4P87A

Crystal structure of est-y29, a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
390
structure length
390
Chain Sequence
SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Est-Y29
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
total genus 121
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p87A00
1LLBA 3NDEA 4L0LA 3IWOA 4U0XA 4OP8A 1ZC2A 3FKWA 2EXAA 4PM8A 4ZJ2A 1PI4A 3V39A 3PBTA 2WGVA 1NZUA 3G4PA 5CGXA 1MY8A 4XUZA 3BFDA 1ESIA 3MZDA 1H8ZA 3CZDA 2IWBA 5I94A 4KZ7A 1KGGA 2XFTA 2PU4A 3HLCA 1PW1A 5DVAA 3ISGA 1N4OA 1RP5A 4MEZA 2XFSA 3LEZA 4KZ3A 1YT4A 2FFFB 2PBYA 3GQZA 2Y2KA 3LCEA 3IH8A 4E3NA 4IBRA 1TEMA 3NIAA 3Q1FA 3SH8A 3VFHA 1XP4A 4JXVA 3SS3A 5G18A 3GVBA 2WAEA 1Z6FA 4OQGA 1WE4A 2ZC3B 5DTSA 4GD8A 3VP0A 2WZZA 3S22A 2X02A 2EFUA 1KDSA 4MBFA 3SS5A 1XXMA 1ES4A 1MKIA 4UAAA 3ZDJA 5KSHA 4OOYA 4OQ0A 3NBLA 4WM9A 5U47A 4R4SA 4DKIA 5FATA 4ID4A 5DTTA 4E3OA 3ZCZA 3VSKA 5CHUA 2H0YA 3OZHA 4DE2A 4O7DA 4QHCA 4B4ZA 1YLWA 4Y0OA 2Y55A 1L0FA 3MXRA 4KZAA 4WEJA 3GV9A 3M6BA 4S2PA 3IWQA 1MBLA 2BLSA 2A3UA 3BM6A 2QMIA 4S2NC 4B88A 1BZAA 1QMFA 3OC2A 2JC7A 4QD4A 3S4XA 1QMEA 2EFXA 2WK0A 1MWRA 3OPPA 3UN7A 4E3JA 2Y2HA 1XGIA 3Q7VB 2X01A 4OPRA 4NETA 4OVDA 3S1YA 4OLDA 3UO9A 1ES2A 1K25A 4OPZA 3IHAA 2DNSA 2Y2QA 2WYXA 3IF6A 1BULA 3HLDA 3N4IA 4WEKA 1MWTA 1NXYA 2WKEA 1E4DA 1ERQA 1FCMA 5E2HA 2IWDA 5FAPA 3ZVTA 2EX6A 4C3QA 3VSLA 2QPNA 4IVIA 4JF6A 3M2JA 4ZAMA 2XD1A 5CTMA 3Q7ZA 1O07A 4S2NA 4Q8IA 3OPHA 2Y2PA 5TR7A 4FSFA 3A3JA 3QNBA 1KVLA 1ZG4A 2Z2LB 3W4QA 5FQMA 3GRJA 4JF4A 2ZQAA 2WGWB 2R9XA 2XEPA 3Q81A 4K0XA 1EWZA 3P98A 3AGEA 4DE0A 1IYSA 4X69A 2Q9MA 1CEFA 3GR2A 2ZM0A 4OPYA 3C4OA 1SKFA 3IXGA 3HLWA 4EBNA 2H5SA 4X68A 1FOFA 1AXBA 3DW0A 4ZTKA 1GCEA 3WS1A 1IKGA 3IHBA 1PWGA 4RX2A 4WZ5C 4IBXA 5EVID 5AQ9A 3V5MA 5F83A 4LV0A 2X71A 3LY4A 5CEBA 4KQOA 4BQMA 4R1GA 1FSYA 2A49A 1YLJA 3PAEA 5EVIB 4P87A 4KZ5A 2J7VA 2J9PA 3C7UA 3GSGA 1ALQA 3IQAA 2Y2LA 1ES3A 4XUXA 5CHJA 2WKHA 2V2FF 4K91A 5GLBA 2XQZA 2ZQCA 1W8QA 1YLYA 1XGJA 1FR6A 4S2KA 3D4FA 3UDFA 4WZ5A 4C75A 1PW8A 1S0WA 3PBNA 5DF9A 2GDNA 4CJNA 4DXCA 3RJUA 1YQSA 5CRFA 2PU2A 1XKZA 4GD6A 1MPLA 1GA0A 4R4RA 1ZG6A 4DDSA 5KZHA 4JKTA 5GLAA 3AGDA 3TG9A 3M2KA 1VQQA 1K57C 1YLZA 5L2FA 1EI5A 5CHMA 5HARA 4EWFA 5EOOA 5AQ7A 3IXHA 1H8YA 1BUEA 1EROA 1YLPA 4RYEA 2HPBA 4WYYA 3BFGA 1K54C 3MFDA 2V20A 5GHYA 3SOIA 1PZPA 3C7VA 1NRFA 1S6RA 2XGNA 5FA7A 1LHYA 3W4OA 4UA6A 5EE8A 1IEMA 1LL9A 3PBRA 3UE1A 5JYPA 5E2GA 4LCLA 1SDNA 5E43A 2XLNA 1KE3A 4EQIA 4R3JA 3UDXA 1PWDA 5GLDA 4GN2A 3G31A 3ZG7B 3DWKA 4HBUA 2Y2OA 3OPRA 1XPBA 3A3FA 3RXWA 3DTMA 2H0TA 4QY5A 2ZC7A 5D3OA 2VGKA 1K55C 1M40A 1K4FA 3A3DA 2BG1A 4XXRA 4MBKA 3EQVA 1TVFA 3GMWA 3NC8A 3BFEA 3PBSA 4EBLA 4HEFA 4Z9QA 4BL2A 2EX2A 3VOYA 3WS2A 4JLFA 5A91A 4RVAA 4WBGA 1BT5A 4YINA 1IYOA 2G2UA 1NYMA 3BECA 3N7WA 2I72A 3DWZA 1BLPA 3CMZA 3OCLA 2Y4AA 3RXXA 4K0WA 4IEDA 3G32A 4E3MA 4KZ6A 3MXSA 5EUAA 2Z2MB 3UPNA 1K55A 2V1ZA 2ZC5B 2JBFA 4RX3A 3QHYA 1PYYA 4DRTA 2E8IA 4OP5A 1MXOA 2OLUA 2ZC6B 3BFFA 3W8KA 2DRWA 2EX9A 4JXSA 1W5DA 5HFOA 3V3RA 4F94A 2HDRA 1ZKJA 2R9WA 5A90A 4X56A 3BYDA 2UWXA 3C5AA 5KSCA 1SCWA 5F82A 4OKPA 4E6WA 4OPQA 4BENA 4S2LA 1O7EA 1LI9A 1W8YA 1XX2A 5A92A 1RGYA 3N6IA 4OH0A 1E25A 4YFMA 5FAQA 4JPMA 4JXWA 2XH9A 5TGFA 2OV5A 3W4PA 1GA9A 3WWXA 2JCHA 3VP4A 3HREA 4ZJ1A 5HW3A 2C5WB 1WYCA 5IHVA 4N9LA 3IXDA 3ZGAB 1E3UD 3MKFA 2Y2MA 1DJCA 4KZ4A 2IWCA 1W79A 1K38A 3LO7A 2ZQ8A 4KG2A 1Y54A 1IELA 1XA1A 2XDMA 4CPKA 1FCOA 2ZMAA 3CJMA 4OQIA 3V3SA 4LCMA 5FI6A 3VMAA 4IVKA 3V50A 1BLCA 2RL3A 1FQGA 1BTLA 3G34A 4ZBEA 1W7FA 4R23A 1Q2QA 3IT9A 5HAPA 3G2ZA 3VP3A 3ZG5A 5EVIC 1GHMA 2P9VB 1JTGA 4WELA 4WMCA 4ZJ3A 5FQKA 3ZG8B 4QU3A 1NYYA 4UA9A 2ZQ9A 4NK3A 5KMWA 3A3IA 2HP9A 1JWZA 1OMEA 3M6HA 3UNWA 4E3LA 5J8XA 1TDLA 1K56A 5CXWA 5FI2A 2EX8A 2Y2IA 4UA7A 1KGEA 2P74A 1PZOA 2QZ6A 4UHUA 3OCNA 4P0MA 3UDIA 4BLMA 3PBQA 2XK1A 4LENA 2Y59A 3FWLA 4B4XA 4R3BA 3UE0A 5EVIA 4S2MA 5GLCA 3MZEA 3ZNTA 1ESUA 3VOZA 3N8LA 1LI0A 4BL3A 1FCNA 4DXBA 3UY6A 4E6XA 5DF7A 5HAQA 1YMXA 4N92A 4FH2A 4M3KA 3UPPA 5DF8A 5AQAA 3E2LA 1MWUA 1RGZA 2Y2GA 3HVFA 3N8RA 1FR1A 1K6SA 4LV3A 1NJ4A 3FZCA 3C4PA 1GHIA 3IF5A 3PBOA 4MNRA 4PM9A 1G6AA 1HD8A 3FV7A 4KZ9A 1WYBA 4OOLA 2HP6A 2Y2JA 3FYZA 2HDQA 5EVLA 4QB8A 4KQRA 3ITBA 5FAOA 2B5RA 1U60A 2RCXA 1CK3A 5EECA 5GHZA 4GNUA 4DDYA 2ZM8A 5CGSA 1K57A 2DCFA 4DE3A 1M6KA 1K6RA 3MBZA 3AGFA 4PM6A 4GB7A 3B3XA 1DY6A 5EOEA 3ZNYA 3NDGA 1K4EA 1DJAA 1VM1A 4OONA 1K54A 4PPRA 3I7JA 4U3TA 4N1XA 3BLSA 1XA7A 2C6WB 1I2WA 2WUQA 5E2EA 1C3BA 2HDUA 3BRMA 5DTKA 5E2FA 3G2YA 3VP1A 2XR0A 5HAIA 2Y2NA 5CEDA 4P6BA 2ZD8A 4BD1A 3SH9A 3ITAA 5HX9A 4Y0UA 4QY6A 4C6YA 5CECA 4BD0A 1SDEA 1ERMA 3O88A 4HBTA 5FDHA 1IYQA 5FQQA 3ZG9B 4PM5A 5JYOA 4PMAA 1I2SA 2J8YA 3UE3A 3PAGA 1LL5A 4GKUA 1Q2PA 2ZLYA 5FASA 1BLSA 3O3VA 2WADA 1SHVA 5GHXA 3ZFZA 4WZ4A 3MKEA 4MLLA 1L0EA 3IF6B 5FQ9A 1JVJA 3IF6C 1FSWA 1ONGA 1IKIA 3CG5A 4U0TA 1H5XA 4OOMA 5FQJA 2OLVA 2VGJA 3QNCA 3WS4A 2HDSA 3IWIA 4N9KA 3WRZA 1MWSA 4PM7A 1PWCA 1YMSA 5CGWA 5GL9A 1N9BA 4FH4A 1JTDA 4FCFA 2EXBA 3WS0A 1HTZA 1JWVA 1PI5A 3Q82A 2XF3A 4KQQA 2ZM2A 3SS4A 3HL9A 1IYPA 3G30A 5CERA 3NI9A 4R0QA 5HL1A 2XD5A 3Q7VA 4X53A 4EUZA 3A3EA 5A93A 1L2SA 3HUOA 3MZFA 1ONHA 4KZ8A 4P85A 1BSGA 1G68A 2ZQ7A 1L0GA 3WRTA 3ZHHA 4QJGA 4A5RA 2G2WA 5FSRA 3NCKA 2WKIA 3HLFA 4DF6A 4HESA 2CC1A 3ZVWA 2Q9NA 3SH7A 4KG6A 4LV2A 3VP2A 2J9OA 5M19A 1BLHA 1YM1A 4GZBA 4H8RA 1KE0A 3GTCA 4ZDXA 1NZOA 4LV1A 1HZOA 4Y0TA 1HVBA 5F1FA 1YLTA 3IH9A 3VFFA 4WMCD 3G35A 4X6TA 3PTEA 3WS5A 4OQHA 4OLGA 2ZC4B 3BLMA 2WGWA 4GOGA 4E3KA 1CEGA 3FKVA 4N1HA 3HLEA 4S2OA 5F1GA 1JWPA 5TFQA 3HUNA 4KG5A 1K56D 3ZG0A 3LY3A 3HBRA 1KDWA 3TSGA 1DJBA 4KZBA 3HLGA 2JE5A 4D2OA 3E2KA 3OPLA 4S2IA 3O86A 1I5QA 1GHPA 3HLBA 4GDBA 4RA7A 4E3IA 4JXGA 4GDNA 1CI8A 2OSUA 5AQBA 1L0DA 3EQUA 3TOIA 1E3UA 4S2JA 5BOHA 3BFCA 4X55A 5FI7A 5FQIA 4BJPA 1CI9A 2Y91A 4JBFA 1KGFA 1J9MA 5EPHA 4DE1A 3UPOA 2H10A 4EV4A 4FD8A 2HP5A 2ZJ9A 3Q07A 1ES5A 2P9VA 3NY4A 1TDGA 3N8SA 3P09A 5CTNA 4MBHA 2WGIA 3IXBA 1KE4A 1NY0A 2WAFA 2ZQDA 5M18A 3HUMA 4Y7PA 2WZXA 1RCJA 1KVMA 3O87A 3JYIA 4EBPA 4KENB 5M1AA 3BEBA 2FFYA 1PIOA 4JF5A
chains in the Genus database with same CATH superfamily
3NDEA 4L0LA 3IWOA 4U0XA 2M7UA 2EXAA 1PI4A 3PBTA 1NZUA 5CGXA 3BFDA 3MZDA 3E4QA 1H8ZA 2IWBA 5I94A 2PU4A 2V9AA 3HLCA 3IS2B 1PW1A 5DVAA 3ISGA 3B47A 5FEGA 2J3TC 1RP5A 3LEZA 4NEED 2PBYA 3LIEA 4IBRA 3Q1FA 3SS3A 4OQGA 1AWIA 1KDSA 1MKIA 3LEQA 4UAAA 2O9BA 4OOYA 2O9CA 1TS0A 5DTTA 3E0YA 4E3OA 3ZCZA 1LSVA 2H0YA 2VV7A 1YLWA 2Y55A 1L0FA 4WEJA 3IWQA 5C5KA 2A3UA 4B88A 1BZAA 3OC2A 3S4XA 4NXGA 1XGIA 2X01A 3A0SA 2O0YA 4NETA 1KOUA 3N4IA 5E2HA 1E4DA 1FCMA 2IWDA 1H8MA 3VSLA 3LIDA 1YAXA 1OTDA 4GW9A 1O07A 2OAQ1 3PXPA 4BBTA 1XJ2A 3AGEA 2YKFA 3T1RA 4DE0A 2WKPA 2ZM0A 1DP8A 3IXGA 5IU1A 2PD8A 4EEPA 4HH2A 3D72A 3WS1A 1IKGA 4WZ5C 4LV0A 4KQOA 1XFQA 4R1GA 2A49A 1YLJA 4MCWA 1A0KA 3LR4A 4KZ5A 3C7UA 3GSGA 1ALQA 2XQZA 4G3WA 1YLYA 1DP9A 4WZ5A 1PW8A 5DF9A 4DXCA 3K3CA 3RJUA 1X0OA 1XKZA 2JKTI 1MPLA 1F2KA 1ZG6A 4F3LB 5CHMA 5HARA 5AQ7A 3IXHA 3T1SA 1K54C 2ACGA 3ICYA 1NRFA 1LHYA 1LL9A 4WUJA 3UE1A 5JYPA 5E43A 2V0UA 4O0PA 2XA7S 4ARZB 4UEYA 1PWDA 5GLDA 3G31A 4K08A 3OPRA 1XPBA 2M1CA 1K55C 1LSWA 1K4FA 4JGPA 3T1XA 4MBKA 3EQVA 1S1YA 4BL2A 3BJNA 2EX2A 4JLFA 2QHKA 2ZMFA 1IYOA 4FOFA 3DWZA 3QP6A 2EA9A 5FDSA 5F5YA 2Z2MB 3UPNA 1K55A 4XT2A 2E8IA 2OLUA 2DRWA 3CHWP 2BASA 2R9WA 2UWXA 1MZUA 3NOUC 3VE3A 4OPQA 2ZOHA 1XX2A 5A92A 3TW8A 1RGYA 4YFMA 2JKFA 2XH9A 2W3FA 5HSQA 5HPIA 5L09A 3NOTC 5J4EA 4N9LA 1T1CA 1E3UD 2IWCA 3LO7A 4KG2A 4OQIA 4LCMA 5FI6A 2JHEA 3VMAA 4HHDA 1BLCA 4ZBEA 1FQGA 1BTLA 3EOIA 3G34A 1W7FA 4H6JA 4DJ2A 1NWZA 1Q2QA 3G2ZA 4ZJ3A 3ZG8B 2R78A 1NYYA 5KMWA 3A3IA 2HP9A 1JWZA 1OMEA 3EEAA 3UNWA 1K56A 1ZHHB 5FEFA 4UA7A 3UB6A 2O99A 4UHUA 3GDIA 3PBQA 2Y59A 3FWLA 4R3BA 5GLCA 1ESUA 4BL3A 1FCNA 4E6XA 2DMWA 5HAQA 1YMXA 4CLCE 4EQ1A 5DF8A 4Y3IA 3HVFA 3LR3A 1GHIA 4PM9A 1G6AA 2QKPA 4KZ9A 1WYBA 4OOLA 2HP6A 2Y2JA 2B5RA 1U60A 2J3TD 2O9AA 2RCXA 3RH8B 3GECA 1FIKA 1K57A 1OPXA 4GHIA 1M6KA 3MBZA 1DY6A 1F98A 2W3EA 4BBUA 4Y13A 2WUQA 1C3BA 3HCYA 2HDUA 3VP1A 2XR0A 4QY6A 3UB5P 1XFNA 1IYQA 4PMAA 1OTEA 1Q2PA 1WA9A 5GHXA 3ZFZA 1NRJA 3MKEA 1FSWA 1IKIA 4U0TA 5IS1A 3QNCA 3IWIA 2PT7A 1YMSA 4IUKA 4FCFA 3HL9A 3G30A 5CERA 5A93A 3O5YA 2ZQ7A 2B02A 2NUTC 3HLFA 1OT6A 4KUOA 4LV1A 3IH9A 4WMCD 2ZC4B 4JGOA 4E3KA 5DKKA 3FKVA 4N1HA 1DP6A 4S2OA 2W3DA 3LY3A 1KDWA 2VV8A 5IT5A 1DJBA 3LIFA 1FILA 4S2IA 1I5QA 1GHPA 4RA7A 1D1JA 4GCZA 3R4KA 3EQUA 4S2JA 2FZ0A 3T4JA 4BJPA 1CI9A 2Y91A 1DRMA 5EPHA 4DE1A 3S7QA 3UPOA 3Q07A 1TDGA 4MBHA 2WGIA 2ZL1A 3CUEC 2WAFA 3LIBA 4I39A 3CI6A 1W63M 1KVMA 1MKMA 5J7EA 4EXOA 4OP8A 1ZC2A 3EGXC 4PM8A 3LI8A 3V39A 2WGVA 4L9FA 1V9YA 1KGGA 2XFTA 3BWLA 4KZ3A 2Y2KA 3IH8A 1HLUP 1TEMA 1XP4A 4JXVA 5G18A 3S7NA 1WE4A 2ZC3B 5DTSA 2WZZA 1GSVA 2X02A 2VGLS 3KSFA 1XXMA 2HJEA 1GSXA 4XT2B 1IOUA 5U47A 4DKIA 4II7A 2PBDP 2V1BA 4DE2A 4QHCA 1Y28A 4Y0OA 3MSHA 4KZAA 3GV9A 3M6BA 1H0MA 4S2PA 2BLSA 1K0KA 2JC7A 2EFXA 3NECA 2VV6A 1ZTUA 2Y2HA 2W0NA 4OPRA 2P08A 3S1YA 4L9EA 4OLDA 3C38A 3UB8A 2Y2QA 3IF6A 1BULA 3EEHA 4D60A 4WEKA 1NXYA 2WKEA 4CQHA 1JNUA 2EX6A 2W1RA 4C3QA 1GSWA 3M2JA 2XD1A 3A0VA 1YKDA 2Y2PA 5EM1A 3GRJA 2ZQAA 2WGWB 5DFXA 3Q81A 4H6JB 1EWZA 2V1AA 3G6OA 2H28A 1LT0A 4WF0A 3W2ZA 3FC7A 4OPYA 3C4OA 2H5SA 4X68A 1AXBA 2UV0E 3DW0A 3IHBA 4IBXA 5AQ9A 5F83A 3LY4A 4R70A 4R6LA 4I3JA 2J9PA 2V2FF 5GLBA 2ZQCA 1W8QA 3IX4A 2QWSA 1FR6A 4HJ6A 2GDNA 3EGDC 5EM0A 5FL3A 1P97A 4G3KA 5KZHA 1S67L 3TG9A 3M2KA 1VQQA 4GHIB 4EWFA 3H7WA 4RYEA 2HPBA 5HDCA 1S6RA 1YPRA 3W4OA 2B18A 4UA6A 4CLCC 3PBRA 4LRYC 2XSSA 1TS8A 4LCLA 1OTBA 2V8FA 4EQIA 4R3JA 5DFYA 4PHTA 2PR6A 3DWKA 1YSQA 3A3FA 3TE8A 3DTKA 2VGKA 3UB7A 3A3DA 2BG1A 4XXRA 4JGQA 2OWHA 3GMWA 3BFEA 3NC8A 4MN5A 4PAUA 3H82A 3VOYA 4HOIA 3WS2A 4RVAA 4YINA 1NYMA 2QJ5A 5I5LA 3RXXA 2J80A 2M7VA 3B33A 3MXSA 2D01A 2V1ZA 2JBFA 4RX3A 1PYYA 4OP5A 1MXOA 2ZC6B 3P01A 3W8KA 4F94A 3L7HA 5A90A 3BYDA 3C5AA 5HL6A 4ETXA 1Z09A 3N6IA 5TGFA 4OH0A 2JCHA 2XROA 5L8MA 4EETB 5HW3A 2OAP1 3IXDA 4GLQA 5DKLA 1P9WA 1IELA 1FCOA 2ZMAA 2W1TA 1TD5A 4WL9A 5F6AA 4R23A 1L3LA 3MQ0A 3ZG5A 5EVIC 1JTGA 4WMCA 5FQKA 2ZL1B 3M6HA 5J8XA 1TDLA 4HJ3A 2EX8A 2QZ6A 2P74A 1PZOA 3MQOA 1F9IA 3LUQA 5F68A 1TF1A 5EVIA 3VOZA 2HV1A 4JGRA 3UY6A 2XRNA 1CQAA 5AQAA 3E2LA 1MWUA 4DXBA 2Y2GA 1K6SA 4LV3A 3FZCA 3IF5A 1T1AA 5EVLA 4QB8A 1VHMA 3ITBA 5EECA 4DDYA 2ZM8A 2VZWA 2JKRI 3B3XA 1SKOB 1K54A 3LIAA 1LSXA 3I7JA 4PPRA 4N1XA 2ZMVA 5E2FA 5HAIA 4P6BA 2HJ9C 3SH9A 3ITAA 5HX9A 4Y0UA 2VEAA 4WLAA 5CECA 1SDEA 1ERMA 4PM5A 3EWKA 5EVEA 4LRZE 3UE3A 4GKUA 3O3VA 3LR5A 4WZ4A 3IF6B 5FQ9A 1ONGA 3WS4A 3F1OA 2HDSA 4ETZA 1MWSA 3VV4A 4UQIS 5CGWA 5AVEA 1HTZA 1JWVA 2XF3A 3FPVA 2XD5A 3IBJA 3R7WA 4X53A 3A3EA 3HUOA 1ONHA 3IX3A 4QJGA 4O8GA 3NCKA 4DF6A 4KG6A 3VP2A 2J9OA 4GZBA 4H8RA 1KE0A 1NZOA 2QYBA 1HZOA 3IBRA 1XJ6A 3G35A 4X6TA 3PTEA 3WS5A 3BLMA 2WGWA 1XJ4A 4GOGA 2JN7A 3HLEA 5F1GA 1JWPA 3PR6A 4KZBA 2JE5A 3OPLA 2D02A 3HLBA 4JXGA 4GDNA 5AQBA 1MC0A 2V0WA 5BOHA 3BFCA 5FQIA 4Y15A 3MR0A 2GJ3A 2VK3A 1KGFA 3OOVA 1VB6A 4EV4A 3KSHA 4FD8A 2HP5A 3H7WB 3N8SA 4Z1WA 1NY0A 3HUMA 4HH3A 2WZXA 2FH5A 3JYIA 5M1AA 2L0WA 3LR0A 4ESPA 3MS6A 3CITA 4ZJ2A 3K2NA 4M4XA 1MY8A 4XUZA 4IUHA 4YOFA 3CZDA 4KZ7A 4CLCD 3ZYTA 2J3WA 1N4OA 3OLOA 4MEZA 2XFSA 1YT4A 2FFFB 3GQZA 3C30A 3LCEA 4E3NA 4CLCB 3NIAA 3VFHA 1PRQA 2XA7M 5HDDA 5K5BA 3H82B 2Z6CA 3GVBA 4X25A 4I38A 3T12B 4GD8A 4L9GA 1ES4A 1H3QA 3CPTA 5KSHA 3NBLA 4WM9A 3KSIA 4R4SA 5CHUA 3OZHA 1N9LA 4X1MA 2VLGA 5CX7A 5DJTA 1VETA 2QMIA 3V67A 1CJFA 1QMFA 1QMEA 1MWRA 4E3JA 4OVDA 4OPZA 3T4KA 2DNSA 4UQIM 3LGOA 1ERQA 3ZVTA 4GJ4A 3JPUA 3LICA 2QPNA 4IVIA 4ZAMA 5CTMA 3OPHA 2W1TB 4Y17A 1KVLA 2Z2LB 3W4QA 5FQMA 2KOIA 2R9XA 4K0XA 2K31A 2G7UA 3VOLA 1IYSA 5L07A 3GR2A 2PYPA 4EBNA 3E98A 3PHYA 1GCEA 2WKQA 5TBMA 4RX2A 1PWGA 5DJUA 5EVID 3DTIA 3ULFA 4MN7A 2L1MA 4BQMA 3PYPA 3PAEA 5EVIB 4P87A 2J7VA 3IQAA 4XUXA 4PKYA 2PDRA 4IHQA 4X1LA 4S2KA 3D4FA 3UDFA 1S0WA 4CJNA 4MN6A 1YQSA 2PU2A 2PRFA 4KUKA 4GD6A 1GA0A 2GZAA 4R4RA 3RTYA 2P7JA 2I9VA 5L2FA 1EI5A 1H8YA 1YLPA 3CUEA 2KX6A 3BFGA 3MFDA 5GHYA 3SOIA 3C7VA 4ZRRA 5J3WA 5EE8A 3T4QA 1SDNA 2XLNA 3UDXA 4I3AA 4GN2A 3ZG7B 4HBUA 1IFQA 1T1BA 2Y79A 3H9WA 1SKOA 3DTMA 4QY5A 3BY9A 1TVFA 3BY8A 4RQ9A 3PBSA 5HD5A 3F1OB 3LFVA 4LLOB 1BT5A 3BECA 2I72A 3SZTA 1BLPA 3CMZA 5EV0A 4K0WA 1D7EA 3TJZC 1NLZA 2ZC5B 3R7WB 1V9ZA 3BFFA 3V3RA 2EX9A 1W5DA 5HFOA 2HDRA 1ZKJA 4X56A 4OKPA 4BWIA 4BENA 4S2LA 5HPFA 4JPMA 4JXWA 1GA9A 3VP4A 3T4TA 3HREA 3HJIA 5IHVA 4LRXC 5LBRA 2JKTM 1W63Q 1P0ZA 3ZGAB 4P6ZS 2Y2MA 2CMNA 1DJCA 4KZ4A 2ZQ8A 1Y54A 1XA1A 2XDMA 3T4LA 4CPKA 3CJMA 1STZA 4I5SA 3V50A 1F5MA 1ACFA 2RL3A 3KO6A 3F1NA 4EEUA 4B9OA 1GHMA 5G4YA 1LL8A 3T1QB 3UB9A 4UA9A 1OTIA 1P9RA 1G6OA 5CXWA 5FI2A 2Y2IA 4P0MA 4BLMA 4LENA 4B4XA 4NG2A 3UE0A 3MZEA 4IJGA 1NLYA 3KYZA 4N92A 1TS6A 4FH2A 3N8RA 1FR1A 1NJ4A 3PBOA 4FTXA 2YKHA 3FV7A 3FYZA 1YSPA 2IA2A 5FAOA 1CK3A 5CGSA 4HY8A 2DCFA 4DE3A 3CPTB 1K6RA 4PM6A 3AGFA 3T4SA 5EOEA 3ZNYA 1K4EA 1DJAA 1VM1A 4OONA 5HWTA 4U3TA 4NXFA 3SW1A 1XA7A 2C6WB 4CLCA 2PD7A 3BW6A 2Y2NA 5CEDA 3C2WA 2VGLM 5FDHA 1VETB 3ZG9B 1I2SA 3P7NA 2LB5A 3PAGA 1BLSA 2WKRA 2WADA 3U4LP 3UMDA 4DMZA 4MLLA 1L0EA 1JVJA 2W3HA 3CG5A 4OOMA 5FQJA 1G28A 2ZOIA 4N9KA 3WRZA 2VX8A 5GL9A 1N9BA 4FH4A 1JTDA 3K3DA 3WS0A 1PI5A 4NXEA 2OWJA 2ZM2A 3SS4A 3B42A 3NI9A 4R0QA 5G4ZA 5HL1A 1L2SA 5TJJA 3MZFA 4I3IA 3D9YA 3ZHHA 1BSGA 3WRTA 1L0GA 5HWWA 2OOLA 4A5RA 2G2WA 2WKIA 2NUPC 2Q9NA 4LV2A 5HWVA 1YM1A 5TBMB 3QP8A 3GTCA 3JVVA 2JKGA 4OQHA 2QJ7A 1CEGA 1Y4OA 4P6ZM 3TSGA 4MMNA 3HLGA 3E2KA 3MQQA 4GS9A 3LI9A 3E4PA 2OSUA 1L0DA 4HI4A 3TOIA 4KQDA 4X55A 5FI7A 1PFLA 2W27A 3NHQA 4B93A 1ES5A 2P9VA 3IXBA 2ZQDA 5M18A 1RCJA 5KIZA 3BEBA 2FFYA 4JF5A 1LLBA 3FKWA 1ODVA 2HGVA 1XJ3A 3G4PA 1ESIA 4NXBA 1EW0A 3TRCA 3SH8A 1UWNX 2A24A 1Z6FA 2WAEA 2K7SA 3VP0A 3S22A 5HDSA 2EFUA 4MBFA 2V8CA 3SS5A 2EWWA 3ZDJA 3KSGA 1VEUA 5FATA 4ID4A 2Q0OA 2GX5A 3VSKA 5F69A 1G5UA 2W3GA 4O7DA 4B4ZA 3MXRA 3QP2A 2Z6DA 2VJWA 1MBLA 2PHYA 3BM6A 4S2NC 3U2AA 3KYEA 4QD4A 2WK0A 4YNRA 3OPPA 3UN7A 2A2LA 3Q7VB 3QP5A 3F1PB 3UO9A 1ES2A 1K25A 3IHAA 2WYXA 3HLDA 1MWTA 5FAPA 3CAXA 4JF6A 4DN0A 3Q7ZA 4S2NA 4Q8IA 5TR7A 3UE6A 4FSFA 3A3JA 3QNBA 1ZG4A 4QPRA 3KX0X 4JF4A 4ME4A 2XEPA 3F1NB 3P98A 4X69A 2Q9MA 1CEFA 4LPZA 3MJQA 1SKFA 4HJ4A 3HLWA 1FOFA 4ZTKA 3V5MA 1TS7A 2X71A 5CEBA 1T18A 1FSYA 1J3WA 3DTEA 4R3AA 2LB9A 2PR5A 2HF6A 4HIAA 4EU0A 2Y2LA 1ES3A 2L4RA 4QWOA 5CHJA 2WKHA 1SZVA 4K91A 4EESA 1XGJA 4C75A 3PBNA 5EFWA 3OBFA 3DAVA 5CRFA 4DDSA 4JKTA 5GLAA 2Y8HA 3AGDA 3D3OA 1K57C 2INWA 1YLZA 4HP9A 5EOOA 4LFUA 1BUEA 1EROA 2HZ5A 5AVFA 4WYYA 2KLIA 2V20A 1PZPA 5FA7A 2XGNA 1IEMA 4Y2FA 5E2GA 1UGUA 3QP4A 1KE3A 4EUVA 4BMWA 4HNBA 2GNXA 2Y2OA 3IS2A 2KDKA 3RXWA 3CWFA 3A0RA 2H0TA 2ZC7A 5D3OA 1M40A 1S4RA 4EBLA 4HEFA 4Z9QA 1UWPX 1N9OA 5A91A 4WBGA 2G2UA 3S7PA 3N7WA 3MFXA 3C8CA 3OCLA 2Y4AA 4IEDA 3G32A 4E3MA 4KZ6A 5EUAA 4AFIA 3QHYA 4DRTA 4JXSA 3FPWA 1CF0A 2B95A 5AJGA 1S66L 5KSCA 4HQAA 1SCWA 2VKSA 3JVUA 5F82A 1OJ5A 4E6WA 4LGWA 1O7EA 4Q0HA 1LI9A 1W8YA 1OJGA 4Q0JA 5FAQA 1E25A 3W4PA 3WWXA 2OV5A 3NULA 2BTFP 4ZJ1A 3HJKA 2C5WB 1WYCA 4Y5FA 3MF0A 3MKFA 4GS9B 1BYWA 1W79A 1K38A 3V3SA 4IVKA 3IT9A 5HAPA 3VP3A 3DBAA 2P9VB 4WELA 3VE4A 2ZBBA 4QU3A 2PYRA 2ZQ9A 4NK3A 3QP1A 4E3LA 1OT9A 1KGEA 4YWZA 3OCNA 3UDIA 2P04A 2XK1A 1N9NA 4S2MA 3ZNTA 4E04A 3N8LA 1LI0A 5DF7A 1OTAA 4M3KA 3UPPA 4OQ0A 1RGZA 4BBVA 4MNRA 5L10A 3C4PA 3UMEA 1HD8A 2A24B 1S1ZA 2HDQA 4KQRA 1D06A 4MDZA 5GHZA 4GNUA 3T50A 4F3LA 2EWVA 3BQAA 4DJ3A 4GB7A 3NDGA 1VEUB 2K2NA 3BLSA 1I2WA 5E2EA 3BRMA 4WN5A 5DTKA 3G2YA 2ZD8A 4BD1A 3S7OA 4EW7A 4C6YA 2VA0A 4BD0A 3ZQ5A 1PNEA 4HBTA 3IX8A 3O88A 4ARZA 5FQQA 3T4OA 5JYOA 3MMHA 4R38A 2J8YA 1LL5A 3L9KA 2ZLYA 5FASA 4HP4A 1SHVA 3FG8A 3RFBA 3IF6C 3MXQA 1H5XA 2PAVP 2OLVA 2VGJA 3BQ8A 3KYQA 4FUWA 4PM7A 1PWCA 3CLOA 2EXBA 5HD3A 3Q82A 2E8JA 4KQQA 4O01A 1IYPA 1T19A 3Q7VA 4EUZA 3F1PA 4KZ8A 5A8BA 4P85A 1G68A 5FSRA 4HESA 2CC1A 3ZVWA 3SH7A 3E4OA 5M19A 1BLHA 4ZDXA 4Y0TA 1HVBA 4NKPA 5F1FA 1YLTA 3VFFA 4EERA 4OLGA 3LYXA 3ZG0A 5TFQA 4Q0IA 3HUNA 4KG5A 1K56D 3HBRA 4D2OA 3O86A 4PKYG 5HZHA 4GDBA 4E3IA 1CI8A 2JKRM 1E3UA 5MC7A 4JBFA 3NJAA 1J9MA 2AVXA 2H10A 2ZJ9A 3NY4A 3P09A 5CTNA 1KE4A 2MJ6A 4Y7PA 3O87A 1S4SA 4EBPA 4KENB 3NOPC 4G3VA 1PIOA
chains in the Genus database with same CATH topology
1LLBA 3NDEA 4L0LA 3IWOA 4U0XA 4OP8A 1ZC2A 3FKWA 2EXAA 4PM8A 4ZJ2A 1PI4A 3V39A 3PBTA 2WGVA 1NZUA 3G4PA 5CGXA 1MY8A 4XUZA 3BFDA 1ESIA 3MZDA 1H8ZA 3CZDA 2IWBA 5I94A 4KZ7A 1KGGA 2XFTA 2PU4A 3HLCA 1PW1A 5DVAA 3ISGA 1N4OA 1RP5A 4MEZA 2XFSA 3LEZA 4KZ3A 1YT4A 2FFFB 2PBYA 3GQZA 2Y2KA 3LCEA 3IH8A 4E3NA 4IBRA 1TEMA 3NIAA 3Q1FA 3SH8A 3VFHA 1XP4A 4JXVA 3SS3A 5G18A 3GVBA 2WAEA 1Z6FA 4OQGA 1WE4A 2ZC3B 5DTSA 4GD8A 3VP0A 2WZZA 3S22A 2X02A 2EFUA 1KDSA 4MBFA 3SS5A 1XXMA 1ES4A 1MKIA 4UAAA 3ZDJA 5KSHA 4OOYA 4OQ0A 3NBLA 4WM9A 5U47A 4R4SA 4DKIA 5FATA 4ID4A 5DTTA 4E3OA 3ZCZA 3VSKA 5CHUA 2H0YA 3OZHA 4DE2A 4O7DA 4QHCA 4B4ZA 1YLWA 4Y0OA 2Y55A 1L0FA 3MXRA 4KZAA 4WEJA 3GV9A 3M6BA 4S2PA 3IWQA 1MBLA 2BLSA 2A3UA 3BM6A 2QMIA 4S2NC 4B88A 1BZAA 1QMFA 3OC2A 2JC7A 4QD4A 3S4XA 1QMEA 2EFXA 2WK0A 1MWRA 3OPPA 3UN7A 4E3JA 2Y2HA 1XGIA 3Q7VB 2X01A 4OPRA 4NETA 4OVDA 3S1YA 4OLDA 3UO9A 1ES2A 1K25A 4OPZA 3IHAA 2DNSA 2Y2QA 2WYXA 3IF6A 1BULA 3HLDA 3N4IA 4WEKA 1MWTA 1NXYA 2WKEA 1E4DA 1ERQA 1FCMA 5E2HA 2IWDA 5FAPA 3ZVTA 2EX6A 4C3QA 3VSLA 2QPNA 4IVIA 4JF6A 3M2JA 4ZAMA 2XD1A 5CTMA 3Q7ZA 1O07A 4S2NA 4Q8IA 3OPHA 2Y2PA 5TR7A 4FSFA 3A3JA 3QNBA 1KVLA 1ZG4A 2Z2LB 3W4QA 5FQMA 3GRJA 4JF4A 2ZQAA 2WGWB 2R9XA 2XEPA 3Q81A 4K0XA 1EWZA 3P98A 3AGEA 4DE0A 1IYSA 4X69A 2Q9MA 1CEFA 3GR2A 2ZM0A 4OPYA 3C4OA 1SKFA 3IXGA 3HLWA 4EBNA 2H5SA 4X68A 1FOFA 1AXBA 3DW0A 4ZTKA 1GCEA 3WS1A 1IKGA 3IHBA 1PWGA 4RX2A 4WZ5C 4IBXA 5EVID 5AQ9A 3V5MA 5F83A 4LV0A 2X71A 3LY4A 5CEBA 4KQOA 4BQMA 4R1GA 1FSYA 2A49A 1YLJA 3PAEA 5EVIB 4P87A 4KZ5A 2J7VA 2J9PA 3C7UA 3GSGA 1ALQA 3IQAA 2Y2LA 1ES3A 4XUXA 5CHJA 2WKHA 2V2FF 4K91A 5GLBA 2XQZA 2ZQCA 1W8QA 1YLYA 1XGJA 1FR6A 4S2KA 3D4FA 3UDFA 4WZ5A 4C75A 1PW8A 1S0WA 3PBNA 5DF9A 2GDNA 4CJNA 4DXCA 3RJUA 1YQSA 5CRFA 2PU2A 1XKZA 4GD6A 1MPLA 1GA0A 4R4RA 1ZG6A 4DDSA 5KZHA 4JKTA 5GLAA 3AGDA 3TG9A 3M2KA 1VQQA 1K57C 1YLZA 5L2FA 1EI5A 5CHMA 5HARA 4EWFA 5EOOA 5AQ7A 3IXHA 1H8YA 1BUEA 1EROA 1YLPA 4RYEA 2HPBA 4WYYA 3BFGA 1K54C 3MFDA 2V20A 5GHYA 3SOIA 1PZPA 3C7VA 1NRFA 1S6RA 2XGNA 5FA7A 1LHYA 3W4OA 4UA6A 5EE8A 1IEMA 1LL9A 3PBRA 3UE1A 5JYPA 5E2GA 4LCLA 1SDNA 5E43A 2XLNA 1KE3A 4EQIA 4R3JA 3UDXA 1PWDA 5GLDA 4GN2A 3G31A 3ZG7B 3DWKA 4HBUA 2Y2OA 3OPRA 1XPBA 3A3FA 3RXWA 3DTMA 2H0TA 4QY5A 2ZC7A 5D3OA 2VGKA 1K55C 1M40A 1K4FA 3A3DA 2BG1A 4XXRA 4MBKA 3EQVA 1TVFA 3GMWA 3NC8A 3BFEA 3PBSA 4EBLA 4HEFA 4Z9QA 4BL2A 2EX2A 3VOYA 3WS2A 4JLFA 5A91A 4RVAA 4WBGA 1BT5A 4YINA 1IYOA 2G2UA 1NYMA 3BECA 3N7WA 2I72A 3DWZA 1BLPA 3CMZA 3OCLA 2Y4AA 3RXXA 4K0WA 4IEDA 3G32A 4E3MA 4KZ6A 3MXSA 5EUAA 2Z2MB 3UPNA 1K55A 2V1ZA 2ZC5B 2JBFA 4RX3A 3QHYA 1PYYA 4DRTA 2E8IA 4OP5A 1MXOA 2OLUA 2ZC6B 3BFFA 3W8KA 2DRWA 2EX9A 4JXSA 1W5DA 5HFOA 3V3RA 4F94A 2HDRA 1ZKJA 2R9WA 5A90A 4X56A 3BYDA 2UWXA 3C5AA 5KSCA 1SCWA 5F82A 4OKPA 4E6WA 4OPQA 4BENA 4S2LA 1O7EA 1LI9A 1W8YA 1XX2A 5A92A 1RGYA 3N6IA 4OH0A 1E25A 4YFMA 5FAQA 4JPMA 4JXWA 2XH9A 5TGFA 2OV5A 3W4PA 1GA9A 3WWXA 2JCHA 3VP4A 3HREA 4ZJ1A 5HW3A 2C5WB 1WYCA 5IHVA 4N9LA 3IXDA 3ZGAB 1E3UD 3MKFA 2Y2MA 1DJCA 4KZ4A 2IWCA 1W79A 1K38A 3LO7A 2ZQ8A 4KG2A 1Y54A 1IELA 1XA1A 2XDMA 4CPKA 1FCOA 2ZMAA 3CJMA 4OQIA 3V3SA 4LCMA 5FI6A 3VMAA 4IVKA 3V50A 1BLCA 2RL3A 1FQGA 1BTLA 3G34A 4ZBEA 1W7FA 4R23A 1Q2QA 3IT9A 5HAPA 3G2ZA 3VP3A 3ZG5A 5EVIC 1GHMA 2P9VB 1JTGA 4WELA 4WMCA 4ZJ3A 5FQKA 3ZG8B 4QU3A 1NYYA 4UA9A 2ZQ9A 4NK3A 5KMWA 3A3IA 2HP9A 1JWZA 1OMEA 3M6HA 3UNWA 4E3LA 5J8XA 1TDLA 1K56A 5CXWA 5FI2A 2EX8A 2Y2IA 4UA7A 1KGEA 2P74A 1PZOA 2QZ6A 4UHUA 3OCNA 4P0MA 3UDIA 4BLMA 3PBQA 2XK1A 4LENA 2Y59A 3FWLA 4B4XA 4R3BA 3UE0A 5EVIA 4S2MA 5GLCA 3MZEA 3ZNTA 1ESUA 3VOZA 3N8LA 1LI0A 4BL3A 1FCNA 4DXBA 3UY6A 4E6XA 5DF7A 5HAQA 1YMXA 4N92A 4FH2A 4M3KA 3UPPA 5DF8A 5AQAA 3E2LA 1MWUA 1RGZA 2Y2GA 3HVFA 3N8RA 1FR1A 1K6SA 4LV3A 1NJ4A 3FZCA 3C4PA 1GHIA 3IF5A 3PBOA 4MNRA 4PM9A 1G6AA 1HD8A 3FV7A 4KZ9A 1WYBA 4OOLA 2HP6A 2Y2JA 3FYZA 2HDQA 5EVLA 4QB8A 4KQRA 3ITBA 5FAOA 2B5RA 1U60A 2RCXA 1CK3A 5EECA 5GHZA 4GNUA 4DDYA 2ZM8A 5CGSA 1K57A 2DCFA 4DE3A 1M6KA 1K6RA 3MBZA 3AGFA 4PM6A 4GB7A 3B3XA 1DY6A 5EOEA 3ZNYA 3NDGA 1K4EA 1DJAA 1VM1A 4OONA 1K54A 4PPRA 3I7JA 4U3TA 4N1XA 3BLSA 1XA7A 2C6WB 1I2WA 2WUQA 5E2EA 1C3BA 2HDUA 3BRMA 5DTKA 5E2FA 3G2YA 3VP1A 2XR0A 5HAIA 2Y2NA 5CEDA 4P6BA 2ZD8A 4BD1A 3SH9A 3ITAA 5HX9A 4Y0UA 4QY6A 4C6YA 5CECA 4BD0A 1SDEA 1ERMA 3O88A 4HBTA 5FDHA 1IYQA 5FQQA 3ZG9B 4PM5A 5JYOA 4PMAA 1I2SA 2J8YA 3UE3A 3PAGA 1LL5A 4GKUA 1Q2PA 2ZLYA 5FASA 1BLSA 3O3VA 2WADA 1SHVA 5GHXA 3ZFZA 4WZ4A 3MKEA 4MLLA 1L0EA 3IF6B 5FQ9A 1JVJA 3IF6C 1FSWA 1ONGA 1IKIA 3CG5A 4U0TA 1H5XA 4OOMA 5FQJA 2OLVA 2VGJA 3QNCA 3WS4A 2HDSA 3IWIA 4N9KA 3WRZA 1MWSA 4PM7A 1PWCA 1YMSA 5CGWA 5GL9A 1N9BA 4FH4A 1JTDA 4FCFA 2EXBA 3WS0A 1HTZA 1JWVA 1PI5A 3Q82A 2XF3A 4KQQA 2ZM2A 3SS4A 3HL9A 1IYPA 3G30A 5CERA 3NI9A 4R0QA 5HL1A 2XD5A 3Q7VA 4X53A 4EUZA 3A3EA 5A93A 1L2SA 3HUOA 3MZFA 1ONHA 4KZ8A 4P85A 1BSGA 1G68A 2ZQ7A 1L0GA 3WRTA 3ZHHA 4QJGA 4A5RA 2G2WA 5FSRA 3NCKA 2WKIA 3HLFA 4DF6A 4HESA 2CC1A 3ZVWA 2Q9NA 3SH7A 4KG6A 4LV2A 3VP2A 2J9OA 5M19A 1BLHA 1YM1A 4GZBA 4H8RA 1KE0A 3GTCA 4ZDXA 1NZOA 4LV1A 1HZOA 4Y0TA 1HVBA 5F1FA 1YLTA 3IH9A 3VFFA 4WMCD 3G35A 4X6TA 3PTEA 3WS5A 4OQHA 4OLGA 2ZC4B 3BLMA 2WGWA 4GOGA 4E3KA 1CEGA 3FKVA 4N1HA 3HLEA 4S2OA 5F1GA 1JWPA 5TFQA 3HUNA 4KG5A 1K56D 3ZG0A 3LY3A 3HBRA 1KDWA 3TSGA 1DJBA 4KZBA 3HLGA 2JE5A 4D2OA 3E2KA 3OPLA 4S2IA 3O86A 1I5QA 1GHPA 3HLBA 4GDBA 4RA7A 4E3IA 4JXGA 4GDNA 1CI8A 2OSUA 5AQBA 1L0DA 3EQUA 3TOIA 1E3UA 4S2JA 5BOHA 3BFCA 4X55A 5FI7A 5FQIA 4BJPA 1CI9A 2Y91A 4JBFA 1KGFA 1J9MA 5EPHA 4DE1A 3UPOA 2H10A 4EV4A 4FD8A 2HP5A 2ZJ9A 3Q07A 1ES5A 2P9VA 3NY4A 1TDGA 3N8SA 3P09A 5CTNA 4MBHA 2WGIA 3IXBA 1KE4A 1NY0A 2WAFA 2ZQDA 5M18A 3HUMA 4Y7PA 2WZXA 1RCJA 1KVMA 3O87A 3JYIA 4EBPA 4KENB 5M1AA 3BEBA 2FFYA 1PIOA 4JF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLB A;  3NDE A;  4L0L A;  3IWO A;  4U0X A;  4OP8 A;  1ZC2 A;  3FKW A;  2EXA A;  4PM8 A;  4ZJ2 A;  1PI4 A;  3V39 A;  3PBT A;  2WGV A;  1NZU A;  3G4P A;  5CGX A;  1MY8 A;  4XUZ A;  3BFD A;  1ESI A;  3MZD A;  1H8Z A;  3CZD A;  2IWB A;  5I94 A;  4KZ7 A;  1KGG A;  2XFT A;  2PU4 A;  3HLC A;  1PW1 A;  5DVA A;  3ISG A;  1N4O A;  1RP5 A;  4MEZ A;  2XFS A;  3LEZ A;  4KZ3 A;  1YT4 A;  2FFF B;  2PBY A;  3GQZ A;  2Y2K A;  3LCE A;  3IH8 A;  4E3N A;  4IBR A;  1TEM A;  3NIA A;  3Q1F A;  3SH8 A;  3VFH A;  1XP4 A;  4JXV A;  3SS3 A;  5G18 A;  3GVB A;  2WAE A;  1Z6F A;  4OQG A;  1WE4 A;  2ZC3 B;  5DTS A;  4GD8 A;  3VP0 A;  2WZZ A;  3S22 A;  2X02 A;  2EFU A;  1KDS A;  4MBF A;  3SS5 A;  1XXM A;  1ES4 A;  1MKI A;  4UAA A;  3ZDJ A;  5KSH A;  4OOY A;  4OQ0 A;  3NBL A;  4WM9 A;  5U47 A;  4R4S A;  4DKI A;  5FAT A;  4ID4 A;  5DTT A;  4E3O A;  3ZCZ A;  3VSK A;  5CHU A;  2H0Y A;  3OZH A;  4DE2 A;  4O7D A;  4QHC A;  4B4Z A;  1YLW A;  4Y0O A;  2Y55 A;  1L0F A;  3MXR A;  4KZA A;  4WEJ A;  3GV9 A;  3M6B A;  4S2P A;  3IWQ A;  1MBL A;  2BLS A;  2A3U A;  3BM6 A;  2QMI A;  4S2N C;  4B88 A;  1BZA A;  1QMF A;  3OC2 A;  2JC7 A;  4QD4 A;  3S4X A;  1QME A;  2EFX A;  2WK0 A;  1MWR A;  3OPP A;  3UN7 A;  4E3J A;  2Y2H A;  1XGI A;  3Q7V B;  2X01 A;  4OPR A;  4NET A;  4OVD A;  3S1Y A;  4OLD A;  3UO9 A;  1ES2 A;  1K25 A;  4OPZ A;  3IHA A;  2DNS A;  2Y2Q A;  2WYX A;  3IF6 A;  1BUL A;  3HLD A;  3N4I A;  4WEK A;  1MWT A;  1NXY A;  2WKE A;  1E4D A;  1ERQ A;  1FCM A;  5E2H A;  2IWD A;  5FAP A;  3ZVT A;  2EX6 A;  4C3Q A;  3VSL A;  2QPN A;  4IVI A;  4JF6 A;  3M2J A;  4ZAM A;  2XD1 A;  5CTM A;  3Q7Z A;  1O07 A;  4S2N A;  4Q8I A;  3OPH A;  2Y2P A;  5TR7 A;  4FSF A;  3A3J A;  3QNB A;  1KVL A;  1ZG4 A;  2Z2L B;  3W4Q A;  5FQM A;  3GRJ A;  4JF4 A;  2ZQA A;  2WGW B;  2R9X A;  2XEP A;  3Q81 A;  4K0X A;  1EWZ A;  3P98 A;  3AGE A;  4DE0 A;  1IYS A;  4X69 A;  2Q9M A;  1CEF A;  3GR2 A;  2ZM0 A;  4OPY A;  3C4O A;  1SKF A;  3IXG A;  3HLW A;  4EBN A;  2H5S A;  4X68 A;  1FOF A;  1AXB A;  3DW0 A;  4ZTK A;  1GCE A;  3WS1 A;  1IKG A;  3IHB A;  1PWG A;  4RX2 A;  4WZ5 C;  4IBX A;  5EVI D;  5AQ9 A;  3V5M A;  5F83 A;  4LV0 A;  2X71 A;  3LY4 A;  5CEB A;  4KQO A;  4BQM A;  4R1G A;  1FSY A;  2A49 A;  1YLJ A;  3PAE A;  5EVI B;  4P87 A;  4KZ5 A;  2J7V A;  2J9P A;  3C7U A;  3GSG A;  1ALQ A;  3IQA A;  2Y2L A;  1ES3 A;  4XUX A;  5CHJ A;  2WKH A;  2V2F F;  4K91 A;  5GLB A;  2XQZ A;  2ZQC A;  1W8Q A;  1YLY A;  1XGJ A;  1FR6 A;  4S2K A;  3D4F A;  3UDF A;  4WZ5 A;  4C75 A;  1PW8 A;  1S0W A;  3PBN A;  5DF9 A;  2GDN A;  4CJN A;  4DXC A;  3RJU A;  1YQS A;  5CRF A;  2PU2 A;  1XKZ A;  4GD6 A;  1MPL A;  1GA0 A;  4R4R A;  1ZG6 A;  4DDS A;  5KZH A;  4JKT A;  5GLA A;  3AGD A;  3TG9 A;  3M2K A;  1VQQ A;  1K57 C;  1YLZ A;  5L2F A;  1EI5 A;  5CHM A;  5HAR A;  4EWF A;  5EOO A;  5AQ7 A;  3IXH A;  1H8Y A;  1BUE A;  1ERO A;  1YLP A;  4RYE A;  2HPB A;  4WYY A;  3BFG A;  1K54 C;  3MFD A;  2V20 A;  5GHY A;  3SOI A;  1PZP A;  3C7V A;  1NRF A;  1S6R A;  2XGN A;  5FA7 A;  1LHY A;  3W4O A;  4UA6 A;  5EE8 A;  1IEM A;  1LL9 A;  3PBR A;  3UE1 A;  5JYP A;  5E2G A;  4LCL A;  1SDN A;  5E43 A;  2XLN A;  1KE3 A;  4EQI A;  4R3J A;  3UDX A;  1PWD A;  5GLD A;  4GN2 A;  3G31 A;  3ZG7 B;  3DWK A;  4HBU A;  2Y2O A;  3OPR A;  1XPB A;  3A3F A;  3RXW A;  3DTM A;  2H0T A;  4QY5 A;  2ZC7 A;  5D3O A;  2VGK A;  1K55 C;  1M40 A;  1K4F A;  3A3D A;  2BG1 A;  4XXR A;  4MBK A;  3EQV A;  1TVF A;  3GMW A;  3NC8 A;  3BFE A;  3PBS A;  4EBL A;  4HEF A;  4Z9Q A;  4BL2 A;  2EX2 A;  3VOY A;  3WS2 A;  4JLF A;  5A91 A;  4RVA A;  4WBG A;  1BT5 A;  4YIN A;  1IYO A;  2G2U A;  1NYM A;  3BEC A;  3N7W A;  2I72 A;  3DWZ A;  1BLP A;  3CMZ A;  3OCL A;  2Y4A A;  3RXX A;  4K0W A;  4IED A;  3G32 A;  4E3M A;  4KZ6 A;  3MXS A;  5EUA A;  2Z2M B;  3UPN A;  1K55 A;  2V1Z A;  2ZC5 B;  2JBF A;  4RX3 A;  3QHY A;  1PYY A;  4DRT A;  2E8I A;  4OP5 A;  1MXO A;  2OLU A;  2ZC6 B;  3BFF A;  3W8K A;  2DRW A;  2EX9 A;  4JXS A;  1W5D A;  5HFO A;  3V3R A;  4F94 A;  2HDR A;  1ZKJ A;  2R9W A;  5A90 A;  4X56 A;  3BYD A;  2UWX A;  3C5A A;  5KSC A;  1SCW A;  5F82 A;  4OKP A;  4E6W A;  4OPQ A;  4BEN A;  4S2L A;  1O7E A;  1LI9 A;  1W8Y A;  1XX2 A;  5A92 A;  1RGY A;  3N6I A;  4OH0 A;  1E25 A;  4YFM A;  5FAQ A;  4JPM A;  4JXW A;  2XH9 A;  5TGF A;  2OV5 A;  3W4P A;  1GA9 A;  3WWX A;  2JCH A;  3VP4 A;  3HRE A;  4ZJ1 A;  5HW3 A;  2C5W B;  1WYC A;  5IHV A;  4N9L A;  3IXD A;  3ZGA B;  1E3U D;  3MKF A;  2Y2M A;  1DJC A;  4KZ4 A;  2IWC A;  1W79 A;  1K38 A;  3LO7 A;  2ZQ8 A;  4KG2 A;  1Y54 A;  1IEL A;  1XA1 A;  2XDM A;  4CPK A;  1FCO A;  2ZMA A;  3CJM A;  4OQI A;  3V3S A;  4LCM A;  5FI6 A;  3VMA A;  4IVK A;  3V50 A;  1BLC A;  2RL3 A;  1FQG A;  1BTL A;  3G34 A;  4ZBE A;  1W7F A;  4R23 A;  1Q2Q A;  3IT9 A;  5HAP A;  3G2Z A;  3VP3 A;  3ZG5 A;  5EVI C;  1GHM A;  2P9V B;  1JTG A;  4WEL A;  4WMC A;  4ZJ3 A;  5FQK A;  3ZG8 B;  4QU3 A;  1NYY A;  4UA9 A;  2ZQ9 A;  4NK3 A;  5KMW A;  3A3I A;  2HP9 A;  1JWZ A;  1OME A;  3M6H A;  3UNW A;  4E3L A;  5J8X A;  1TDL A;  1K56 A;  5CXW A;  5FI2 A;  2EX8 A;  2Y2I A;  4UA7 A;  1KGE A;  2P74 A;  1PZO A;  2QZ6 A;  4UHU A;  3OCN A;  4P0M A;  3UDI A;  4BLM A;  3PBQ A;  2XK1 A;  4LEN A;  2Y59 A;  3FWL A;  4B4X A;  4R3B A;  3UE0 A;  5EVI A;  4S2M A;  5GLC A;  3MZE A;  3ZNT A;  1ESU A;  3VOZ A;  3N8L A;  1LI0 A;  4BL3 A;  1FCN A;  4DXB A;  3UY6 A;  4E6X A;  5DF7 A;  5HAQ A;  1YMX A;  4N92 A;  4FH2 A;  4M3K A;  3UPP A;  5DF8 A;  5AQA A;  3E2L A;  1MWU A;  1RGZ A;  2Y2G A;  3HVF A;  3N8R A;  1FR1 A;  1K6S A;  4LV3 A;  1NJ4 A;  3FZC A;  3C4P A;  1GHI A;  3IF5 A;  3PBO A;  4MNR A;  4PM9 A;  1G6A A;  1HD8 A;  3FV7 A;  4KZ9 A;  1WYB A;  4OOL A;  2HP6 A;  2Y2J A;  3FYZ A;  2HDQ A;  5EVL A;  4QB8 A;  4KQR A;  3ITB A;  5FAO A;  2B5R A;  1U60 A;  2RCX A;  1CK3 A;  5EEC A;  5GHZ A;  4GNU A;  4DDY A;  2ZM8 A;  5CGS A;  1K57 A;  2DCF A;  4DE3 A;  1M6K A;  1K6R A;  3MBZ A;  3AGF A;  4PM6 A;  4GB7 A;  3B3X A;  1DY6 A;  5EOE A;  3ZNY A;  3NDG A;  1K4E A;  1DJA A;  1VM1 A;  4OON A;  1K54 A;  4PPR A;  3I7J A;  4U3T A;  4N1X A;  3BLS A;  1XA7 A;  2C6W B;  1I2W A;  2WUQ A;  5E2E A;  1C3B A;  2HDU A;  3BRM A;  5DTK A;  5E2F A;  3G2Y A;  3VP1 A;  2XR0 A;  5HAI A;  2Y2N A;  5CED A;  4P6B A;  2ZD8 A;  4BD1 A;  3SH9 A;  3ITA A;  5HX9 A;  4Y0U A;  4QY6 A;  4C6Y A;  5CEC A;  4BD0 A;  1SDE A;  1ERM A;  3O88 A;  4HBT A;  5FDH A;  1IYQ A;  5FQQ A;  3ZG9 B;  4PM5 A;  5JYO A;  4PMA A;  1I2S A;  2J8Y A;  3UE3 A;  3PAG A;  1LL5 A;  4GKU A;  1Q2P A;  2ZLY A;  5FAS A;  1BLS A;  3O3V A;  2WAD A;  1SHV A;  5GHX A;  3ZFZ A;  4WZ4 A;  3MKE A;  4MLL A;  1L0E A;  3IF6 B;  5FQ9 A;  1JVJ A;  3IF6 C;  1FSW A;  1ONG A;  1IKI A;  3CG5 A;  4U0T A;  1H5X A;  4OOM A;  5FQJ A;  2OLV A;  2VGJ A;  3QNC A;  3WS4 A;  2HDS A;  3IWI A;  4N9K A;  3WRZ A;  1MWS A;  4PM7 A;  1PWC A;  1YMS A;  5CGW A;  5GL9 A;  1N9B A;  4FH4 A;  1JTD A;  4FCF A;  2EXB A;  3WS0 A;  1HTZ A;  1JWV A;  1PI5 A;  3Q82 A;  2XF3 A;  4KQQ A;  2ZM2 A;  3SS4 A;  3HL9 A;  1IYP A;  3G30 A;  5CER A;  3NI9 A;  4R0Q A;  5HL1 A;  2XD5 A;  3Q7V A;  4X53 A;  4EUZ A;  3A3E A;  5A93 A;  1L2S A;  3HUO A;  3MZF A;  1ONH A;  4KZ8 A;  4P85 A;  1BSG A;  1G68 A;  2ZQ7 A;  1L0G A;  3WRT A;  3ZHH A;  4QJG A;  4A5R A;  2G2W A;  5FSR A;  3NCK A;  2WKI A;  3HLF A;  4DF6 A;  4HES A;  2CC1 A;  3ZVW A;  2Q9N A;  3SH7 A;  4KG6 A;  4LV2 A;  3VP2 A;  2J9O A;  5M19 A;  1BLH A;  1YM1 A;  4GZB A;  4H8R A;  1KE0 A;  3GTC A;  4ZDX A;  1NZO A;  4LV1 A;  1HZO A;  4Y0T A;  1HVB A;  5F1F A;  1YLT A;  3IH9 A;  3VFF A;  4WMC D;  3G35 A;  4X6T A;  3PTE A;  3WS5 A;  4OQH A;  4OLG A;  2ZC4 B;  3BLM A;  2WGW A;  4GOG A;  4E3K A;  1CEG A;  3FKV A;  4N1H A;  3HLE A;  4S2O A;  5F1G A;  1JWP A;  5TFQ A;  3HUN A;  4KG5 A;  1K56 D;  3ZG0 A;  3LY3 A;  3HBR A;  1KDW A;  3TSG A;  1DJB A;  4KZB A;  3HLG A;  2JE5 A;  4D2O A;  3E2K A;  3OPL A;  4S2I A;  3O86 A;  1I5Q A;  1GHP A;  3HLB A;  4GDB A;  4RA7 A;  4E3I A;  4JXG A;  4GDN A;  1CI8 A;  2OSU A;  5AQB A;  1L0D A;  3EQU A;  3TOI A;  1E3U A;  4S2J A;  5BOH A;  3BFC A;  4X55 A;  5FI7 A;  5FQI A;  4BJP A;  1CI9 A;  2Y91 A;  4JBF A;  1KGF A;  1J9M A;  5EPH A;  4DE1 A;  3UPO A;  2H10 A;  4EV4 A;  4FD8 A;  2HP5 A;  2ZJ9 A;  3Q07 A;  1ES5 A;  2P9V A;  3NY4 A;  1TDG A;  3N8S A;  3P09 A;  5CTN A;  4MBH A;  2WGI A;  3IXB A;  1KE4 A;  1NY0 A;  2WAF A;  2ZQD A;  5M18 A;  3HUM A;  4Y7P A;  2WZX A;  1RCJ A;  1KVM A;  3O87 A;  3JYI A;  4EBP A;  4KEN B;  5M1A A;  3BEB A;  2FFY A;  1PIO A;  4JF5 A; 
#chains in the Genus database with same CATH topology
 3NDE A;  4L0L A;  3IWO A;  4U0X A;  2M7U A;  2EXA A;  1PI4 A;  3PBT A;  1NZU A;  5CGX A;  3BFD A;  3MZD A;  3E4Q A;  1H8Z A;  2IWB A;  5I94 A;  2PU4 A;  2V9A A;  3HLC A;  3IS2 B;  1PW1 A;  5DVA A;  3ISG A;  3B47 A;  5FEG A;  2J3T C;  1RP5 A;  3LEZ A;  4NEE D;  2PBY A;  3LIE A;  4IBR A;  3Q1F A;  3SS3 A;  4OQG A;  1AWI A;  1KDS A;  1MKI A;  3LEQ A;  4UAA A;  2O9B A;  4OOY A;  2O9C A;  1TS0 A;  5DTT A;  3E0Y A;  4E3O A;  3ZCZ A;  1LSV A;  2H0Y A;  2VV7 A;  1YLW A;  2Y55 A;  1L0F A;  4WEJ A;  3IWQ A;  5C5K A;  2A3U A;  4B88 A;  1BZA A;  3OC2 A;  3S4X A;  4NXG A;  1XGI A;  2X01 A;  3A0S A;  2O0Y A;  4NET A;  1KOU A;  3N4I A;  5E2H A;  1E4D A;  1FCM A;  2IWD A;  1H8M A;  3VSL A;  3LID A;  1YAX A;  1OTD A;  4GW9 A;  1O07 A;  2OAQ 1;  3PXP A;  4BBT A;  1XJ2 A;  3AGE A;  2YKF A;  3T1R A;  4DE0 A;  2WKP A;  2ZM0 A;  1DP8 A;  3IXG A;  5IU1 A;  2PD8 A;  4EEP A;  4HH2 A;  3D72 A;  3WS1 A;  1IKG A;  4WZ5 C;  4LV0 A;  4KQO A;  1XFQ A;  4R1G A;  2A49 A;  1YLJ A;  4MCW A;  1A0K A;  3LR4 A;  4KZ5 A;  3C7U A;  3GSG A;  1ALQ A;  2XQZ A;  4G3W A;  1YLY A;  1DP9 A;  4WZ5 A;  1PW8 A;  5DF9 A;  4DXC A;  3K3C A;  3RJU A;  1X0O A;  1XKZ A;  2JKT I;  1MPL A;  1F2K A;  1ZG6 A;  4F3L B;  5CHM A;  5HAR A;  5AQ7 A;  3IXH A;  3T1S A;  1K54 C;  2ACG A;  3ICY A;  1NRF A;  1LHY A;  1LL9 A;  4WUJ A;  3UE1 A;  5JYP A;  5E43 A;  2V0U A;  4O0P A;  2XA7 S;  4ARZ B;  4UEY A;  1PWD A;  5GLD A;  3G31 A;  4K08 A;  3OPR A;  1XPB A;  2M1C A;  1K55 C;  1LSW A;  1K4F A;  4JGP A;  3T1X A;  4MBK A;  3EQV A;  1S1Y A;  4BL2 A;  3BJN A;  2EX2 A;  4JLF A;  2QHK A;  2ZMF A;  1IYO A;  4FOF A;  3DWZ A;  3QP6 A;  2EA9 A;  5FDS A;  5F5Y A;  2Z2M B;  3UPN A;  1K55 A;  4XT2 A;  2E8I A;  2OLU A;  2DRW A;  3CHW P;  2BAS A;  2R9W A;  2UWX A;  1MZU A;  3NOU C;  3VE3 A;  4OPQ A;  2ZOH A;  1XX2 A;  5A92 A;  3TW8 A;  1RGY A;  4YFM A;  2JKF A;  2XH9 A;  2W3F A;  5HSQ A;  5HPI A;  5L09 A;  3NOT C;  5J4E A;  4N9L A;  1T1C A;  1E3U D;  2IWC A;  3LO7 A;  4KG2 A;  4OQI A;  4LCM A;  5FI6 A;  2JHE A;  3VMA A;  4HHD A;  1BLC A;  4ZBE A;  1FQG A;  1BTL A;  3EOI A;  3G34 A;  1W7F A;  4H6J A;  4DJ2 A;  1NWZ A;  1Q2Q A;  3G2Z A;  4ZJ3 A;  3ZG8 B;  2R78 A;  1NYY A;  5KMW A;  3A3I A;  2HP9 A;  1JWZ A;  1OME A;  3EEA A;  3UNW A;  1K56 A;  1ZHH B;  5FEF A;  4UA7 A;  3UB6 A;  2O99 A;  4UHU A;  3GDI A;  3PBQ A;  2Y59 A;  3FWL A;  4R3B A;  5GLC A;  1ESU A;  4BL3 A;  1FCN A;  4E6X A;  2DMW A;  5HAQ A;  1YMX A;  4CLC E;  4EQ1 A;  5DF8 A;  4Y3I A;  3HVF A;  3LR3 A;  1GHI A;  4PM9 A;  1G6A A;  2QKP A;  4KZ9 A;  1WYB A;  4OOL A;  2HP6 A;  2Y2J A;  2B5R A;  1U60 A;  2J3T D;  2O9A A;  2RCX A;  3RH8 B;  3GEC A;  1FIK A;  1K57 A;  1OPX A;  4GHI A;  1M6K A;  3MBZ A;  1DY6 A;  1F98 A;  2W3E A;  4BBU A;  4Y13 A;  2WUQ A;  1C3B A;  3HCY A;  2HDU A;  3VP1 A;  2XR0 A;  4QY6 A;  3UB5 P;  1XFN A;  1IYQ A;  4PMA A;  1OTE A;  1Q2P A;  1WA9 A;  5GHX A;  3ZFZ A;  1NRJ A;  3MKE A;  1FSW A;  1IKI A;  4U0T A;  5IS1 A;  3QNC A;  3IWI A;  2PT7 A;  1YMS A;  4IUK A;  4FCF A;  3HL9 A;  3G30 A;  5CER A;  5A93 A;  3O5Y A;  2ZQ7 A;  2B02 A;  2NUT C;  3HLF A;  1OT6 A;  4KUO A;  4LV1 A;  3IH9 A;  4WMC D;  2ZC4 B;  4JGO A;  4E3K A;  5DKK A;  3FKV A;  4N1H A;  1DP6 A;  4S2O A;  2W3D A;  3LY3 A;  1KDW A;  2VV8 A;  5IT5 A;  1DJB A;  3LIF A;  1FIL A;  4S2I A;  1I5Q A;  1GHP A;  4RA7 A;  1D1J A;  4GCZ A;  3R4K A;  3EQU A;  4S2J A;  2FZ0 A;  3T4J A;  4BJP A;  1CI9 A;  2Y91 A;  1DRM A;  5EPH A;  4DE1 A;  3S7Q A;  3UPO A;  3Q07 A;  1TDG A;  4MBH A;  2WGI A;  2ZL1 A;  3CUE C;  2WAF A;  3LIB A;  4I39 A;  3CI6 A;  1W63 M;  1KVM A;  1MKM A;  5J7E A;  4EXO A;  4OP8 A;  1ZC2 A;  3EGX C;  4PM8 A;  3LI8 A;  3V39 A;  2WGV A;  4L9F A;  1V9Y A;  1KGG A;  2XFT A;  3BWL A;  4KZ3 A;  2Y2K A;  3IH8 A;  1HLU P;  1TEM A;  1XP4 A;  4JXV A;  5G18 A;  3S7N A;  1WE4 A;  2ZC3 B;  5DTS A;  2WZZ A;  1GSV A;  2X02 A;  2VGL S;  3KSF A;  1XXM A;  2HJE A;  1GSX A;  4XT2 B;  1IOU A;  5U47 A;  4DKI A;  4II7 A;  2PBD P;  2V1B A;  4DE2 A;  4QHC A;  1Y28 A;  4Y0O A;  3MSH A;  4KZA A;  3GV9 A;  3M6B A;  1H0M A;  4S2P A;  2BLS A;  1K0K A;  2JC7 A;  2EFX A;  3NEC A;  2VV6 A;  1ZTU A;  2Y2H A;  2W0N A;  4OPR A;  2P08 A;  3S1Y A;  4L9E A;  4OLD A;  3C38 A;  3UB8 A;  2Y2Q A;  3IF6 A;  1BUL A;  3EEH A;  4D60 A;  4WEK A;  1NXY A;  2WKE A;  4CQH A;  1JNU A;  2EX6 A;  2W1R A;  4C3Q A;  1GSW A;  3M2J A;  2XD1 A;  3A0V A;  1YKD A;  2Y2P A;  5EM1 A;  3GRJ A;  2ZQA A;  2WGW B;  5DFX A;  3Q81 A;  4H6J B;  1EWZ A;  2V1A A;  3G6O A;  2H28 A;  1LT0 A;  4WF0 A;  3W2Z A;  3FC7 A;  4OPY A;  3C4O A;  2H5S A;  4X68 A;  1AXB A;  2UV0 E;  3DW0 A;  3IHB A;  4IBX A;  5AQ9 A;  5F83 A;  3LY4 A;  4R70 A;  4R6L A;  4I3J A;  2J9P A;  2V2F F;  5GLB A;  2ZQC A;  1W8Q A;  3IX4 A;  2QWS A;  1FR6 A;  4HJ6 A;  2GDN A;  3EGD C;  5EM0 A;  5FL3 A;  1P97 A;  4G3K A;  5KZH A;  1S67 L;  3TG9 A;  3M2K A;  1VQQ A;  4GHI B;  4EWF A;  3H7W A;  4RYE A;  2HPB A;  5HDC A;  1S6R A;  1YPR A;  3W4O A;  2B18 A;  4UA6 A;  4CLC C;  3PBR A;  4LRY C;  2XSS A;  1TS8 A;  4LCL A;  1OTB A;  2V8F A;  4EQI A;  4R3J A;  5DFY A;  4PHT A;  2PR6 A;  3DWK A;  1YSQ A;  3A3F A;  3TE8 A;  3DTK A;  2VGK A;  3UB7 A;  3A3D A;  2BG1 A;  4XXR A;  4JGQ A;  2OWH A;  3GMW A;  3BFE A;  3NC8 A;  4MN5 A;  4PAU A;  3H82 A;  3VOY A;  4HOI A;  3WS2 A;  4RVA A;  4YIN A;  1NYM A;  2QJ5 A;  5I5L A;  3RXX A;  2J80 A;  2M7V A;  3B33 A;  3MXS A;  2D01 A;  2V1Z A;  2JBF A;  4RX3 A;  1PYY A;  4OP5 A;  1MXO A;  2ZC6 B;  3P01 A;  3W8K A;  4F94 A;  3L7H A;  5A90 A;  3BYD A;  3C5A A;  5HL6 A;  4ETX A;  1Z09 A;  3N6I A;  5TGF A;  4OH0 A;  2JCH A;  2XRO A;  5L8M A;  4EET B;  5HW3 A;  2OAP 1;  3IXD A;  4GLQ A;  5DKL A;  1P9W A;  1IEL A;  1FCO A;  2ZMA A;  2W1T A;  1TD5 A;  4WL9 A;  5F6A A;  4R23 A;  1L3L A;  3MQ0 A;  3ZG5 A;  5EVI C;  1JTG A;  4WMC A;  5FQK A;  2ZL1 B;  3M6H A;  5J8X A;  1TDL A;  4HJ3 A;  2EX8 A;  2QZ6 A;  2P74 A;  1PZO A;  3MQO A;  1F9I A;  3LUQ A;  5F68 A;  1TF1 A;  5EVI A;  3VOZ A;  2HV1 A;  4JGR A;  3UY6 A;  2XRN A;  1CQA A;  5AQA A;  3E2L A;  1MWU A;  4DXB A;  2Y2G A;  1K6S A;  4LV3 A;  3FZC A;  3IF5 A;  1T1A A;  5EVL A;  4QB8 A;  1VHM A;  3ITB A;  5EEC A;  4DDY A;  2ZM8 A;  2VZW A;  2JKR I;  3B3X A;  1SKO B;  1K54 A;  3LIA A;  1LSX A;  3I7J A;  4PPR A;  4N1X A;  2ZMV A;  5E2F A;  5HAI A;  4P6B A;  2HJ9 C;  3SH9 A;  3ITA A;  5HX9 A;  4Y0U A;  2VEA A;  4WLA A;  5CEC A;  1SDE A;  1ERM A;  4PM5 A;  3EWK A;  5EVE A;  4LRZ E;  3UE3 A;  4GKU A;  3O3V A;  3LR5 A;  4WZ4 A;  3IF6 B;  5FQ9 A;  1ONG A;  3WS4 A;  3F1O A;  2HDS A;  4ETZ A;  1MWS A;  3VV4 A;  4UQI S;  5CGW A;  5AVE A;  1HTZ A;  1JWV A;  2XF3 A;  3FPV A;  2XD5 A;  3IBJ A;  3R7W A;  4X53 A;  3A3E A;  3HUO A;  1ONH A;  3IX3 A;  4QJG A;  4O8G A;  3NCK A;  4DF6 A;  4KG6 A;  3VP2 A;  2J9O A;  4GZB A;  4H8R A;  1KE0 A;  1NZO A;  2QYB A;  1HZO A;  3IBR A;  1XJ6 A;  3G35 A;  4X6T A;  3PTE A;  3WS5 A;  3BLM A;  2WGW A;  1XJ4 A;  4GOG A;  2JN7 A;  3HLE A;  5F1G A;  1JWP A;  3PR6 A;  4KZB A;  2JE5 A;  3OPL A;  2D02 A;  3HLB A;  4JXG A;  4GDN A;  5AQB A;  1MC0 A;  2V0W A;  5BOH A;  3BFC A;  5FQI A;  4Y15 A;  3MR0 A;  2GJ3 A;  2VK3 A;  1KGF A;  3OOV A;  1VB6 A;  4EV4 A;  3KSH A;  4FD8 A;  2HP5 A;  3H7W B;  3N8S A;  4Z1W A;  1NY0 A;  3HUM A;  4HH3 A;  2WZX A;  2FH5 A;  3JYI A;  5M1A A;  2L0W A;  3LR0 A;  4ESP A;  3MS6 A;  3CIT A;  4ZJ2 A;  3K2N A;  4M4X A;  1MY8 A;  4XUZ A;  4IUH A;  4YOF A;  3CZD A;  4KZ7 A;  4CLC D;  3ZYT A;  2J3W A;  1N4O A;  3OLO A;  4MEZ A;  2XFS A;  1YT4 A;  2FFF B;  3GQZ A;  3C30 A;  3LCE A;  4E3N A;  4CLC B;  3NIA A;  3VFH A;  1PRQ A;  2XA7 M;  5HDD A;  5K5B A;  3H82 B;  2Z6C A;  3GVB A;  4X25 A;  4I38 A;  3T12 B;  4GD8 A;  4L9G A;  1ES4 A;  1H3Q A;  3CPT A;  5KSH A;  3NBL A;  4WM9 A;  3KSI A;  4R4S A;  5CHU A;  3OZH A;  1N9L A;  4X1M A;  2VLG A;  5CX7 A;  5DJT A;  1VET A;  2QMI A;  3V67 A;  1CJF A;  1QMF A;  1QME A;  1MWR A;  4E3J A;  4OVD A;  4OPZ A;  3T4K A;  2DNS A;  4UQI M;  3LGO A;  1ERQ A;  3ZVT A;  4GJ4 A;  3JPU A;  3LIC A;  2QPN A;  4IVI A;  4ZAM A;  5CTM A;  3OPH A;  2W1T B;  4Y17 A;  1KVL A;  2Z2L B;  3W4Q A;  5FQM A;  2KOI A;  2R9X A;  4K0X A;  2K31 A;  2G7U A;  3VOL A;  1IYS A;  5L07 A;  3GR2 A;  2PYP A;  4EBN A;  3E98 A;  3PHY A;  1GCE A;  2WKQ A;  5TBM A;  4RX2 A;  1PWG A;  5DJU A;  5EVI D;  3DTI A;  3ULF A;  4MN7 A;  2L1M A;  4BQM A;  3PYP A;  3PAE A;  5EVI B;  4P87 A;  2J7V A;  3IQA A;  4XUX A;  4PKY A;  2PDR A;  4IHQ A;  4X1L A;  4S2K A;  3D4F A;  3UDF A;  1S0W A;  4CJN A;  4MN6 A;  1YQS A;  2PU2 A;  2PRF A;  4KUK A;  4GD6 A;  1GA0 A;  2GZA A;  4R4R A;  3RTY A;  2P7J A;  2I9V A;  5L2F A;  1EI5 A;  1H8Y A;  1YLP A;  3CUE A;  2KX6 A;  3BFG A;  3MFD A;  5GHY A;  3SOI A;  3C7V A;  4ZRR A;  5J3W A;  5EE8 A;  3T4Q A;  1SDN A;  2XLN A;  3UDX A;  4I3A A;  4GN2 A;  3ZG7 B;  4HBU A;  1IFQ A;  1T1B A;  2Y79 A;  3H9W A;  1SKO A;  3DTM A;  4QY5 A;  3BY9 A;  1TVF A;  3BY8 A;  4RQ9 A;  3PBS A;  5HD5 A;  3F1O B;  3LFV A;  4LLO B;  1BT5 A;  3BEC A;  2I72 A;  3SZT A;  1BLP A;  3CMZ A;  5EV0 A;  4K0W A;  1D7E A;  3TJZ C;  1NLZ A;  2ZC5 B;  3R7W B;  1V9Z A;  3BFF A;  3V3R A;  2EX9 A;  1W5D A;  5HFO A;  2HDR A;  1ZKJ A;  4X56 A;  4OKP A;  4BWI A;  4BEN A;  4S2L A;  5HPF A;  4JPM A;  4JXW A;  1GA9 A;  3VP4 A;  3T4T A;  3HRE A;  3HJI A;  5IHV A;  4LRX C;  5LBR A;  2JKT M;  1W63 Q;  1P0Z A;  3ZGA B;  4P6Z S;  2Y2M A;  2CMN A;  1DJC A;  4KZ4 A;  2ZQ8 A;  1Y54 A;  1XA1 A;  2XDM A;  3T4L A;  4CPK A;  3CJM A;  1STZ A;  4I5S A;  3V50 A;  1F5M A;  1ACF A;  2RL3 A;  3KO6 A;  3F1N A;  4EEU A;  4B9O A;  1GHM A;  5G4Y A;  1LL8 A;  3T1Q B;  3UB9 A;  4UA9 A;  1OTI A;  1P9R A;  1G6O A;  5CXW A;  5FI2 A;  2Y2I A;  4P0M A;  4BLM A;  4LEN A;  4B4X A;  4NG2 A;  3UE0 A;  3MZE A;  4IJG A;  1NLY A;  3KYZ A;  4N92 A;  1TS6 A;  4FH2 A;  3N8R A;  1FR1 A;  1NJ4 A;  3PBO A;  4FTX A;  2YKH A;  3FV7 A;  3FYZ A;  1YSP A;  2IA2 A;  5FAO A;  1CK3 A;  5CGS A;  4HY8 A;  2DCF A;  4DE3 A;  3CPT B;  1K6R A;  4PM6 A;  3AGF A;  3T4S A;  5EOE A;  3ZNY A;  1K4E A;  1DJA A;  1VM1 A;  4OON A;  5HWT A;  4U3T A;  4NXF A;  3SW1 A;  1XA7 A;  2C6W B;  4CLC A;  2PD7 A;  3BW6 A;  2Y2N A;  5CED A;  3C2W A;  2VGL M;  5FDH A;  1VET B;  3ZG9 B;  1I2S A;  3P7N A;  2LB5 A;  3PAG A;  1BLS A;  2WKR A;  2WAD A;  3U4L P;  3UMD A;  4DMZ A;  4MLL A;  1L0E A;  1JVJ A;  2W3H A;  3CG5 A;  4OOM A;  5FQJ A;  1G28 A;  2ZOI A;  4N9K A;  3WRZ A;  2VX8 A;  5GL9 A;  1N9B A;  4FH4 A;  1JTD A;  3K3D A;  3WS0 A;  1PI5 A;  4NXE A;  2OWJ A;  2ZM2 A;  3SS4 A;  3B42 A;  3NI9 A;  4R0Q A;  5G4Z A;  5HL1 A;  1L2S A;  5TJJ A;  3MZF A;  4I3I A;  3D9Y A;  3ZHH A;  1BSG A;  3WRT A;  1L0G A;  5HWW A;  2OOL A;  4A5R A;  2G2W A;  2WKI A;  2NUP C;  2Q9N A;  4LV2 A;  5HWV A;  1YM1 A;  5TBM B;  3QP8 A;  3GTC A;  3JVV A;  2JKG A;  4OQH A;  2QJ7 A;  1CEG A;  1Y4O A;  4P6Z M;  3TSG A;  4MMN A;  3HLG A;  3E2K A;  3MQQ A;  4GS9 A;  3LI9 A;  3E4P A;  2OSU A;  1L0D A;  4HI4 A;  3TOI A;  4KQD A;  4X55 A;  5FI7 A;  1PFL A;  2W27 A;  3NHQ A;  4B93 A;  1ES5 A;  2P9V A;  3IXB A;  2ZQD A;  5M18 A;  1RCJ A;  5KIZ A;  3BEB A;  2FFY A;  4JF5 A;  1LLB A;  3FKW A;  1ODV A;  2HGV A;  1XJ3 A;  3G4P A;  1ESI A;  4NXB A;  1EW0 A;  3TRC A;  3SH8 A;  1UWN X;  2A24 A;  1Z6F A;  2WAE A;  2K7S A;  3VP0 A;  3S22 A;  5HDS A;  2EFU A;  4MBF A;  2V8C A;  3SS5 A;  2EWW A;  3ZDJ A;  3KSG A;  1VEU A;  5FAT A;  4ID4 A;  2Q0O A;  2GX5 A;  3VSK A;  5F69 A;  1G5U A;  2W3G A;  4O7D A;  4B4Z A;  3MXR A;  3QP2 A;  2Z6D A;  2VJW A;  1MBL A;  2PHY A;  3BM6 A;  4S2N C;  3U2A A;  3KYE A;  4QD4 A;  2WK0 A;  4YNR A;  3OPP A;  3UN7 A;  2A2L A;  3Q7V B;  3QP5 A;  3F1P B;  3UO9 A;  1ES2 A;  1K25 A;  3IHA A;  2WYX A;  3HLD A;  1MWT A;  5FAP A;  3CAX A;  4JF6 A;  4DN0 A;  3Q7Z A;  4S2N A;  4Q8I A;  5TR7 A;  3UE6 A;  4FSF A;  3A3J A;  3QNB A;  1ZG4 A;  4QPR A;  3KX0 X;  4JF4 A;  4ME4 A;  2XEP A;  3F1N B;  3P98 A;  4X69 A;  2Q9M A;  1CEF A;  4LPZ A;  3MJQ A;  1SKF A;  4HJ4 A;  3HLW A;  1FOF A;  4ZTK A;  3V5M A;  1TS7 A;  2X71 A;  5CEB A;  1T18 A;  1FSY A;  1J3W A;  3DTE A;  4R3A A;  2LB9 A;  2PR5 A;  2HF6 A;  4HIA A;  4EU0 A;  2Y2L A;  1ES3 A;  2L4R A;  4QWO A;  5CHJ A;  2WKH A;  1SZV A;  4K91 A;  4EES A;  1XGJ A;  4C75 A;  3PBN A;  5EFW A;  3OBF A;  3DAV A;  5CRF A;  4DDS A;  4JKT A;  5GLA A;  2Y8H A;  3AGD A;  3D3O A;  1K57 C;  2INW A;  1YLZ A;  4HP9 A;  5EOO A;  4LFU A;  1BUE A;  1ERO A;  2HZ5 A;  5AVF A;  4WYY A;  2KLI A;  2V20 A;  1PZP A;  5FA7 A;  2XGN A;  1IEM A;  4Y2F A;  5E2G A;  1UGU A;  3QP4 A;  1KE3 A;  4EUV A;  4BMW A;  4HNB A;  2GNX A;  2Y2O A;  3IS2 A;  2KDK A;  3RXW A;  3CWF A;  3A0R A;  2H0T A;  2ZC7 A;  5D3O A;  1M40 A;  1S4R A;  4EBL A;  4HEF A;  4Z9Q A;  1UWP X;  1N9O A;  5A91 A;  4WBG A;  2G2U A;  3S7P A;  3N7W A;  3MFX A;  3C8C A;  3OCL A;  2Y4A A;  4IED A;  3G32 A;  4E3M A;  4KZ6 A;  5EUA A;  4AFI A;  3QHY A;  4DRT A;  4JXS A;  3FPW A;  1CF0 A;  2B95 A;  5AJG A;  1S66 L;  5KSC A;  4HQA A;  1SCW A;  2VKS A;  3JVU A;  5F82 A;  1OJ5 A;  4E6W A;  4LGW A;  1O7E A;  4Q0H A;  1LI9 A;  1W8Y A;  1OJG A;  4Q0J A;  5FAQ A;  1E25 A;  3W4P A;  3WWX A;  2OV5 A;  3NUL A;  2BTF P;  4ZJ1 A;  3HJK A;  2C5W B;  1WYC A;  4Y5F A;  3MF0 A;  3MKF A;  4GS9 B;  1BYW A;  1W79 A;  1K38 A;  3V3S A;  4IVK A;  3IT9 A;  5HAP A;  3VP3 A;  3DBA A;  2P9V B;  4WEL A;  3VE4 A;  2ZBB A;  4QU3 A;  2PYR A;  2ZQ9 A;  4NK3 A;  3QP1 A;  4E3L A;  1OT9 A;  1KGE A;  4YWZ A;  3OCN A;  3UDI A;  2P04 A;  2XK1 A;  1N9N A;  4S2M A;  3ZNT A;  4E04 A;  3N8L A;  1LI0 A;  5DF7 A;  1OTA A;  4M3K A;  3UPP A;  4OQ0 A;  1RGZ A;  4BBV A;  4MNR A;  5L10 A;  3C4P A;  3UME A;  1HD8 A;  2A24 B;  1S1Z A;  2HDQ A;  4KQR A;  1D06 A;  4MDZ A;  5GHZ A;  4GNU A;  3T50 A;  4F3L A;  2EWV A;  3BQA A;  4DJ3 A;  4GB7 A;  3NDG A;  1VEU B;  2K2N A;  3BLS A;  1I2W A;  5E2E A;  3BRM A;  4WN5 A;  5DTK A;  3G2Y A;  2ZD8 A;  4BD1 A;  3S7O A;  4EW7 A;  4C6Y A;  2VA0 A;  4BD0 A;  3ZQ5 A;  1PNE A;  4HBT A;  3IX8 A;  3O88 A;  4ARZ A;  5FQQ A;  3T4O A;  5JYO A;  3MMH A;  4R38 A;  2J8Y A;  1LL5 A;  3L9K A;  2ZLY A;  5FAS A;  4HP4 A;  1SHV A;  3FG8 A;  3RFB A;  3IF6 C;  3MXQ A;  1H5X A;  2PAV P;  2OLV A;  2VGJ A;  3BQ8 A;  3KYQ A;  4FUW A;  4PM7 A;  1PWC A;  3CLO A;  2EXB A;  5HD3 A;  3Q82 A;  2E8J A;  4KQQ A;  4O01 A;  1IYP A;  1T19 A;  3Q7V A;  4EUZ A;  3F1P A;  4KZ8 A;  5A8B A;  4P85 A;  1G68 A;  5FSR A;  4HES A;  2CC1 A;  3ZVW A;  3SH7 A;  3E4O A;  5M19 A;  1BLH A;  4ZDX A;  4Y0T A;  1HVB A;  4NKP A;  5F1F A;  1YLT A;  3VFF A;  4EER A;  4OLG A;  3LYX A;  3ZG0 A;  5TFQ A;  4Q0I A;  3HUN A;  4KG5 A;  1K56 D;  3HBR A;  4D2O A;  3O86 A;  4PKY G;  5HZH A;  4GDB A;  4E3I A;  1CI8 A;  2JKR M;  1E3U A;  5MC7 A;  4JBF A;  3NJA A;  1J9M A;  2AVX A;  2H10 A;  2ZJ9 A;  3NY4 A;  3P09 A;  5CTN A;  1KE4 A;  2MJ6 A;  4Y7P A;  3O87 A;  1S4S A;  4EBP A;  4KEN B;  3NOP C;  4G3V A;  1PIO A; 
#chains in the Genus database with same CATH homology
 1LLB A;  3NDE A;  4L0L A;  3IWO A;  4U0X A;  4OP8 A;  1ZC2 A;  3FKW A;  2EXA A;  4PM8 A;  4ZJ2 A;  1PI4 A;  3V39 A;  3PBT A;  2WGV A;  1NZU A;  3G4P A;  5CGX A;  1MY8 A;  4XUZ A;  3BFD A;  1ESI A;  3MZD A;  1H8Z A;  3CZD A;  2IWB A;  5I94 A;  4KZ7 A;  1KGG A;  2XFT A;  2PU4 A;  3HLC A;  1PW1 A;  5DVA A;  3ISG A;  1N4O A;  1RP5 A;  4MEZ A;  2XFS A;  3LEZ A;  4KZ3 A;  1YT4 A;  2FFF B;  2PBY A;  3GQZ A;  2Y2K A;  3LCE A;  3IH8 A;  4E3N A;  4IBR A;  1TEM A;  3NIA A;  3Q1F A;  3SH8 A;  3VFH A;  1XP4 A;  4JXV A;  3SS3 A;  5G18 A;  3GVB A;  2WAE A;  1Z6F A;  4OQG A;  1WE4 A;  2ZC3 B;  5DTS A;  4GD8 A;  3VP0 A;  2WZZ A;  3S22 A;  2X02 A;  2EFU A;  1KDS A;  4MBF A;  3SS5 A;  1XXM A;  1ES4 A;  1MKI A;  4UAA A;  3ZDJ A;  5KSH A;  4OOY A;  4OQ0 A;  3NBL A;  4WM9 A;  5U47 A;  4R4S A;  4DKI A;  5FAT A;  4ID4 A;  5DTT A;  4E3O A;  3ZCZ A;  3VSK A;  5CHU A;  2H0Y A;  3OZH A;  4DE2 A;  4O7D A;  4QHC A;  4B4Z A;  1YLW A;  4Y0O A;  2Y55 A;  1L0F A;  3MXR A;  4KZA A;  4WEJ A;  3GV9 A;  3M6B A;  4S2P A;  3IWQ A;  1MBL A;  2BLS A;  2A3U A;  3BM6 A;  2QMI A;  4S2N C;  4B88 A;  1BZA A;  1QMF A;  3OC2 A;  2JC7 A;  4QD4 A;  3S4X A;  1QME A;  2EFX A;  2WK0 A;  1MWR A;  3OPP A;  3UN7 A;  4E3J A;  2Y2H A;  1XGI A;  3Q7V B;  2X01 A;  4OPR A;  4NET A;  4OVD A;  3S1Y A;  4OLD A;  3UO9 A;  1ES2 A;  1K25 A;  4OPZ A;  3IHA A;  2DNS A;  2Y2Q A;  2WYX A;  3IF6 A;  1BUL A;  3HLD A;  3N4I A;  4WEK A;  1MWT A;  1NXY A;  2WKE A;  1E4D A;  1ERQ A;  1FCM A;  5E2H A;  2IWD A;  5FAP A;  3ZVT A;  2EX6 A;  4C3Q A;  3VSL A;  2QPN A;  4IVI A;  4JF6 A;  3M2J A;  4ZAM A;  2XD1 A;  5CTM A;  3Q7Z A;  1O07 A;  4S2N A;  4Q8I A;  3OPH A;  2Y2P A;  5TR7 A;  4FSF A;  3A3J A;  3QNB A;  1KVL A;  1ZG4 A;  2Z2L B;  3W4Q A;  5FQM A;  3GRJ A;  4JF4 A;  2ZQA A;  2WGW B;  2R9X A;  2XEP A;  3Q81 A;  4K0X A;  1EWZ A;  3P98 A;  3AGE A;  4DE0 A;  1IYS A;  4X69 A;  2Q9M A;  1CEF A;  3GR2 A;  2ZM0 A;  4OPY A;  3C4O A;  1SKF A;  3IXG A;  3HLW A;  4EBN A;  2H5S A;  4X68 A;  1FOF A;  1AXB A;  3DW0 A;  4ZTK A;  1GCE A;  3WS1 A;  1IKG A;  3IHB A;  1PWG A;  4RX2 A;  4WZ5 C;  4IBX A;  5EVI D;  5AQ9 A;  3V5M A;  5F83 A;  4LV0 A;  2X71 A;  3LY4 A;  5CEB A;  4KQO A;  4BQM A;  4R1G A;  1FSY A;  2A49 A;  1YLJ A;  3PAE A;  5EVI B;  4P87 A;  4KZ5 A;  2J7V A;  2J9P A;  3C7U A;  3GSG A;  1ALQ A;  3IQA A;  2Y2L A;  1ES3 A;  4XUX A;  5CHJ A;  2WKH A;  2V2F F;  4K91 A;  5GLB A;  2XQZ A;  2ZQC A;  1W8Q A;  1YLY A;  1XGJ A;  1FR6 A;  4S2K A;  3D4F A;  3UDF A;  4WZ5 A;  4C75 A;  1PW8 A;  1S0W A;  3PBN A;  5DF9 A;  2GDN A;  4CJN A;  4DXC A;  3RJU A;  1YQS A;  5CRF A;  2PU2 A;  1XKZ A;  4GD6 A;  1MPL A;  1GA0 A;  4R4R A;  1ZG6 A;  4DDS A;  5KZH A;  4JKT A;  5GLA A;  3AGD A;  3TG9 A;  3M2K A;  1VQQ A;  1K57 C;  1YLZ A;  5L2F A;  1EI5 A;  5CHM A;  5HAR A;  4EWF A;  5EOO A;  5AQ7 A;  3IXH A;  1H8Y A;  1BUE A;  1ERO A;  1YLP A;  4RYE A;  2HPB A;  4WYY A;  3BFG A;  1K54 C;  3MFD A;  2V20 A;  5GHY A;  3SOI A;  1PZP A;  3C7V A;  1NRF A;  1S6R A;  2XGN A;  5FA7 A;  1LHY A;  3W4O A;  4UA6 A;  5EE8 A;  1IEM A;  1LL9 A;  3PBR A;  3UE1 A;  5JYP A;  5E2G A;  4LCL A;  1SDN A;  5E43 A;  2XLN A;  1KE3 A;  4EQI A;  4R3J A;  3UDX A;  1PWD A;  5GLD A;  4GN2 A;  3G31 A;  3ZG7 B;  3DWK A;  4HBU A;  2Y2O A;  3OPR A;  1XPB A;  3A3F A;  3RXW A;  3DTM A;  2H0T A;  4QY5 A;  2ZC7 A;  5D3O A;  2VGK A;  1K55 C;  1M40 A;  1K4F A;  3A3D A;  2BG1 A;  4XXR A;  4MBK A;  3EQV A;  1TVF A;  3GMW A;  3NC8 A;  3BFE A;  3PBS A;  4EBL A;  4HEF A;  4Z9Q A;  4BL2 A;  2EX2 A;  3VOY A;  3WS2 A;  4JLF A;  5A91 A;  4RVA A;  4WBG A;  1BT5 A;  4YIN A;  1IYO A;  2G2U A;  1NYM A;  3BEC A;  3N7W A;  2I72 A;  3DWZ A;  1BLP A;  3CMZ A;  3OCL A;  2Y4A A;  3RXX A;  4K0W A;  4IED A;  3G32 A;  4E3M A;  4KZ6 A;  3MXS A;  5EUA A;  2Z2M B;  3UPN A;  1K55 A;  2V1Z A;  2ZC5 B;  2JBF A;  4RX3 A;  3QHY A;  1PYY A;  4DRT A;  2E8I A;  4OP5 A;  1MXO A;  2OLU A;  2ZC6 B;  3BFF A;  3W8K A;  2DRW A;  2EX9 A;  4JXS A;  1W5D A;  5HFO A;  3V3R A;  4F94 A;  2HDR A;  1ZKJ A;  2R9W A;  5A90 A;  4X56 A;  3BYD A;  2UWX A;  3C5A A;  5KSC A;  1SCW A;  5F82 A;  4OKP A;  4E6W A;  4OPQ A;  4BEN A;  4S2L A;  1O7E A;  1LI9 A;  1W8Y A;  1XX2 A;  5A92 A;  1RGY A;  3N6I A;  4OH0 A;  1E25 A;  4YFM A;  5FAQ A;  4JPM A;  4JXW A;  2XH9 A;  5TGF A;  2OV5 A;  3W4P A;  1GA9 A;  3WWX A;  2JCH A;  3VP4 A;  3HRE A;  4ZJ1 A;  5HW3 A;  2C5W B;  1WYC A;  5IHV A;  4N9L A;  3IXD A;  3ZGA B;  1E3U D;  3MKF A;  2Y2M A;  1DJC A;  4KZ4 A;  2IWC A;  1W79 A;  1K38 A;  3LO7 A;  2ZQ8 A;  4KG2 A;  1Y54 A;  1IEL A;  1XA1 A;  2XDM A;  4CPK A;  1FCO A;  2ZMA A;  3CJM A;  4OQI A;  3V3S A;  4LCM A;  5FI6 A;  3VMA A;  4IVK A;  3V50 A;  1BLC A;  2RL3 A;  1FQG A;  1BTL A;  3G34 A;  4ZBE A;  1W7F A;  4R23 A;  1Q2Q A;  3IT9 A;  5HAP A;  3G2Z A;  3VP3 A;  3ZG5 A;  5EVI C;  1GHM A;  2P9V B;  1JTG A;  4WEL A;  4WMC A;  4ZJ3 A;  5FQK A;  3ZG8 B;  4QU3 A;  1NYY A;  4UA9 A;  2ZQ9 A;  4NK3 A;  5KMW A;  3A3I A;  2HP9 A;  1JWZ A;  1OME A;  3M6H A;  3UNW A;  4E3L A;  5J8X A;  1TDL A;  1K56 A;  5CXW A;  5FI2 A;  2EX8 A;  2Y2I A;  4UA7 A;  1KGE A;  2P74 A;  1PZO A;  2QZ6 A;  4UHU A;  3OCN A;  4P0M A;  3UDI A;  4BLM A;  3PBQ A;  2XK1 A;  4LEN A;  2Y59 A;  3FWL A;  4B4X A;  4R3B A;  3UE0 A;  5EVI A;  4S2M A;  5GLC A;  3MZE A;  3ZNT A;  1ESU A;  3VOZ A;  3N8L A;  1LI0 A;  4BL3 A;  1FCN A;  4DXB A;  3UY6 A;  4E6X A;  5DF7 A;  5HAQ A;  1YMX A;  4N92 A;  4FH2 A;  4M3K A;  3UPP A;  5DF8 A;  5AQA A;  3E2L A;  1MWU A;  1RGZ A;  2Y2G A;  3HVF A;  3N8R A;  1FR1 A;  1K6S A;  4LV3 A;  1NJ4 A;  3FZC A;  3C4P A;  1GHI A;  3IF5 A;  3PBO A;  4MNR A;  4PM9 A;  1G6A A;  1HD8 A;  3FV7 A;  4KZ9 A;  1WYB A;  4OOL A;  2HP6 A;  2Y2J A;  3FYZ A;  2HDQ A;  5EVL A;  4QB8 A;  4KQR A;  3ITB A;  5FAO A;  2B5R A;  1U60 A;  2RCX A;  1CK3 A;  5EEC A;  5GHZ A;  4GNU A;  4DDY A;  2ZM8 A;  5CGS A;  1K57 A;  2DCF A;  4DE3 A;  1M6K A;  1K6R A;  3MBZ A;  3AGF A;  4PM6 A;  4GB7 A;  3B3X A;  1DY6 A;  5EOE A;  3ZNY A;  3NDG A;  1K4E A;  1DJA A;  1VM1 A;  4OON A;  1K54 A;  4PPR A;  3I7J A;  4U3T A;  4N1X A;  3BLS A;  1XA7 A;  2C6W B;  1I2W A;  2WUQ A;  5E2E A;  1C3B A;  2HDU A;  3BRM A;  5DTK A;  5E2F A;  3G2Y A;  3VP1 A;  2XR0 A;  5HAI A;  2Y2N A;  5CED A;  4P6B A;  2ZD8 A;  4BD1 A;  3SH9 A;  3ITA A;  5HX9 A;  4Y0U A;  4QY6 A;  4C6Y A;  5CEC A;  4BD0 A;  1SDE A;  1ERM A;  3O88 A;  4HBT A;  5FDH A;  1IYQ A;  5FQQ A;  3ZG9 B;  4PM5 A;  5JYO A;  4PMA A;  1I2S A;  2J8Y A;  3UE3 A;  3PAG A;  1LL5 A;  4GKU A;  1Q2P A;  2ZLY A;  5FAS A;  1BLS A;  3O3V A;  2WAD A;  1SHV A;  5GHX A;  3ZFZ A;  4WZ4 A;  3MKE A;  4MLL A;  1L0E A;  3IF6 B;  5FQ9 A;  1JVJ A;  3IF6 C;  1FSW A;  1ONG A;  1IKI A;  3CG5 A;  4U0T A;  1H5X A;  4OOM A;  5FQJ A;  2OLV A;  2VGJ A;  3QNC A;  3WS4 A;  2HDS A;  3IWI A;  4N9K A;  3WRZ A;  1MWS A;  4PM7 A;  1PWC A;  1YMS A;  5CGW A;  5GL9 A;  1N9B A;  4FH4 A;  1JTD A;  4FCF A;  2EXB A;  3WS0 A;  1HTZ A;  1JWV A;  1PI5 A;  3Q82 A;  2XF3 A;  4KQQ A;  2ZM2 A;  3SS4 A;  3HL9 A;  1IYP A;  3G30 A;  5CER A;  3NI9 A;  4R0Q A;  5HL1 A;  2XD5 A;  3Q7V A;  4X53 A;  4EUZ A;  3A3E A;  5A93 A;  1L2S A;  3HUO A;  3MZF A;  1ONH A;  4KZ8 A;  4P85 A;  1BSG A;  1G68 A;  2ZQ7 A;  1L0G A;  3WRT A;  3ZHH A;  4QJG A;  4A5R A;  2G2W A;  5FSR A;  3NCK A;  2WKI A;  3HLF A;  4DF6 A;  4HES A;  2CC1 A;  3ZVW A;  2Q9N A;  3SH7 A;  4KG6 A;  4LV2 A;  3VP2 A;  2J9O A;  5M19 A;  1BLH A;  1YM1 A;  4GZB A;  4H8R A;  1KE0 A;  3GTC A;  4ZDX A;  1NZO A;  4LV1 A;  1HZO A;  4Y0T A;  1HVB A;  5F1F A;  1YLT A;  3IH9 A;  3VFF A;  4WMC D;  3G35 A;  4X6T A;  3PTE A;  3WS5 A;  4OQH A;  4OLG A;  2ZC4 B;  3BLM A;  2WGW A;  4GOG A;  4E3K A;  1CEG A;  3FKV A;  4N1H A;  3HLE A;  4S2O A;  5F1G A;  1JWP A;  5TFQ A;  3HUN A;  4KG5 A;  1K56 D;  3ZG0 A;  3LY3 A;  3HBR A;  1KDW A;  3TSG A;  1DJB A;  4KZB A;  3HLG A;  2JE5 A;  4D2O A;  3E2K A;  3OPL A;  4S2I A;  3O86 A;  1I5Q A;  1GHP A;  3HLB A;  4GDB A;  4RA7 A;  4E3I A;  4JXG A;  4GDN A;  1CI8 A;  2OSU A;  5AQB A;  1L0D A;  3EQU A;  3TOI A;  1E3U A;  4S2J A;  5BOH A;  3BFC A;  4X55 A;  5FI7 A;  5FQI A;  4BJP A;  1CI9 A;  2Y91 A;  4JBF A;  1KGF A;  1J9M A;  5EPH A;  4DE1 A;  3UPO A;  2H10 A;  4EV4 A;  4FD8 A;  2HP5 A;  2ZJ9 A;  3Q07 A;  1ES5 A;  2P9V A;  3NY4 A;  1TDG A;  3N8S A;  3P09 A;  5CTN A;  4MBH A;  2WGI A;  3IXB A;  1KE4 A;  1NY0 A;  2WAF A;  2ZQD A;  5M18 A;  3HUM A;  4Y7P A;  2WZX A;  1RCJ A;  1KVM A;  3O87 A;  3JYI A;  4EBP A;  4KEN B;  5M1A A;  3BEB A;  2FFY A;  1PIO A;  4JF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...