4P8OA

S. aureus gyrase bound to an aminobenzimidazole urea inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
184
structure length
184
Chain Sequence
GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Second-generation antibacterial benzimidazole ureas: discovery of a preclinical candidate with reduced metabolic liability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
molecule keywords DNA gyrase subunit B
total genus 57
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4p8oA00
4EMVA 4NH9A 1U0ZA 1YC3A 3INXA 3HEKA 4ASAA 3OWDA 1NHIA 1I58A 2YGEA 5D7RA 2YJXA 4EFTA 4L93A 1Y8OA 4R3AA 3K99A 2XJXA 3OMUA 4HXWA 4ASFA 2QG0A 1Y4UA 1YT0A 4R3MA 4CWNA 4FCRA 2GFDA 3TZ4A 2ZDYA 1ID0A 3IEDA 3MNRP 4PU9A 1Z59A 2BT0A 2CH4A 4YKZA 1NHHA 1YSZA 2CGFA 1MU5A 4U7OA 1GKXA 4YKWA 2CG9A 4BIUA 4KQVA 4XKOA 3B26A 4H85A 5CTYA 4GT8A 3T0ZA 3WQ9A 2YECA 4XIPA 1I5AA 4AWQA 3EKRA 4HYMA 3RLRA 4H81A 1L0OA 3O0IA 2UWDA 3T2SA 4E00A 3RKZA 4WUCA 2FYPA 4O0BA 2YE4A 2FWZA 3TZ2A 3A0RA 5M4HA 3R4NA 3T10A 4LWGA 2YI7A 2YI5A 4L8ZA 2YEJA 2YEDA 4I3HA 5M4EA 2YKCA 4FMTA 2BTZA 5FNFA 4JAUA 5D6QA 1US7A 2WI2A 4ASGA 5CTUA 1AMWA 4BAEA 2YI0A 5M4MA 1BGQA 3U2KA 1TBWA 1YS3A 3B28A 2YGAA 1UYDA 1I5CA 1YESA 4CE3A 5CF0A 3NMQA 5D7CA 1A4HA 3U2DA 2YEGA 4P8OA 3D36A 3TTZA 1GJVA 5D7DA 4O05A 4EM7A 1Z5AA 2XDXA 2WI4A 4URMA 4CWTA 1EA6A 2CCSA 3BMYA 4GEEA 4NH8A 2XD6A 3H80A 4FCPA 1YT1A 4XTJA 2YE6A 3A0ZA 1UYFA 2VCJA 3RLQA 1PVGA 4L90A 5C93A 3EHFA 2K5BA 4CWQA 2XJJA 4W7TA 4XKAA 4EEHA 2WI1A 4LWIA 3CRKA 3Q5KA 3VADA 3U67A 3VHCA 4BIZA 1UYMA 1EI1A 3FT5A 3ZXQA 4LPBA 2Q8GA 3CRLA 3G7BA 5M4PA 2VWCA 3A0YA 4YKRA 1U2OA 2QFOA 2YEFA 4XC0A 3HYYA 1AM1A 2ZBKB 4R1FA 2XCMA 4DUHA 2XHXA 4XKKA 1I5BA 2WEPA 1YT2A 5CPHA 3QTFA 4CWFA 4EGHA 2IWUA 1Y8PA 2XDLA 4URLA 1B63A 2YE8A 4GGLA 3GIGB 3ZXOA 4I5SA 2YK2A 2WI5A 3TUHA 2VW5A 2XX5A 4LWEA 4GQTA 2YJWA 4JAVA 2XDSA 4KFGA 4EFUA 4MB9A 1TILA 2WI7A 2XK2A 2HKJA 4HY6A 2IWXA 2IWSA 2VCIA 2HCHA 2E0AA 1I5DA 4X9LA 4CE2A 4PRVA 2XX2A 2ZKJA 3VHAA 4XCLA 3EKOA 4QPJA 3R4MA 2YE5A 3LPSA 1ZXNA 4UROA 5IDMA 4DZYA 4H7QA 2Q8FA 4XIQA 3T1KA 3O6OA 4HXZA 4MPNA 4MBCA 1TC0A 1BXDA 3C0EA 2O1VA 2ZDXA 2YI6A 3GIEA 2IOQA 1ZWHA 4MP7A 4PRXA 5CTXA 3Q5JA 1QZRA 4U93A 2FXSA 3HHUA 1AH6A 4CWPA 1UYHA 1Y8NA 5F3KA 3RLPA 3T0HA 4MPEA 4HY1A 4URNA 1Z5BA 2IORA 4CWOA 3SL2A 1YC1A 3ZKBA 2JKIA 4MP2A 4Q20A 2YKEA 1TIDA 1KZNA 3EHGA 3G7EA 1UY7A 2XHTA 3H4LA 2XDUA 3C11A 4CWRA 2CCUA 4MPCA 3ZM7A 1YETA 3FT8A 3CGYA 4E02A 4XITA 4BQGA 4HYPA 1AJ6A 4CE1A 3K98A 2YE7A 5F5RA 1YC4A 1TC6A 3D2RA 2BU6A 4FCQA 3O2FA 4E01A 2YE3A 3EHJA 4FPPA 4LWFA 3A0WA 1MX0A 2XABA 2BREA 2C2AA 2O1WA 1QYEA 2WEQA 3CWVA 4AS9A 1ZW9A 1UYIA 4KTNA 2YE2A 5IN9A 4EGIA 2XX4A 2QF6A 4AWPA 3OWBA 4HZ5A 4WUBA 2XDKA 5J6AA 4NH7A 4O07A 4XD8A 5FWKA 3R92A 3JZ3A 1YERA 4XE2A 3PEHA 3GIGA 4YKTA 3OW6A 4O04A 4PL9A 2BSMA 4B6CA 2YKBA 5J71A 2JJCA 3QDDA 2BZ5A 5BODA 3HZ5A 3EHHA 1ZXMA 3VHDA 2YEAA 4HZ0A 2PNRA 2CCTA 4MOTA 4AWOA 1KIJA 1H7SA 3BM9A 1QY8A 2YGFA 2YKIA 2BU8A 2HG1A 1TH8A 2BRCA 2BU7A 4JASA 4YKXA 3FV5A 3ZKDA 2WI3A 4XDMA 3TZ0A 4KSGA 3DGEA 2BYHA 5FNDA 2YE9A 4XCJA 3D0BA 3CGZA 2YKJA 1UYCA 3GIFA 2BU2A 1S14A 1Z5CA 1B3QA 5BOCA 2FWYA 4KP4A 1UYKA 3HZ1A 3R4OA 2BU5A 4V26A 4O09A 5GGZA 3WHAA 3R4PA 1UYEA 4LWHA 4L91A 4XIRA 4L94A 4YKQA 1THNA 2Q8HA 1UY9A 2H8MA 1BKNA 4YKUA 2H55A 2YK9A 3KE6A 1UY6A 5IDJA 2Q2EB 3OPDA 2EXLA 3LNUA 5CTWA 2WERA 4BXIA 4BQJA 2O1UA 1NHJA 3B25A 3B27A 4P7AA 3K97A 2BYIA 4WUDA 1JM6A 1H7UA 1GKZA 3PEJA 3G75A 5D6PA 3R91A 1BYQA 4ASBA 2AKPA 2GQPA 2WI6A 4ZVIA 2YEBA 4QPKA 3K60A 1UYLA 1AH8A 4ZKIA 2ESAA 4U7NA 2YEIA 4GFNA 3TZ5A 4KSHA 4LP0A 1R62A 1Y4SA 4B7PA 4JQLA 3INWA 1UYGA 3HYZA 5M4KA 2IOPA 4V25A 1OSFA 2YEHA 5FNCA 4EGKA 3A0XA 2YEEA 4GCZA 4YKYA 3Q5LA 1I59A 5M4NA 1YSRA 2XHRA 2Q8IA 3B24A 5L3JA 2XJGA 4CWSA 4K4OA 2QG2A 1B62A 1UY8A 3A0TA 1S16A
chains in the Genus database with same CATH superfamily
4EMVA 4NH9A 1U0ZA 1YC3A 3INXA 3HEKA 4ASAA 3OWDA 1NHIA 1I58A 2YGEA 5D7RA 2YJXA 4EFTA 4L93A 1Y8OA 4R3AA 3K99A 2XJXA 3OMUA 4HXWA 4ASFA 2QG0A 1Y4UA 1YT0A 4R3MA 4CWNA 4FCRA 2GFDA 3TZ4A 2ZDYA 1ID0A 3IEDA 3MNRP 4PU9A 1Z59A 2BT0A 2CH4A 4YKZA 1NHHA 1YSZA 2CGFA 1MU5A 4U7OA 1GKXA 4YKWA 2CG9A 4BIUA 4KQVA 4XKOA 3B26A 4H85A 5CTYA 4GT8A 3T0ZA 3WQ9A 2YECA 4XIPA 1I5AA 4AWQA 3EKRA 4HYMA 3RLRA 4H81A 1L0OA 3O0IA 2UWDA 3T2SA 4E00A 3RKZA 4WUCA 2FYPA 4O0BA 2YE4A 2FWZA 3TZ2A 3A0RA 5M4HA 3R4NA 3T10A 4LWGA 2YI7A 2YI5A 4L8ZA 2YEJA 2YEDA 4I3HA 5M4EA 2YKCA 4FMTA 2BTZA 5FNFA 4JAUA 4E72A 5D6QA 1US7A 2WI2A 4ASGA 5CTUA 1AMWA 4BAEA 2YI0A 5M4MA 1BGQA 3U2KA 1TBWA 1YS3A 3B28A 2YGAA 1UYDA 1I5CA 1YESA 4CE3A 5CF0A 3NMQA 5D7CA 1A4HA 3U2DA 2YEGA 3LMMA 4P8OA 3D36A 1F51A 3TTZA 1GJVA 5D7DA 4O05A 4EM7A 1Z5AA 2XDXA 2WI4A 4URMA 4CWTA 2FTKA 1EA6A 2CCSA 3BMYA 4GEEA 4NH8A 2XD6A 3H80A 4FCPA 1YT1A 4XTJA 2YE6A 3A0ZA 1UYFA 2VCJA 3RLQA 1PVGA 4L90A 5C93A 3EHFA 2K5BA 3S5TA 4CWQA 2XJJA 4W7TA 4XKAA 4EEHA 2WI1A 4LWIA 3CRKA 3Q5KA 3VADA 3U67A 3VHCA 4BIZA 1UYMA 1EI1A 1IXMA 3FT5A 3ZXQA 4LPBA 2Q8GA 3CRLA 3G7BA 5M4PA 2VWCA 3A0YA 4YKRA 1U2OA 2QFOA 2YEFA 4XC0A 3HYYA 1AM1A 2ZBKB 4R1FA 2XCMA 4DUHA 2XHXA 4XKKA 1I5BA 2WEPA 1YT2A 5CPHA 3QTFA 4CWFA 4EGHA 2IWUA 1Y8PA 2XDLA 4URLA 1B63A 2YE8A 4GGLA 3GIGB 3ZXOA 4I5SA 2YK2A 2WI5A 3TUHA 2VW5A 2XX5A 4LWEA 4GQTA 2YJWA 4JAVA 2XDSA 4KFGA 4EFUA 4MB9A 1TILA 2WI7A 2XK2A 2HKJA 4HY6A 2IWXA 2IWSA 2VCIA 2HCHA 2E0AA 1I5DA 3CYGA 4X9LA 4CE2A 4PRVA 2XX2A 2ZKJA 3VHAA 4XCLA 3EKOA 4QPJA 3R4MA 2YE5A 3LPSA 1ZXNA 4UROA 5IDMA 4DZYA 4H7QA 2Q8FA 4XIQA 3T1KA 3O6OA 4HXZA 4MPNA 4MBCA 1TC0A 1BXDA 3C0EA 2O1VA 2ZDXA 2YI6A 3GIEA 2IOQA 1ZWHA 4MP7A 4PRXA 5CTXA 3Q5JA 1QZRA 4U93A 2FXSA 3HHUA 1AH6A 4CWPA 1UYHA 1Y8NA 5F3KA 3RLPA 3T0HA 4MPEA 4HY1A 4URNA 1Z5BA 2IORA 4CWOA 3SL2A 1YC1A 3ZKBA 2JKIA 4MP2A 4Q20A 2YKEA 1TIDA 1KZNA 3EHGA 5JENA 3G7EA 1UY7A 2XHTA 3H4LA 2XDUA 3C11A 4CWRA 2CCUA 4MPCA 3ZM7A 1YETA 3FT8A 3CGYA 4E02A 4XITA 4BQGA 4HYPA 1AJ6A 4CE1A 3K98A 2YE7A 5F5RA 1YC4A 1TC6A 3D2RA 2BU6A 4FCQA 3O2FA 4E01A 2YE3A 3EHJA 4FPPA 4LWFA 3A0WA 1MX0A 2XABA 2BREA 2C2AA 2O1WA 1QYEA 2WEQA 3CWVA 4AS9A 1ZW9A 1UYIA 4KTNA 2YE2A 5IN9A 4EGIA 2XX4A 2QF6A 4AWPA 3OWBA 4HZ5A 4WUBA 2XDKA 5J6AA 4NH7A 4O07A 4XD8A 5FWKA 3R92A 3JZ3A 1YERA 4XE2A 3PEHA 3GIGA 4YKTA 3OW6A 4O04A 4PL9A 2BSMA 4B6CA 2C1GA 2YKBA 5J71A 2JJCA 3QDDA 2BZ5A 5BODA 3HZ5A 3EHHA 1ZXMA 3VHDA 2YEAA 4HZ0A 2PNRA 2CCTA 4MOTA 4AWOA 1KIJA 1H7SA 3BM9A 1QY8A 2YGFA 2YKIA 2BU8A 2HG1A 1TH8A 2BRCA 2BU7A 4JASA 4YKXA 3FV5A 3ZKDA 2WI3A 4XDMA 3TZ0A 4KSGA 3DGEA 2BYHA 5FNDA 2YE9A 4XCJA 3D0BA 2HHIA 3CGZA 2YKJA 1UYCA 3GIFA 2BU2A 1S14A 1Z5CA 1B3QA 5BOCA 2FWYA 4KP4A 1UYKA 3HZ1A 3R4OA 2BU5A 4V26A 4O09A 5GGZA 3WHAA 3R4PA 1UYEA 4LWHA 4L91A 4XIRA 4L94A 4YKQA 1THNA 2Q8HA 1UY9A 2H8MA 1BKNA 4YKUA 2H55A 2YK9A 3KE6A 1UY6A 5IDJA 2Q2EB 3OPDA 2EXLA 3LNUA 5CTWA 2WERA 4BXIA 4BQJA 2O1UA 1NHJA 3B25A 3B27A 4P7AA 2C1IA 3K97A 2BYIA 4WUDA 1JM6A 1H7UA 1GKZA 3PEJA 3G75A 5D6PA 3R91A 1BYQA 4ASBA 2AKPA 2GQPA 2WI6A 4ZVIA 2YEBA 4QPKA 3K60A 1UYLA 1AH8A 4ZKIA 2ESAA 4U7NA 2YEIA 4GFNA 3TZ5A 4KSHA 4LP0A 1R62A 1Y4SA 4B7PA 4JQLA 3INWA 1UYGA 3HYZA 5M4KA 2IOPA 4V25A 1OSFA 2YEHA 5FNCA 4EGKA 3A0XA 2YEEA 4GCZA 4YKYA 3Q5LA 1I59A 5M4NA 1YSRA 2XHRA 2Q8IA 3B24A 5L3JA 2XJGA 4CWSA 4K4OA 2QG2A 1B62A 1UY8A 3A0TA 1S16A
chains in the Genus database with same CATH topology
4EMVA 4NH9A 1U0ZA 1YC3A 3INXA 3HEKA 4ASAA 3OWDA 1NHIA 1I58A 2YGEA 5D7RA 2YJXA 4EFTA 4L93A 1Y8OA 4R3AA 3K99A 2XJXA 3OMUA 4HXWA 4ASFA 2QG0A 1Y4UA 1YT0A 4R3MA 4CWNA 4FCRA 2GFDA 3TZ4A 2ZDYA 1ID0A 3IEDA 3MNRP 4PU9A 1Z59A 2BT0A 2CH4A 4YKZA 1NHHA 1YSZA 2CGFA 1MU5A 4U7OA 1GKXA 4YKWA 2CG9A 4BIUA 4KQVA 4XKOA 3B26A 4H85A 5CTYA 4GT8A 3T0ZA 3WQ9A 2YECA 4XIPA 1I5AA 4AWQA 3EKRA 4HYMA 3RLRA 4H81A 1L0OA 3O0IA 2UWDA 3T2SA 4E00A 3RKZA 4WUCA 2FYPA 4O0BA 2YE4A 2FWZA 3TZ2A 3A0RA 5M4HA 3R4NA 3T10A 4LWGA 2YI7A 2YI5A 4L8ZA 2YEJA 2YEDA 4I3HA 5M4EA 2YKCA 4FMTA 2BTZA 5FNFA 4JAUA 5D6QA 1US7A 2WI2A 4ASGA 5CTUA 1AMWA 4BAEA 2YI0A 5M4MA 1BGQA 3U2KA 1TBWA 1YS3A 3B28A 2YGAA 1UYDA 1I5CA 1YESA 4CE3A 5CF0A 3NMQA 5D7CA 1A4HA 3U2DA 2YEGA 4P8OA 3D36A 3TTZA 1GJVA 5D7DA 4O05A 4EM7A 1Z5AA 2XDXA 2WI4A 4URMA 4CWTA 1EA6A 2CCSA 3BMYA 4GEEA 4NH8A 2XD6A 3H80A 4FCPA 1YT1A 4XTJA 2YE6A 3A0ZA 1UYFA 2VCJA 3RLQA 1PVGA 4L90A 5C93A 3EHFA 2K5BA 4CWQA 2XJJA 4W7TA 4XKAA 4EEHA 2WI1A 4LWIA 3CRKA 3Q5KA 3VADA 3U67A 3VHCA 4BIZA 1UYMA 1EI1A 3FT5A 3ZXQA 4LPBA 2Q8GA 3CRLA 3G7BA 5M4PA 2VWCA 3A0YA 4YKRA 1U2OA 2QFOA 2YEFA 4XC0A 3HYYA 1AM1A 2ZBKB 4R1FA 2XCMA 4DUHA 2XHXA 4XKKA 1I5BA 2WEPA 1YT2A 5CPHA 3QTFA 4CWFA 4EGHA 2IWUA 1Y8PA 2XDLA 4URLA 1B63A 2YE8A 4GGLA 3GIGB 3ZXOA 4I5SA 2YK2A 2WI5A 3TUHA 2VW5A 2XX5A 4LWEA 4GQTA 2YJWA 4JAVA 2XDSA 4KFGA 4EFUA 4MB9A 1TILA 2WI7A 2XK2A 2HKJA 4HY6A 2IWXA 2IWSA 2VCIA 2HCHA 2E0AA 1I5DA 4X9LA 4CE2A 4PRVA 2XX2A 2ZKJA 3VHAA 4XCLA 3EKOA 4QPJA 3R4MA 2YE5A 3LPSA 1ZXNA 4UROA 5IDMA 4DZYA 4H7QA 2Q8FA 4XIQA 3T1KA 3O6OA 4HXZA 4MPNA 4MBCA 1TC0A 1BXDA 3C0EA 2O1VA 2ZDXA 2YI6A 3GIEA 2IOQA 1ZWHA 4MP7A 4PRXA 5CTXA 3Q5JA 1QZRA 4U93A 2FXSA 3HHUA 1AH6A 4CWPA 1UYHA 1Y8NA 5F3KA 3RLPA 3T0HA 4MPEA 4HY1A 4URNA 1Z5BA 2IORA 4CWOA 3SL2A 1YC1A 3ZKBA 2JKIA 4MP2A 4Q20A 2YKEA 1TIDA 1KZNA 3EHGA 3G7EA 1UY7A 2XHTA 3H4LA 2XDUA 3C11A 4CWRA 2CCUA 4MPCA 3ZM7A 1YETA 3FT8A 3CGYA 4E02A 4XITA 4BQGA 4HYPA 1AJ6A 4CE1A 3K98A 2YE7A 5F5RA 1YC4A 1TC6A 3D2RA 2BU6A 4FCQA 3O2FA 4E01A 2YE3A 3EHJA 4FPPA 4LWFA 3A0WA 1MX0A 2XABA 2BREA 2C2AA 2O1WA 1QYEA 2WEQA 3CWVA 4AS9A 1ZW9A 1UYIA 4KTNA 2YE2A 5IN9A 4EGIA 2XX4A 2QF6A 4AWPA 3OWBA 4HZ5A 4WUBA 2XDKA 5J6AA 4NH7A 4O07A 4XD8A 5FWKA 3R92A 3JZ3A 1YERA 4XE2A 3PEHA 3GIGA 4YKTA 3OW6A 4O04A 4PL9A 2BSMA 4B6CA 2YKBA 5J71A 2JJCA 3QDDA 2BZ5A 5BODA 3HZ5A 3EHHA 1ZXMA 3VHDA 2YEAA 4HZ0A 2PNRA 2CCTA 4MOTA 4AWOA 1KIJA 1H7SA 3BM9A 1QY8A 2YGFA 2YKIA 2BU8A 2HG1A 1TH8A 2BRCA 2BU7A 4JASA 4YKXA 3FV5A 3ZKDA 2WI3A 4XDMA 3TZ0A 4KSGA 3DGEA 2BYHA 5FNDA 2YE9A 4XCJA 3D0BA 3CGZA 2YKJA 1UYCA 3GIFA 2BU2A 1S14A 1Z5CA 1B3QA 5BOCA 2FWYA 4KP4A 1UYKA 3HZ1A 3R4OA 2BU5A 4V26A 4O09A 5GGZA 3WHAA 3R4PA 1UYEA 4LWHA 4L91A 4XIRA 4L94A 4YKQA 1THNA 2Q8HA 1UY9A 2H8MA 1BKNA 4YKUA 2H55A 2YK9A 3KE6A 1UY6A 5IDJA 2Q2EB 3OPDA 2EXLA 3LNUA 5CTWA 2WERA 4BXIA 4BQJA 2O1UA 1NHJA 3B25A 3B27A 4P7AA 3K97A 2BYIA 4WUDA 1JM6A 1H7UA 1GKZA 3PEJA 3G75A 5D6PA 3R91A 1BYQA 4ASBA 2AKPA 2GQPA 2WI6A 4ZVIA 2YEBA 4QPKA 3K60A 1UYLA 1AH8A 4ZKIA 2ESAA 4U7NA 2YEIA 4GFNA 3TZ5A 4KSHA 4LP0A 1R62A 1Y4SA 4B7PA 4JQLA 3INWA 1UYGA 3HYZA 5M4KA 2IOPA 4V25A 1OSFA 2YEHA 5FNCA 4EGKA 3A0XA 2YEEA 4GCZA 4YKYA 3Q5LA 1I59A 5M4NA 1YSRA 2XHRA 2Q8IA 3B24A 5L3JA 2XJGA 4CWSA 4K4OA 2QG2A 1B62A 1UY8A 3A0TA 1S16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMV A;  4NH9 A;  1U0Z A;  1YC3 A;  3INX A;  3HEK A;  4ASA A;  3OWD A;  1NHI A;  1I58 A;  2YGE A;  5D7R A;  2YJX A;  4EFT A;  4L93 A;  1Y8O A;  4R3A A;  3K99 A;  2XJX A;  3OMU A;  4HXW A;  4ASF A;  2QG0 A;  1Y4U A;  1YT0 A;  4R3M A;  4CWN A;  4FCR A;  2GFD A;  3TZ4 A;  2ZDY A;  1ID0 A;  3IED A;  3MNR P;  4PU9 A;  1Z59 A;  2BT0 A;  2CH4 A;  4YKZ A;  1NHH A;  1YSZ A;  2CGF A;  1MU5 A;  4U7O A;  1GKX A;  4YKW A;  2CG9 A;  4BIU A;  4KQV A;  4XKO A;  3B26 A;  4H85 A;  5CTY A;  4GT8 A;  3T0Z A;  3WQ9 A;  2YEC A;  4XIP A;  1I5A A;  4AWQ A;  3EKR A;  4HYM A;  3RLR A;  4H81 A;  1L0O A;  3O0I A;  2UWD A;  3T2S A;  4E00 A;  3RKZ A;  4WUC A;  2FYP A;  4O0B A;  2YE4 A;  2FWZ A;  3TZ2 A;  3A0R A;  5M4H A;  3R4N A;  3T10 A;  4LWG A;  2YI7 A;  2YI5 A;  4L8Z A;  2YEJ A;  2YED A;  4I3H A;  5M4E A;  2YKC A;  4FMT A;  2BTZ A;  5FNF A;  4JAU A;  5D6Q A;  1US7 A;  2WI2 A;  4ASG A;  5CTU A;  1AMW A;  4BAE A;  2YI0 A;  5M4M A;  1BGQ A;  3U2K A;  1TBW A;  1YS3 A;  3B28 A;  2YGA A;  1UYD A;  1I5C A;  1YES A;  4CE3 A;  5CF0 A;  3NMQ A;  5D7C A;  1A4H A;  3U2D A;  2YEG A;  4P8O A;  3D36 A;  3TTZ A;  1GJV A;  5D7D A;  4O05 A;  4EM7 A;  1Z5A A;  2XDX A;  2WI4 A;  4URM A;  4CWT A;  1EA6 A;  2CCS A;  3BMY A;  4GEE A;  4NH8 A;  2XD6 A;  3H80 A;  4FCP A;  1YT1 A;  4XTJ A;  2YE6 A;  3A0Z A;  1UYF A;  2VCJ A;  3RLQ A;  1PVG A;  4L90 A;  5C93 A;  3EHF A;  2K5B A;  4CWQ A;  2XJJ A;  4W7T A;  4XKA A;  4EEH A;  2WI1 A;  4LWI A;  3CRK A;  3Q5K A;  3VAD A;  3U67 A;  3VHC A;  4BIZ A;  1UYM A;  1EI1 A;  3FT5 A;  3ZXQ A;  4LPB A;  2Q8G A;  3CRL A;  3G7B A;  5M4P A;  2VWC A;  3A0Y A;  4YKR A;  1U2O A;  2QFO A;  2YEF A;  4XC0 A;  3HYY A;  1AM1 A;  2ZBK B;  4R1F A;  2XCM A;  4DUH A;  2XHX A;  4XKK A;  1I5B A;  2WEP A;  1YT2 A;  5CPH A;  3QTF A;  4CWF A;  4EGH A;  2IWU A;  1Y8P A;  2XDL A;  4URL A;  1B63 A;  2YE8 A;  4GGL A;  3GIG B;  3ZXO A;  4I5S A;  2YK2 A;  2WI5 A;  3TUH A;  2VW5 A;  2XX5 A;  4LWE A;  4GQT A;  2YJW A;  4JAV A;  2XDS A;  4KFG A;  4EFU A;  4MB9 A;  1TIL A;  2WI7 A;  2XK2 A;  2HKJ A;  4HY6 A;  2IWX A;  2IWS A;  2VCI A;  2HCH A;  2E0A A;  1I5D A;  4X9L A;  4CE2 A;  4PRV A;  2XX2 A;  2ZKJ A;  3VHA A;  4XCL A;  3EKO A;  4QPJ A;  3R4M A;  2YE5 A;  3LPS A;  1ZXN A;  4URO A;  5IDM A;  4DZY A;  4H7Q A;  2Q8F A;  4XIQ A;  3T1K A;  3O6O A;  4HXZ A;  4MPN A;  4MBC A;  1TC0 A;  1BXD A;  3C0E A;  2O1V A;  2ZDX A;  2YI6 A;  3GIE A;  2IOQ A;  1ZWH A;  4MP7 A;  4PRX A;  5CTX A;  3Q5J A;  1QZR A;  4U93 A;  2FXS A;  3HHU A;  1AH6 A;  4CWP A;  1UYH A;  1Y8N A;  5F3K A;  3RLP A;  3T0H A;  4MPE A;  4HY1 A;  4URN A;  1Z5B A;  2IOR A;  4CWO A;  3SL2 A;  1YC1 A;  3ZKB A;  2JKI A;  4MP2 A;  4Q20 A;  2YKE A;  1TID A;  1KZN A;  3EHG A;  3G7E A;  1UY7 A;  2XHT A;  3H4L A;  2XDU A;  3C11 A;  4CWR A;  2CCU A;  4MPC A;  3ZM7 A;  1YET A;  3FT8 A;  3CGY A;  4E02 A;  4XIT A;  4BQG A;  4HYP A;  1AJ6 A;  4CE1 A;  3K98 A;  2YE7 A;  5F5R A;  1YC4 A;  1TC6 A;  3D2R A;  2BU6 A;  4FCQ A;  3O2F A;  4E01 A;  2YE3 A;  3EHJ A;  4FPP A;  4LWF A;  3A0W A;  1MX0 A;  2XAB A;  2BRE A;  2C2A A;  2O1W A;  1QYE A;  2WEQ A;  3CWV A;  4AS9 A;  1ZW9 A;  1UYI A;  4KTN A;  2YE2 A;  5IN9 A;  4EGI A;  2XX4 A;  2QF6 A;  4AWP A;  3OWB A;  4HZ5 A;  4WUB A;  2XDK A;  5J6A A;  4NH7 A;  4O07 A;  4XD8 A;  5FWK A;  3R92 A;  3JZ3 A;  1YER A;  4XE2 A;  3PEH A;  3GIG A;  4YKT A;  3OW6 A;  4O04 A;  4PL9 A;  2BSM A;  4B6C A;  2YKB A;  5J71 A;  2JJC A;  3QDD A;  2BZ5 A;  5BOD A;  3HZ5 A;  3EHH A;  1ZXM A;  3VHD A;  2YEA A;  4HZ0 A;  2PNR A;  2CCT A;  4MOT A;  4AWO A;  1KIJ A;  1H7S A;  3BM9 A;  1QY8 A;  2YGF A;  2YKI A;  2BU8 A;  2HG1 A;  1TH8 A;  2BRC A;  2BU7 A;  4JAS A;  4YKX A;  3FV5 A;  3ZKD A;  2WI3 A;  4XDM A;  3TZ0 A;  4KSG A;  3DGE A;  2BYH A;  5FND A;  2YE9 A;  4XCJ A;  3D0B A;  3CGZ A;  2YKJ A;  1UYC A;  3GIF A;  2BU2 A;  1S14 A;  1Z5C A;  1B3Q A;  5BOC A;  2FWY A;  4KP4 A;  1UYK A;  3HZ1 A;  3R4O A;  2BU5 A;  4V26 A;  4O09 A;  5GGZ A;  3WHA A;  3R4P A;  1UYE A;  4LWH A;  4L91 A;  4XIR A;  4L94 A;  4YKQ A;  1THN A;  2Q8H A;  1UY9 A;  2H8M A;  1BKN A;  4YKU A;  2H55 A;  2YK9 A;  3KE6 A;  1UY6 A;  5IDJ A;  2Q2E B;  3OPD A;  2EXL A;  3LNU A;  5CTW A;  2WER A;  4BXI A;  4BQJ A;  2O1U A;  1NHJ A;  3B25 A;  3B27 A;  4P7A A;  3K97 A;  2BYI A;  4WUD A;  1JM6 A;  1H7U A;  1GKZ A;  3PEJ A;  3G75 A;  5D6P A;  3R91 A;  1BYQ A;  4ASB A;  2AKP A;  2GQP A;  2WI6 A;  4ZVI A;  2YEB A;  4QPK A;  3K60 A;  1UYL A;  1AH8 A;  4ZKI A;  2ESA A;  4U7N A;  2YEI A;  4GFN A;  3TZ5 A;  4KSH A;  4LP0 A;  1R62 A;  1Y4S A;  4B7P A;  4JQL A;  3INW A;  1UYG A;  3HYZ A;  5M4K A;  2IOP A;  4V25 A;  1OSF A;  2YEH A;  5FNC A;  4EGK A;  3A0X A;  2YEE A;  4GCZ A;  4YKY A;  3Q5L A;  1I59 A;  5M4N A;  1YSR A;  2XHR A;  2Q8I A;  3B24 A;  5L3J A;  2XJG A;  4CWS A;  4K4O A;  2QG2 A;  1B62 A;  1UY8 A;  3A0T A;  1S16 A; 
#chains in the Genus database with same CATH topology
 4EMV A;  4NH9 A;  1U0Z A;  1YC3 A;  3INX A;  3HEK A;  4ASA A;  3OWD A;  1NHI A;  1I58 A;  2YGE A;  5D7R A;  2YJX A;  4EFT A;  4L93 A;  1Y8O A;  4R3A A;  3K99 A;  2XJX A;  3OMU A;  4HXW A;  4ASF A;  2QG0 A;  1Y4U A;  1YT0 A;  4R3M A;  4CWN A;  4FCR A;  2GFD A;  3TZ4 A;  2ZDY A;  1ID0 A;  3IED A;  3MNR P;  4PU9 A;  1Z59 A;  2BT0 A;  2CH4 A;  4YKZ A;  1NHH A;  1YSZ A;  2CGF A;  1MU5 A;  4U7O A;  1GKX A;  4YKW A;  2CG9 A;  4BIU A;  4KQV A;  4XKO A;  3B26 A;  4H85 A;  5CTY A;  4GT8 A;  3T0Z A;  3WQ9 A;  2YEC A;  4XIP A;  1I5A A;  4AWQ A;  3EKR A;  4HYM A;  3RLR A;  4H81 A;  1L0O A;  3O0I A;  2UWD A;  3T2S A;  4E00 A;  3RKZ A;  4WUC A;  2FYP A;  4O0B A;  2YE4 A;  2FWZ A;  3TZ2 A;  3A0R A;  5M4H A;  3R4N A;  3T10 A;  4LWG A;  2YI7 A;  2YI5 A;  4L8Z A;  2YEJ A;  2YED A;  4I3H A;  5M4E A;  2YKC A;  4FMT A;  2BTZ A;  5FNF A;  4JAU A;  4E72 A;  5D6Q A;  1US7 A;  2WI2 A;  4ASG A;  5CTU A;  1AMW A;  4BAE A;  2YI0 A;  5M4M A;  1BGQ A;  3U2K A;  1TBW A;  1YS3 A;  3B28 A;  2YGA A;  1UYD A;  1I5C A;  1YES A;  4CE3 A;  5CF0 A;  3NMQ A;  5D7C A;  1A4H A;  3U2D A;  2YEG A;  3LMM A;  4P8O A;  3D36 A;  1F51 A;  3TTZ A;  1GJV A;  5D7D A;  4O05 A;  4EM7 A;  1Z5A A;  2XDX A;  2WI4 A;  4URM A;  4CWT A;  2FTK A;  1EA6 A;  2CCS A;  3BMY A;  4GEE A;  4NH8 A;  2XD6 A;  3H80 A;  4FCP A;  1YT1 A;  4XTJ A;  2YE6 A;  3A0Z A;  1UYF A;  2VCJ A;  3RLQ A;  1PVG A;  4L90 A;  5C93 A;  3EHF A;  2K5B A;  3S5T A;  4CWQ A;  2XJJ A;  4W7T A;  4XKA A;  4EEH A;  2WI1 A;  4LWI A;  3CRK A;  3Q5K A;  3VAD A;  3U67 A;  3VHC A;  4BIZ A;  1UYM A;  1EI1 A;  1IXM A;  3FT5 A;  3ZXQ A;  4LPB A;  2Q8G A;  3CRL A;  3G7B A;  5M4P A;  2VWC A;  3A0Y A;  4YKR A;  1U2O A;  2QFO A;  2YEF A;  4XC0 A;  3HYY A;  1AM1 A;  2ZBK B;  4R1F A;  2XCM A;  4DUH A;  2XHX A;  4XKK A;  1I5B A;  2WEP A;  1YT2 A;  5CPH A;  3QTF A;  4CWF A;  4EGH A;  2IWU A;  1Y8P A;  2XDL A;  4URL A;  1B63 A;  2YE8 A;  4GGL A;  3GIG B;  3ZXO A;  4I5S A;  2YK2 A;  2WI5 A;  3TUH A;  2VW5 A;  2XX5 A;  4LWE A;  4GQT A;  2YJW A;  4JAV A;  2XDS A;  4KFG A;  4EFU A;  4MB9 A;  1TIL A;  2WI7 A;  2XK2 A;  2HKJ A;  4HY6 A;  2IWX A;  2IWS A;  2VCI A;  2HCH A;  2E0A A;  1I5D A;  3CYG A;  4X9L A;  4CE2 A;  4PRV A;  2XX2 A;  2ZKJ A;  3VHA A;  4XCL A;  3EKO A;  4QPJ A;  3R4M A;  2YE5 A;  3LPS A;  1ZXN A;  4URO A;  5IDM A;  4DZY A;  4H7Q A;  2Q8F A;  4XIQ A;  3T1K A;  3O6O A;  4HXZ A;  4MPN A;  4MBC A;  1TC0 A;  1BXD A;  3C0E A;  2O1V A;  2ZDX A;  2YI6 A;  3GIE A;  2IOQ A;  1ZWH A;  4MP7 A;  4PRX A;  5CTX A;  3Q5J A;  1QZR A;  4U93 A;  2FXS A;  3HHU A;  1AH6 A;  4CWP A;  1UYH A;  1Y8N A;  5F3K A;  3RLP A;  3T0H A;  4MPE A;  4HY1 A;  4URN A;  1Z5B A;  2IOR A;  4CWO A;  3SL2 A;  1YC1 A;  3ZKB A;  2JKI A;  4MP2 A;  4Q20 A;  2YKE A;  1TID A;  1KZN A;  3EHG A;  5JEN A;  3G7E A;  1UY7 A;  2XHT A;  3H4L A;  2XDU A;  3C11 A;  4CWR A;  2CCU A;  4MPC A;  3ZM7 A;  1YET A;  3FT8 A;  3CGY A;  4E02 A;  4XIT A;  4BQG A;  4HYP A;  1AJ6 A;  4CE1 A;  3K98 A;  2YE7 A;  5F5R A;  1YC4 A;  1TC6 A;  3D2R A;  2BU6 A;  4FCQ A;  3O2F A;  4E01 A;  2YE3 A;  3EHJ A;  4FPP A;  4LWF A;  3A0W A;  1MX0 A;  2XAB A;  2BRE A;  2C2A A;  2O1W A;  1QYE A;  2WEQ A;  3CWV A;  4AS9 A;  1ZW9 A;  1UYI A;  4KTN A;  2YE2 A;  5IN9 A;  4EGI A;  2XX4 A;  2QF6 A;  4AWP A;  3OWB A;  4HZ5 A;  4WUB A;  2XDK A;  5J6A A;  4NH7 A;  4O07 A;  4XD8 A;  5FWK A;  3R92 A;  3JZ3 A;  1YER A;  4XE2 A;  3PEH A;  3GIG A;  4YKT A;  3OW6 A;  4O04 A;  4PL9 A;  2BSM A;  4B6C A;  2C1G A;  2YKB A;  5J71 A;  2JJC A;  3QDD A;  2BZ5 A;  5BOD A;  3HZ5 A;  3EHH A;  1ZXM A;  3VHD A;  2YEA A;  4HZ0 A;  2PNR A;  2CCT A;  4MOT A;  4AWO A;  1KIJ A;  1H7S A;  3BM9 A;  1QY8 A;  2YGF A;  2YKI A;  2BU8 A;  2HG1 A;  1TH8 A;  2BRC A;  2BU7 A;  4JAS A;  4YKX A;  3FV5 A;  3ZKD A;  2WI3 A;  4XDM A;  3TZ0 A;  4KSG A;  3DGE A;  2BYH A;  5FND A;  2YE9 A;  4XCJ A;  3D0B A;  2HHI A;  3CGZ A;  2YKJ A;  1UYC A;  3GIF A;  2BU2 A;  1S14 A;  1Z5C A;  1B3Q A;  5BOC A;  2FWY A;  4KP4 A;  1UYK A;  3HZ1 A;  3R4O A;  2BU5 A;  4V26 A;  4O09 A;  5GGZ A;  3WHA A;  3R4P A;  1UYE A;  4LWH A;  4L91 A;  4XIR A;  4L94 A;  4YKQ A;  1THN A;  2Q8H A;  1UY9 A;  2H8M A;  1BKN A;  4YKU A;  2H55 A;  2YK9 A;  3KE6 A;  1UY6 A;  5IDJ A;  2Q2E B;  3OPD A;  2EXL A;  3LNU A;  5CTW A;  2WER A;  4BXI A;  4BQJ A;  2O1U A;  1NHJ A;  3B25 A;  3B27 A;  4P7A A;  2C1I A;  3K97 A;  2BYI A;  4WUD A;  1JM6 A;  1H7U A;  1GKZ A;  3PEJ A;  3G75 A;  5D6P A;  3R91 A;  1BYQ A;  4ASB A;  2AKP A;  2GQP A;  2WI6 A;  4ZVI A;  2YEB A;  4QPK A;  3K60 A;  1UYL A;  1AH8 A;  4ZKI A;  2ESA A;  4U7N A;  2YEI A;  4GFN A;  3TZ5 A;  4KSH A;  4LP0 A;  1R62 A;  1Y4S A;  4B7P A;  4JQL A;  3INW A;  1UYG A;  3HYZ A;  5M4K A;  2IOP A;  4V25 A;  1OSF A;  2YEH A;  5FNC A;  4EGK A;  3A0X A;  2YEE A;  4GCZ A;  4YKY A;  3Q5L A;  1I59 A;  5M4N A;  1YSR A;  2XHR A;  2Q8I A;  3B24 A;  5L3J A;  2XJG A;  4CWS A;  4K4O A;  2QG2 A;  1B62 A;  1UY8 A;  3A0T A;  1S16 A; 
#chains in the Genus database with same CATH homology
 4EMV A;  4NH9 A;  1U0Z A;  1YC3 A;  3INX A;  3HEK A;  4ASA A;  3OWD A;  1NHI A;  1I58 A;  2YGE A;  5D7R A;  2YJX A;  4EFT A;  4L93 A;  1Y8O A;  4R3A A;  3K99 A;  2XJX A;  3OMU A;  4HXW A;  4ASF A;  2QG0 A;  1Y4U A;  1YT0 A;  4R3M A;  4CWN A;  4FCR A;  2GFD A;  3TZ4 A;  2ZDY A;  1ID0 A;  3IED A;  3MNR P;  4PU9 A;  1Z59 A;  2BT0 A;  2CH4 A;  4YKZ A;  1NHH A;  1YSZ A;  2CGF A;  1MU5 A;  4U7O A;  1GKX A;  4YKW A;  2CG9 A;  4BIU A;  4KQV A;  4XKO A;  3B26 A;  4H85 A;  5CTY A;  4GT8 A;  3T0Z A;  3WQ9 A;  2YEC A;  4XIP A;  1I5A A;  4AWQ A;  3EKR A;  4HYM A;  3RLR A;  4H81 A;  1L0O A;  3O0I A;  2UWD A;  3T2S A;  4E00 A;  3RKZ A;  4WUC A;  2FYP A;  4O0B A;  2YE4 A;  2FWZ A;  3TZ2 A;  3A0R A;  5M4H A;  3R4N A;  3T10 A;  4LWG A;  2YI7 A;  2YI5 A;  4L8Z A;  2YEJ A;  2YED A;  4I3H A;  5M4E A;  2YKC A;  4FMT A;  2BTZ A;  5FNF A;  4JAU A;  5D6Q A;  1US7 A;  2WI2 A;  4ASG A;  5CTU A;  1AMW A;  4BAE A;  2YI0 A;  5M4M A;  1BGQ A;  3U2K A;  1TBW A;  1YS3 A;  3B28 A;  2YGA A;  1UYD A;  1I5C A;  1YES A;  4CE3 A;  5CF0 A;  3NMQ A;  5D7C A;  1A4H A;  3U2D A;  2YEG A;  4P8O A;  3D36 A;  3TTZ A;  1GJV A;  5D7D A;  4O05 A;  4EM7 A;  1Z5A A;  2XDX A;  2WI4 A;  4URM A;  4CWT A;  1EA6 A;  2CCS A;  3BMY A;  4GEE A;  4NH8 A;  2XD6 A;  3H80 A;  4FCP A;  1YT1 A;  4XTJ A;  2YE6 A;  3A0Z A;  1UYF A;  2VCJ A;  3RLQ A;  1PVG A;  4L90 A;  5C93 A;  3EHF A;  2K5B A;  4CWQ A;  2XJJ A;  4W7T A;  4XKA A;  4EEH A;  2WI1 A;  4LWI A;  3CRK A;  3Q5K A;  3VAD A;  3U67 A;  3VHC A;  4BIZ A;  1UYM A;  1EI1 A;  3FT5 A;  3ZXQ A;  4LPB A;  2Q8G A;  3CRL A;  3G7B A;  5M4P A;  2VWC A;  3A0Y A;  4YKR A;  1U2O A;  2QFO A;  2YEF A;  4XC0 A;  3HYY A;  1AM1 A;  2ZBK B;  4R1F A;  2XCM A;  4DUH A;  2XHX A;  4XKK A;  1I5B A;  2WEP A;  1YT2 A;  5CPH A;  3QTF A;  4CWF A;  4EGH A;  2IWU A;  1Y8P A;  2XDL A;  4URL A;  1B63 A;  2YE8 A;  4GGL A;  3GIG B;  3ZXO A;  4I5S A;  2YK2 A;  2WI5 A;  3TUH A;  2VW5 A;  2XX5 A;  4LWE A;  4GQT A;  2YJW A;  4JAV A;  2XDS A;  4KFG A;  4EFU A;  4MB9 A;  1TIL A;  2WI7 A;  2XK2 A;  2HKJ A;  4HY6 A;  2IWX A;  2IWS A;  2VCI A;  2HCH A;  2E0A A;  1I5D A;  4X9L A;  4CE2 A;  4PRV A;  2XX2 A;  2ZKJ A;  3VHA A;  4XCL A;  3EKO A;  4QPJ A;  3R4M A;  2YE5 A;  3LPS A;  1ZXN A;  4URO A;  5IDM A;  4DZY A;  4H7Q A;  2Q8F A;  4XIQ A;  3T1K A;  3O6O A;  4HXZ A;  4MPN A;  4MBC A;  1TC0 A;  1BXD A;  3C0E A;  2O1V A;  2ZDX A;  2YI6 A;  3GIE A;  2IOQ A;  1ZWH A;  4MP7 A;  4PRX A;  5CTX A;  3Q5J A;  1QZR A;  4U93 A;  2FXS A;  3HHU A;  1AH6 A;  4CWP A;  1UYH A;  1Y8N A;  5F3K A;  3RLP A;  3T0H A;  4MPE A;  4HY1 A;  4URN A;  1Z5B A;  2IOR A;  4CWO A;  3SL2 A;  1YC1 A;  3ZKB A;  2JKI A;  4MP2 A;  4Q20 A;  2YKE A;  1TID A;  1KZN A;  3EHG A;  3G7E A;  1UY7 A;  2XHT A;  3H4L A;  2XDU A;  3C11 A;  4CWR A;  2CCU A;  4MPC A;  3ZM7 A;  1YET A;  3FT8 A;  3CGY A;  4E02 A;  4XIT A;  4BQG A;  4HYP A;  1AJ6 A;  4CE1 A;  3K98 A;  2YE7 A;  5F5R A;  1YC4 A;  1TC6 A;  3D2R A;  2BU6 A;  4FCQ A;  3O2F A;  4E01 A;  2YE3 A;  3EHJ A;  4FPP A;  4LWF A;  3A0W A;  1MX0 A;  2XAB A;  2BRE A;  2C2A A;  2O1W A;  1QYE A;  2WEQ A;  3CWV A;  4AS9 A;  1ZW9 A;  1UYI A;  4KTN A;  2YE2 A;  5IN9 A;  4EGI A;  2XX4 A;  2QF6 A;  4AWP A;  3OWB A;  4HZ5 A;  4WUB A;  2XDK A;  5J6A A;  4NH7 A;  4O07 A;  4XD8 A;  5FWK A;  3R92 A;  3JZ3 A;  1YER A;  4XE2 A;  3PEH A;  3GIG A;  4YKT A;  3OW6 A;  4O04 A;  4PL9 A;  2BSM A;  4B6C A;  2YKB A;  5J71 A;  2JJC A;  3QDD A;  2BZ5 A;  5BOD A;  3HZ5 A;  3EHH A;  1ZXM A;  3VHD A;  2YEA A;  4HZ0 A;  2PNR A;  2CCT A;  4MOT A;  4AWO A;  1KIJ A;  1H7S A;  3BM9 A;  1QY8 A;  2YGF A;  2YKI A;  2BU8 A;  2HG1 A;  1TH8 A;  2BRC A;  2BU7 A;  4JAS A;  4YKX A;  3FV5 A;  3ZKD A;  2WI3 A;  4XDM A;  3TZ0 A;  4KSG A;  3DGE A;  2BYH A;  5FND A;  2YE9 A;  4XCJ A;  3D0B A;  3CGZ A;  2YKJ A;  1UYC A;  3GIF A;  2BU2 A;  1S14 A;  1Z5C A;  1B3Q A;  5BOC A;  2FWY A;  4KP4 A;  1UYK A;  3HZ1 A;  3R4O A;  2BU5 A;  4V26 A;  4O09 A;  5GGZ A;  3WHA A;  3R4P A;  1UYE A;  4LWH A;  4L91 A;  4XIR A;  4L94 A;  4YKQ A;  1THN A;  2Q8H A;  1UY9 A;  2H8M A;  1BKN A;  4YKU A;  2H55 A;  2YK9 A;  3KE6 A;  1UY6 A;  5IDJ A;  2Q2E B;  3OPD A;  2EXL A;  3LNU A;  5CTW A;  2WER A;  4BXI A;  4BQJ A;  2O1U A;  1NHJ A;  3B25 A;  3B27 A;  4P7A A;  3K97 A;  2BYI A;  4WUD A;  1JM6 A;  1H7U A;  1GKZ A;  3PEJ A;  3G75 A;  5D6P A;  3R91 A;  1BYQ A;  4ASB A;  2AKP A;  2GQP A;  2WI6 A;  4ZVI A;  2YEB A;  4QPK A;  3K60 A;  1UYL A;  1AH8 A;  4ZKI A;  2ESA A;  4U7N A;  2YEI A;  4GFN A;  3TZ5 A;  4KSH A;  4LP0 A;  1R62 A;  1Y4S A;  4B7P A;  4JQL A;  3INW A;  1UYG A;  3HYZ A;  5M4K A;  2IOP A;  4V25 A;  1OSF A;  2YEH A;  5FNC A;  4EGK A;  3A0X A;  2YEE A;  4GCZ A;  4YKY A;  3Q5L A;  1I59 A;  5M4N A;  1YSR A;  2XHR A;  2Q8I A;  3B24 A;  5L3J A;  2XJG A;  4CWS A;  4K4O A;  2QG2 A;  1B62 A;  1UY8 A;  3A0T A;  1S16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...