4P86A

Structure of pyrr protein from bacillus subtilis with gmp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
177
Chain Sequence
QKAVILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDITLYRDDLSTSNDEPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQNDLVAIYENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein PyrR
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 54
structure length 177
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p86A00
2PRYA 5JSQA 4P86A 1MZVA 3M3HA 2AEEA 1DQNA 1QCDA 1DBRA 1VSTA 2FXVA 3NAGA 5BRNA 2HCRA 2DY0A 5BSKA 4X44A 4LYYA 4RV4A 3DEZA 4Z1OA 1QCCA 1QB8A 3GGJA 4JLSA 1A97A 1NONA 2EHJA 3ACDA 1L1QA 5IAOA 1XTTA 2JKYA 1I5EA 3O7MA 1ECBA 3ACBA 1OREA 1HGXA 4RAQA 4RQAA 4RAOA 4LZAA 4LZOA 1D6NA 4WN3A 5EUCA 1UPFA 1G2QA 4M0KA 2JI4A 4P3KA 1P4AA 3EFHA 4X45A 1GRVA 5KAMA 4KN6A 4F8EA 1A95A 4RANA 4QYIB 5JV5A 5ESWA 4LYGA 1O57A 1P17A 3GEPA 1R3UA 2C4KA 1FSGA 1I14A 4QYIA 3QW4B 1G2PA 1BD3A 2H06A 2WNSA 4QRIA 3OHPA 1DKRA 1UFRA 4RACA 3HVUA 1AO0A 1VDMA 2IGBA 3N2LA 1U9YA 3DAHA 5HIAA 4P84A 1XTVA 4LZNA 1G9SA 1GPH1 1UPUA 2GEBA 4P81A 1ECGA 1ZN9A 4RHTA 1DQPA 1G9TA 1A98A 1I0LA 1HMPA 1ZN8A 4P82A 4IJQA 4RABA 5K51A 4ZFNA 3MBIA 5IPFA 2PS1A 4RQBA 4TWBA 1U9ZA 4OHCA 1JLSA 4M0UA 1W30A 1I0IA 4MB6A 4WMLA 1Z7GA 4RHYA 1PZMA 4PAWA 1LH0A 1A4XA 5BQPA 1P18A 1STOA 4P83A 2JBHA 3G6WA 1OROA 3KB8A 1QK3A 1XZ8A 3LRTA 1DKUA 2XBUA 2P1ZA 3OZGA 5KAPA 1ZN7A 5BQOA 3LPNA 4S2UA 1IBSA 1QK5A 1TC2A 1QB7A 1V9SA 1ECCA 3GGCA 5HKLA 1BD4A 1O5OA 1TC1A 4FYMA 4M0PA 2E55A 4RADA 4P80A 1ECJA 1OPRA 4RHUA 1CJBA 1VCHA 2PRZA 5ESXA 3H83A 3OZFA 1I13A 3DMPA 3MJDA 1XTUA 1J7JA 1L1RA 1ECFA 2H07A 3S5JA 2VFAA 2H08A 3ACCA 1P19A 1NULA 1A3CA 1BZYA 1QK4A 1YFZA 1A96A 1XZNA 1WD5A 4RHXA 2JKZA 2YZKA 1Y0BA 5E38A 4PFQA 4JITA 1JLRA
chains in the Genus database with same CATH superfamily
4MKZA 4C6TB 4QM6A 5DP1A 1NIJA 2HBZA 3ETLA 4KJXA 2PX8A 4D96A 3ER8A 4M36A 2QG6A 2HQOA 1FU7A 1LPSA 2PL3A 4DA9A 2Z8ZA 5EXSA 2H1CA 5FOVA 3I5YA 3WMFA 2P27A 4QLAA 2Z9BA 3W3AD 1EUDB 2W4QA 3ZGXA 5JZSA 5LP1A 3O8OA 1DOZA 4B4OA 3GLIB 1OAOC 1VP9A 5CB0A 1G55A 2C7VA 1PJAA 2XCSB 1FP1D 1MCZA 1BHO1 1XELA 3H5NA 4H7FA 3EVEA 4J6EA 4JLAA 4L4XA 3RVOA 3HCWA 3B78A 3WLEA 2QMZA 1Z16A 4CCAA 5A0TA 1UPTA 2HK9A 4Y2JA 1E5XA 2VDPB 2Y0CA 1UC9A 4MPDA 4ED9A 3IB3A 3WK5A 2W8ZA 2C5BA 4E94A 5EP4A 3VOAA 3WG9A 4EEZA 3PRHA 5KDLA 1I36A 3I09A 1I3KA 1OX4A 1UUFA 4RGQA 2I3DA 4QRDA 2VI5A 1AXRA 2CT8A 1Q57A 4O63O 4X1YB 1P17A 2GYUA 1XTJA 2XEDA 5E4JA 3T5PA 2CVOA 3GQBA 4D0RA 3IA7A 4Z6KA 2P0AA 4MVWA 1J1IA 1IIBA 4P4LA 3BCUA 2QAGB 5U4XA 3L5KA 1CVRA 4OLAA 2AUTA 4E4RA 2NVWA 4AMBA 1OTYA 3DZBA 4OJMX 4PYNA 4NMXB 4WWHA 1U0NA 1Z17A 1XDBA 3L0YA 4HAIA 5B37A 1UMDA 1YXMA 1PTJA 1EWKA 2XUZA 4LE2A 4LHXA 4MWSA 5JD6A 2A5GA 2JCYA 3KPUA 2FRXA 1NVXQ 3COWA 4JC8A 2BFFA 3BL6A 1DQPA 5KYWB 3REQA 1HLPA 2BC9A 1ULSA 3EWSA 3PDHA 4J9VA 4NWIA 4RABA 4BMCA 4MR8B 4UM8B 5IYZB 3RABA 2A9RA 3FWYA 2H2FA 9ATCA 5IUKC 3IEVA 1EQUA 2CEKA 1Y4ZA 1D04A 3U7QA 3FKSD 2COEA 4RFSB 5L4NA 2DUUA 4E22A 5JS8A 2XT0A 3EJWA 1CZLA 1GT6A 2QZZA 4Q3OA 2F2TA 2E4ZA 4KOAA 4LRTB 5FBLB 1ZGBA 1I2BA 1PJBA 2DHDA 2C4NA 3E9DA 4AZ3B 2OHGA 3C6ZA 5JD4A 1QIDA 3CNOA 2WSSD 2XT9A 4QJ3A 1XDWA 3A9RA 3A37A 4F9EA 4Z4QA 2QTVB 1MC4A 4TSFD 1HRKA 3T1OA 1X7XA 5KJCA 4KN5A 3NAZA 4ACBA 3FOEC 1XKQA 2JLVA 1GG9A 1X8KA 5I9TA 2OOKA 5JDCA 3HWWA 1ZUNB 4DB4A 1ZKDA 2FMXA 3EPHA 3COPA 4R1UA 3ZHCA 3ZWYA 3AEQA 1ECJA 3G89A 3X1WA 3OP4A 2MSEB 5TSDA 4HQFA 1AUQA 1U31A 2AT1A 3AR8A 2PDAA 3L5OA 4MS1B 4YO7A 3RRYA 5BSEA 3ASZA 1H0SA 1GAJA 4EW2A 1GZDA 5BV0A 4US0R 2G3YA 4HH4A 3KKPA 4E88A 2H1LA 3CN9A 4G6ZA 5ABPA 1Y9ZA 3KO8A 5HJ2A 1FX1A 1KK3A 2V55B 5KTOA 1U04A 3UH0A 4ZJPA 4JU9A 1ZI8A 1B23P 2GXUA 1E2IA 2WKWA 3RS7A 1UEIA 5CLJA 2DXIA 3GEIA 3BSFA 3M4JA 3KXDA 1P7VA 2C8LA 3E7WA 4KQXA 5GAJA 4HQNA 5HM6A 1Y7TA 3EEYA 1C0EA 3BOSA 4JITA 2HPZA 2OAGA 3DBRA 4ND2A 3T5BA 4B6QA 5JS7A 4L7QA 5KMGA 1WHSB 1SC1A 2CDBA 4Q9AA 3R5XA 3G0BA 4RF5A 2PLFA 1DB3A 2WB4A 3G0DA 2WU0A 5CT4A 4GPD1 5L7YA 4ZQIA 1GZ3A 3FCCA 4RK1A 5E6SA 3H2JA 3WLKX 1VHLA 2CBZA 3ZNNA 1U8EA 4BO3A 4COOA 4RTOA 1P75A 1TZCA 3K6SB 4I14A 1VIAA 4G1UC 2JIBA 3HKEA 4OB7A 3HXMA 4X54A 5ALDA 5JAZA 4H18A 3AJAA 3DTVD 3W5JA 1ESCA 5DYIA 4TYYA 2PT9A 3HCPA 1EVZA 1KJQA 2I2AA 3BE6A 3QVWA 4UOZA 2DFTA 2Q6TA 4EABA 4BVKA 5B55A 1I2ZA 3EQ7A 4QYMA 1I9CA 5IFLA 2LE0A 4EVIA 2ILVA 3L6RA 3OTOB 2BFPA 5K8JB 3SX2A 3W9UA 4X66B 1YI8A 4G1EB 1DKLA 4LRQA 4Q03A 3ANNA 4ZMRA 5EZSA 2J46A 1WV0A 1WVMA 1EFVA 4UPDA 3CZPA 4CL8A 4GR9A 5LQAA 2B2XA 1M8JA 1GXSA 2O8BA 1DXHA 2AHOA 4WLEA 2HNBA 3H9JA 4PHHA 5DBHX 2FPOA 2Y9PB 3G2QA 3D1VA 3HB5X 3K0FB 3UV3A 1O1YA 3LLUA 4FIZA 5F2EA 2HSEA 1DIOB 1RJEA 1KNXA 1UJ2A 4EYGA 4QDXA 5ARDA 4DNXA 2CSXA 2PVSA 4IS2A 4PO9A 1UAYA 1FPMA 5L40A 1HK7A 1IOVA 2MYPA 2B9VA 2P9GA 1NM5A 1ZN9A 3CB2A 4L15A 1ZGHA 1Z68A 4RHTA 1N33B 4NCIA 1R4NA 2EERA 3TZKA 1K68A 2NUBA 2ZOSA 5I8ZA 1ORVA 2FFHA 1WLYA 4BECA 4NFHA 5C5EA 4TQAA 3AL0C 2HSJA 3GFSA 1LPBB 4JKOA 3OX2A 5CFQA 1BJRE 1UFQA 3FZGA 2FZCA 4OLHA 1MNQA 4B4WA 2GK6A 2JFUA 3N7AA 3V4SA 1HT1E 1E1RD 1YDHA 4Y6QA 5REQB 4FZJA 1TM2A 3B1JA 2AN9A 4PAWA 3WKAA 5JRDS 2HGSA 5CVEA 4I4LA 3ENNA 3VSDA 1OHHA 3F9IA 3IRUA 4P2GA 5ERXA 4PPGA 2XXAA 5HRAA 4RWEA 3NHFA 5I5EA 5IZCA 5AW1A 5C8YF 4AXBA 4RL4A 1E7WA 1JX6A 1YKSA 5CEJA 1AV6A 2GZ3A 4O33A 3RC2A 4EKIA 4YUXA 2FP4B 5TLSA 1ZVJA 2VUUA 5EE1A 4YWJA 2YW2A 1L7BA 1T4CA 3H9EO 2QE7A 5T41A 3VUEA 1YS9A 3EYAA 3OT5A 4J16C 4B43A 1QHIA 1EZ4A 4C4TA 3RT7A 3AR6A 1J09A 2XCUA 1H3EA 3FYTA 1Y9JA 1LI4A 3UXYA 4G56A 5ALWA 2B69A 4EHJA 1E3WB 4GE3A 3OJEA 1X9HA 2QLTA 2RAPA 5EIFA 1Y33E 1MEOA 2G1UA 4LBWA 4HV4A 3R1IA 3RIYA 4YYZA 1ZJ6A 3SBOA 2HCJB 2GHRA 1T0JB 1T1RA 3E27A 4NAUA 4KGZA 1RC1A 4ARSA 2GMWA 4XEHA 5LKAA 3WZ2A 5C35A 2PKRA 3SM9A 3AI2A 5DP2A 1K8XB 4OLFA 4J7AA 4JYMA 1R9MA 4P86A 4JJEA 3CVUA 1WMEA 2ZE7A 4WBNB 5BRNA 2EFJA 2Y1DA 5LOVB 1KIAA 5AI5A 3ZTWA 2F9FA 2SCUA 2VT3A 5KSYA 1MP0A 1CUAA 3HQ4O 1B00A 4MXDA 1RBMA 1U94A 1BROA 1FA9A 4V0SA 4JA2A 3W79A 1H66A 1RLIA 2SICE 1LEHA 2QRHA 1Y3IA 2QA5A 5BNFA 2JFXA 2BEWA 4HNGA 4KE9A 2QRZA 3RE1A 3V8NA 4EMBA 4C4SA 2GZHA 1JLKA 4U2DA 2OT3B 1QRDA 3NTOA 5EJAA 3UQZA 4JLWA 4P4SA 3VO2A 1CR0A 1XMVA 3JQBC 3UV6A 3MN1A 4PCAA 3WMXA 3WWEA 5EIBC 3N76A 4YJ2B 4Q1CA 4D43A 1DDIA 1DINA 1D0SA 1V8FA 2QRKA 3E7XA 3KJGA 2EGUA 3WFIA 1T9KA 1FX0A 1LQ2A 2P4HX 2VDVE 3DMFA 4BFVA 2FN7A 4MLCA 1IU9A 1C5KA 2QR2A 1JR3D 5JZVA 4I36A 4BFZA 1S1CA 3P0FA 3I2HA 1QZXA 1QG6A 2XNDD 1PDWA 4KE8A 1APBA 4XYBA 5K09A 4GF5A 4KGDA 1CUSA 4Z53A 1FSFA 4KIWA 3VTAA 3C3YA 4ZOQI 4ZV7A 2HREA 5FH9A 3PXUA 2ZROA 1FFAA 1O03A 2AEJA 2XGMA 3C1OA 4P53A 4ZI5A 4BJ5A 1RXWA 4N0EA 3GLVA 3D7KA 4FQ5A 4EI7A 4EY3A 1K89A 1GITA 1RMYA 4CM6A 4WOPA 4A16A 1YASA 4X71A 1KQPA 2H5EA 3L0PA 2WSBA 2WE8A 4S12A 4D44A 3HUUA 2B8TA 2G7MC 3PUVA 4N4AA 1BDJA 2I3BA 2O4UX 2W8BA 4JY7A 4QICA 5ENZA 5K0LA 5LNK1 2EZUA 2LKCA 3G68A 5TQ2B 1PN3A 3MHTA 2WABA 2AFIE 4WK6A 4YHHB 1BCRB 1PLJA 4MO9A 1XRPA 1A4XA 4Z9XA 3AESB 4WNCA 3T5MA 3N6RA 2YQ4A 3KQQA 3I52A 1OXVA 2OHXA 1Y81A 1YH3A 1L8OA 3O3CA 4NYJR 1CYDA 2A59A 5JJIA 3HBFA 1YB5A 4XLZA 4RZXA 2GSDA 1GCGA 3TRKA 2OHFA 4BYMA 5JJLA 2ZW9A 3W78A 2AF4C 3E8XA 3RGWS 2Q2WA 4DYHA 1T5SA 1IHOA 521PA 2IX3A 1ONSA 4FFBB 4BO4A 4TLEA 2K7ZA 3SIPA 3D4NA 1KAHA 3WYNA 1WUTA 2WB2A 1C8KA 3OJ0A 3OZVA 1PWHA 2IQIA 1ZD3A 3MLAA 4RMIA 3RS3A 5EYPB 2FQXA 5EHIA 1VLVA 3TECE 4XRGA 1LPMA 4G97A 1MW9X 1X1RA 1SB8A 2JZCA 3QYJA 1SU7A 2YUTA 2OGWA 1N32B 1A96A 4ZICA 1WD5A 2W6OA 2AWOA 3BMNB 3L7KA 4GC9A 4RK4A 4Y3UA 1TLFA 2XBMA 1DWPA 1YAJA 3QVVA 4P9NA 1JDTA 2HPHA 3I28A 2NV2B 6GPBA 1L7RA 2PR2A 4NQRA 1KDVA 4EI8A 1BGVA 4MARA 1PL8A 1G60A 4MAMA 1RQRA 1QVZA 2DBYA 2JGLA 2PXAA 4B2YA 4OQDA 4RU1A 4MYUA 1ZN2A 1WDTA 1Y48E 2XZLA 5K8TA 3MJRA 4X95A 4DADA 3R77A 1R15A 1I5EA 4B6GA 3M5DA 1H5NA 3HPRA 4RVNA 2FY8A 3ET4A 2POCA 2RGNA 4KLCA 3WLRA 1JL3A 2EX1A 3IXMA 1CZRA 1G5HA 2Q9BA 3HGTA 5CNIA 5E4FA 1OTXA 4DJDC 2A7QA 2JIQA 2VT2A 3LWDA 5AK0A 3MXOA 3ZQ6A 5T6MA 2YIMA 5JD5A 4OQXA 2AKYA 1NNLA 5MF6A 5T8KA 5JBNA 2C9DA 3CWCA 2RHCA 3QMVA 3DFKA 1SIUA 1MX5A 1JQ5A 5AKLA 5I7RA 4Z9FA 2GESA 3OM1A 3C97A 3F8TA 2CVFA 1FTNA 3U7JA 1F20A 2ZQYA 5DHPA 4RETA 4BNNA 4IDPA 2MINA 1S4QA 3FSGA 4IINA 5FBQB 4BLTA 1IIRA 3A4YA 4KFSA 3R23A 1CFZA 5B7NA 4P0PB 3DE2X 4W5NA 2RI6A 1NVUQ 3VKVA 1VDZA 2V9PA 4RJ2A 1B2LA 4F5DA 1H69A 2VJAA 3VAYA 1BCSA 2A1TR 1REQB 1TQ6A 3GQVA 2O8EB 3CJRA 3DFFA 1ZY2A 1G8MA 1KAMA 3FSEA 3FNEA 5F1PA 3O2NA 4JWTA 1QF6A 1JDBC 1NWHA 2PZGA 1YNSA 4D45A 3KE9A 1E0AA 4L4UA 3O5AA 4JJ4A 1E0SA 1Q2UA 1KTIA 5AI8A 5FADA 4R40A 3LRPA 2AA3A 2XSZD 3A1TA 3IP8A 4IAOA 3PNLA 2GPJA 2DLDA 3DLPX 5AK5A 1I01A 5IK2D 1B6TA 5GVRA 3LQ4A 4N0DA 1B73A 4U6SA 2QUKA 3D6FA 3MWGA 1E3IA 4XDZA 5TC4A 5TVGA 3HZZA 5IBQA 1H94A 1I0ZA 3G9XA 2ZSUA 4DV5B 3DFIA 1XX6A 1OI3A 2FZGA 4ASUD 4D9JA 2RJ3A 3CQ9A 2WJ4A 3NJ8A 3H9QA 1PJ3A 3TOVA 2ZZMA 1IB6A 2X2EA 3FPGA 4CKEA 5JPIA 1OBHA 1V5IA 4CR7A 2W6ID 1ENZA 3OZGA 3CZQA 1NVGA 2G9VA 2XXJA 1CS0B 1LD3A 2GXQA 1K7YA 1DQZA 3LPLA 4LI3X 4WRRA 5KS2A 4DDVA 5JTTA 3CUKA 2DGDA 5JRZA 2NP7A 1O5OA 4N6OA 2IHJA 1XEWX 2XTZA 4HNRA 4DDMA 1XYGA 5IW8A 1M1YE 2WYVA 2REQB 2ZI6A 1P8JA 2CJWA 1TJPB 2PS0A 3OURA 1E4OA 3OUTA 4EG0A 3FR8A 3RBVA 2QD1A 4JDUA 3GCZA 4TSKA 5IX8A 3B9RA 1C81A 4Z1MA 2VRBA 3RSFA 5DTQA 4R3WA 1NPTO 2E89A 2XUDA 4EY6A 2O8VA 1FQJA 1JVBA 4L51A 1J5PA 5COBA 3VUFA 1KWGA 3E22A 2J85A 3EA4A 3ZLVA 4AX4A 3OCCA 2IPOA 1QQAA 1NHGA 2FRVA 3OT1A 1XPOA 1JHXA 1Y8QA 1OC2A 2VXYA 3Q7EA 5FWAA 1SIWA 4BC0A 1Q0RA 4DPMA 4EX7A 1SM4A 3IQXA 2DP4E 4KW7A 821PA 4EPWA 1LBSA 4QJ5A 4IJWA 1E5QA 1AKUA 3DOEA 4J1TA 3U1TA 2VNJA 3QKRA 1IBMB 1N3BA 1VBNA 3DBOB 3H6GA 3ICQB 5T4HA 3GN2A 5JYEA 4I46A 3HU3A 4TRRA 1GAEO 3TLMA 5AXDA 2JHCA 2VSOA 1JG2A 1HE3A 2B1RA 1L1QA 4GI1A 5IKEA 3TQIA 1OXUA 1AS2A 1RSZA 4YAOA 3RYHB 4A8JC 5LB4A 3TM5A 1M34E 5J58A 2ZT8A 3HC7A 3ORRA 2FMUA 1GO2A 1SXJA 1Y1LA 3AR4A 2H1WA 4I55A 2FX5A 5TPZA 3JQ9C 4IXNA 3IXLA 3S27A 2HRDA 1G7TA 3EY9A 4JVLA 3UOAB 2RHDA 3N59A 1WZ2A 3RREA 3T5DA 4KRGA 4PTYA 1HKHA 4RORA 3JQAB 3EXHB 1TYEB 2JFFA 2ZSKA 4MW4A 4QULA 5EE5B 4DCNA 2JG3A 4RTNA 2VNKA 2O1WA 3NORA 1LPOA 3PDCA 3JATB 4W8HA 4DEXA 5CEEA 3USZA 1F12A 1ONNA 1E61A 3TD9A 3FYDA 2RIPA 3IMGA 4F3CA 3RVDA 1KI1A 3MBOA 1JHZA 3C2QA 4X7RA 4A6DA 3PEWA 3ECCA 3ESAA 4RMNA 1S7CA 2J59A 1P2DA 2B78A 4AWAA 2X6RA 3L1UA 4QA9A 4MRSA 5CD1A 2VQFB 3COJA 1UBRS 2B25A 4QGFA 3PQ2A 4J75A 5HJEA 4XVUA 5JH7B 2PZJA 3SF0A 4Y6PA 2IDZA 1AUOA 3KC2A 3MWEA 1UM9B 2PZFA 3IV6A 3NWBA 5FORA 2ZUSA 1Z6XA 3KKMA 1E3QA 5EXXA 2ID9A 1KY3A 4Q7KA 3WOVA 3GPDG 3HADA 4TRMA 3GIDA 2XUOA 4GW3A 2HHLA 2IOFA 3NDJA 3K8QA 1J2TA 3PXXA 2PEZA 2IEIA 4LE0A 4UARA 3C7DB 4IF6A 3E05A 2QN3A 3AKZA 5L3ZA 2XH8A 4BHTA 2I7DA 2NSHA 3K9BA 4BZQA 3DPIA 1PZGA 3WRXA 2ZZNA 3U37A 2IPAB 3UAYA 1KXJA 3NNDA 2W6JD 1Z18A 1HE4A 3PQ6A 4A92A 4ND8B 1I7NA 1SG0A 4WZBE 2AD1A 2VP0A 3CMCO 1RR6A 1XZ8A 2YFHA 3EMBA 3TCXB 3FD8A 3VYVA 1Z73A 4UAGA 1YIDA 1ZHHA 2DE0X 3LP5A 2ZRGA 2P5TB 4H1UA 1JG1A 1SUFA 4MQEA 1K8RA 4POAA 1N8NA 4R3NA 5KDDA 3BWMA 2C7QA 4DCCA 1V9SA 5HKKD 1U9CA 3MA0A 4MROA 2NO6A 4UQLA 3N8DA 2WM2A 3LX6A 5BO5A 4AS2A 2WQ6A 2ZSDA 1P1HA 2IF0A 3W2IA 5I8WA 1QHHA 3P2OA 3VU0A 2NUTA 1MJGA 3JD3A 1JUDA 5IT4A 1FC0A 1Z13A 1OH7A 1VMEA 3VM6A 4Q3BA 2OP1A 1T3TA 3BMOA 1PR3A 4PZYA 2SNIE 3NHKA 3HV0A 3MSXA 2E87A 1K7SN 3R76A 2M9MA 1Y5RA 1X8XA 1A77A 2XYRA 4WASA 3UJCA 3FJYA 3IAHA 1GY8A 3NEPX 3OM8A 4I66A 4IQ4A 4L9WA 3WFZA 4DQLA 1ATIA 3UT5A 4B40A 4GVXA 3H5WA 4MUAA 4PRKA 3SZGA 2HDOA 3VHLB 4ML3A 3IEUA 4BMNA 2BR4A 4CF6A 3R9WA 2A84A 2O23A 4XW2A 1AX9A 1Z5GA 1C9DB 5EGNA 3V33A 2HHCA 2QN9A 4PVCA 4N82A 5IDYA 4ZI7F 5KC9A 2C96A 3V4PB 1M0EA 2PZBA 4AD8A 2W4IA 2AMJA 1MG5A 1QIHA 2I29A 3GELA 4QBTA 4GYYA 5EJ2A 4AJ9A 2XMCA 1LU9A 4N7MA 5AHRA 3H5AA 4IYRA 4D3FA 4BO8A 1X0VA 4YI3A 2OVBA 3LCCA 3LM8A 4JQOA 2E4WA 2FUG1 1C80A 1YSCA 1G5QA 3NHSA 5ALUA 4CL2A 5L51A 2IE8A 1H1LB 1OMOA 3LQFA 1E3MA 4B34A 1CVLA 3EXFA 3Q9NA 4UTNA 2OHVA 3TKYA 1MABA 3N86A 3QY0A 3DDWA 1PT8A 3L8ZA 4JGGA 5ESWA 2VNIA 2Y1KA 1KI7A 2IS4A 1E9BA 5LL6P 3ER9A 1GJRA 2Y0BA 3SZUA 3D64A 4R0NA 4TROA 1TVMA 4QYIA 4RK7A 2IEYA 3JV7A 4HAYA 2JNWA 3L40A 4LDJA 3ONVA 4GMHA 2PUJA 2B1IA 2ZU6A 1CP3A 1BC5A 3GARA 3KTAB 4YVFA 2LIVA 5LYJB 2RAVA 1D1TA 2CWWA 4Z7JA 2X8BA 4ZDIA 1OB2A 1J5EB 1B15A 3UANA 1N6KA 1R66A 1TZKA 1OIVA 3LUGA 1UXOA 4BKQA 3IMKA 5A02A 5TMPA 5J4YA 3UC5A 1IJEA 1KHHA 1L6RA 5LQDA 1TFRA 1T13A 4MRRA 1VECA 1YF3A 2ZB3A 1L5HB 3R5HA 1JZTA 4QDZA 1KVUA 1GAXA 2J3KA 3KKLA 4DC9A 1N7JA 2QRGA 1NA5A 2ECKA 2ZWMA 1T6ZA 3QXGA 1IWBB 1SK8A 3FDFA 1U9ZA 5H1YA 2C2BA 1PS9A 3SVTA 1SZCA 1ZESA 2PD3A 3NUZA 4QOHA 1L7MA 3VR5H 3IUQA 3GP5A 3QSGA 3OLQA 1ZZEA 3M6IA 3RRBA 3CEAA 4EKYA 4ZU1X 3W9BA 1I7LA 1RXSA 1Z25A 2R9VA 4IIVA 2BGTA 4B3MB 3HBNA 4G24A 5CH5A 1VCOA 1VMAA 4CLRA 1L7VC 3K32A 4U2EA 1UBTS 1ZG3A 3PJRA 2FB9A 1NBMA 1PNTA 3QFRA 5I3CA 4EB8A 2ZPTX 3H19A 4MIKA 4MKRA 1KJJA 4RZQA 4TYMA 5IDQA 5KYTA 1KKLA 1Y98A 4JVMA 2W83A 3U44A 2NACA 2YRFA 4O4IB 4GOXA 2PIAA 1VPWA 4CDRA 3B6KA 1ZUD1 4IHJB 2EC5A 2ZRAA 4LUCA 5HOEA 2EXXA 4BJ1A 1IATA 3AF6A 3F6RA 2GLUA 4I50F 4OKNA 4ZT6A 4ZV9A 1DCKA 1AA9A 4GZMA 3D8RA 5G1PA 2Y76A 5IRCD 4C04A 3RS8A 1MXFA 5JAOA 2Z4TA 3MNFA 2HA5A 1KJIA 5I9BA 5L3SB 4BLWA 3OJWA 3HYTA 3VAAA 2PMEA 1YJCA 1SVOA 2A9FA 3GJQA 2NTYC 1A5AB 2CNNA 4YAEA 4XLTA 1P1FA 1T2DA 3WK6A 5E3HA 5K05A 4Q18A 4ENSA 1QF9A 1HDIA 3I32A 2GN4A 3ZWNA 1Y7IA 3AQIA 2IP1A 5KTYA 2CNKA 3H7AA 2G4LA 4TYWA 2IVZA 4EUEA 1H3FA 1TVCA 3KPYA 2PCLA 1TQ2A 4MYHA 3TTWA 5K0TA 2H4XA 2GM5A 3L6EA 3AB7A 1J0DA 1A76A 1QAMA 2IUEA 2OV2A 1Z0ZA 3N28A 1DC4A 4FVTA 5JO9A 1TMGE 2OHOA 4F92B 3CZ4A 4YREA 3ZH2A 4RIFA 5B1HA 1OOEA 3QVJA 1NLFA 1Z2PX 2P3LA 2WHQA 1ORTA 1CULC 2X3UA 2CZGA 3I6YA 4DLAA 3U16A 2HJSA 2JFQA 1HZZC 3DT8A 2KHZA 4FI3F 2ZYDA 1JG6A 4Z54A 3GEHA 3ZWBA 1BN7A 1LDEA 1FUEA 2CLHB 2AFHB 5AUQA 1NOKA 1Q7GA 4CF4A 3G9TA 4BXOB 1AZWA 3LLMA 1C3OB 3C70A 2CBXA 1T5BA 4CUZA 1N0VC 1EU1A 2IPMA 1FYDA 2RG1A 3ZW7A 4AJOA 4DNQA 2VLIA 1P7YA 4BWYA 1Q0SA 2XUIA 3Q3HA 4YCBA 4EECA 1JWLA 1ZXBA 2GPSA 4ENVA 2HNKA 2G72A 2XYQA 3UUWA 1TT5B 2WPDD 3CIFA 2GDZA 3WQBA 1KY4A 4R7ZA 5TDHA 4BB0A 4F1WA 4LSZA 1LTQA 3HCEA 1P2TA 1HYHA 3IR5A 3KL4A 4JAVC 3TNDA 4OLBA 3STWA 2Z9DA 1X19A 2H29A 4JBHA 4K7JA 2ZRJA 4WOJA 3NHMA 3LXMA 5KX5F 1PIWA 5K8UA 3LOPA 1ZBDA 3R5KA 3AFGA 2IUFA 4GD3Q 3UXHA 3WWYA 4R2XA 2O2SA 1U8TA 4CR8A 1G8FA 1QMGA 4EMUA 5LXTF 4D97A 1D1PA 3MRVA 1YZFA 3CLRD 1QHSA 4HDAA 4EGQA 3DWEX 4N41A 1OWPA 2CKDA 1JQBA 2GNOA 4GU5A 4KMOA 3RYFA 5JHHB 1XWIA 4I5IA 4IDGA 3ICEA 2QENA 3D8HA 3KZKA 4AJJA 4QPDA 4NZYA 4L2IA 3GRYA 4TLDA 1LVGA 5GGXA 2QRJA 4MVCA 3DTVB 5B2ZA 3N2KA 3BULA 1M2NA 2BFBA 2UZ3A 3HKDB 1LPNA 3M1IA 4S2EA 3AVTA 2B7LA 2UYYA 3MMSA 3LHFA 4AU1A 5HKLA 4C03A 5C8XA 1TJ4A 6REQB 3PFCA 3TQQA 4F4FA 3V7NA 5KNBA 1ZK2A 4HRXA 3IHKA 3GAAA 4PPNA 3T3EA 4GPZA 4BVLA 4BKPA 3L06A 3FDZA 5JCJA 1VPEA 2HLNA 1QRSA 1GILA 5F2KA 5BN3A 5ITZA 1QQTA 4CNBA 4ZZ3A 1Q0TA 4HPXB 3PNPA 1J24A 1JYFA 2Z98A 5EXDA 1QGUB 3B2EA 1VLZA 4LMBA 1JIIA 4NV1A 2YZGA 1Z4PX 3PGLA 4LIPD 2C4WA 4KAFA 1R9NA 5EUMA 1L4HA 1Z2CA 2C78A 2EKQA 4X3PA 3UMFA 2XDQA 1TK3A 2Q6VA 4ARAA 4YCNA 4DLPA 1K97A 1KFBB 1XMJA 1R0KA 3C6XA 3DE7X 3IOCA 3LQQA 4UUPA 5GJVC 3T5CA 3UJ8A 2IT1A 3EIWA 4ZHQF 3IGFA 3RIEA 4WEQA 2DY0A 4XRRA 1MUUA 3F1LA 3HJRA 4DLVA 3LCRA 4ETMA 5DBEX 2B2NA 3LBYA 3ROGA 5H3CA 1LS6A 4Q15A 4JBNA 4C78A 1UT5A 5IKOA 3EDRA 1QGDA 2P40A 2WF7A 3DFMA 2ZYUX 1MHPA 1ECBA 3ACBA 3HNOA 1QE5A 3UHFA 1H8HD 3HTXA 1QIMA 3DLHA 4EY5A 3UATA 3P45A 2AOTA 5AUOB 2DERA 4NE7A 4KPUB 4F1JA 5JEDA 4N3GA 1AHPA 3BA6A 1NKTA 3VJRA 2ZVDA 3K0AB 3OD1A 4PBTA 4DDUA 1FYWA 1V35A 3Q3IA 1U0LA 2C03A 2X1MA 3P71T 4J90A 3KKQA 3BC1A 2GJSA 4LNUA 5JV5A 1ULHA 3K5WA 1GIAA 1YB4A 3O91A 4A91A 3SYNA 4Q4HB 5MFPA 1MV8A 1WU8A 2P65A 3D6NB 3E5MA 2HEGA 3ZH9B 1QH9A 3AQ4A 3AR9A 1NVBA 4EFLA 1JLLB 2IHKA 3GHHA 5IASA 4ERNA 2AOXA 2CW5A 2X41A 4MA4A 4S0ZA 4RA9A 3VDMA 3Q87B 4TT8A 2I71A 2IIPA 4YB8A 3TRIA 1JR6A 1SD1A 1U9YA 3LGAA 3M9WA 3DZIA 1YB7A 1INLA 1RBZA 1MC5A 1Y4DE 1WZIA 4J0EA 4UEQA 5EINA 2MT9A 2H85A 3FOAA 4LBZA 1TUBB 2QT0A 3RHFA 4FCTA 2GHIA 2Q4TA 1K8YB 1NR5A 3HDJA 4OJTA 5A7HA 1P81A 4R9VA 5K9ZA 3JAWA 1Z74A 3OPVA 4C0JA 1P3Y1 4WQMA 1DTWB 1OWMA 2JAPA 4MVJA 4JLVA 4HC4A 5AOAA 2V8BA 4BQPA 2ZRCA 1IBRA 2C0QA 3B3FA 3GY0A 2QBYB 2B4AA 1IJFA 2D2FA 2C7BA 1OD6A 1PSZA 2XOEA 5FNVB 2JA1A 1DX4A 2H5JA 2PZ8A 3A6KA 3FYUC 4BEJA 4K8OA 1B2RA 4RHYA 2PMKA 5EJ9A 1DFHA 1BMDA 1HE1C 1RI3A 2QV0A 2SECE 2FW9A 4HTAA 4RM3A 5WRFA 1T9BA 4E4YA 8ATCA 1PVDA 1VGRA 4MVYA 1NVTA 2I3ZA 5L3RA 1W2GA 1V7PC 1YZHA 1D4AA 4ZOCA 2R00C 3K7EA 3E8SA 2AJBA 4NFSA 3IQWA 5G41A 5ALRA 3FAZA 2JIPA 4LDQA 2YFKA 4WCFB 2BGNA 1F5NA 4BRSA 2O8DA 1HOXA 1KYVA 1T8TA 4L7VA 1YZNA 2D5IA 2Z83A 4JS0A 3FJOA 1K5HA 2X4LA 1TC1A 1WULS 3ET5A 1U3CA 3U49A 1I24A 1NN5A 2J48A 4OKSA 5M2QA 1GZ6A 4NV0A 3QFSA 3MLBA 3BD6A 4O3FA 3MMXA 4AJEA 2IS6A 1E6WA 4BZXA 4ZIRA 1PUJA 2HJHA 1AMUA 2BFCB 1J4AA 4YMTA 5KB3A 4DABA 3H86A 1TNDA 3DH0A 1UT8A 2EVWX 2REBA 1VKZA 1P0IA 2Z58A 3I6IA 3IAAA 4ODIA 2IV7A 4BUCA 3H6HA 5DSZA 2UVDA 4MRMA 3LQYA 4XDYA 1KDRA 2QPLA 4JBIA 4F46A 1NTRA 3LPMA 1U1EA 2CHQA 1OXTA 2P3QA 4FILA 4JT4A 1E4YA 5A62A 1W6UA 2AR7A 2WIJA 3ND8A 2JLAA 2XTMA 3DKIA 3FOWA 1DOAA 3SX4A 4DXDA 3DMYA 5F5XA 2R6CA 1W4BA 2GF2A 1S7GA 1DP4A 2FG7C 1YL7A 1YS4A 4OI2A 5CJJA 4MUEA 5BOVA 5BMOA 1ZIDA 1JDJA 3D8SA 1VPDA 3JWIA 1QCDA 4EF5A 1QS0B 4M53A 4OP3A 1DMRA 5FOTA 1F2TA 1F4PA 1WSDA 2VP6A 3GFRA 4INAA 4L0QA 5DJ5A 3SU8A 1N8KA 1SC3A 4J2TA 2QVLA 3V9PA 3NG1A 5EZYF 4WT7A 4ABYA 3IAFA 3TR6A 3WHKA 2QUHA 4RPGA 1CZNA 1R6VA 1YZGA 4WKCA 3FG9A 3JQCA 3R0IA 1O5IA 2R47A 1DEOA 1XEAA 5AKXA 3CKKA 2RGWA 3D3WA 2Z1NA 4XE5A 3AH8A 4XD7A 4H7IA 5JYBA 3KSDO 4WFIA 1X6VA 1NMXA 5BSTA 3GGGA 3GDWA 5HCIA 1S02A 1NLYA 2ETVA 3JQ8B 3GWZA 4PS0A 3AG5A 2P68A 2GK3A 3SYKA 3E58A 4OU5A 5DI3A 3ZWOA 2KPOA 1B0UA 2A33A 4F4UA 4AY2A 2PSHA 3FGZA 4DLWA 3KRTA 4MRPA 1O94C 3QQPA 4X1KA 2LR0A 3TAUA 4LJ8A 4RIIA 5I7OA 2HIAA 2NSLA 5FQOA 3KJIA 2XNCA 2L42A 1ZNQO 3P7MA 2HCTA 4NAVA 1TAHA 2H48A 2HF2A 4KDRA 1GUZA 4FFPA 3IUBA 4JMPA 4JT2A 1TRHA 3T4XA 1CUHA 1FP2A 1N3LA 1M0WA 1XEXA 1ZXLA 2GEBA 2VF8A 1O58A 2A3NA 2GJ9A 2YWBA 3OMLA 1I33A 1NJ8A 2FOLA 1U0OC 1Q19A 2YRWA 1WB6A 1ZGCA 1DJPA 1Q7RA 2C5GA 3PR2B 3PYLA 4FBGA 4PGAA 4LI0A 1G20A 3W6PA 4R2JA 2PRSA 4E08A 2VH2A 3WP1B 3WB2A 4IHQA 1IM2A 2G1AA 1M75A 3V2HA 4EQ6A 5GTDA 3I0MA 3KT0A 2GJ4A 3UJ9A 2J6CA 1B1CA 4ZI2A 4W5TA 3ASYA 3WBBA 4CPDA 1G6OA 3GRFA 3BRCA 1UBHS 5GONB 5A5VA 2Y9MB 4WVFA 2NTVA 5K3DA 3BWDD 5EJ7A 4PANA 1L3BA 2ODPA 3C5HA 5JNLA 3OMWA 4URZR 2G1JA 1P0FA 4DPLA 5J1SB 5JVDF 4AZSA 2VF7A 4ZALA 3EZYA 4QGAA 4YEDA 4QUEA 3IO5A 4PG6A 3T3GA 1TO2E 3GD5A 5EPOA 1J22A 2YZMA 3EDMA 1FQOA 2YWCA 5J40A 5A2GA 2LBPA 3ESYA 3TLKA 2NPOA 3QTLA 4BNHA 1U81A 2DQ4A 1IN6A 4KEAA 3WGUA 2XDYA 2Z08A 2ZKIA 1JHOA 3RSSA 4NECA 4EG5A 5AW7A 2WJAA 1A9SA 4BCDA 1CUBA 2C61A 4CMEA 1IL0A 2BE7A 2GI4A 2H8KA 2O4CA 2OQVA 4M8NE 4EB6A 2FI1A 4U2FA 2FSVA 4ZV4A 3OCZA 1W49A 2XTAA 4J9UE 5AK3A 3MVEA 1YB2A 4FSDA 3IT2A 3R3JA 4LYFA 4QJBA 2VUIB 1I7PA 3AW8A 3P2MA 5DYTA 1XMQB 1XVLA 1ZEMA 2H9IA 5FT9A 3KU4A 3AGQA 1EFAA 3C3MA 3R8FA 3MSCA 2ZYRA 1E9EA 2WR8A 4PC7A 2ST1A 3OZEA 2BMFA 4OAQA 4DSZA 3ADBA 1TVKA 3RGGA 2Z3VA 2NXWA 1FFSA 3VNBA 2PWZA 4TV8A 3ZDCA 4IMRA 2PLRA 1HX7A 2H3HA 2YJ3A 3OIUA 4RK6A 2NVUA 4O2BF 3THYB 1PF7E 5JE8A 3DUFA 3OZAA 4I3GA 1YMVA 4DDTA 3E03A 4XGRA 2IYRA 1EXNA 4PTLA 1V8ZA 4TKMA 3DZGA 3VSEA 2LVBA 1A71A 2CJYA 1G2QA 5C5IA 2VAVA 1ABBA 1NMZA 3HO1A 2ZDHA 4F2WA 4WLFA 5FHRA 1DXYA 3BPSA 1NBHA 2DY1A 2WNHA 4LJ7A 1BGWA 5SZJA 3Q2KA 4A0QA 1RYYA 1WABA 1SG6A 2G0AA 4ZQCB 2X7JA 4BFSA 3RHZA 4DL9A 4QLBA 1FDUA 1QPBA 1VE1A 3DMNA 1C4OA 2MHCA 7ADHA 4YBRA 2DR0A 3K0HA 1NBAA 4AIIA 1B41A 5JSZB 2XVXA 3SCZA 4B3FX 2GD6A 3EGDB 1RFLA 1UOOA 2JFNA 4GMKA 2HRQA 3B8HA 3THRA 4DUZB 3C6KA 2ZE8A 1QUFA 3DEAA 4D0GA 2R8XA 3CW9A 4UNRA 1GTG1 1EHIA 2HTEA 4NU8X 3HGMA 1BG6A 4K03A 3S55A 4BO6A 3U7IA 3OM9A 3O83A 4WXHA 1I4TD 2XMBA 4H3HB 2C3YA 4M1YA 4PZCA 4FHCA 3ZIAA 3PFKA 4DKJA 4QBHA 4ENRA 2OZLA 4KFCA 1T0PA 2QHXA 2PQMA 4NBLA 2CHUA 2A1UB 5ICSA 3JCZA 3INRA 3KJFA 1T8YA 5KYYA 2WFZA 3B1VA 3KQSA 2DMRA 1G2OA 3EVTA 4IH9A 3CVYA 3EGEA 2V0GA 1G0OA 1D5CA 4ZYUA 5K6AC 3RFUA 2FEWB 4EJMA 3BAFA 3ETDA 2E49A 2NW6A 2OV4A 3TE6A 2I62A 3NYIA 1KFEB 4DCVA 4F06A 5DSXA 5B6PA 3REOA 3EFOA 1CXZA 1X7HA 4O4LF 3F2IA 2VDUE 4M1WA 5EKUA 1GPBA 3AIKA 4MTLA 4IDOA 1DO2A 1KGSA 3MS2A 3P2JA 4NBSA 1U9IC 5D6OA 4G41A 4XCVA 1FDIA 4O0LA 1MO3A 1YZVA 1TU4A 4Y2TA 5BQOA 5C4MA 3C6YA 5EJ5A 3UA4A 4V0KA 3BSWA 5CVUA 2O5EA 3NH6A 2DPGA 3NCHA 2K4MA 4MUJA 1N9KA 4EHAA 3R9IA 2OM6A 4AZWA 4WY5A 1SCNE 3LUCA 2Q8NA 1SBTA 3OOHA 3ROMA 2FJPA 2C2OA 4AQ7A 1FP6A 3L7JA 4INPA 4KQCA 3LWNA 5EIAA 1JIJA 4IFEA 3BB3A 5EZQA 4XQ0A 1JSRA 1WHTA 3RYCB 2E4UA 2DFKB 2EJTA 2GA9A 4PNEA 1TEXA 1X7WA 4B6PA 3A6JA 4DQUA 3OG9A 2Q1YA 2W90A 1MN6A 3BM5A 1HSZA 1V0JA 1ZEJA 4QQNA 4ZVQA 2ADMA 4K9NA 4BVHA 3TF5A 2VJMB 3T5TA 2FEMA 1N0IA 1KO5A 2GK4A 1JKJA 1UBSB 1XNJA 2HMUA 2YHUA 2ZUBA 3KZMA 3LX8A 2ZJ7A 2UUOA 3K2EA 4H7PA 4QASA 3L4JA 4IBOA 4N3CA 2ASVA 3GJ7A 2H16A 2RONA 1Q1BA 4MW2A 3NAGA 3DVLA 5SICE 4U5XA 2O57A 1OHHD 4UM9D 4ALIA 5K2OA 1QC5B 5C4GB 5ULLA 3AFIA 3VAZA 4KDFA 3A06A 3AEYA 3PUXA 3RVPA 1XJQA 3GGJA 1V37A 5AMXA 2WAMA 5C1OA 2FA9A 3JAKB 3WS7A 2NXJA 4RTQA 4LFBB 4QJIA 3V9AA 2I4LA 3OLWA 4PQYA 2C2WA 2ZANA 1NWCA 1OLOA 1P9OA 4HUQB 2BBSA 2QE7D 1E63A 3ZJTA 2BE9A 2YN4A 4KWEA 4AJPA 2AG8A 3G1UA 3Q8LA 4C7OB 2O54A 2XCTB 4KQHA 3OO0A 1O95A 1W581 1Z28A 5FR1A 3T9AA 5KAMA 2NUPA 3ZOZA 3ZXIA 4OL0A 1NR7A 3WYAA 3EIUA 1YFJA 3H2GA 3D54D 1K2WA 1GAWA 2NWQA 2WMDA 1FU8A 4Z8XA 4WTOA 5JFOA 1A8IA 4GGOA 3CNQS 4NL4H 4R1TA 1R64A 4GWLA 4Y9UA 5A3VA 5KJ1A 1RYZA 4RWZA 1UINA 2GM4A 2Q3LA 5ESDA 1MO5A 5AUPB 1NDHA 3QTBA 3FNHA 3KKOA 4YACA 3RNLA 3MJHA 4MDFA 2O2DA 4D2IA 3PE3A 1YJ8A 1SWWA 5H8WA 1ACJA 5GADl 1XA3A 4B7UA 4FX5A 1D6MA 1T3LA 2XRZA 1WQ1R 4MHOA 2PVCA 3Q3CA 5IDWA 4YCDA 4YP1A 2RGGA 2XCIA 4NK5A 1OAOA 1CY6A 2DUWA 1RLUA 2FETA 4FZRA 4NCXA 5TVKA 1FUUA 2PH7A 2BV3A 4Y6GB 5UKDA 4B3XA 3N0VA 4IY1A 5BVHB 2P0YA 3BFPA 5FA6A 1C30A 2QR5A 4I19A 3HDVA 3D59A 4HLQB 2GKSA 3H1AA 2B0JA 4N49A 3VV2A 3P9YA 2JARA 4I1VA 4HEHA 1IOWA 1NGSA 4HXYA 4NIMA 4PRLA 4ZO4A 4HI0E 1RWXA 3TVTA 5JI3E 3O8QA 4ZVVA 5C81A 4GKAA 1PJRA 3GT3A 4QVGA 1W46A 3VBEA 3GAZA 1K6IA 3SIWA 4RSRA 4Y2YA 5ECYA 3KB8A 1NUHA 4QLOA 4M88A 5GGYA 1QX3A 1C9MA 3LCUA 3KLOA 3PX3A 4KI7A 2FN3A 1FQWA 3BWYA 2FPKA 1KJNA 3LKZA 2ZKLA 3WO0A 3EHDA 1M74A 3MM4A 4ROSA 1UMBA 1CT9A 4RY8A 4L8VA 4IH4A 4RXUA 4YT2A 3EFEA 5DTMA 4FKMA 4AM8A 4CCSA 1HI9A 5B36A 1KYXA 1OJLA 2V7VA 2LWIA 5DASA 1JVSA 4HVLA 3BQ9A 5T67A 1K3TA 3BD8A 3E2IA 1QE3A 3U4HA 1RPAA 3AEKB 2Y6VA 2BTQB 2JLQA 1V1MB 2P6PA 4KR0A 4NENA 4QVKA 2QUJA 1A5BB 3JYLA 4XPIA 2YR0A 4Q39A 1H1TA 1XVUA 3PEYA 4EZBA 4NOKA 1PJSA 4H60A 3T9EA 1TRKA 1P19A 3GP8A 4LC1A 4RLQA 2IZOA 3F5SA 1HA3A 2QN7A 4RIGA 1WWKA 2P78A 4I9GA 2I6SA 1QQBA 3OVMA 1J39A 1TCVA 4PAOA 4BMYA 3LHSA 3I05A 5CURA 2WU4A 3I2JA 4IIJB 5FF9A 1NW5A 3PNQA 3Q11A 3MTBA 4P08A 1X2EA 1V8OA 3TW8B 3RDPA 3CY6A 3TSWA 1G21B 5KTTA 1DBRA 3O6VA 3IHWA 1T3HA 4DCUA 2PKQO 4D4GA 2C98A 4YP6A 4MUBA 1ADGA 1V5WA 2BKAA 3AR2A 3CKMA 3MILA 5AHXA 2F8MA 4DLYA 1GM5A 3H2ZA 4DWJA 5LP6B 3D0RA 1HNZB 2XUPA 3UAXA 1XEWY 5FDFA 1HE5A 3E3LA 4XUCA 2APJA 2Y0DA 1TTTA 1SUCA 3NRBA 2CVZA 3IC5A 3I6MA 1R9JA 2R1TB 2Y1EA 5IANA 1NVWQ 3F71A 5B4VA 3M83A 4OQPA 3KVVA 4C9BA 2Q5JA 2L18A 4UTXA 3AFOA 3Q12A 1GPLA 2QTGA 1XP8A 1X77A 1NQXA 4HKTA 1PJZA 4KWTA 5I51A 3BTOA 3RS4A 2HXGA 4TV9B 1O4WA 1PR6A 2FLKA 2W2KB 3S44A 5BVGB 1JXQA 1NDQA 3LUAA 4ZEWA 1XZQA 5DTIA 5ANRB 4L08A 2H06A 3SEQA 3PWZA 2D1SA 3RAEC 3IYLW 2IYXA 4M0MA 2YYSA 1K27A 4XYEA 5I9IA 4R54A 4C89A 4W5WA 1MX9A 3CE9A 3T7TA 1H9CA 1H2ZA 3A1VA 3DR3A 3QEMB 4XTCS 1YKGA 5BWBA 4XJTA 5HIAA 1H6CA 4KKVA 4NDZA 4PLCA 2AXNA 1IUKA 4GBGA 5LQCA 5HA5A 1NTOA 1XHEA 1Q2XA 2ZB8A 1A8HA 4FPXA 4EBFA 2O2GA 4HDRB 2PS1A 2BFDA 2C3PA 4OOEA 3KCNA 3SXJA 2XA9A 3AC0A 3FCUB 4MWZA 4B6OA 1F1JA 2HL6A 2O3QA 2Y27A 3PT5A 3OPXA 2B0CA 2NAFA 4B6RA 1Z0UA 2A88A 1JKFA 4C0LA 3JQ6A 1DMSA 3LYHA 5AM5A 1EHYA 4MQFA 1J0CA 4DCOA 8MHTA 2FWMX 1KPIA 1YJQA 3FBGA 3R9XB 1BEZA 3P2YA 2I1WA 1WPQA 1PJTA 1YR3A 2VZ0A 2X4IA 3AERB 3C8DA 1ZA1A 3HJCA 4FDLA 1KA9H 3S70A 5KAPA 3HU1A 3JWJA 3FSGD 2ATCA 1Y6JA 2XUKA 1E18A 1PX0A 1P4HA 4O4HA 2HSGA 5G1OA 1T8PA 2QJRA 3SEFA 3GGCA 4JYBA 3VZCA 2CHGA 1NW9B 1X86B 16PKA 4KAAA 5FLKA 5FPYA 4NU0A 2V7QA 1BE8A 3T4PA 1JBEA 4FFOA 4BE7B 5ICCA 1XOIA 1Y5IA 4GYWA 1B93A 1UZUA 3AHIA 1K75A 3ONDA 3P26A 4ZARA 2LZ0A 4DJAA 2BN4A 4R01A 1UDRA 3IUEA 4UZEA 3HRKA 4NSNA 2I4OA 1I4DD 5CFPA 1XLTC 4AZ0A 5T3UA 3UBMA 5JAUA 5C8DA 4MR9B 4X7MA 2FEPA 5E6UB 3TCNA 4UUQA 1AXGA 5LP6F 5EQTA 1SUEA 3H8SA 3CX8A 5JQGA 4UHHA 5JMOA 2QU7A 1UFVA 3K70D 4ARZA 1JIQA 1YVUA 2FMHA 5ARBA 3NTRA 3MIIA 3CTPA 3I4LA 3HY6A 3JQRA 1P1JA 2EDAA 1Y7PA 4MQLA 5TJHA 2CLIB 1IZYA 1M6YA 4Z7NB 3AJ9A 4DLUA 1B8VA 1NE7A 1VG9B 2YINC 3KQOA 4JR1A 5ILQA 2A4MA 2LPMA 1QFXA 3B5EA 3EG5A 1QIKA 4BO9A 1E69A 1I94B 4TOIA 2RGBA 2BM1A 3FCOA 3BK2A 3ENKA 2EHJA 4ZO7A 2GM9A 3H11A 4R98A 1I7QB 4CN9A 3S68A 3U62A 3OJFA 1QYVA 1E9CA 2F8LA 4WZAE 2GEJA 2J08A 5IVIA 3EGIA 2PRIA 4J16A 1LV7A 2QX8A 4JEUA 4RPLA 3DGEC 3QVXA 5DMXA 4X65B 4GYKA 1OI2A 4QU5A 5JCOC 1ES9A 1IWOA 1VGQA 4COKA 5ILOA 2EKPA 3BE5A 4CI9A 2XMSA 5DNUA 3OQPA 1M6EX 2GJ8A 4IXDA 2NSJA 4P5EA 3BKXA 4HLNA 4OQQA 1Y37A 1PLKA 2Y0PA 4WHMA 4LGYA 5CJ2A 1N2SA 3K6JA 1HQYE 1KS9A 2QZJA 5AJWA 1Y1RA 2QNIA 1G2PA 3PRJA 2V7GA 4HDNB 3ZX5A 3WGHA 1BO6A 1DZ3A 2UV8A 3IDAA 3KOYA 5LA6F 4YJ3A 2WTMA 4XKJA 1XC7A 3W2HA 3L92A 4NC9A 3U7EB 3MUEA 1ULAA 3EEIA 3BXXA 5KQSA 1YU6A 4HQ6A 3SI7A 3NHUA 2HD4A 3GO4A 3WRWA 2A0XA 3T7DA 4X1IA 4KOEC 2GAOA 2J0EA 1YMQA 3O21A 4EDFA 3EDYA 1G38A 3FSJX 5LBIA 1ORWA 4NJOA 3L07A 1CQXA 1Z75A 1X3SA 2RGUA 4CQMA 3BVPA 4BNLA 4XQEA 3ZE6A 2H1SA 3ZV7A 5A9SB 5COAA 2P2NA 2BUAA 1N5LA 3CV3A 4FDVA 1SXJD 1P45A 1MA3A 1ZJYA 1KDTA 5FULA 5TPZD 4RVOA 3JQBA 4D4JA 1H6BA 4MV1A 4PQGA 4R2HA 1ULZA 4DR1B 5DT9A 1EM8B 3MFYA 2CDRA 3CLTC 4OQMA 2VR1A 4C05A 3KETA 2BKVA 5E3IA 1LDMA 1ZZGA 4YR7A 1KAOA 2JH9A 3DXXA 3SJZA 4DIEA 4BOYA 1IAQA 4FMPA 1NURA 1SO8A 5CCDA 3UGTA 4CKYA 4E5MA 1EK5A 3DT6A 2B6HA 3RV4A 1RZ3A 1YQUA 2WU8A 1NG1A 4O4JA 4AG6A 5HX7A 2RH4A 3DB1A 1GP2A 1L4LA 1YJBA 1FNDA 4TMZA 4ENTA 1Q3HA 3B70A 3H2YA 1ISHA 4IIYA 3ROTA 3NNNA 3CLSD 4C88A 4PAQA 1DAHA 1RNLA 3JZAA 1RWWA 3KALA 2QG4A 4L4SA 2DKOA 2QYSA 1J07A 1LKZA 2Y93A 4MMYB 3ZR4B 4AJNA 4OREX 1SVMA 4C3OB 2HXSA 1EUDA 4QQ8A 2GBCA 3S8YA 2Z2KA 3LKVA 2HFKA 2HSWA 4PEVA 3U19A 4N6GA 2F3RA 1VZ3A 3TIXB 2H7VA 2PJDA 1NRXA 2JIZA 1CEEA 3KWLA 4OSPA 4REQB 1VFNA 1N7GA 1SCUB 3MWFA 1GKUB 2CVHA 1YQQA 1ZD4A 2GZ2A 3D3JA 4TLLB 5KJFA 4GLOA 5KYXB 1RXVA 1Z33A 4NJMB 3ZNPA 5J63A 1P7WA 1QGOA 2CLLB 3FMVA 4R83A 2P3SA 3LT2A 1P0PA 2QMHA 3AF4A 3F7NA 3UHPA 3ETEA 3COYA 3Q6NA 1RT9A 4MIOA 1VE5A 2FLWA 4PHGA 1C8LA 3QPCA 2CXTA 2ZRPA 4F4DA 1HDYA 3WL7A 3HN6A 4LOKA 2R68A 1MAAA 4U3JB 3VU1A 4OSEA 1NKVA 1NONA 4UM7A 5FI3A 2AG5A 2YMQA 4LJSA 4HH3C 1NUUA 4JR0A 3SIXA 4O2AB 1DKPA 2DYKA 1N2XA 5F2NA 2ZIUB 2PZKA 1WEHA 5HF9A 1PZFA 1ST3A 1UC8A 2VP3A 3CT4A 2J3JA 2N46A 3ADOA 4AUKA 4LZWA 2HK6A 3A3KA 7REQB 1DBWA 1F9AA 2IL1A 4F8EA 2HBRA 3WOHA 4JBWA 1GTZA 1YJAA 2F1OA 2FVXA 4DDWA 1LI5A 3LE8A 4YAIA 3U3MA 4TUYA 2YWEA 1BE0A 2I22A 4MR8A 4CDMA 3E81A 4C0HA 4ZPJA 1M2GA 1H22A 2IE0A 3H2KA 4C4RA 5KQPA 1E3DA 2H0QA 3KYCB 1NF8A 1P1IA 2IRWA 3LXXA 4RFSA 2AXPA 2PRJA 2ZS7A 3ONNA 1ORDA 2B8WA 4HWOA 5KVAA 2E4AA 2Z8XA 1DAPA 1GFIA 2QYOA 2M32A 3MIZA 4C1NA 3EUEA 5I48A 2AXEA 4G4SP 3L82B 2WHPA 3QM1A 3UKJA 3O0DA 1X7YB 2WTNA 3KQWA 1GGMA 4D92A 4RJLA 1Z38A 4HD8A 3AHJA 2HK8A 2B94A 1NMYA 2DBZA 1AQYA 2QTVA 2PWBA 4M0FA 1WY5A 2PX0A 4R5HA 2Q9CA 5HIJA 3V5NA 4BQRA 1NRWA 4CM8B 1E2KA 2PUHA 1VG0B 2IXEA 4L6IA 5HE9A 5LQUA 2X15A 2WJYA 4D56A 2I2CA 2G6BA 5TNXA 1ZMXA 3AI1A 2M1ZA 3SICE 4ES6A 1B1AA 1CUGA 2EQAA 2WICA 4HF7A 2C83A 2Q50A 2VO1A 4R9UC 3UCEA 3WDKA 2BGUA 3SZMA 2WKPA 2AMFA 2VJKA 1UXIA 2J9FB 3Q9UA 5JZMA 4AWXA 4RCZA 3UFXB 3FTFA 4JV5B 4OI4A 3TRHA 1IDOA 1P5RA 2EGHA 2J5XA 5LKRA 3DP7A 1NVMB 1P73A 3N6XA 1WNTA 3DVAB 1LSUA 1DC6A 3F5DA 3QE2A 5AXAA 4DBLC 2JGIA 1CRLA 2CJXA 3SKVA 4HDSB 1SKUA 2ODEA 4TXMA 4FFDA 3BA1A 1BKYA 1KXZA 2AX3A 4LCEA 5FEMA 2C7PA 1KQGA 2JJMA 1PZEA 4ZWNA 3GR6A 5NULA 5SY4A 3H16A 1GG5A 3DO6A 2ZIWB 2NTNA 4A1OA 4BFUA 4BGDA 2Q3DA 3GZNA 4OBEA 1JSZA 4QWMA 3TZBA 1FLAA 4PLHA 1IZ7A 2Y77A 3FWZA 1XG5A 4J3JA 4O59O 3LOUA 4O02B 4WXMA 4XDGA 1JMYA 2A5JA 3GUZA 3A9TA 3PBKA 3BXGA 5JY6A 2ZUDA 4WV3A 2Q2QA 2YXEA 4BO2A 1KF0A 4BN4A 2H7CA 2PD4A 1ECLA 1S2IA 4Q7LA 1R0RE 3L6BA 3TNLA 1XNRB 2A94A 3QPAA 4PXSA 4RZIA 1EIZA 4XSGA 4FDTA 5HTKA 1MFZA 2D5CA 1GNSA 1Z2AA 1SBNE 1WXWA 2P1DA 2P2GA 3CX6A 2GWRA 4HX2A 3UFBA 1ZUWA 3PRYA 1U7OA 3WB0A 3K4PA 1BFUA 1MEEA 1JU9A 1OVGA 3GP3A 3UJPA 2OSBA 4HXEB 3R6DA 3UMMA 4ETIA 3VH4A 4LTMA 2GD1O 3P9PA 4HO1X 4RESA 1BA2A 3PCRB 1NBMD 3W77A 4E2WA 5JWRA 5FBRB 3IO3A 1JSXA 2IV3A 1Q7BA 2PGLA 1PT9A 2WC1A 4RDHA 2EGGA 2FOIA 1QHEA 2FFJA 1W44A 2ZRNA 3ENVA 2GZAA 3G8CA 3BZWA 4ZDJA 3ISTA 1SBZA 3FLAA 3K0FA 3PQDA 3DPUA 1OX4B 4X20A 4QHYA 2F8TA 4F9FA 4UEOA 2IBSA 4OBXA 5H9WA 4MCJA 2BSAA 4XFJA 2RCYA 4MWTA 4G9GA 2Q46A 3NBFA 2NT4A 1J8QA 3OEYA 1DAMA 1DQRA 4IWNA 5F1YA 4EO4A 1OYVA 3GQBB 3PD0A 2QP3A 2WTEA 4TTVA 4EBBA 1UOQA 2N42A 3QFHA 4LRYA 1XTQA 3HDYA 1TLLA 2IPNA 3A1FA 4B4UA 3B3QA 1DTSA 1FU4A 3V1NA 4F12A 4OHKA 1EVJA 5KOJA 2AB0A 1Q14A 3PZRA 1CQPA 1GL7A 1UMDB 2FZWA 3HSYA 3NZEA 4D4KA 1K4YA 5G0SA 4HGZA 2JAHA 3T95A 3NTXA 4NONA 4M1EA 2FW8A 3JX9A 1WVGA 2BFFB 1DAIA 4C2TA 2WU1A 2WWRA 3LBNA 1T8UA 1ZM4A 2O0LA 3IJRA 4B6EA 4I1OA 5HFJA 1B42A 3DONA 1ZWKA 3QUCA 4P82A 4AMYA 1T9AA 5EFZA 1ZP6A 3U7QB 1ND6A 4A8JA 1V8BA 5KREA 4GS5A 1H4QA 3UNXA 1Z8FA 1VSUA 3CIOA 2YBEA 1FVHA 4P3NA 1SCJA 5JMWA 1Q12A 3JQ9A 1L0BA 1LBIA 4JOCA 1YFLA 2AI3A 4UBMA 1NF3A 1CDOA 3DHEA 5HKAA 1WS6A 1PJLA 1NI3A 2OC4A 3G8AA 3HG7A 3JPYA 3JD2A 3L0DA 3N0WA 3NX4A 1EJ2A 3PQ3A 5C3UA 4CDGA 4E46A 3B53X 2IGTA 5FFMA 2YCBA 1X7XB 2FPIB 5ED4A 3RVNA 3U17A 3S81A 3D1JA 3Q5EA 1SMKA 4Y30A 1JH8A 3RODA 5J9FA 4LYDA 5B12A 2FE4A 3AEQB 5FBVB 2WNIA 3N07A 1SQ5A 1UBEA 1A9YA 4Q48A 2ZTVA 4ZQEA 3W6UA 3N3AC 1GR1A 3EWIA 3O3NB 1F8XA 1P74A 1Q0QA 3I2YX 1LRKA 4G67A 1L2TA 2EF0A 3RUAA 4IFTA 2ZXEA 3CYFA 3K96A 4F6RA 4QTZA 1CJMA 1CKEA 1O54A 5JD3A 3B12A 1OPXA 2GPAA 4V0OA 4YC7A 2ZXFA 4MCAA 5J59A 4CEJA 1KYQA 1SKYE 2NYRA 3D8TA 1K3FA 1UC5B 3L84A 4Q9NA 5CFOA 3I01M 4BMZA 2X7HA 1A3CA 3VR5A 3I9JA 4JMLA 1TKCA 4GPIB 2VOJA 1ESEA 4GXNA 3JAMA 4OJKA 3ZBTA 3V8MA 1AXEA 4E4TA 5JXIA 1RM3A 2R7NA 4PFQA 1Z63A 1Q3TA 2PWAA 2W93A 1AU9A 1SA0B 1B7GO 3LY7A 2QLMA 2XQJA 3GT7A 1DV2A 3HLKA 4BB9A 3PP8A 1HFEL 5E6SB 1DUSA 3UJ6A 1U63A 4MA5A 2Z6VA 1XPJA 1UQUA 4DBVO 5TQ0A 1N2OA 1EWRA 3ABZA 2HFJA 3F2VA 3HKEB 2I1VB 4Z3KA 7YASA 5KO2A 1DKOA 4EY8A 3LY5A 3V48A 1SHLA 3BE8A 1II9A 2O2ZA 1N34B 1BOOA 3AI3A 4EY4A 3CNEA 1RLTA 3NBZC 2ORWA 1P2FA 5IKMA 4G5SA 4J07A 5IM4F 2GZSA 2Q49A 4F97A 2PUFA 2W6PA 3RAFC 4UE2A 1BU8A 2ZEJA 5TARA 4J43A 4ZCIA 1CX9B 1PFVA 1VJTA 2GCIA 1J1ZA 5JCJD 5D7BA 1NBME 1EFVB 5KOHA 4F11A 3ZGZA 1KRXA 1GXSB 3ORQA 1I14A 5C34B 4WESA 3WMEA 3VR6D 4ZAVA 3H9GA 4JXXA 2DHQA 2B35A 4FM9A 3H1FA 3W34A 2R84A 4M89A 4K3UA 1N2GA 4CTKA 4L5YA 4RVGA 4YP0A 3W7BA 4V03A 2C82A 3NHPA 2PGJA 1O97C 3CNNA 4I7EA 2AZ4A 2PMCA 1ZA2A 2Z43A 3C1UA 3FVVA 1ZGGA 2WVHA 2QL5A 1BKSB 3LU1A 1R4NB 4WFJA 3DJFA 5A0FA 5GM1A 1OR8A 3CH5A 1OIWA 3P9QA 4K9KA 4B82A 5A9RA 2CLFB 1ZN8A 2AR9A 3V1TC 1Q7TA 1VL2A 2MMGA 5GOZA 4Q7JB 3CM0A 2CL5A 3GLFA 2P2ZA 1OFUA 3I0NA 4KWCA 4ONEA 3QHPA 3H05A 3Q0EA 4CIDA 4ESEA 2HIGA 4ZJUA 7MDHA 3FDIA 4N5NA 3MYYA 3ND5A 5EE0A 2NYAA 1K86A 4UM9B 2XXAB 3FFBA 4LSWA 3QPWA 4DEVA 1TU0A 2UVPA 4U9IS 5IBPA 4H4DA 1XWWA 3IAM6 5CJPA 5I9NA 1KEVA 3A14A 4JB3A 3GFQA 5TQVA 3W8FA 1BVYF 1PQYA 4E07A 3C4VA 2GETA 1MORA 3EMDA 4KX3A 5ITWA 3Q10A 3E3NA 1W36D 2VTEA 2D8MA 3ETCA 2YY5A 1T4CB 2YJGA 3K6RA 3QOWA 1IDN1 5FFNA 4EG6A 1Z12A 3MCZA 4TXJA 4Y2GA 4NI5A 4F1KA 5B7QA 1AQNA 2AJCA 2GTPA 1HR0B 2V7WA 2VKTA 3A04A 4YAFA 4DZRA 1K5DA 4NU5A 3TBKA 1A9OA 2FV8A 2DU8A 2GBPA 1GYQA 3T1QA 2PN1A 3QU2A 5HPYB 2C3MA 4N8SA 4BS9A 4Q3CA 1PS8A 2O3TA 5KSZA 1VCHA 2KS6A 1UH5A 4MB2A 3B2NA 1ZNXA 4CFZA 3I9NA 1OGYA 2BGIA 1SOMA 4BU0A 1I6WA 2MYUA 2OY0A 1RWQA 1WDWB 2XDAA 3GOHA 4FNMA 1DC5A 4GRAA 5DM1A 4ZZ2A 5MGNA 1ZMOA 3KQTA 3NT2A 1ESNA 1QOZA 2C31A 1FFEA 2OBNA 4RYLA 1WG8A 4MVJD 1W88A 1KE1A 4LC0A 3LA6A 4YLEA 1Y1KE 1JAYA 2A0UA 3M1LA 2NZVG 2GEDA 3R6WA 2J4DA 3PKZA 3PQFA 2ZE5A 3UEOA 3WK9A 2CFTA 2V4ZA 3O0TA 1KI6A 1YDWA 1CR4A 1RKBA 1ZX1A 1V71A 2Z5VA 5E8JA 2XRMA 2QRNA 2YOFA 3DOCA 1LK7A 3GJ4A 4JLUA 2VQDA 2IIBA 3QKTA 5CA0F 2V3VA 4E5VA 3AIMA 3QV2A 5H3HA 3LVFO 4BRZA 2BEWB 3T5GA 4CI0B 4WZZA 1U0FA 4RTJA 1UBUS 1U99A 1CNEA 1RJDA 4P4SB 2DFDA 3B7WA 4U9HS 4H0CA 4F96A 3H5VA 4LZAA 2I87A 2GN2A 3C85A 1F8UA 1L5ZA 3B82A 1DXOA 3H4IA 3KHSA 4XQGA 5IMBA 1SQFA 3A6DA 3ZEIA 1P4JA 1C2YA 4I6EA 4QUDA 2WOJA 1BXKA 3G5AA 1QH1B 3FE2A 3A2KA 4AMVA 1XLUA 3RWBA 1HT2E 3E5HA 1IM8A 3LT0A 3TLGB 5C18A 1ZHOA 3B51X 3GDOA 1JJIA 5LBUA 1QKKA 4LVOA 3MTEA 2WKSA 3HE3A 3F9CA 2WWFA 1G66A 4WAUA 1OASA 4NDNE 1QYDA 5IJXA 1A2BA 4MQUA 3UM9A 3LBFA 2O05A 1NBEA 4GUDA 4YLYA 5FTKA 1YQDA 1UXGA 4R8RA 3TLBA 2IPXA 2QSYA 4CV3A 2IGBA 4ZT2A 3KX2A 4RTKA 4HVCA 3VRHA 2CV0A 1EG2A 2ZI4A 4HG2A 4XH9B 4KVZA 4CM4A 4I99A 1FPQA 2Z5GA 3ORFA 3OAAA 4QYWA 1X87A 5B64A 4WZAB 2A0WA 4L78A 4BVGA 3A8TA 2H3EA 1FDVA 3PL5A 5P21A 4LX8A 3BCRA 4RH1A 4MCIA 3PEFA 3Q3GE 1J99A 3V2IA 4LVNA 2IXAA 2JI6A 4YH1A 2W8BB 2QQFA 4N8DA 3ONWA 3PC8C 3UCXA 1VL6A 4BFCA 5JO0A 4GX0A 2CLDX 1GA6A 1LFDB 3SEAA 1F8FA 1ZM3A 2O50A 2R5WA 3ZLBA 4ZMSA 1C1DB 3QE9Y 2IHNA 2IS1A 3AUJB 4RY9A 2REQA 1G42A 3PDWA 1WQ3A 1HZZA 3FNFA 3DE1X 3HFRA 5H16A 4XD7D 1E9SA 1G3IA 1H2FA 3K2IA 4OIMA 3RNOA 2WJIA 1WDKA 3E7PA 1T0BA 3NBKA 8ABPA 4ZTUB 4UUBA 1D2MA 1TIPA 2XCLA 2BCGY 1CRQA 2X0RA 4BLSA 5BMVA 1LLCA 3ZE0B 4EHHA 4EPVA 3T9BA 2CJPA 1ISGA 2YOHA 2GAAA 1N6HA 4DCMA 3QJGA 1F9EA 2CLKB 2HRZA 5D8DA 4FFVA 3IIJA 4Y2UA 4YWHA 3WNQA 4B74A 4Y1GA 3DMDA 1BYIA 1F7VA 4YPFA 2CVQA 4C30A 1SRQA 3ELYA 4AIRA 4FEEA 3ZCXA 2O7NA 1WETA 4JC4A 4KCGA 3AXTA 5EEHA 2JVJA 1J1UA 5IJ9B 2IV2X 3SLGA 4QPPA 1JSLA 3L3BA 5E7QA 4BWFB 3ELBA 3OBIA 1D4OA 4JXKA 4B09A 3KYDA 3NB0A 2O3JA 3E23A 1GN9A 2FPRA 4B5KA 1DEKA 1DIBA 3UK6A 3M5PA 1I2MA 1UF9A 2YRXA 1PKXA 2YVKA 5CXSA 3ZNQA 4R1NA 4YAGA 3H8VA 4CKWB 2P4EA 3PYXA 2V58A 1P72A 2YWHA 3KEOA 4D81A 3PE6A 1U7XA 4IXMA 4ISBA 5FOWA 1OF1A 2I4TA 1C0PA 5TGZA 3MWJA 1V16A 1JIXA 3R7AA 1VPTA 3F96A 4JASB 2CNOA 4TS3A 5DOZA 4B76A 2FN4A 3IDSA 2O20A 2VQ6A 2WDZA 1UXKA 2RDMA 4M9QA 3F7OA 5LB2A 5BNTA 5IC5A 2FF7A 5J23A 1BMTA 4EP1A 3AEUB 1LWNA 1AIPA 3H0KA 3RVBA 3AB3A 3HBLA 3ZDZB 5EQJB 4ZZ0A 2HMWA 3DQZA 2JGEA 2XI4A 4QFBA 4PO3X 4E6EA 1B76A 4X91A 1E2GA 3N0XA 5TF0A 5JH7A 4RK5A 4NZZA 5DHUA 5DHAA 2QRLA 3U4MA 3KVYA 3NV7A 2FR0A 3BN3A 4I2VA 2X4GA 4XM0A 4YCLA 4KKXB 2QQ5A 1ISJA 1S2OA 2MINB 4LYGA 2BM0A 5FO0A 4DSAA 4DR2B 2IY8A 2Y3IA 2ZWAA 4KLNA 4UDNA 3B13B 3MCUA 4R0MA 1BCSB 3B3JA 2P4UA 3BB1A 1CDEA 4J0DA 2DFVA 4RS4A 5J2UF 4OMCA 3VR3D 2DFPA 3NVKI 2A5LA 3VO9A 2WEKA 4B8YA 5A6SA 2C42A 3AL3A 2B30A 4CTNA 1Z6TA 4TLMB 1FNCA 4XB2A 1QRTA 1U2EA 4GLJA 2K87A 5EXTA 1BU5A 4ND8A 1ADJA 2FFBA 4N5DA 2GDJA 2XB8A 1L4BA 2VDRB 4RLHA 4D8YA 1K8QA 4PSAA 4DC1A 3OX1A 5BT9A 2QZPA 2GYWA 2QTTA 3MWLA 1T1IA 3K70B 3T9FA 1XL1A 1XD8A 3Q8KA 2J6HA 5CLFA 3TUIC 4KXWA 4F2GA 1QWSA 3QKIA 1J0EA 1UK6A 4AI6A 2OFWA 3C3AA 4WMLA 1RHJA 4A8TA 4AQDA 3DS8A 4KQMA 4CKEB 1U1GA 3P4UA 3NBUA 2J41A 1P18A 2O1EA 1G3RA 1RMQA 2ACEA 3OF3A 3JALA 4UUOA 1QV6A 3DKPA 4TL8A 1U8ZA 4MEAA 1LTHR 5BWLA 4DKXA 1GYPA 2ECFA 4ZCRA 3F3MA 2XB2A 4JSRA 2G8NA 3I5AA 5J4HA 3OY7A 4N6NA 5LQKA 3MS4A 3WQSB 3GVXA 1QB7A 2I6TA 2XMPA 4PZ0A 4HGQA 4ERXA 3K9WA 4UBIA 4C06A 2CJWB 4N9QA 4NZNA 3ZQKA 2DZDA 1AKNA 2JAOA 3UAOA 2O2HA 2AJ8A 1O9BA 3SBXA 4Y1FA 2A86A 1CB7A 1CQWA 4G0NA 4NQZA 2X0EA 2WINI 1E32A 1B8UA 4RF3A 5AXCA 1BFKA 4LISA 1AA6A 3AUTA 3E22B 5G1NA 3D7MA 5HM8A 3KQKA 4LJAA 3I83A 5IJWA 5MFZA 4L07A 3ZIAD 2BJVA 1UKEA 3S2IA 2FN8A 3FMPB 1R6TA 1L9XA 1THTA 1DBVO 1B26A 1Y8QB 2OHHA 3OT1B 4UC0A 5IC6A 2C92A 3K1TA 1KZ1A 2HWKA 3UAGA 5C5CA 2OUKA 2J0SA 3NHZA 2ONJA 1EA5A 2I3GA 3FUTA 4UPEA 4GDMA 2GPYA 4Y0VA 1RWKA 3FYUA 1S3IA 1TPYA 1XMIA 3EAFA 4QTTB 5KWSA 4KGVA 4XX1A 4AY3A 2CNWA 2ZZKA 1CUJA 3CJTA 3T94A 1B3BA 4PLVA 1NG9A 1SD5A 2GBIA 2R00A 5CT6A 5AM3A 1I1NA 3N5KA 3TD6A 4P0QB 1SXJB 2O7QA 2YMLA 1FNMA 1Z34A 3KOUA 3M2PA 3ZCQA 3R75A 1V3TA 4B7AA 1UBFA 1QONA 4ZYZA 3I1YA 2Z6UA 4KSYA 5BUCA 1AN9A 1VKNA 2DG2A 4PWYA 2Q8PA 3ECAA 1PJCA 1PWYE 3HL4A 4FMCF 4MKHA 5FWYA 2EHDA 3ETJA 2FZVA 1N2JA 3GGSA 3HS3A 3WWOA 4KC0A 4PN7A 1PT6A 4EENA 1R3UA 3NYWA 1ZMRA 3FOCA 5F78A 5DNCA 1W7AA 3NM4A 1DQSA 3CVJA 2O48X 3ROEA 1K7CA 3IPYA 4FFSA 4NFLA 2YL2A 4IZIA 2EBWA 3TJMA 3MQ4A 2QMQA 5KTRA 2IDKA 3HM9A 2ZCJA 4DA8A 2IIQA 1YI1A 3F6BX 4FS3A 1SUSA 4C7XA 2FUKA 3DAHA 2EL7A 2FE1A 3MWEB 3N7UA 1VB5A 3O9ZA 5AOVA 3KB2A 4TYPA 4OK3A 5FPQA 5HNKA 4E03A 2Q3FA 1XZPA 1KOFA 3LDAA 2XVMA 4IPTA 2IJGX 2AXQA 5KWVA 3CH6A 4URWR 2VDOB 1N6NA 3BEOA 3SOZA 1Z0JA 3PUIA 2PKXA 2C94A 1KAGA 2Q8QA 1UPXA 4FJ0A 4PNHA 3RQIA 5M29A 3QNUA 4O4IA 2QUZA 4GX1A 4U2BA 4JI2B 4OGKA 3AUYA 3QHAA 1E1MA 3GRKA 4IHJA 3TLAA 1P77A 2XDWA 3UUGA 1XT6A 4KO2S 1SZPA 1XGKA 3BEDA 3HP4A 4JL6A 3RC7A 1PI3A 1BWQA 2FPGB 3LPCA 4ZOLF 1Y6GA 3PHGA 3UHOA 1O95D 4MQ5A 1DDGA 1SH7A 1A7KA 3TWOA 3FB1A 2CEAA 1BE1A 4RHCA 2DM6A 2NO1A 1NXOA 2OWDA 2W00A 1FYFA 4MQEB 4QOSA 4EHBA 3L8GA 1QV7A 4JI8B 1YT5A 4Q5IA 1P39A 2X2PA 5L3SA 3COZA 3TQTA 4R41A 5JBQA 1A2KC 3DC2A 1O94A 4FR0A 3ESDA 1CUWA 3R44A 1U2GC 3VC2A 3V8VA 3G2LA 1YONA 1XVIA 4JP5A 2VYFA 3V8PA 5GINE 4R8KA 3U4QA 1QHHB 1FXWA 3CUUA 3P20A 1MQ8B 4FGUA 4ID9A 3UJ7A 4B35A 1YQTA 2NUTB 3G3EA 3KCQA 3ST7A 1DAOA 1Q17A 5CM2Z 4D9EA 1QJCA 1CUZA 4X3CA 1SPBS 3AK4A 2CMDA 1KDYA 2ISSD 3BMOB 3CNHA 4G2TA 4FJ1A 2B36A 2DQYA 4G5YA 1D2AA 3TINA 5HZMA 2ANBA 1OE0A 2UZ0A 4BATA 4JGBA 4PFSA 1EFCA 3TW6A 3G2PA 4OA8A 5IAAA 4LY0A 1JKIA 3GFGA 2Q3CA 1PP4A 3QU5A 3LQ2A 1SCAA 1YE3A 3Q8XB 4CVNA 3GMDA 3JQ7A 4IV0A 1YBVA 2E82A 3FVRA 4OHBA 3ZXYA 1M9NA 1AQLA 3NP7A 3BGDA 3QXJA 4U1RA 2WSSA 3NIGB 3FR7A 3IAUA 4X93A 1PK8A 2JFHA 2VJDA 2EU8A 1I2DA 2YCLA 1Y8AA 4LYYA 3BIXA 4S1NA 3EB9A 5EIOA 5IWAB 2VATA 4RVSA 3PFIA 5HEKA 1EXDA 4V38A 4HNAA 3BRWA 5DULA 1KJWA 4OPMA 3RG8A 2BDUA 2PGXA 2X0NA 3R3WA 2F7SA 4RULA 4M0CA 5B1SA 1A82A 2DF8A 3PGKA 4BZPA 2RBEA 3DMRA 4M8IA 2JLSA 4UVIA 4Z99A 3U80A 3L04A 3S0JA 1F6BA 1UBGA 4F5ZA 1MABB 2WFLA 1EE2A 5F64A 1DAEA 3R9KA 4Z2YA 2CCKA 5YASA 4MWOA 4TVBA 2VHVA 4MKFA 4BFYA 1QGZA 1TYDE 1RLOA 1M76A 1E60A 4QYIB 2ID4A 1NE2A 4AXXA 4F2HA 2YY6A 4KBGA 1XNGA 9LDBA 2KBFA 1P7CA 3HB1A 4A8PA 5KOIA 3OKCA 4CT0A 3GRCA 5DBGA 2RB4A 3S8MA 1GZSA 1PWZA 3TDMA 2Q1XA 3E4DA 5CFZA 5K3EA 1ZBQA 3WSVA 2IIVA 1PZNA 5I7FA 2AR0A 1E9AA 1X38A 3T12A 3TX6A 3ZBPA 4EHFA 1NP6A 4U8HA 2FW0A 2GZRA 3U9LA 5ELLA 4NCKA 4Z4EA 1CR6A 3NBXX 4J3NA 1KOGA 4EK9A 3DZDA 1J9GA 2HX1A 2Q45A 4IG9A 3LFTA 2PO5A 1T2EA 1RE1A 3DTVA 1IEQA 2RC5A 1ZGAA 4G1BA 5BOSB 2QROA 3EVGA 1MG0A 4LXTA 4MKGA 5B6JA 3FLBA 3KSBC 2ZREA 2Q5EA 3EULA 3K9QO 4GEKA 2W2QA 4LTNA 4PO1A 2DPLA 3CE6A 3PA6A 4PQFA 5F3RA 4CLRB 4OXIA 2VF2A 1N57A 1GL3A 2VUTA 3PLRA 4KV9A 1J56A 3NIBA 4OUKX 2PKYX 1XQ1A 5JIBA 4LF7B 2RB5A 3GVIA 2JBHA 5E2AA 1UIRA 4QDUA 4BNIA 4MPTA 3LUFA 4N0MA 3NGLA 2GVZC 1JDNA 1HYGA 5AVWA 3U44B 4CM1A 4B3GA 3QUAA 4WGFA 3U26A 2MYNA 4CJXA 4CLEA 3H99A 2AFIA 1W29A 2PYDA 5DM4A 3ZWDA 3W9SA 2BY4A 3OSZA 2NVBA 4TTQA 5ICFA 4EUFA 4INOA 2ZR7A 3QOFA 3VGJA 3DXZA 1BHSA 4ON9A 3B3AA 3JWGA 5AW4A 2G9QA 3IB6A 2AC7A 2VYCA 1XIVA 4FINA 1VIVA 2H11A 1BVRA 1SU4A 5CPBA 3LI2A 1Q0UA 1HG0A 1J8VA 4J1NA 3ZZUA 1Q22A 1MO6A 4D8WA 5BYBA 2ZJ6A 2VHJA 4GDFA 2M1XA 1J7JA 121PA 1RPTA 4XB6B 5FIUA 2O06A 3TSYA 1Z4OA 1M1ZA 1Y6QA 2VBIA 4PQEA 3S2GA 1E1RA 2D2EA 1E1CA 4H3VA 2CDCA 1OBFO 3K6KA 4GKJB 4PF1A 2VWGA 3R7LA 2CMHA 3A10A 3FSRA 3VU3A 4QDJA 4DS3A 3IE0A 2C2KA 1MZPA 5DZSA 3WO1A 3UICA 4EA7A 4HBZA 3TB6A 2AEEA 1CU1A 1NAIA 2P9JA 1M6HA 2WLSA 1RKVA 3EF0A 1WBBA 1KIMA 3PQ5A 5HXAA 2QE6A 1PFUA 3H0CA 3HL0A 1KHTA 3ICWA 3FI9A 1TEVA 3C6MA 2J3LA 3CGWA 3KVOA 4Q4HA 1U9IA 1HDXA 1A97A 3AHFA 4QOEA 4RZHA 4FFNA 3OQMA 2QMOA 3IEMA 5LDHA 3GJ5A 4QSMA 3RAGA 2Q4DA 1NATA 2XZPA 5DM0A 1HTWA 2AN4A 2GHTA 2VC2B 4D0NA 3CBQA 4GLBA 4DR6B 3IA2A 2C9MA 5K03A 4LWOA 4A27A 3OKAA 1U8UA 3N2ZB 1QQ5A 2V7QD 1YO6A 2C5FA 4JXJA 4TMFA 4PYRA 3C0KA 4UCWA 1AKYA 2P6NA 4D5GA 3KELA 1J2RA 2NQTA 3CKLA 3LVQE 3PTLA 1TUEA 3MTGA 3HNPA 1IZ9A 1F6WA 5I7VA 3NOQA 3JU3A 1DU4A 1G8HA 2W22A 3FUVA 3AL2A 1U9JA 3TG8A 4NLLA 4XWOA 5CA1F 1EFPA 1VA5A 1J8YF 4IO1A 4ZRMA 1P4RA 3UIEA 2QBYA 2RHLA 1NJ5A 1Z5ZA 4N7BA 3I3SR 2WIBA 4BP9A 2RC6A 2QK4A 2ZIAA 5H0IA 2JAXA 4M99A 4NG4A 4X97A 4G0OA 4DUPA 1E6KA 2W6QA 4QT4A 5CXQA 5F98A 4NPHA 2X0IA 2N9UA 4PU0A 3SKXA 4DLXA 4NXMB 5DN9A 5LZ2A 4JFRA 3H3FA 4EYKA 3ZCVA 4K28A 4ZAFA 3EN0A 2F4VB 1KJ8A 3P2EA 4UREA 1R8SA 1HETA 4E5PA 5HZKA 4MI6A 5EZ6B 3LP8A 4WCFA 4ZFNA 2WOOA 1JS1X 4JC0A 3I9OA 2OHIA 2ZRHA 3KUUA 1VJCA 3KUXA 5BYKA 5JSFA 2G28A 3P2IA 4DV2B 5FUWA 1X15A 1N5KA 1Z6PA 2IF2A 3L7NA 1BVHA 4DMMA 1SKAA 4KPEC 4E7PA 1FDRA 4LE1A 4C6RA 1GQQA 1VRCA 4XSVA 3RYFB 3V8RA 4XR4A 2FW6A 2FPSA 3AHCA 3EGWA 1MB9A