4P8OA

S. aureus gyrase bound to an aminobenzimidazole urea inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
184
structure length
184
Chain Sequence
b'GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Second-generation antibacterial benzimidazole ureas: discovery of a preclinical candidate with reduced metabolic liability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
total genus 57
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4p8oA00
4L91A 4AWOA 2O1VA 2XX5A 3ZKBA 2WEQA 4CWPA 4HZ5A 2QG2A 2XX4A 2XJGA 4LWEA 4LWIA 2FYPA 3D2RA 4PL9A 3R4PA 2BU5A 3TZ5A 4BIZA 1B63A 3D36A 1Y4UA 3FV5A 1YSRA 1YT2A 3B25A 2XD6A 2UWDA 2ZBKB 4V25A 3WQ9A 4FMTA 2CG9A 2XDSA 3R91A 3LPSA 1UYLA 3TZ2A 4KP4A 5M4MA 1BXDA 2FXSA 4MP7A 4LPBA 3INXA 4CWQA 4CWNA 4O04A 2YI7A 2QG0A 4YKZA 4FPPA 4O0BA 2K5BA 3H4LA 4H81A 3A0TA 4MOTA 2JJCA 4O09A 2Q8IA 3CGYA 2BU2A 3OPDA 2XHTA 2BYIA 4XC0A 3CRKA 5FNDA 1YC1A 4XIPA 4ASFA 5IDMA 2Q8FA 4XIQA 2VWCA 4GFNA 4JAUA 2QF6A 4U93A 3EKOA 5CPHA 2CCSA 5CTWA 4CWRA 4XKOA 4URMA 2WI7A 4O05A 5FNCA 2ZDXA 3K97A 4R1FA 4NH8A 3K60A 1OSFA 3INWA 3BMYA 2WERA 5M4EA 3D0BA 5M4PA 1ZW9A 2YEBA 4AS9A 2HCHA 3B26A 4HXWA 2BTZA 2BU7A 2YKEA 4HYMA 4JAVA 3T1KA 3Q5KA 2XDUA 1Y8NA 4HY1A 1ZXMA 3HYZA 4Q20A 4CWTA 2WI4A 2YKJA 2GFDA 1UYMA 5J71A 1TBWA 2YI5A 1H7SA 1TC0A 3ZXOA 2YI6A 2XHXA 4YKRA 3ZM7A 4AWQA 4YKTA 3R92A 4MPNA 3VHAA 2YE6A 2BREA 4XIRA 2YGEA 2YJWA 4E00A 2IORA 2CCTA 1GJVA 3HYYA 2XDLA 2ESAA 1MU5A 1ID0A 1AM1A 1AJ6A 4B7PA 1AH8A 1Z5AA 3B27A 4WUCA 4HXZA 3EHFA 2YE4A 4YKYA 4ASBA 2YKBA 3RLPA 4MB9A 3TUHA 1I5DA 3DGEA 1UYHA 3VHCA 3Q5JA 4BXIA 4ASGA 3O0IA 1UYKA 3WHAA 1UY6A 4KSGA 1BGQA 2XABA 4GT8A 4EFUA 1L0OA 2HG1A 4HZ0A 1YESA 1NHHA 1YT1A 3HEKA 5GGZA 5D6QA 4WUDA 2C2AA 4EGHA 4YKUA 2BYHA 4E02A 3T0HA 1YETA 3A0ZA 5FNFA 4UROA 4KQVA 4DZYA 1BYQA 3T2SA 4JASA 5CTXA 1ZWHA 3KE6A 3T0ZA 5F5RA 2CCUA 4V26A 2YEIA 3U67A 3GIFA 5D6PA 3NMQA 3OW6A 2GQPA 4GEEA 4KFGA 5CTYA 5D7CA 1UYIA 4H85A 3B28A 1MX0A 2H8MA 4EMVA 2AKPA 3K99A 3PEHA 4U7OA 4PRVA 2Q2EB 1U0ZA 4GGLA 5D7RA 1Z5BA 2XJXA 2FWZA 3FT5A 2VW5A 4YKXA 4MPEA 4URLA 4R3MA 3U2DA 2O1UA 1H7UA 3O2FA 2XDXA 1S16A 4QPKA 1QY8A 4L8ZA 3TZ0A 3VADA 2H55A 4W7TA 4L90A 4ZKIA 3C11A 2ZDYA 5CTUA 3C0EA 5FWKA 4XTJA 1TH8A 2VCJA 3TZ4A 3G75A 1BKNA 3OWBA 2BZ5A 3U2KA 3RKZA 4EGKA 2WI1A 3EKRA 3A0RA 4QPJA 4CE3A 1UYGA 4XCJA 2E0AA 3CRLA 4LP0A 5D7DA 2WI2A 4MBCA 5BOCA 1KIJA 4EM7A 4NH9A 5BODA 4XD8A 4HYPA 4XKKA 4BAEA 1I5CA 3LNUA 4I5SA 3EHHA 3TTZA 2WI5A 2WI6A 3PEJA 1S14A 2YE3A 1I5AA 1KZNA 5F3KA 4YKQA 1UY9A 4X9LA 2IWUA 1UYCA 5IN9A 2CH4A 4GQTA 4O07A 3CWVA 3R4NA 1Z5CA 2YE9A 1YSZA 4URNA 4XITA 2YEDA 1B62A 1QZRA 2BU6A 4K4OA 3FT8A 4PU9A 3VHDA 4PRXA 5IDJA 1JM6A 1I5BA 3BM9A 1YT0A 2IOPA 4KTNA 1YS3A 2HKJA 2YEFA 2FWYA 4B6CA 3R4MA 2YK9A 1YERA 4XDMA 3O6OA 1UY8A 2YKCA 2YECA 2XK2A 3H80A 3GIEA 4JQLA 4R3AA 1GKZA 2CGFA 2YE8A 3OWDA 4L93A 4XKAA 1Y8PA 3A0YA 1YC4A 3ZXQA 5L3JA 2PNRA 2YEHA 2Q8GA 4LWHA 2BT0A 2YGAA 2O1WA 3QDDA 5J6AA 4MP2A 1PVGA 1TC6A 2YGFA 4ASAA 4CE1A 4BQJA 2IWXA 3IEDA 1TILA 4XCLA 4CWSA 4MPCA 4CWOA 2XCMA 2IWSA 1UY7A 1UYEA 4WUBA 2XHRA 3GIGB 3EHJA 2ZKJA 3QTFA 2BSMA 2YJXA 3MNRP 4DUHA 3HZ5A 3ZKDA 1A4HA 3RLRA 1EA6A 2YEGA 3RLQA 2YEAA 4H7QA 4LWGA 1U2OA 4XE2A 3Q5LA 4U7NA 1EI1A 1I59A 4HY6A 2WEPA 1THNA 2XDKA 2Q8HA 4BIUA 4P7AA 3T10A 1ZXNA 4P8OA 4ZVIA 2BU8A 2BRCA 4CE2A 1NHJA 3HHUA 3G7BA 3A0WA 4NH7A 1Y8OA 3JZ3A 3R4OA 2EXLA 2XX2A 2QFOA 3A0XA 4EEHA 1NHIA 2YE5A 1AMWA 2YE2A 3HZ1A 3K98A 4FCPA 2JKIA 1R62A 3GIGA 4CWFA 3CGZA 1YC3A 1AH6A 4BQGA 4AWPA 4L94A 3G7EA 2YK2A 4EFTA 4EGIA 4YKWA 2XJJA 1US7A 3EHGA 5M4NA 5M4KA 2YI0A 4FCRA 2YEEA 1Y4SA 4KSHA 3OMUA 3SL2A 4LWFA 2IOQA 2VCIA 4I3HA 4E01A 1GKXA 5M4HA 3B24A 1UYDA 1B3QA 5CF0A 2YEJA 1QYEA 2WI3A 5C93A 1Z59A 1TIDA 1UYFA 2YE7A 1I58A 4FCQA 4GCZA 2YKIA
chains in the Genus database with same CATH superfamily
4L91A 1IXMA 4AWOA 2O1VA 2XX5A 3ZKBA 2WEQA 4CWPA 1F51A 4HZ5A 2QG2A 2XX4A 2FTKA 2XJGA 4LWEA 4LWIA 2FYPA 3D2RA 4PL9A 3R4PA 2BU5A 3TZ5A 4BIZA 1B63A 3D36A 1Y4UA 3FV5A 1YSRA 1YT2A 3B25A 2XD6A 2UWDA 2ZBKB 4V25A 3WQ9A 4FMTA 2CG9A 2XDSA 3R91A 3LPSA 1UYLA 3TZ2A 4KP4A 5M4MA 1BXDA 2FXSA 4MP7A 4LPBA 3INXA 4CWQA 4CWNA 4O04A 2YI7A 2QG0A 4YKZA 4FPPA 4O0BA 2K5BA 3H4LA 4H81A 3A0TA 4MOTA 2JJCA 4O09A 2Q8IA 3CGYA 2BU2A 3OPDA 2XHTA 2BYIA 4XC0A 3CRKA 5FNDA 1YC1A 4XIPA 4ASFA 5IDMA 2Q8FA 4XIQA 2VWCA 4GFNA 4JAUA 2QF6A 4U93A 3EKOA 5CPHA 2CCSA 5CTWA 4CWRA 4XKOA 4URMA 2WI7A 4O05A 5FNCA 2ZDXA 3K97A 4R1FA 4NH8A 3K60A 1OSFA 3INWA 3BMYA 2WERA 5M4EA 3D0BA 5M4PA 1ZW9A 2YEBA 4AS9A 2HCHA 3B26A 4HXWA 2BTZA 2BU7A 2YKEA 4HYMA 4JAVA 3T1KA 3Q5KA 2XDUA 1Y8NA 4HY1A 3S5TA 1ZXMA 3HYZA 4Q20A 4CWTA 2WI4A 2YKJA 2GFDA 1UYMA 5J71A 1TBWA 2C1GA 2YI5A 1H7SA 1TC0A 3ZXOA 2YI6A 2XHXA 4YKRA 3ZM7A 4AWQA 4YKTA 3R92A 4MPNA 3VHAA 2YE6A 2BREA 4XIRA 2YGEA 2YJWA 4E00A 2IORA 2CCTA 1GJVA 3HYYA 2XDLA 2ESAA 1MU5A 1ID0A 1AM1A 1AJ6A 4B7PA 1AH8A 1Z5AA 3B27A 4WUCA 4HXZA 3EHFA 2YE4A 4YKYA 4ASBA 2YKBA 3RLPA 4MB9A 3TUHA 1I5DA 3DGEA 1UYHA 3VHCA 3Q5JA 4BXIA 4ASGA 3O0IA 1UYKA 3WHAA 1UY6A 4KSGA 1BGQA 2XABA 4GT8A 4EFUA 1L0OA 2HG1A 4HZ0A 1YESA 1NHHA 1YT1A 3HEKA 5GGZA 5D6QA 4WUDA 2C2AA 4EGHA 4YKUA 2BYHA 4E02A 3T0HA 1YETA 3A0ZA 5FNFA 4UROA 4KQVA 4DZYA 1BYQA 3T2SA 4JASA 5CTXA 1ZWHA 3KE6A 3T0ZA 5F5RA 2CCUA 4V26A 2YEIA 3U67A 3GIFA 5D6PA 3NMQA 3OW6A 2GQPA 4GEEA 4KFGA 5CTYA 2C1IA 5D7CA 1UYIA 4H85A 3B28A 1MX0A 2H8MA 4EMVA 2AKPA 3K99A 3PEHA 4U7OA 4PRVA 2Q2EB 1U0ZA 4GGLA 5D7RA 1Z5BA 2XJXA 2FWZA 3FT5A 2VW5A 4YKXA 4MPEA 4URLA 4R3MA 3U2DA 2O1UA 1H7UA 3O2FA 2XDXA 1S16A 4QPKA 1QY8A 4L8ZA 3TZ0A 3VADA 2H55A 4W7TA 4L90A 4ZKIA 3C11A 2ZDYA 5CTUA 3C0EA 5FWKA 4XTJA 1TH8A 2VCJA 3TZ4A 3G75A 1BKNA 3OWBA 2BZ5A 3U2KA 3RKZA 4EGKA 2WI1A 3EKRA 3A0RA 4QPJA 4CE3A 1UYGA 4XCJA 2E0AA 3CRLA 4LP0A 5D7DA 2WI2A 4MBCA 5BOCA 1KIJA 4EM7A 4NH9A 5BODA 4XD8A 4HYPA 4XKKA 4BAEA 1I5CA 3LNUA 4I5SA 3EHHA 3TTZA 2WI5A 2HHIA 2WI6A 3PEJA 1S14A 2YE3A 1I5AA 1KZNA 5F3KA 4YKQA 1UY9A 4X9LA 2IWUA 1UYCA 5IN9A 2CH4A 4GQTA 4O07A 3CWVA 3R4NA 1Z5CA 2YE9A 1YSZA 4URNA 4XITA 2YEDA 1B62A 1QZRA 2BU6A 4K4OA 3FT8A 4PU9A 3VHDA 4PRXA 5IDJA 1JM6A 1I5BA 3BM9A 1YT0A 2IOPA 4KTNA 1YS3A 2HKJA 2YEFA 2FWYA 4B6CA 3R4MA 2YK9A 1YERA 4XDMA 3O6OA 1UY8A 2YKCA 2YECA 2XK2A 3H80A 3GIEA 3CYGA 4JQLA 4R3AA 1GKZA 2CGFA 2YE8A 3OWDA 4L93A 4XKAA 1Y8PA 3A0YA 1YC4A 3ZXQA 5L3JA 2PNRA 2YEHA 2Q8GA 4LWHA 2BT0A 2YGAA 2O1WA 3QDDA 5J6AA 4MP2A 1PVGA 1TC6A 2YGFA 4ASAA 4CE1A 4BQJA 2IWXA 3IEDA 1TILA 4XCLA 4CWSA 4MPCA 4CWOA 2XCMA 2IWSA 1UY7A 1UYEA 4WUBA 4E72A 2XHRA 3GIGB 3EHJA 2ZKJA 3QTFA 2BSMA 2YJXA 3MNRP 4DUHA 3HZ5A 3ZKDA 1A4HA 3RLRA 1EA6A 2YEGA 3RLQA 2YEAA 4H7QA 4LWGA 1U2OA 4XE2A 3Q5LA 4U7NA 1EI1A 1I59A 4HY6A 2WEPA 1THNA 3LMMA 2XDKA 2Q8HA 4BIUA 4P7AA 3T10A 1ZXNA 4P8OA 4ZVIA 2BU8A 2BRCA 4CE2A 1NHJA 3HHUA 5JENA 3G7BA 3A0WA 4NH7A 1Y8OA 3JZ3A 3R4OA 2EXLA 2XX2A 2QFOA 3A0XA 4EEHA 1NHIA 2YE5A 1AMWA 2YE2A 3HZ1A 3K98A 4FCPA 2JKIA 1R62A 3GIGA 4CWFA 3CGZA 1YC3A 1AH6A 4BQGA 4AWPA 4L94A 3G7EA 2YK2A 4EFTA 4EGIA 4YKWA 2XJJA 1US7A 3EHGA 5M4NA 5M4KA 2YI0A 4FCRA 2YEEA 1Y4SA 4KSHA 3OMUA 3SL2A 4LWFA 2IOQA 2VCIA 4I3HA 4E01A 1GKXA 5M4HA 3B24A 1UYDA 1B3QA 5CF0A 2YEJA 1QYEA 2WI3A 5C93A 1Z59A 1TIDA 1UYFA 2YE7A 1I58A 4FCQA 4GCZA 2YKIA
chains in the Genus database with same CATH topology
4L91A 4AWOA 2O1VA 2XX5A 3ZKBA 2WEQA 4CWPA 4HZ5A 2QG2A 2XX4A 2XJGA 4LWEA 4LWIA 2FYPA 3D2RA 4PL9A 3R4PA 2BU5A 3TZ5A 4BIZA 1B63A 3D36A 1Y4UA 3FV5A 1YSRA 1YT2A 3B25A 2XD6A 2UWDA 2ZBKB 4V25A 3WQ9A 4FMTA 2CG9A 2XDSA 3R91A 3LPSA 1UYLA 3TZ2A 4KP4A 5M4MA 1BXDA 2FXSA 4MP7A 4LPBA 3INXA 4CWQA 4CWNA 4O04A 2YI7A 2QG0A 4YKZA 4FPPA 4O0BA 2K5BA 3H4LA 4H81A 3A0TA 4MOTA 2JJCA 4O09A 2Q8IA 3CGYA 2BU2A 3OPDA 2XHTA 2BYIA 4XC0A 3CRKA 5FNDA 1YC1A 4XIPA 4ASFA 5IDMA 2Q8FA 4XIQA 2VWCA 4GFNA 4JAUA 2QF6A 4U93A 3EKOA 5CPHA 2CCSA 5CTWA 4CWRA 4XKOA 4URMA 2WI7A 4O05A 5FNCA 2ZDXA 3K97A 4R1FA 4NH8A 3K60A 1OSFA 3INWA 3BMYA 2WERA 5M4EA 3D0BA 5M4PA 1ZW9A 2YEBA 4AS9A 2HCHA 3B26A 4HXWA 2BTZA 2BU7A 2YKEA 4HYMA 4JAVA 3T1KA 3Q5KA 2XDUA 1Y8NA 4HY1A 1ZXMA 3HYZA 4Q20A 4CWTA 2WI4A 2YKJA 2GFDA 1UYMA 5J71A 1TBWA 2YI5A 1H7SA 1TC0A 3ZXOA 2YI6A 2XHXA 4YKRA 3ZM7A 4AWQA 4YKTA 3R92A 4MPNA 3VHAA 2YE6A 2BREA 4XIRA 2YGEA 2YJWA 4E00A 2IORA 2CCTA 1GJVA 3HYYA 2XDLA 2ESAA 1MU5A 1ID0A 1AM1A 1AJ6A 4B7PA 1AH8A 1Z5AA 3B27A 4WUCA 4HXZA 3EHFA 2YE4A 4YKYA 4ASBA 2YKBA 3RLPA 4MB9A 3TUHA 1I5DA 3DGEA 1UYHA 3VHCA 3Q5JA 4BXIA 4ASGA 3O0IA 1UYKA 3WHAA 1UY6A 4KSGA 1BGQA 2XABA 4GT8A 4EFUA 1L0OA 2HG1A 4HZ0A 1YESA 1NHHA 1YT1A 3HEKA 5GGZA 5D6QA 4WUDA 2C2AA 4EGHA 4YKUA 2BYHA 4E02A 3T0HA 1YETA 3A0ZA 5FNFA 4UROA 4KQVA 4DZYA 1BYQA 3T2SA 4JASA 5CTXA 1ZWHA 3KE6A 3T0ZA 5F5RA 2CCUA 4V26A 2YEIA 3U67A 3GIFA 5D6PA 3NMQA 3OW6A 2GQPA 4GEEA 4KFGA 5CTYA 5D7CA 1UYIA 4H85A 3B28A 1MX0A 2H8MA 4EMVA 2AKPA 3K99A 3PEHA 4U7OA 4PRVA 2Q2EB 1U0ZA 4GGLA 5D7RA 1Z5BA 2XJXA 2FWZA 3FT5A 2VW5A 4YKXA 4MPEA 4URLA 4R3MA 3U2DA 2O1UA 1H7UA 3O2FA 2XDXA 1S16A 4QPKA 1QY8A 4L8ZA 3TZ0A 3VADA 2H55A 4W7TA 4L90A 4ZKIA 3C11A 2ZDYA 5CTUA 3C0EA 5FWKA 4XTJA 1TH8A 2VCJA 3TZ4A 3G75A 1BKNA 3OWBA 2BZ5A 3U2KA 3RKZA 4EGKA 2WI1A 3EKRA 3A0RA 4QPJA 4CE3A 1UYGA 4XCJA 2E0AA 3CRLA 4LP0A 5D7DA 2WI2A 4MBCA 5BOCA 1KIJA 4EM7A 4NH9A 5BODA 4XD8A 4HYPA 4XKKA 4BAEA 1I5CA 3LNUA 4I5SA 3EHHA 3TTZA 2WI5A 2WI6A 3PEJA 1S14A 2YE3A 1I5AA 1KZNA 5F3KA 4YKQA 1UY9A 4X9LA 2IWUA 1UYCA 5IN9A 2CH4A 4GQTA 4O07A 3CWVA 3R4NA 1Z5CA 2YE9A 1YSZA 4URNA 4XITA 2YEDA 1B62A 1QZRA 2BU6A 4K4OA 3FT8A 4PU9A 3VHDA 4PRXA 5IDJA 1JM6A 1I5BA 3BM9A 1YT0A 2IOPA 4KTNA 1YS3A 2HKJA 2YEFA 2FWYA 4B6CA 3R4MA 2YK9A 1YERA 4XDMA 3O6OA 1UY8A 2YKCA 2YECA 2XK2A 3H80A 3GIEA 4JQLA 4R3AA 1GKZA 2CGFA 2YE8A 3OWDA 4L93A 4XKAA 1Y8PA 3A0YA 1YC4A 3ZXQA 5L3JA 2PNRA 2YEHA 2Q8GA 4LWHA 2BT0A 2YGAA 2O1WA 3QDDA 5J6AA 4MP2A 1PVGA 1TC6A 2YGFA 4ASAA 4CE1A 4BQJA 2IWXA 3IEDA 1TILA 4XCLA 4CWSA 4MPCA 4CWOA 2XCMA 2IWSA 1UY7A 1UYEA 4WUBA 2XHRA 3GIGB 3EHJA 2ZKJA 3QTFA 2BSMA 2YJXA 3MNRP 4DUHA 3HZ5A 3ZKDA 1A4HA 3RLRA 1EA6A 2YEGA 3RLQA 2YEAA 4H7QA 4LWGA 1U2OA 4XE2A 3Q5LA 4U7NA 1EI1A 1I59A 4HY6A 2WEPA 1THNA 2XDKA 2Q8HA 4BIUA 4P7AA 3T10A 1ZXNA 4P8OA 4ZVIA 2BU8A 2BRCA 4CE2A 1NHJA 3HHUA 3G7BA 3A0WA 4NH7A 1Y8OA 3JZ3A 3R4OA 2EXLA 2XX2A 2QFOA 3A0XA 4EEHA 1NHIA 2YE5A 1AMWA 2YE2A 3HZ1A 3K98A 4FCPA 2JKIA 1R62A 3GIGA 4CWFA 3CGZA 1YC3A 1AH6A 4BQGA 4AWPA 4L94A 3G7EA 2YK2A 4EFTA 4EGIA 4YKWA 2XJJA 1US7A 3EHGA 5M4NA 5M4KA 2YI0A 4FCRA 2YEEA 1Y4SA 4KSHA 3OMUA 3SL2A 4LWFA 2IOQA 2VCIA 4I3HA 4E01A 1GKXA 5M4HA 3B24A 1UYDA 1B3QA 5CF0A 2YEJA 1QYEA 2WI3A 5C93A 1Z59A 1TIDA 1UYFA 2YE7A 1I58A 4FCQA 4GCZA 2YKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L91 A;  4AWO A;  2O1V A;  2XX5 A;  3ZKB A;  2WEQ A;  4CWP A;  4HZ5 A;  2QG2 A;  2XX4 A;  2XJG A;  4LWE A;  4LWI A;  2FYP A;  3D2R A;  4PL9 A;  3R4P A;  2BU5 A;  3TZ5 A;  4BIZ A;  1B63 A;  3D36 A;  1Y4U A;  3FV5 A;  1YSR A;  1YT2 A;  3B25 A;  2XD6 A;  2UWD A;  2ZBK B;  4V25 A;  3WQ9 A;  4FMT A;  2CG9 A;  2XDS A;  3R91 A;  3LPS A;  1UYL A;  3TZ2 A;  4KP4 A;  5M4M A;  1BXD A;  2FXS A;  4MP7 A;  4LPB A;  3INX A;  4CWQ A;  4CWN A;  4O04 A;  2YI7 A;  2QG0 A;  4YKZ A;  4FPP A;  4O0B A;  2K5B A;  3H4L A;  4H81 A;  3A0T A;  4MOT A;  2JJC A;  4O09 A;  2Q8I A;  3CGY A;  2BU2 A;  3OPD A;  2XHT A;  2BYI A;  4XC0 A;  3CRK A;  5FND A;  1YC1 A;  4XIP A;  4ASF A;  5IDM A;  2Q8F A;  4XIQ A;  2VWC A;  4GFN A;  4JAU A;  2QF6 A;  4U93 A;  3EKO A;  5CPH A;  2CCS A;  5CTW A;  4CWR A;  4XKO A;  4URM A;  2WI7 A;  4O05 A;  5FNC A;  2ZDX A;  3K97 A;  4R1F A;  4NH8 A;  3K60 A;  1OSF A;  3INW A;  3BMY A;  2WER A;  5M4E A;  3D0B A;  5M4P A;  1ZW9 A;  2YEB A;  4AS9 A;  2HCH A;  3B26 A;  4HXW A;  2BTZ A;  2BU7 A;  2YKE A;  4HYM A;  4JAV A;  3T1K A;  3Q5K A;  2XDU A;  1Y8N A;  4HY1 A;  1ZXM A;  3HYZ A;  4Q20 A;  4CWT A;  2WI4 A;  2YKJ A;  2GFD A;  1UYM A;  5J71 A;  1TBW A;  2YI5 A;  1H7S A;  1TC0 A;  3ZXO A;  2YI6 A;  2XHX A;  4YKR A;  3ZM7 A;  4AWQ A;  4YKT A;  3R92 A;  4MPN A;  3VHA A;  2YE6 A;  2BRE A;  4XIR A;  2YGE A;  2YJW A;  4E00 A;  2IOR A;  2CCT A;  1GJV A;  3HYY A;  2XDL A;  2ESA A;  1MU5 A;  1ID0 A;  1AM1 A;  1AJ6 A;  4B7P A;  1AH8 A;  1Z5A A;  3B27 A;  4WUC A;  4HXZ A;  3EHF A;  2YE4 A;  4YKY A;  4ASB A;  2YKB A;  3RLP A;  4MB9 A;  3TUH A;  1I5D A;  3DGE A;  1UYH A;  3VHC A;  3Q5J A;  4BXI A;  4ASG A;  3O0I A;  1UYK A;  3WHA A;  1UY6 A;  4KSG A;  1BGQ A;  2XAB A;  4GT8 A;  4EFU A;  1L0O A;  2HG1 A;  4HZ0 A;  1YES A;  1NHH A;  1YT1 A;  3HEK A;  5GGZ A;  5D6Q A;  4WUD A;  2C2A A;  4EGH A;  4YKU A;  2BYH A;  4E02 A;  3T0H A;  1YET A;  3A0Z A;  5FNF A;  4URO A;  4KQV A;  4DZY A;  1BYQ A;  3T2S A;  4JAS A;  5CTX A;  1ZWH A;  3KE6 A;  3T0Z A;  5F5R A;  2CCU A;  4V26 A;  2YEI A;  3U67 A;  3GIF A;  5D6P A;  3NMQ A;  3OW6 A;  2GQP A;  4GEE A;  4KFG A;  5CTY A;  5D7C A;  1UYI A;  4H85 A;  3B28 A;  1MX0 A;  2H8M A;  4EMV A;  2AKP A;  3K99 A;  3PEH A;  4U7O A;  4PRV A;  2Q2E B;  1U0Z A;  4GGL A;  5D7R A;  1Z5B A;  2XJX A;  2FWZ A;  3FT5 A;  2VW5 A;  4YKX A;  4MPE A;  4URL A;  4R3M A;  3U2D A;  2O1U A;  1H7U A;  3O2F A;  2XDX A;  1S16 A;  4QPK A;  1QY8 A;  4L8Z A;  3TZ0 A;  3VAD A;  2H55 A;  4W7T A;  4L90 A;  4ZKI A;  3C11 A;  2ZDY A;  5CTU A;  3C0E A;  5FWK A;  4XTJ A;  1TH8 A;  2VCJ A;  3TZ4 A;  3G75 A;  1BKN A;  3OWB A;  2BZ5 A;  3U2K A;  3RKZ A;  4EGK A;  2WI1 A;  3EKR A;  3A0R A;  4QPJ A;  4CE3 A;  1UYG A;  4XCJ A;  2E0A A;  3CRL A;  4LP0 A;  5D7D A;  2WI2 A;  4MBC A;  5BOC A;  1KIJ A;  4EM7 A;  4NH9 A;  5BOD A;  4XD8 A;  4HYP A;  4XKK A;  4BAE A;  1I5C A;  3LNU A;  4I5S A;  3EHH A;  3TTZ A;  2WI5 A;  2WI6 A;  3PEJ A;  1S14 A;  2YE3 A;  1I5A A;  1KZN A;  5F3K A;  4YKQ A;  1UY9 A;  4X9L A;  2IWU A;  1UYC A;  5IN9 A;  2CH4 A;  4GQT A;  4O07 A;  3CWV A;  3R4N A;  1Z5C A;  2YE9 A;  1YSZ A;  4URN A;  4XIT A;  2YED A;  1B62 A;  1QZR A;  2BU6 A;  4K4O A;  3FT8 A;  4PU9 A;  3VHD A;  4PRX A;  5IDJ A;  1JM6 A;  1I5B A;  3BM9 A;  1YT0 A;  2IOP A;  4KTN A;  1YS3 A;  2HKJ A;  2YEF A;  2FWY A;  4B6C A;  3R4M A;  2YK9 A;  1YER A;  4XDM A;  3O6O A;  1UY8 A;  2YKC A;  2YEC A;  2XK2 A;  3H80 A;  3GIE A;  4JQL A;  4R3A A;  1GKZ A;  2CGF A;  2YE8 A;  3OWD A;  4L93 A;  4XKA A;  1Y8P A;  3A0Y A;  1YC4 A;  3ZXQ A;  5L3J A;  2PNR A;  2YEH A;  2Q8G A;  4LWH A;  2BT0 A;  2YGA A;  2O1W A;  3QDD A;  5J6A A;  4MP2 A;  1PVG A;  1TC6 A;  2YGF A;  4ASA A;  4CE1 A;  4BQJ A;  2IWX A;  3IED A;  1TIL A;  4XCL A;  4CWS A;  4MPC A;  4CWO A;  2XCM A;  2IWS A;  1UY7 A;  1UYE A;  4WUB A;  2XHR A;  3GIG B;  3EHJ A;  2ZKJ A;  3QTF A;  2BSM A;  2YJX A;  3MNR P;  4DUH A;  3HZ5 A;  3ZKD A;  1A4H A;  3RLR A;  1EA6 A;  2YEG A;  3RLQ A;  2YEA A;  4H7Q A;  4LWG A;  1U2O A;  4XE2 A;  3Q5L A;  4U7N A;  1EI1 A;  1I59 A;  4HY6 A;  2WEP A;  1THN A;  2XDK A;  2Q8H A;  4BIU A;  4P7A A;  3T10 A;  1ZXN A;  4P8O A;  4ZVI A;  2BU8 A;  2BRC A;  4CE2 A;  1NHJ A;  3HHU A;  3G7B A;  3A0W A;  4NH7 A;  1Y8O A;  3JZ3 A;  3R4O A;  2EXL A;  2XX2 A;  2QFO A;  3A0X A;  4EEH A;  1NHI A;  2YE5 A;  1AMW A;  2YE2 A;  3HZ1 A;  3K98 A;  4FCP A;  2JKI A;  1R62 A;  3GIG A;  4CWF A;  3CGZ A;  1YC3 A;  1AH6 A;  4BQG A;  4AWP A;  4L94 A;  3G7E A;  2YK2 A;  4EFT A;  4EGI A;  4YKW A;  2XJJ A;  1US7 A;  3EHG A;  5M4N A;  5M4K A;  2YI0 A;  4FCR A;  2YEE A;  1Y4S A;  4KSH A;  3OMU A;  3SL2 A;  4LWF A;  2IOQ A;  2VCI A;  4I3H A;  4E01 A;  1GKX A;  5M4H A;  3B24 A;  1UYD A;  1B3Q A;  5CF0 A;  2YEJ A;  1QYE A;  2WI3 A;  5C93 A;  1Z59 A;  1TID A;  1UYF A;  2YE7 A;  1I58 A;  4FCQ A;  4GCZ A;  2YKI A; 
#chains in the Genus database with same CATH topology
 4L91 A;  1IXM A;  4AWO A;  2O1V A;  2XX5 A;  3ZKB A;  2WEQ A;  4CWP A;  1F51 A;  4HZ5 A;  2QG2 A;  2XX4 A;  2FTK A;  2XJG A;  4LWE A;  4LWI A;  2FYP A;  3D2R A;  4PL9 A;  3R4P A;  2BU5 A;  3TZ5 A;  4BIZ A;  1B63 A;  3D36 A;  1Y4U A;  3FV5 A;  1YSR A;  1YT2 A;  3B25 A;  2XD6 A;  2UWD A;  2ZBK B;  4V25 A;  3WQ9 A;  4FMT A;  2CG9 A;  2XDS A;  3R91 A;  3LPS A;  1UYL A;  3TZ2 A;  4KP4 A;  5M4M A;  1BXD A;  2FXS A;  4MP7 A;  4LPB A;  3INX A;  4CWQ A;  4CWN A;  4O04 A;  2YI7 A;  2QG0 A;  4YKZ A;  4FPP A;  4O0B A;  2K5B A;  3H4L A;  4H81 A;  3A0T A;  4MOT A;  2JJC A;  4O09 A;  2Q8I A;  3CGY A;  2BU2 A;  3OPD A;  2XHT A;  2BYI A;  4XC0 A;  3CRK A;  5FND A;  1YC1 A;  4XIP A;  4ASF A;  5IDM A;  2Q8F A;  4XIQ A;  2VWC A;  4GFN A;  4JAU A;  2QF6 A;  4U93 A;  3EKO A;  5CPH A;  2CCS A;  5CTW A;  4CWR A;  4XKO A;  4URM A;  2WI7 A;  4O05 A;  5FNC A;  2ZDX A;  3K97 A;  4R1F A;  4NH8 A;  3K60 A;  1OSF A;  3INW A;  3BMY A;  2WER A;  5M4E A;  3D0B A;  5M4P A;  1ZW9 A;  2YEB A;  4AS9 A;  2HCH A;  3B26 A;  4HXW A;  2BTZ A;  2BU7 A;  2YKE A;  4HYM A;  4JAV A;  3T1K A;  3Q5K A;  2XDU A;  1Y8N A;  4HY1 A;  3S5T A;  1ZXM A;  3HYZ A;  4Q20 A;  4CWT A;  2WI4 A;  2YKJ A;  2GFD A;  1UYM A;  5J71 A;  1TBW A;  2C1G A;  2YI5 A;  1H7S A;  1TC0 A;  3ZXO A;  2YI6 A;  2XHX A;  4YKR A;  3ZM7 A;  4AWQ A;  4YKT A;  3R92 A;  4MPN A;  3VHA A;  2YE6 A;  2BRE A;  4XIR A;  2YGE A;  2YJW A;  4E00 A;  2IOR A;  2CCT A;  1GJV A;  3HYY A;  2XDL A;  2ESA A;  1MU5 A;  1ID0 A;  1AM1 A;  1AJ6 A;  4B7P A;  1AH8 A;  1Z5A A;  3B27 A;  4WUC A;  4HXZ A;  3EHF A;  2YE4 A;  4YKY A;  4ASB A;  2YKB A;  3RLP A;  4MB9 A;  3TUH A;  1I5D A;  3DGE A;  1UYH A;  3VHC A;  3Q5J A;  4BXI A;  4ASG A;  3O0I A;  1UYK A;  3WHA A;  1UY6 A;  4KSG A;  1BGQ A;  2XAB A;  4GT8 A;  4EFU A;  1L0O A;  2HG1 A;  4HZ0 A;  1YES A;  1NHH A;  1YT1 A;  3HEK A;  5GGZ A;  5D6Q A;  4WUD A;  2C2A A;  4EGH A;  4YKU A;  2BYH A;  4E02 A;  3T0H A;  1YET A;  3A0Z A;  5FNF A;  4URO A;  4KQV A;  4DZY A;  1BYQ A;  3T2S A;  4JAS A;  5CTX A;  1ZWH A;  3KE6 A;  3T0Z A;  5F5R A;  2CCU A;  4V26 A;  2YEI A;  3U67 A;  3GIF A;  5D6P A;  3NMQ A;  3OW6 A;  2GQP A;  4GEE A;  4KFG A;  5CTY A;  2C1I A;  5D7C A;  1UYI A;  4H85 A;  3B28 A;  1MX0 A;  2H8M A;  4EMV A;  2AKP A;  3K99 A;  3PEH A;  4U7O A;  4PRV A;  2Q2E B;  1U0Z A;  4GGL A;  5D7R A;  1Z5B A;  2XJX A;  2FWZ A;  3FT5 A;  2VW5 A;  4YKX A;  4MPE A;  4URL A;  4R3M A;  3U2D A;  2O1U A;  1H7U A;  3O2F A;  2XDX A;  1S16 A;  4QPK A;  1QY8 A;  4L8Z A;  3TZ0 A;  3VAD A;  2H55 A;  4W7T A;  4L90 A;  4ZKI A;  3C11 A;  2ZDY A;  5CTU A;  3C0E A;  5FWK A;  4XTJ A;  1TH8 A;  2VCJ A;  3TZ4 A;  3G75 A;  1BKN A;  3OWB A;  2BZ5 A;  3U2K A;  3RKZ A;  4EGK A;  2WI1 A;  3EKR A;  3A0R A;  4QPJ A;  4CE3 A;  1UYG A;  4XCJ A;  2E0A A;  3CRL A;  4LP0 A;  5D7D A;  2WI2 A;  4MBC A;  5BOC A;  1KIJ A;  4EM7 A;  4NH9 A;  5BOD A;  4XD8 A;  4HYP A;  4XKK A;  4BAE A;  1I5C A;  3LNU A;  4I5S A;  3EHH A;  3TTZ A;  2WI5 A;  2HHI A;  2WI6 A;  3PEJ A;  1S14 A;  2YE3 A;  1I5A A;  1KZN A;  5F3K A;  4YKQ A;  1UY9 A;  4X9L A;  2IWU A;  1UYC A;  5IN9 A;  2CH4 A;  4GQT A;  4O07 A;  3CWV A;  3R4N A;  1Z5C A;  2YE9 A;  1YSZ A;  4URN A;  4XIT A;  2YED A;  1B62 A;  1QZR A;  2BU6 A;  4K4O A;  3FT8 A;  4PU9 A;  3VHD A;  4PRX A;  5IDJ A;  1JM6 A;  1I5B A;  3BM9 A;  1YT0 A;  2IOP A;  4KTN A;  1YS3 A;  2HKJ A;  2YEF A;  2FWY A;  4B6C A;  3R4M A;  2YK9 A;  1YER A;  4XDM A;  3O6O A;  1UY8 A;  2YKC A;  2YEC A;  2XK2 A;  3H80 A;  3GIE A;  3CYG A;  4JQL A;  4R3A A;  1GKZ A;  2CGF A;  2YE8 A;  3OWD A;  4L93 A;  4XKA A;  1Y8P A;  3A0Y A;  1YC4 A;  3ZXQ A;  5L3J A;  2PNR A;  2YEH A;  2Q8G A;  4LWH A;  2BT0 A;  2YGA A;  2O1W A;  3QDD A;  5J6A A;  4MP2 A;  1PVG A;  1TC6 A;  2YGF A;  4ASA A;  4CE1 A;  4BQJ A;  2IWX A;  3IED A;  1TIL A;  4XCL A;  4CWS A;  4MPC A;  4CWO A;  2XCM A;  2IWS A;  1UY7 A;  1UYE A;  4WUB A;  4E72 A;  2XHR A;  3GIG B;  3EHJ A;  2ZKJ A;  3QTF A;  2BSM A;  2YJX A;  3MNR P;  4DUH A;  3HZ5 A;  3ZKD A;  1A4H A;  3RLR A;  1EA6 A;  2YEG A;  3RLQ A;  2YEA A;  4H7Q A;  4LWG A;  1U2O A;  4XE2 A;  3Q5L A;  4U7N A;  1EI1 A;  1I59 A;  4HY6 A;  2WEP A;  1THN A;  3LMM A;  2XDK A;  2Q8H A;  4BIU A;  4P7A A;  3T10 A;  1ZXN A;  4P8O A;  4ZVI A;  2BU8 A;  2BRC A;  4CE2 A;  1NHJ A;  3HHU A;  5JEN A;  3G7B A;  3A0W A;  4NH7 A;  1Y8O A;  3JZ3 A;  3R4O A;  2EXL A;  2XX2 A;  2QFO A;  3A0X A;  4EEH A;  1NHI A;  2YE5 A;  1AMW A;  2YE2 A;  3HZ1 A;  3K98 A;  4FCP A;  2JKI A;  1R62 A;  3GIG A;  4CWF A;  3CGZ A;  1YC3 A;  1AH6 A;  4BQG A;  4AWP A;  4L94 A;  3G7E A;  2YK2 A;  4EFT A;  4EGI A;  4YKW A;  2XJJ A;  1US7 A;  3EHG A;  5M4N A;  5M4K A;  2YI0 A;  4FCR A;  2YEE A;  1Y4S A;  4KSH A;  3OMU A;  3SL2 A;  4LWF A;  2IOQ A;  2VCI A;  4I3H A;  4E01 A;  1GKX A;  5M4H A;  3B24 A;  1UYD A;  1B3Q A;  5CF0 A;  2YEJ A;  1QYE A;  2WI3 A;  5C93 A;  1Z59 A;  1TID A;  1UYF A;  2YE7 A;  1I58 A;  4FCQ A;  4GCZ A;  2YKI A; 
#chains in the Genus database with same CATH homology
 4L91 A;  4AWO A;  2O1V A;  2XX5 A;  3ZKB A;  2WEQ A;  4CWP A;  4HZ5 A;  2QG2 A;  2XX4 A;  2XJG A;  4LWE A;  4LWI A;  2FYP A;  3D2R A;  4PL9 A;  3R4P A;  2BU5 A;  3TZ5 A;  4BIZ A;  1B63 A;  3D36 A;  1Y4U A;  3FV5 A;  1YSR A;  1YT2 A;  3B25 A;  2XD6 A;  2UWD A;  2ZBK B;  4V25 A;  3WQ9 A;  4FMT A;  2CG9 A;  2XDS A;  3R91 A;  3LPS A;  1UYL A;  3TZ2 A;  4KP4 A;  5M4M A;  1BXD A;  2FXS A;  4MP7 A;  4LPB A;  3INX A;  4CWQ A;  4CWN A;  4O04 A;  2YI7 A;  2QG0 A;  4YKZ A;  4FPP A;  4O0B A;  2K5B A;  3H4L A;  4H81 A;  3A0T A;  4MOT A;  2JJC A;  4O09 A;  2Q8I A;  3CGY A;  2BU2 A;  3OPD A;  2XHT A;  2BYI A;  4XC0 A;  3CRK A;  5FND A;  1YC1 A;  4XIP A;  4ASF A;  5IDM A;  2Q8F A;  4XIQ A;  2VWC A;  4GFN A;  4JAU A;  2QF6 A;  4U93 A;  3EKO A;  5CPH A;  2CCS A;  5CTW A;  4CWR A;  4XKO A;  4URM A;  2WI7 A;  4O05 A;  5FNC A;  2ZDX A;  3K97 A;  4R1F A;  4NH8 A;  3K60 A;  1OSF A;  3INW A;  3BMY A;  2WER A;  5M4E A;  3D0B A;  5M4P A;  1ZW9 A;  2YEB A;  4AS9 A;  2HCH A;  3B26 A;  4HXW A;  2BTZ A;  2BU7 A;  2YKE A;  4HYM A;  4JAV A;  3T1K A;  3Q5K A;  2XDU A;  1Y8N A;  4HY1 A;  1ZXM A;  3HYZ A;  4Q20 A;  4CWT A;  2WI4 A;  2YKJ A;  2GFD A;  1UYM A;  5J71 A;  1TBW A;  2YI5 A;  1H7S A;  1TC0 A;  3ZXO A;  2YI6 A;  2XHX A;  4YKR A;  3ZM7 A;  4AWQ A;  4YKT A;  3R92 A;  4MPN A;  3VHA A;  2YE6 A;  2BRE A;  4XIR A;  2YGE A;  2YJW A;  4E00 A;  2IOR A;  2CCT A;  1GJV A;  3HYY A;  2XDL A;  2ESA A;  1MU5 A;  1ID0 A;  1AM1 A;  1AJ6 A;  4B7P A;  1AH8 A;  1Z5A A;  3B27 A;  4WUC A;  4HXZ A;  3EHF A;  2YE4 A;  4YKY A;  4ASB A;  2YKB A;  3RLP A;  4MB9 A;  3TUH A;  1I5D A;  3DGE A;  1UYH A;  3VHC A;  3Q5J A;  4BXI A;  4ASG A;  3O0I A;  1UYK A;  3WHA A;  1UY6 A;  4KSG A;  1BGQ A;  2XAB A;  4GT8 A;  4EFU A;  1L0O A;  2HG1 A;  4HZ0 A;  1YES A;  1NHH A;  1YT1 A;  3HEK A;  5GGZ A;  5D6Q A;  4WUD A;  2C2A A;  4EGH A;  4YKU A;  2BYH A;  4E02 A;  3T0H A;  1YET A;  3A0Z A;  5FNF A;  4URO A;  4KQV A;  4DZY A;  1BYQ A;  3T2S A;  4JAS A;  5CTX A;  1ZWH A;  3KE6 A;  3T0Z A;  5F5R A;  2CCU A;  4V26 A;  2YEI A;  3U67 A;  3GIF A;  5D6P A;  3NMQ A;  3OW6 A;  2GQP A;  4GEE A;  4KFG A;  5CTY A;  5D7C A;  1UYI A;  4H85 A;  3B28 A;  1MX0 A;  2H8M A;  4EMV A;  2AKP A;  3K99 A;  3PEH A;  4U7O A;  4PRV A;  2Q2E B;  1U0Z A;  4GGL A;  5D7R A;  1Z5B A;  2XJX A;  2FWZ A;  3FT5 A;  2VW5 A;  4YKX A;  4MPE A;  4URL A;  4R3M A;  3U2D A;  2O1U A;  1H7U A;  3O2F A;  2XDX A;  1S16 A;  4QPK A;  1QY8 A;  4L8Z A;  3TZ0 A;  3VAD A;  2H55 A;  4W7T A;  4L90 A;  4ZKI A;  3C11 A;  2ZDY A;  5CTU A;  3C0E A;  5FWK A;  4XTJ A;  1TH8 A;  2VCJ A;  3TZ4 A;  3G75 A;  1BKN A;  3OWB A;  2BZ5 A;  3U2K A;  3RKZ A;  4EGK A;  2WI1 A;  3EKR A;  3A0R A;  4QPJ A;  4CE3 A;  1UYG A;  4XCJ A;  2E0A A;  3CRL A;  4LP0 A;  5D7D A;  2WI2 A;  4MBC A;  5BOC A;  1KIJ A;  4EM7 A;  4NH9 A;  5BOD A;  4XD8 A;  4HYP A;  4XKK A;  4BAE A;  1I5C A;  3LNU A;  4I5S A;  3EHH A;  3TTZ A;  2WI5 A;  2WI6 A;  3PEJ A;  1S14 A;  2YE3 A;  1I5A A;  1KZN A;  5F3K A;  4YKQ A;  1UY9 A;  4X9L A;  2IWU A;  1UYC A;  5IN9 A;  2CH4 A;  4GQT A;  4O07 A;  3CWV A;  3R4N A;  1Z5C A;  2YE9 A;  1YSZ A;  4URN A;  4XIT A;  2YED A;  1B62 A;  1QZR A;  2BU6 A;  4K4O A;  3FT8 A;  4PU9 A;  3VHD A;  4PRX A;  5IDJ A;  1JM6 A;  1I5B A;  3BM9 A;  1YT0 A;  2IOP A;  4KTN A;  1YS3 A;  2HKJ A;  2YEF A;  2FWY A;  4B6C A;  3R4M A;  2YK9 A;  1YER A;  4XDM A;  3O6O A;  1UY8 A;  2YKC A;  2YEC A;  2XK2 A;  3H80 A;  3GIE A;  4JQL A;  4R3A A;  1GKZ A;  2CGF A;  2YE8 A;  3OWD A;  4L93 A;  4XKA A;  1Y8P A;  3A0Y A;  1YC4 A;  3ZXQ A;  5L3J A;  2PNR A;  2YEH A;  2Q8G A;  4LWH A;  2BT0 A;  2YGA A;  2O1W A;  3QDD A;  5J6A A;  4MP2 A;  1PVG A;  1TC6 A;  2YGF A;  4ASA A;  4CE1 A;  4BQJ A;  2IWX A;  3IED A;  1TIL A;  4XCL A;  4CWS A;  4MPC A;  4CWO A;  2XCM A;  2IWS A;  1UY7 A;  1UYE A;  4WUB A;  2XHR A;  3GIG B;  3EHJ A;  2ZKJ A;  3QTF A;  2BSM A;  2YJX A;  3MNR P;  4DUH A;  3HZ5 A;  3ZKD A;  1A4H A;  3RLR A;  1EA6 A;  2YEG A;  3RLQ A;  2YEA A;  4H7Q A;  4LWG A;  1U2O A;  4XE2 A;  3Q5L A;  4U7N A;  1EI1 A;  1I59 A;  4HY6 A;  2WEP A;  1THN A;  2XDK A;  2Q8H A;  4BIU A;  4P7A A;  3T10 A;  1ZXN A;  4P8O A;  4ZVI A;  2BU8 A;  2BRC A;  4CE2 A;  1NHJ A;  3HHU A;  3G7B A;  3A0W A;  4NH7 A;  1Y8O A;  3JZ3 A;  3R4O A;  2EXL A;  2XX2 A;  2QFO A;  3A0X A;  4EEH A;  1NHI A;  2YE5 A;  1AMW A;  2YE2 A;  3HZ1 A;  3K98 A;  4FCP A;  2JKI A;  1R62 A;  3GIG A;  4CWF A;  3CGZ A;  1YC3 A;  1AH6 A;  4BQG A;  4AWP A;  4L94 A;  3G7E A;  2YK2 A;  4EFT A;  4EGI A;  4YKW A;  2XJJ A;  1US7 A;  3EHG A;  5M4N A;  5M4K A;  2YI0 A;  4FCR A;  2YEE A;  1Y4S A;  4KSH A;  3OMU A;  3SL2 A;  4LWF A;  2IOQ A;  2VCI A;  4I3H A;  4E01 A;  1GKX A;  5M4H A;  3B24 A;  1UYD A;  1B3Q A;  5CF0 A;  2YEJ A;  1QYE A;  2WI3 A;  5C93 A;  1Z59 A;  1TID A;  1UYF A;  2YE7 A;  1I58 A;  4FCQ A;  4GCZ A;  2YKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...