKA 4D3ZA 4CLDA 3JZMA 3SS7X 5CW2A 1UBUS 3U3RA 5KNBH 3QXHA 4PG7A 2P2LA 2C7PA 1QFYA 2ZAOA 1QG4A 3FBWA 3QHQA 4JIGA 2ONZA 4OB6A 4OGFA 2GSWA 4TRMA 3D8BA 1SULA 4MQ6A 3FDZA 4HS9A 4EENA 4RGYA 4CT0A 1UKCA 3B1JA 1LBQA 2GVNA 2WWXA 3Q7RA 4IINA 5G0WA 2JA2A 5J4LA 3DZKA 3R9IA 3V4LA 3WDLA 2XYQA 4BVJA 1EP1B 1WA5A 4CEIB 1UFOA 3EVBA 5TF4A 2VZ0A 1IE3A 4K9KA 4LW8A 3Q0IA 3LDUA 5FBLB 1AM4D 1T4MA 3KUXA 5AM3A 2VDWA 4LWQA 3ROTA 1G3QA 2VUHB 2H00A 2P7HA 3DLTA 3IXQA 4B71A 4NFLA 3MCTA 2V55B 5A9SA 4OXYA 4MIKA 1N34B 1FMFA 3AH8A 4BVLA 1C1DA 1WW8A 2KJQA 3GOHA 4ZEXA 1PG2A 1DIRA 3D54D 4RTMA 3NTLA 1TVKA 5IYZB 4MUGA 4DMMA 1RC8A 3P9ZA 4RTSA 2JGAA 1OVGA 1YUNA 1TJYA 3EGXA 4TYNA 1AZTA 4JSRA 1ML3A 3BK1A 1XEXA 4A0QA 1DCFA 4RZHA 2RKOA 1ILEA 5FV4A 1KI7A 1NRWA 3B3FA 2P2CA 1OH8A 3N8NA 1HETA 1NV8A 1WABA 4LRQA 4D97A 2E82A 1HURA 1FYVA 1NVKA 1KPIA 2J9RA 4J3JA 4AUNA 3PU6A 1HR0B 3QOWA 5K3OA 2CB9A 4J0CA 2CZQA 3BJIC 2OWEA 5EWMA 5FLKA 2DQ4A 3EXHC 2Y1LA 1PR4A 2XMPA 4C08A 4AFNA 3TUJC 3C0KA 5KOHA 1SCNE 1Y5IA 5B7QA 3W2TA 2A7XA 1CQIB 4UJ5A 1JR2A 4C2UA 3BA1A 4MKXA 2ZT8A 2V6MA 4Q1CA 1EX1A 4IKOA 2B4TO 4R8LA 3KG2A 4IDGA 1DXHA 4K6FA 2JFZA 4NAHA 3ZG6A 1CBUA 5E7JA 2Y76A 5IVPA 1M6WA 2DRIA 1DQYA 3SFVA 5KSZA 2D1YA 4TUYA 3HZOA 1KC1A 3KT3A 1V9SA 3VMFA 3IKJA 1Y34E 2PUAA 2I67A 5FHRA 4G1UC 1CZKA 2O8NA 5I8PA 1IMJA 1Z73A 2HQOA 5DWDA 2H29A 2VDPB 4RIHA 3CNNA 1ZJ6A 5GWXA 5IDVA 3UMVA 4TLDA 1E20A 4H08A 1BHO1 4IO1A 2ZRDA 5CG2A 3UB2A 1XMPA 4J0DA 1OYVA 2Q41A 3F49S 3HB4X 2J45A 1NW4A 3OMXA 3Q87B 5DCLA 4AXBA 3FHOA 1Y8RB 3C16C 1L5QA 2OLEA 3CGGA 2AC7A 5I9NA 1GUAA 2NMVA 2E37A 3JYHA 4DM4A 3J80A 1S2LA 1CF4A 4RQBA 2OXCA 2OZEA 3I6YA 5H70A 4Q66C 4OQDA 4NC9A 3E58A 3WK4A 3ZXIA 4ZCRA 1ZESA 2WNIA 5AXBA 1P2GA 1R50A 3CINA 2KE5A 3G2JA 3E05A 5HQ3B 2R4UA 2F3PA 2VKQA 1UK6A 3CYFA 5BMOA 5BRJA 5J4KA 2QUHA 4QVGA 4R7GA 3IP6A 2NXJA 3OCWA 4FDUA 1XZFA 2GEUA 3C5VA 3DR5A 4I1UA 3PX7A 1SG6A 3BMCA 4NMXB 4WN9A 1T9ZA 1YI8A 1ZZGA 5H1YA 3L6EA 5K4GA 4DQUA 1TUBA 3IJEB 3TZQA 1R6UA 1MXHA 2PBZA 4HDRA 2G88A 2XAUA 1E1CA 1QM5A 3N39C 3WGYA 3TLCA 4A2CA 3N0VA 5BN4B 1PGQA 4RGBA 4HJRA 3WO0A 4E5DA 3U6KA 1ZDMA 3ND5A 3D7KA 5G02A 1AURA 5BORA 2DUWA 4DQXA 3PWZA 1GNLA 1Z5ZA 4KVFA 4C1NA 2CKDA 2FPSA 3F6SA 2ZZMA 3KJGA 2W37A 3I28A 2JGKA 1DCTA 4U9UA 1BFDA 3FMGA 1CQPA 2XOXA 3EY4A 3B6JA 4ARZB 4BBPA 4C7XA 2J5KA 2NXCA 5AVTA 3F4BA 3GT7A 1I3CA 1QNFA 2H4JA 3HYLA 4MWBA 4RF2A 3MWJA 4ZFNA 2CYCA 2JK1A 3KTDA 4P82A 1NY6A 2HHAA 3CRZA 2HA6A 3KIPA 1RTKA 1H4QA 2OY0A 4J4HA 2QRMA 2HCJB 2Z09A 4P92A 3I32A 1M8KA 3M2TA 1NBIA 1RLUA 4ARSA 4RMNA 5AVJA 4AZ0B 5KYYA 4FNOA 1RP7A 1K1EA 1T4GA 1Z38A 3KJZA 3NANA 3FSEA 2E4UA 4JR1A 2P0AA 5G0VA 2AEJA 1XMOB 2OCKA 3RYHB 3RNOA 1GGKA 3M4XA 3BE4A 3F8WA 2KBFA 3NW9A 4BMVA 1H8ED 2V7GA 4NZNA 2QVBA 1Z17A 3EDYA 5LVAA 4PEVA 4UAGA 3OZSA 4B35A 1T5LA 1ZUWA 4BUCA 2EFEB 2ZBFA 4ZV7A 1YL7A 3FMFA 4HZGA 1L8OA 2V1XA 5DCUA 1QHXA 1A8QA 2G76A 3HFSA 3PXAA 1UPTA 4EHLA 1UBMS 2QS9A 1LTQA 1WTCA 1W35A 4AYXA 5HE8A 2Y0DA 4E08A 1RJDA 4M6WA 5ELMA 1C30A 3JYNA 3E4CA 2L82A 2R00A 3N0XA 3D3JA 2VF2A 2GJ4A 4Q01A 1CJUC 2A57A 1Q17A 1U7HA 1JR6A 3D3KA 3O1LA 3R9XB 1ADFA 1CZOA 1G63A 1QGAA 3PG5A 5KTNA 3UWOA 2VATA 3E84A 1U2GA 5IT4A 2V0GA 3OP1A 3B7WA 3BXFA 2BFOA 4O4IA 5TB5A 2DR3A 5AUOB 2J4DA 1TKAA 2Z95A 3DO5A 5C35A 2QU7A 3OZEA 2YN2A 3DMNA 4FFMA 1L1QA 4FYWA 4CMHA 4ND2A 3BXZA 2ZBPA 2B7LA 3LCVB 1F3OA 4HWPA 1IAVA 5TMDA 4E7PA 3L8YA 5CFPA 1PJBA 2NT4A 1AV7A 2REXB 1GGJA 2WHXA 3E3OA 2J6IA 3GJZA 3AERB 3K96A 1QNLA 1Y9EA 3V4VB 3AM3A 4JR0A 2X22A 4NU6A 3TQFA 4F12A 1L7NA 2VHCA 4AP5A 1OI2A 4Z0PA 4XIIA 3U5ZB 3LXXA 4WV3A 4FFDA 2QPOA 5K0LA 1VXOA 5C8DA 4YAKA 2ZBGA 1ZUIA 1BQ4A 1BH2A 2HRDA 1LDMA 2ZRLA 4TV9A 4BZXA 1WMFA 1BMFA 2CD9A 1BCRB 4LJRA 4OCZA 3OCJA 2WHEA 4K26A 2OAEA 3ONWA 2FMTA 2DTEA 4X1OA 1OBOA 1E7WA 1TTPB 2NSHA 1G5FA 4QG3A 1IJBA 2Y4NA 2DVMA 4N03A 3QRWA 3ZWMA 4PG4A 1GPAA 4BQNA 4RDXA 4BV2A 1E0AA 3VC3A 2H1VA 4YUXA 1WHSB 2WV9A 1SZPA 2BPOA 1LW7A 4AECA 2A0XA 3MOGA 3L7KA 2J0VA 1DBWA 4MUIA 4WESA 3TJMA 2O19A 5F21A 2TMYA 1SXQA 2ECKA 3QY9A 5IDQA 1UAAA 1PIWA 2HYDA 4AKHA 2PSJA 4XGIA 5IDWA 4GQBA 1TQDA 4XH9B 1LK5A 4MA4A 2RGGA 3UJBA 1J2EA 4ZVQA 3N9IA 4LSWA 3I1IA 2ZOSA 2RGDA 2EBUA 4D3XA 3UFBA 3V9AA 1U3CA 4DCUA 2QE6A 3OA0A 3AVXA 1PJRA 1EFLA 1E77A 3T1QA 2Q3LA 3ONNA 4AP9A 2CJPA 3EAGA 3BB1A 4A2QA 4K3UA 4ESHA 4DNFA 1T2NA 1M66A 2BZGA 4MKHA 1EFAA 3HBFA 3ZWAA 2ZYWX 3H84A 2A14A 4YRZA 2EZ4A 3PRYA 4YAEA 6CHYA 1TXGA 5DNEA 4Q4JB 5AYVA 5ICFA 3SIRA 4O29A 3SBXA 2X9GA 2GF9A 2RFLA 3RVDA 1E5QA 1HEUA 2WOJA 1J42A 1TAGA 1N5LA 1DC8A 2ZG6A 3JZDA 4REOA 5GONA 2V6FA 3RRJA 2RK4A 3D8HA 3EGDB 4E5KA 5LPNA 3B7PA 4ESVA 1NYTA 3O82A 2HA4A 3H16A 4X20A 3FHLA 1XLVA 3RU2A 3HO6A 1LV8A 1ZI8A 1GEGA 2WWIA 3GP5A 3IQZA 4ZVSA 4D9KA 1RJ9B 2XCUA 5DSZA 1SUSA 3IIJA 4PLCA 1PX0A 2JIZD 2BGJA 3JWPA 3R7BA 1P33A 4BLTA 4EB0A 5L7TA 3PB3A 3OIUA 3CLRD 4Y1GA 1THTA 4JBXA 2PK3A 5HBRA 5AFSA 2RK6A 3O9VA 2QT0A 2V4UA 1HQDA 5BQ5A 5I51A 3DV0A 3KVYA 1J07A 2X8BA 3EZ2A 2AXEA 4B79A 5DPMA 2Q28A 1G2IA 4GR4A 1GPJA 4MHOA 5KNDA 4DCMA 5D7NA 1FVOA 1O95A 4F97A 4MDEA 1KSFX 2C9ZA 2JJ1D 3QXSA 4FX2A 3HHEA 1CUSA 1C4KA 4UHBA 4Z9BA 3WHPA 5JXIA 2AUTA 3LBFA 2XB6A 2Q3JA 3STWA 4DB4A 3JQGB 3FGOA 5BOSB 1ZOIA 3PXGA 4GQIA 4GZ3A 5AOVA 3I9MA 2G1PA 4C0SA 2X4DA 2GILA 2G5TA 4GT1A 4JWTA 5A5VA 4FOOA 4KGVA 4D6XA 4IDOA 3TD2A 1XZPA 5LDDC 4G4SP 2DFDA 1MPTA 1LC0A 3DMPA 5IW8A 2UYYA 2PJDA 4R83A 5TGTA 1F4PA 3WE7A 5KSWB 1EK5A 3MLEA 4D02A 4MW0A 1KI2A 3KCNA 4U3JA 4K9MA 2NQ2C 3OE7A 4MLPA 5AKZA 1Q3HA 3W5JA 3ZV3A 4CJXA 3ESRA 4P4NA 5E2BA 4P4TA 3UZUA 3W1VA 2QA5A 3W9SA 2QRZA 1C50A 1LK7A 2IFTA 4BMOB 4KQMA 1SZJG 1E63A 2JI9A 4GMFA 3K2IA 4KXYA 5AI4A 2O54A 4TS3A 2P9BA 5M2QA 1BU8A 2R0QC 3PUVA 5JT1A 1DARA 1A9TA 3V4SA 2E87A 2DWPA 3AHFA 3PX3A 2WJYA 3NHAA 2WG2A 2NTJA 1NW5A 2GKOA 2V8OA 3KKOA 4MR7B 3N5CA 3UJ8A 1RXUA 1AZSC 3AJ8A 3A9UA 4R7ZA 1OREA 3EZXA 4HGOA 4LRYA 4YP1A 4CIXA 4NBLA 5CW1A 3MAJA 5KYXB 3I6BA 1Z0DA 1CJVC 3ZVMA 1KJWA 1CKEA 1V95A 3FWHA 4R2MA 3LSTA 4PIPA 1CRLA 4O4JA 4AC9A 5IMBA 1OT3A 1P81A 1HORA 2B8JA 2CNDA 1XHFA 1FU4A 2FFQA 2QTVA 2RC5A 3FFWA 3I8XA 3T3GA 2QTCA 1QHEA 2ZJ7A 1NSFA 2HK6A 2ZYSA 2GYWA 2B78A 3FY4A 5CB0A 1Q19A 3WWDA 1J8QA 1OAOC 1P77A 3N7UA 4QT4A 1E9FA 4DC9A 3L43A 5AJYA 4YIHA 1N2XA 2ZT6A 5HCUA 1RLJA 2V0CA 3ZH9B 1JALA 5BUZA 1WB4A 1A7UA 1GQQA 1NM5C 3UXEA 2ARKA 3Q1LA 2X2OA 3JPYA 5M34A 3ZY4A 1QPZA 1WDMA 3OCZA 1R8SA 4H77A 2B4RO 4WECA 3WAKA 4MUHA 4RORA 3LDFA 1THGA 1D09A 1PF7E 2G36A 3WZMA 3ZIAA 1YH3A 1Y3CE 4E11A 4I8IA 4AO8A 2DQYA 1ULUA 3KUUA 4BJ6A 3LCCA 3TL2A 3FHJA 3RIYA 3FWPA 3BKXA 5JPDA 4QOIA 1U3VA 3FOEC 2KI5A 1F1JA 1KK0A 1FNBA 2JLWA 2G08A 4EOGA 2GJAA 4FFWA 2FSUA 1N6OA 3RYFA 4DSTA 2R7MA 5ES4B 3U37A 2FW8A 4HVTA 3A6PC 3RYIA 3IHLA 5CM8B 2WF7A 2X41A 4HL6A 4F04A 1A1VA 3RYCA 1TECE 4LN1A 3UJDA 3ZJ4A 3FD8A 1KBQA 2E1PA 3L7AA 4RHXA 4RSGA 3ZCVA 2I71A 3ROMA 4ILEA 4JXXA 3NGMA 4CG0A 1SXJE 5CT6A 2AJDA 1CY8A 4JB8A 3G59A 4WE3A 2BHRA 2YXBA 2BLLA 5ALKA 4B6RA 5EJ6A 3TLBA 2AD1A 1FJ2A 2IUEA 2Q6TA 4HMQA 2B2CA 2HSGA 2O2IA 3AR7A 3QUBA 2QORA 4KUEA 4Q3OA 4I66A 2CXTA 1CVIA 3THXA 2IV2X 2YW2A 4RPKA 1R6VA 2ZBRA 5J4HA 4IH9A 4OYHA 3V8EA 1Y8AA 4DUGD 1AV6A 4DKJA 3BJMA 5GAJA 3TZ6A 3DH0A 5L4NA 3TVDA 1Y9JA 3GRUA 4PCVA 4U8HA 4M8KA 1CP3A 2CDAA 1WZUA 1XTQA 2LD4A 1ZNYA 4ND8B 1X3SA 2AW5A 4MQUA 4Q00A 3SVLA 2ZI6A 4H0FA 1SC3A 4EF5A 2IYVA 4WFIA 4EMUA 1JVBA 1S1MA 4MI1A 4AKSA 2DR0A 1EFDN 1MOQA 2ZIZA 3AEQB 1M6NA 2OORC 2IHTA 1T0BA 1ZOPA 2VF5X 4L6CA 2F1OA 2NXWA 4AY3A 1W5EA 4QUJA 3REGA 2Y68A 3DZFA 3VNBA 1LBEA 1PNOA 2R9VA 4MKZA 3CUEF 4G0UA 1ECLA 1H0KA 1M8FA 1X13A 1IOLA 1RDFA 1XDDA 4OU5A 4B5KA 5JJKA 3ESAA 3VKUA 2FNAA 3R40A 1PL7A 2WJZB 1XWFA 3B5IA 3Q5GA 5DIFA 4CVNA 3ZGZA 5BVHB 4GPBA 2QD1A 1AZLA 3DUFA 3FUCA 1AB5A 3V3TA 3A70A 2YH2A 3A6LA 3FFTA 3ND8A 4URFA 1ZN7A 5ED4A 3JZFA 1B26A 2O57A 1D2CA 2X23A 4ZZIA 1EUYA 1I4LD 1YCFA 5JXWA 4EYSA 1YC2A 5LZ8A 1RWXA 2JI6A 1QP4A 4X60A 1E69A 2O8DB 4QO8A 2GJ8A 1VKHA 3JAWA 4BBZA 3U13A 4D8YA 5A1JA 3VSBA 1H05A 2BJWA 4BTLA 2LE0A 5DM70 3WNDA 4R54A 1J2RA 1SU7A 2CFRA 4HNGA 1X7HA 1MUUA 3DW1X 3QE9Y 3SHTA 3G1WA 2UVPB 1CUAA 5CXQA 4A1OA 5KYUB 1BGWA 2ZJAA 2NTYC 4JUFA 5SV2A 5TQ2B 3OUZA 2VJLA 3VJLA 1CD5A 3EGCA 1A76A 1UMBB 4IHQA 3AJRA 3GA7A 1U28A 1C30B 3UPUA 2IYWA 5I3CA 2D1SA 1QHYA 1VIAA 3AUAA 3RKRA 3URMA 1DAIA 1E6MA 4RD2A 5JSQA 1V0JA 4EHBA 2VC2B 4NJMB 4BIIA 4EKYA 3KQNA 4D79A 2ES4A 3M6LA 4JJEA 4B8ZA 4FN5A 1RI2A 1YTLA 1JHUA 2CW5A 3TYXA 5K0ZA 3R5XA 4DDTA 2E2WA 2HIHA 3QJ5A 3DE4X 2FPKA 3OLXA 4P3OA 3G68A 2W0MA 3COYA 2YJ5A 3KV1A 3RG2A 2ZJ5A 2XCRB 1KYIA 2R6AA 3T7EA 1B0AA 4OHFA 2QG4A 3EGWA 1VHTA 1SKBA 3HNRA 1T3SA 2X1MA 4XRGA 3MS2A 1M8JA 3LGXA 1W8DA 3O03A 3D6FA 4CF7A 1WMAA 3AF6A 1V4VA 1IY1A 3HKEA 3LI2A 1QVZA 3EEBA 5HM6A 1BXKA 1IIRA 2ZPUA 3UUGA 1LNQA 3KWMA 3W5HA 4AMUA 1H1LA 1XD2B 3LKVA 5BV8A 3A1UA 3D6JA 1RT9A 3ANMA 4RADA 1XYGA 3L4JA 3AEZA 3WJ2A 2VHTA 5A3QA 1N6RA 4IBOA 3LLMA 5ALTA 4EY6A 2XQGA 4Y9UA 3OEED 2FJPA 5C5DA 3S3TA 3OLCX 2XA9A 1KYVA 1B6RA 4RNDB 1U2QA 3ABRB 2ZWVA 5FBVB 3B3AA 2ZRPA 1L4HA 3TTSA 4I9HA 2JIPA 3BTUA 4IS2A 4C4XA 1H9AA 1TK3A 3LVFO 4EY5A 4IGFA 4W5QA 5F9MA 3K20A 4C07A 4OAOA 3WGMA 5IG2A 1T0UA 2PD3A 1SKMA 5ERYA 1ZRHA 3RU3A 2PUHA 4G5FA 4ZCIA 1XVTA 4B7AA 4TROA 2WJ6A 2L42A 3WOVA 5HS4A 2N3ZA 2IU3A 3MCWA 3HCWA 5F4ZA 4CLOB 3AJ9A 4TKVB 4J9VA 4WN9B 2GETA 1Q57A 3OEEA 4G5SA 1A5BB 1BQ3A 2JFPA 2QZ9A 4W8OA 2PLFA 4MEBA 5DNVA 5C1BA 1JQJC 2JJ2D 5JXJA 1KRHA 1QIFA 3H2IA 1NR7A 1AHIA 1HO3A 1PJTA 3NNSA 4RWEA 3GLSA 1L3CA 1GA1A 2FE1A 4FDAA 5FL3A 2WK1A 4DV5B 3I34X 3TFWA 4M8NE 2B99A 1E9DA 3UKOA 1BW9B 3NBXX 3GH3A 4RACA 1QGDA 1UINA 2HDNB 3A6JA 4XVHA 4D9NA 4AU1A 1HE4A 1CEYA 3DTVB 2BFBA 3MEQA 1R0BA 3EK2A 4RZ2A 5IH3A 4P8RA 3R3XA 2QJOA 3KTFA 3QU2A 4F9EA 4ZYVA 3K71B 1A8UA 3T6KA 4L8VA 1YR6A 2E6UX 1C81A 3HLKA 5JS1A 2NYUA 5DMXA 4F4UA 1IEVA 3WYFA 1LJUA 2A1UB 3H1BA 1G4AE 3S81A 3IELA 5CA0A 1FFBA 3NJ4A 4OM8A 3RS5A 4KLCA 2YY7A 3SF8B 4E12A 2AI2A 3AEXA 4U2CA 3FSGA 3OKFA 3O8NA 1MV5A 4TV8F 2IHJA 1XQYA 1OHHA 3P0EA 4GOJA 2EFCB 4HAUA 5E4TA 1XZIA 3HM2A 3O8OA 4MVCA 2FZ4A 2ISSD 3D2BA 3LC2O 3LYHA 1SU4A 2R5FA 1EUQA 1T5DX 3BRWD 4N0QA 3V6LA 2GEBA 2IPNA 4HT3B 5EPUA 2BH9A 3X43A 3O2QB 4IIVA 2G7MC 2BGNA 4CG3A 4OIFA 4K5QA 5CVUA 2E1RA 5TX7A 5CVDA 5CTJA 4QX6A 3ZQKA 3VR4D 2G0NA 4EHKA 5K3BA 1JHZA 2XUKA 3DLAA 3FNQA 4JCOA 3LX8A 3VC7A 1KGSA 4CT4B 4EBFA 3SX2A 3GP8A 2Q0SA 1Z8HA 3AIKA 4X3CA 3ZHUA 4QTZA 3Q41A 3VPDA 3ICQB 1LKZA 4H27A 4HJXA 4ADSG 4CTJA 1YVRA 2C3UA 3HZRA 5GGYA 4O2RA 2ACVA 3FF4A 3LF1A 5DEOA 3OO1A 4RAQA 2VL7A 3O4GA 4OMUA 2EAUA 4WOCA 2RHBA 4EWLA 1CV2A 1ADYA 1TAHA 5AM5A 2G63A 1E9VA 1TMGE 3CU5A 4HYQA 2N9UA 4HDRB 2G1JA 3JATB 2XTNA 1TA4A 5L3SB 2IWHA 4XIJA 2XT9A 1FX0A 4HH4A 1SIUA 5A6SB 3MXOA 2V7XA 2QM8A 4FBMA 1NDQA 3LCMA 1V11B 3GNLA 1EI9A 2VYCA 3GPIA 2ZI3A 3I5UA 4XIYA 1U9IA 3R9WA 3AY6A 2Q5IA 3M9LA 3I01M 2O2JA 4G9GA 4KB5A 4QXPA 5FBWB 1POWA 3WGZA 1MAHA 4B3DA 4EY4A 2JAQA 2Z5VA 1JPVA 4BATA 4RMIA 4BP3A 4KKVA 3W8EA 1OB5A 1KI8A 5IZCA 4HGPA 3IODA 5B1DA 3DUFB 3RD5A 5LXTF 4Z5XA 5LZ7A 1JTFA 5FLXA 2C7VA 1FTYA 2IYOA 2Q29A 2YWFA 1UBCA 3W2IA 1UMDA 4GGMX 2Y92A 1NFFA 2RI0A 3NHMA 2QVZX 4BNUA 2CYAA 3IAEA 2GJKA 2QM3A 3M6AA 1W36D 1QHNA 2B5VA 2O7VA 4FXOA 3L3BA 1OXMA 4JASB 4KI0A 5BSUA 4HNVA 5B64A 3ZOZA 4NCHA 1ZD3A 2W6PA 3H1TA 2DKFA 1DOHA 4NNOA 1SCKA 4OMFG 2ZDHA 1EU1A 4R16A 1HDXA 1X1SA 5M29A 5GINE 7REQA 1JVNA 5DCWA 5C2JB 4HX9A 4TN1A 4OKSA 2H2AA 5H80A 2CJWB 4BJ3A 3L18A 4FMPA 4N5IX 4GZLA 3TI9A 1CQZA 1SC4A 2FPIA 5CB4F 2E21A 1USIA 2BKXA 3NRJA 5K09A 2A3RA 5B3LA 3WHIA 2PUBA 2WKSA 4R2KA 5D84A 3TS1A 4TMFA 2NO0A 1R0WA 2QMQA 1OX4B 3MWEB 4LZOA 3CRRA 4NMHA 3SJCA 3PPIA 2JG3A 1MAUA 4YRJA 2NSYA 3FR8A 4MQ5A 1WSAA 3QVLA 2TRSB 1VLJA 1EIZA 3GFOA 1CIPA 4L15A 4X7PA 3WRYA 1UWKA 3FWZA 4TMYA 2VH5R 4GOLD 1PBTA 3C8MA 2P78A 1H4VB 5JVDF 1JLMA 1EUCA 2YV2A 1N2IA 4R9NA 3FJYA 4I5FA 5DDIP 3KT8A 3WRXA 1L7DA 2XE7A 1GV0A 2CFOA 4ZCLA 4JBIA 5COQA 1W52X 3CF4A 3EWSA 4ZXFA 1QHIA 3GY0A 2BM0A 3PJRA 3LUFA 3ZHXA 3EIXA 2ZUUA 3RSGA 1GCIA 4LC9A 3KZKA 4EGFA 3VOBA 2Q6OA 4H60A 2AXPA 4WACA 1XWIA 1RJFA 1H1TA 2C57A 3ETHA 4PYLA 4MVJP 1VYHA 5TT1A 4Y1RB 2QUAA 2FG5A 1KH1A 3WFIA 4F45A 1QGUA 1QLHA 3DPUA 1EVKA 1L7PA 4KLZA 3SZUA 1T15A 1NONA 3CH5A 1Y80A 1VIDA 2II6A 2YIJA 1Q7GA 3R09A 2FU5C 1GUYA 2X15A 3OOHA 1FP2A 2C5GA 4BASA 3G9UA 1R0LA 3UK1A 4C5CA 1C8LA 4QOSA 4RVCA 2JD0A 1GAXA 2HK8A 2BTEA 4IX1A 3SI7A 3U48A 4UHHA 3L8DA 1U9YA 1DMRA 1O94A 3V46A 5D00A 3L41A 4C4SA 3NYRA 1DLIA 1M1YA 2EXXA 4DV1B 1VMEA 1G6HA 2AYZA 3THYB 3RTEA 3WZ2A 1ETHA 4TKVA 3UFXA 4EJSA 5IVKA 3TLJA 4C7OB 4MARA 2I55A 3KD2A 4H3SA 4JDPA 3W4JA 1KS2A 3IIIA 1IEQA 1EWVA 2NVOA 2ESRA 2A1IA 3NAZA 3CNHA 4KN6A 3QTTA 3TNJA 3H18A 4U9HS 5I7EA 1TO2E 3H4VA 3AW8A 3KQMA 3T9BA 1NULA 5DTJA 1T5BA 4LYEA 1QLJA 4IFBA 3HUUA 4B4KA 1KAQA 2BBWA 1BN6A 3RS3A 1JLHA 4LF5B 5DW0A 5CDTA 4JQCA 3SVTA 1OBFO 2HA0A 3WVNA 1BVUA 4DY4A 1GKKA 2AFHA 1CY4A 2VXOA 4FYIA 2WU4A 1FOEB 3L79A 3KNZA 2BGWA 3NVKI 4MR7A 3AKDA 3DOUA 1IVYA 2HEGA 3B53X 1QKKA 3EVDA 4M1ZA 4ZQCB 5B1SA 4BX9A 5HWSA 3UJ6A 3OQBA 2Y71A 3C7CB 3QWAA 5JH7A 3JVDA 2GEVA 1IL0A 3ML1A 4J94A 3TM5A 2XUDA 2WMDA 4DLUA 5HDBB 4YYZA 4IF6A 1DMSA 2LXNA 4K03A 4YB8A 2A5FA 4CEHA 2YHBA 1R4AA 3EFBA 3GJ8A 2H9YA 3FLEA 2WIKA 1YXMA 3K0AA 4XB6B 2ONJA 4EJ0A 5GIPE 1KOJA 4UBIA 4IR7A 1T9AA 3I4FA 5CXXA 3I9OA 3LGAA 2UXBB 4D8XA 3ZDQA 1UR5A 1P4AA 4GUAA 5AW1A 2IXFA 4TS9A 4MNTA 4E33A 1U4NA 1Z4KA 2EW8A 4G0ZA 1QP7A 3KLNA 4ZI7A 1DAMA 1DPGA 1P1RA 1VMDA 3L40A 3VQTA 2CZCA 1BXGB 1EGHA 4D3YA 2VOJA 2EJBA 3R7WB 1GU1A 5JI2E 1JFFA 1RMQA 2XQVA 1RHRA 4W5WA 5C37A 2FQ1A 1C9JA 4K9SA 4DARA 4Z4QA 4RJ2A 4RD3A 3N2EA 2R6DA 4MKIA 2XNDD 2VUTA 3M33A 4OH1A 2VP4A 4Z9FA 1MBZA 3EDMA 4LC1A 4WXHA 3ZZNA 1T4BA 1ZM2A 2Y05A 2IYZA 2WFLB 2HF7A 3NP9A 3BQ9A 1X1DA 2OSVA 4M6WB 1ZGZA 3WFZA 4UKDA 1YS4A 4X24A 2A1TS 2SCUB 3O7WA 3OFND 3SIWA 4I46A 4MS3A 1VJTA 1Q7TA 1A69A 4R0VA 1Q0QA 2C5HA 2OV3A 5F76A 4CTNA 2AK3A 1TLTA 2CEAA 1JIXA 4CV2A 4E5VA 4C87A 4LVCA 2Q6LA 2G9QA 3I0MA 1ESCA 5DULA 3DONA 5HE9A 1S8OA 4JI3B 3SYNA 1CB7A 1D0IA 4DCVA 2A88A 3FPLA 3FUUA 3Q7QA 4GU5A 4GPTA 4V24A 4BNZA 4DDWA 3UWKA 1LPNA 1AKNA 1S8NA 2EFJA 3BCSA 1ISGA 4W1PA 4LF7B 3EZGA 4GOKA 4GKAA 4HV4A 2GEFA 2ZU0C 1F48A 4XQ0A 3EEOA 3Q2IA 1UC4B 2WIAA 4DPLA 3CKKA 3HP1A 4JUIA 5A5GA 2CJFA 4RX1A 4J29A 2WDZA 1W19A 1S0UA 2M9MA 3UMYA 4QA9A 1VJCA 3A28A 5HUHA 1E5XA 1NIPA 2WG1A 1MVOA 1S8FA 3BHIA 4HX2A 4TVBA 5L51A 1XZBA 3ANYB 3SEQA 2AYYA 4DV0B 1AQLA 1Z7GA 3UMGA 2UVQA 3AJAA 1OF1A 3F2VA 3GN1A 3QEOA 3VDNB 1JEDA 2WUVA 1OFUA 5JCXA 1AQJA 1P1JA 2B61A 3K70B 1EVQA 2XT6A 2VRCA 2Y1XA 3CZAA 3L8GA 3EXFA 4GOOD 5IAKA 3ZV7A 5FUMA 5IWAB 5A9RA 2YFKA 1L7RA 4Y0VA 3WSWA 5CTAA 4DDUA 5KWEA 1AGXA 3PJDA 2OCGA 4X8MA 4EB6A 1Z6YA 4DUZB 4FCTA 4NYJR 3GHHA 1GSHA 2B4QA 2HWWA 4BVHA 1SCIA 4NF2A 3QBJA 3UK7A 1X1TA 4CKCB 3VZCA 2WTEA 4HNAB 1YA6A 4EAQA 2A7QA 5LN1A 1AKRA 1PK9A 4CHTA 1DBVO 2RONA 4J0EA 1SOMA 1MNAA 2HBZA 1VJDA 2HZBA 2WHRA 3CBQA 3MMXA 3P2MA 4PWYA 4I0WB 2I4MA 4WZAA 3I62A 1MG0A 1NTRA 1KIFA 2ZRKA 4S1OA 2J9FB 1D3AA 1M6EX 4ZU3A 3ABZA 4TXLA 1L5LA 2V3VA 4NMLA 1E2IA 3L01A 5AOCA 4FHCA 1J0AA 2C54A 1UT6A 2IV3A 4OSPA 5T7BA 1GOTA 1ONNA 1KH3A 3EQ7A 1N1MA 2CHVA 3JQBC 1FZQA 4WNCA 1I0LA 3NHKA 4MW1A 4GI1A 4I4NA 4PF1A 2XX3A 3DZ8A 5HBGA 4TSFD 2GWRA 1KEZA 2H07A 2PYZA 4HS4A 2WB2A 1BYIA 2AMJA 3AESA 4H3KB 3RI3A 1JLSA 3WLQA 1R0KA 3ETDA 1TQ6A 4DA9A 1LPPA 2PX8A 3UVEA 3EISA 4NZOA 1J0XO 1FU8A 2I7XA 1F14A 1LLDA 1L5HB 1UXIA 4HH0A 4DIEA 5DVZA 2WZDA 2H4FA 4QFCA 5GM1A 3L0SA 1WX1A 2AZDA 2GO7A 4WDRA 4DEXA 4KDEA 4FOPA 5IAJA 4GP9A 1ADBA 1CB0A 2A3NA 4FZ3A 3DAYA 1YRHA 4QFDA 1MB2A 2PR7A 3QE4A 4X3PA 3VHXB 3ZCUA 5LMZA 2DPXA 4WN3A 3E48A 1TCUA 3MUNA 1I13A 4AIRA 4EKDA 5I9LA 5DN6A 1R64A 2O2HA 3WNQA 3RC1A 2PMDA 3DCIA 3JD3A 5I8ZA 3RSQA 1RZVA 2IYNA 3HG7A 4PZDA 1UMBA 1U6KA 1EDDA 1JJVA 2HJGA 2HMTA 3BGSA 3N87A 4TSRA 2ZM5A 1K4MA 2J5BA 1KL7A 4KUGA 3S99A 4FDMA 3OTWA 4RKRA 1IBCA 2NT3A 3LC1O 4EYQA 1EDBA 2NACA 5J2TA 1WO8A 1SN7A 1YU6A 4MGEA 3CPEA 1I0IA 1NOJA 4JLPA 3HR7A 4EMBA 5ITSA 4JROA 1IC6A 3RROA 1GZ4A 3EG9B 2A5YB 5HHTA 3W04A 1KQOA 4MS1A 4ND1A 1SQGA 3GJTA 2AFVA 4N18A 4XD2A 4HQOA 2B6NA 2YVKA 2JGDA 4BO7A 3E15A 1FYDA 5L3RA 2B3DA 2EZ9A 4YUZA 2AZXA 3AHHA 1LC3A 5EEGA 4KX3A 4LE1A 4ZODA 4IIDA 4EGAA </