4P8OA

S. aureus gyrase bound to an aminobenzimidazole urea inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
184
structure length
184
Chain Sequence
GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Second-generation antibacterial benzimidazole ureas: discovery of a preclinical candidate with reduced metabolic liability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
molecule keywords DNA gyrase subunit B
total genus 57
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4p8oA00
2XX5A 3KE6A 4L91A 2YE2A 2O1VA 2QG2A 2YEJA 4H7QA 4MBCA 2Q8GA 2ZBKB 2YE8A 3O2FA 3B28A 2Q8IA 1UYCA 1TC6A 1AJ6A 1AH8A 4YKQA 1UYHA 5FWKA 4HY6A 2GFDA 4E02A 2WI1A 4GQTA 3C11A 3LNUA 2IOQA 3BMYA 4E00A 2XX2A 2XDSA 2CG9A 2XCMA 4WUBA 4AS9A 2BU5A 5M4PA 1US7A 2YEAA 3TZ2A 4HZ0A 2E0AA 3MNRP 3K99A 4EEHA 2ZDXA 1B63A 2YI6A 5CTYA 1UYFA 3HEKA 4LWGA 4BQJA 4ZKIA 2YI5A 2CCSA 1MU5A 4YKXA 4MP2A 4FCPA 4EGKA 3RLRA 3ZKBA 3BM9A 4XTJA 2CGFA 4GGLA 3CGYA 2YEHA 2YEFA 2ZKJA 3R4MA 2XJGA 2Q8HA 2Q2EB 2YE9A 3QTFA 3VHAA 4Q20A 1YC4A 1Y8NA 5IN9A 5M4EA 2YEDA 4XIPA 1Y4SA 3R92A 3TZ0A 4XDMA 2GQPA 1YT1A 3T0ZA 1TH8A 1S14A 1Z5AA 1YERA 1MX0A 3K60A 1ZXNA 2WERA 2XHXA 3FT8A 4BIUA 1U0ZA 4FMTA 4WUCA 1GJVA 3A0WA 4BQGA 4MPNA 1THNA 2YGAA 4O04A 2BRCA 5D7CA 4PL9A 4FCQA 1KZNA 5D7RA 2PNRA 3Q5LA 2XDKA 4JAVA 1YETA 2YI0A 4MP7A 2IWUA 4GT8A 4YKZA 4KQVA 5J71A 4UROA 4E01A 4MPCA 5FNFA 2VW5A 4GEEA 4NH8A 3A0TA 2WI2A 4KSHA 3ZKDA 4GFNA 1L0OA 4ASFA 4KTNA 2YKCA 4URMA 1B62A 2YKIA 4CWTA 4EM7A 2QFOA 3T2SA 3D2RA 4R3AA 2XHRA 3NMQA 1BXDA 2BU6A 4B6CA 2WI6A 2CCUA 4V26A 4KSGA 3TZ5A 3EKRA 1YC3A 2BSMA 2K5BA 4HZ5A 1I5CA 2QF6A 4PU9A 4MPEA 4MOTA 3ZXOA 2JJCA 4KP4A 1AH6A 1I5AA 1EA6A 3G7BA 3PEJA 4GCZA 3G7EA 5D6PA 1UYIA 4O09A 5J6AA 3T10A 4X9LA 4JASA 4EGHA 1UYLA 3TUHA 5GGZA 1UYMA 1I58A 2XX4A 3QDDA 3GIEA 1U2OA 3CRLA 2EXLA 2YEEA 4ASAA 1GKZA 1TBWA 2O1UA 4PRVA 4HYPA 4YKYA 2XDXA 5M4NA 1Y4UA 4B7PA 1YT0A 5F5RA 4K4OA 2BYHA 4U93A 2YE6A 2YK2A 4CE2A 3RLQA 5BODA 4W7TA 1TILA 2WEQA 5FNDA 4HY1A 4NH7A 3R4OA 3Q5JA 4R3MA 2VCJA 4JQLA 3C0EA 4ZVIA 4CWFA 1NHJA 2IOPA 2AKPA 3PEHA 2BZ5A 5C93A 3INXA 5D7DA 2IWXA 4U7OA 3VHCA 2XABA 3A0RA 1UYGA 1YC1A 1B3QA 4P7AA 4EFUA 4O05A 1AM1A 5F3KA 4R1FA 3K98A 5M4KA 2IWSA 3CWVA 1Z5BA 4L8ZA 2WI5A 2JKIA 4XIRA 2YEGA 4AWOA 4CWQA 5CTXA 2BU7A 1NHHA 2WI3A 2XD6A 2ZDYA 4XC0A 1H7SA 1JM6A 2CCTA 3JZ3A 2HCHA 3RLPA 4NH9A 2WEPA 2Q8FA 2YK9A 3VADA 1TIDA 4XD8A 4V25A 3RKZA 1PVGA 3HYYA 2YE5A 3GIGA 3INWA 2YKEA 3G75A 4FPPA 3VHDA 3IEDA 3B26A 2XK2A 4EMVA 3EHJA 3OMUA 3CGZA 4XCLA 3GIFA 2BREA 3EHFA 4XKKA 2YJWA 1QZRA 4CWPA 4I5SA 3R4PA 2YEIA 4YKUA 3ZXQA 3DGEA 4CWRA 3O6OA 5D6QA 1ID0A 3A0XA 4FCRA 2YI7A 3FV5A 4ASGA 5M4HA 3OWDA 4CWSA 4P8OA 3HZ5A 1YS3A 3D0BA 3FT5A 3OW6A 4L90A 3H4LA 1ZXMA 5IDJA 2BT0A 4CE3A 1QY8A 1Z59A 3HHUA 4XITA 4URLA 1QYEA 1AMWA 1GKXA 2O1WA 3O0IA 2XJXA 2YGEA 3D36A 3EHHA 1Y8PA 3OPDA 3ZM7A 2VCIA 3HYZA 4YKRA 3EKOA 2C2AA 1UYDA 2VWCA 1YSRA 2BYIA 1I5DA 2BTZA 3LPSA 4H85A 2YE3A 5CTWA 1BGQA 4XKAA 1YT2A 3A0YA 3U67A 2WI7A 4XCJA 1Z5CA 3EHGA 3SL2A 3R4NA 4HXWA 1ZWHA 2YE4A 4BAEA 2HG1A 4LP0A 5IDMA 1EI1A 4H81A 2YGFA 4CE1A 2YKBA 5L3JA 4LWEA 4U7NA 1UY8A 4QPJA 1BYQA 4LWFA 1OSFA 2YEBA 1KIJA 4WUDA 3T1KA 4BXIA 3Q5KA 4O0BA 2XHTA 2FWYA 3WQ9A 1UYKA 5CF0A 5M4MA 1S16A 3U2KA 4CWOA 2CH4A 5BOCA 2XDUA 3K97A 1YESA 4EFTA 4L94A 4LPBA 2YECA 4ASBA 2ESAA 4XE2A 2FYPA 2HKJA 2YKJA 4DUHA 3B24A 4MB9A 2H55A 4YKWA 2BU2A 4URNA 4KFGA 3H80A 4DZYA 5CTUA 1UY9A 4EGIA 1I59A 4LWIA 5CPHA 3GIGB 5FNCA 2YE7A 2XJJA 1I5BA 3T0HA 3U2DA 3WHAA 1BKNA 3OWBA 4AWQA 1YSZA 4LWHA 4BIZA 4HXZA 3B27A 3TTZA 1UY7A 3HZ1A 2IORA 2BU8A 2XDLA 4CWNA 4O07A 1NHIA 1UYEA 1H7UA 4L93A 1ZW9A 3R91A 4HYMA 1Y8OA 3CRKA 2WI4A 4JAUA 1R62A 1TC0A 2QG0A 4QPKA 2FXSA 1A4HA 2UWDA 4AWPA 1UY6A 3B25A 4PRXA 4XKOA 2H8MA 3TZ4A 4XIQA 2YJXA 4YKTA 3A0ZA 2FWZA 4I3HA
chains in the Genus database with same CATH superfamily
2XX5A 3KE6A 4L91A 2YE2A 2O1VA 2QG2A 2YEJA 4H7QA 4MBCA 2Q8GA 2ZBKB 2YE8A 3O2FA 2HHIA 3B28A 2Q8IA 1UYCA 1TC6A 1AJ6A 1AH8A 4YKQA 1UYHA 5FWKA 4HY6A 2GFDA 4E02A 2WI1A 4GQTA 3C11A 3LNUA 2IOQA 3BMYA 4E00A 2XX2A 2XDSA 2CG9A 2XCMA 4WUBA 4AS9A 2BU5A 5M4PA 1US7A 2YEAA 3TZ2A 4HZ0A 2E0AA 3MNRP 3K99A 1F51A 4EEHA 2ZDXA 1B63A 2YI6A 5CTYA 1UYFA 3HEKA 4LWGA 3S5TA 4BQJA 4ZKIA 2YI5A 2CCSA 1MU5A 4YKXA 4MP2A 4FCPA 4EGKA 3RLRA 3ZKBA 3BM9A 4XTJA 2CGFA 1IXMA 4GGLA 3CGYA 2YEHA 2YEFA 2ZKJA 3R4MA 2XJGA 2Q8HA 2Q2EB 2YE9A 3QTFA 3VHAA 4Q20A 1YC4A 1Y8NA 5IN9A 5M4EA 2YEDA 4XIPA 1Y4SA 3R92A 3TZ0A 4XDMA 2GQPA 1YT1A 3T0ZA 1TH8A 1S14A 1Z5AA 2C1GA 1YERA 1MX0A 3K60A 1ZXNA 2WERA 2XHXA 3FT8A 4BIUA 1U0ZA 4FMTA 4WUCA 1GJVA 3A0WA 3LMMA 4BQGA 4MPNA 1THNA 2YGAA 4O04A 2BRCA 5D7CA 4PL9A 4FCQA 1KZNA 5D7RA 2PNRA 3Q5LA 2XDKA 4JAVA 1YETA 2FTKA 2YI0A 4MP7A 2IWUA 4GT8A 4YKZA 4KQVA 5J71A 4UROA 4E01A 4MPCA 5FNFA 2VW5A 4GEEA 4NH8A 3A0TA 2WI2A 4KSHA 3ZKDA 4GFNA 1L0OA 4ASFA 4KTNA 2YKCA 4URMA 1B62A 2YKIA 4CWTA 4EM7A 2QFOA 3T2SA 3D2RA 4R3AA 2XHRA 3NMQA 4E72A 1BXDA 2BU6A 4B6CA 2WI6A 2CCUA 4V26A 4KSGA 3TZ5A 3EKRA 1YC3A 2BSMA 2K5BA 4HZ5A 1I5CA 2QF6A 4PU9A 4MPEA 4MOTA 5JENA 3ZXOA 2JJCA 4KP4A 1AH6A 1I5AA 1EA6A 3G7BA 3PEJA 4GCZA 3G7EA 5D6PA 1UYIA 4O09A 5J6AA 3T10A 4X9LA 4JASA 4EGHA 1UYLA 3TUHA 5GGZA 1UYMA 1I58A 2XX4A 3QDDA 3GIEA 1U2OA 3CRLA 2EXLA 2YEEA 4ASAA 1GKZA 1TBWA 2O1UA 4PRVA 4HYPA 4YKYA 2XDXA 5M4NA 1Y4UA 4B7PA 1YT0A 5F5RA 4K4OA 2BYHA 4U93A 2YE6A 2YK2A 4CE2A 3RLQA 5BODA 4W7TA 1TILA 2WEQA 5FNDA 4HY1A 4NH7A 3R4OA 3Q5JA 4R3MA 2VCJA 4JQLA 3C0EA 4ZVIA 4CWFA 1NHJA 2IOPA 2AKPA 3PEHA 2BZ5A 5C93A 3INXA 5D7DA 2IWXA 4U7OA 3VHCA 2XABA 3A0RA 1UYGA 1YC1A 1B3QA 4P7AA 4EFUA 4O05A 1AM1A 5F3KA 4R1FA 3K98A 5M4KA 2IWSA 3CWVA 1Z5BA 4L8ZA 2WI5A 2JKIA 4XIRA 2YEGA 4AWOA 4CWQA 5CTXA 2BU7A 1NHHA 2WI3A 2XD6A 2ZDYA 4XC0A 1H7SA 1JM6A 2CCTA 3JZ3A 2HCHA 3RLPA 4NH9A 2WEPA 2Q8FA 2YK9A 3VADA 1TIDA 4XD8A 4V25A 3RKZA 1PVGA 3HYYA 2YE5A 3GIGA 3INWA 2YKEA 3G75A 4FPPA 3VHDA 3IEDA 3B26A 2XK2A 4EMVA 3EHJA 3OMUA 3CGZA 4XCLA 3GIFA 2BREA 3EHFA 4XKKA 2YJWA 1QZRA 4CWPA 4I5SA 3R4PA 2YEIA 4YKUA 3ZXQA 3DGEA 4CWRA 3O6OA 5D6QA 1ID0A 3A0XA 4FCRA 2YI7A 3FV5A 4ASGA 5M4HA 3OWDA 4CWSA 4P8OA 3HZ5A 1YS3A 3D0BA 3FT5A 3OW6A 4L90A 3H4LA 1ZXMA 5IDJA 2BT0A 4CE3A 1QY8A 1Z59A 3HHUA 3CYGA 4XITA 4URLA 1QYEA 1AMWA 1GKXA 2O1WA 3O0IA 2XJXA 2YGEA 3D36A 3EHHA 1Y8PA 3OPDA 3ZM7A 2VCIA 2C1IA 3HYZA 4YKRA 3EKOA 2C2AA 1UYDA 2VWCA 1YSRA 2BYIA 1I5DA 2BTZA 3LPSA 4H85A 2YE3A 5CTWA 1BGQA 4XKAA 1YT2A 3A0YA 3U67A 2WI7A 4XCJA 1Z5CA 3EHGA 3SL2A 3R4NA 4HXWA 1ZWHA 2YE4A 4BAEA 2HG1A 4LP0A 5IDMA 1EI1A 4H81A 2YGFA 4CE1A 2YKBA 5L3JA 4LWEA 4U7NA 1UY8A 4QPJA 1BYQA 4LWFA 1OSFA 2YEBA 1KIJA 4WUDA 3T1KA 4BXIA 3Q5KA 4O0BA 2XHTA 2FWYA 3WQ9A 1UYKA 5CF0A 5M4MA 1S16A 3U2KA 4CWOA 2CH4A 5BOCA 2XDUA 3K97A 1YESA 4EFTA 4L94A 4LPBA 2YECA 4ASBA 2ESAA 4XE2A 2FYPA 2HKJA 2YKJA 4DUHA 3B24A 4MB9A 2H55A 4YKWA 2BU2A 4URNA 4KFGA 3H80A 4DZYA 5CTUA 1UY9A 4EGIA 1I59A 4LWIA 5CPHA 3GIGB 5FNCA 2YE7A 2XJJA 1I5BA 3T0HA 3U2DA 3WHAA 1BKNA 3OWBA 4AWQA 1YSZA 4LWHA 4BIZA 4HXZA 3B27A 3TTZA 1UY7A 3HZ1A 2IORA 2BU8A 2XDLA 4CWNA 4O07A 1NHIA 1UYEA 1H7UA 4L93A 1ZW9A 3R91A 4HYMA 1Y8OA 3CRKA 2WI4A 4JAUA 1R62A 1TC0A 2QG0A 4QPKA 2FXSA 1A4HA 2UWDA 4AWPA 1UY6A 3B25A 4PRXA 4XKOA 2H8MA 3TZ4A 4XIQA 2YJXA 4YKTA 3A0ZA 2FWZA 4I3HA
chains in the Genus database with same CATH topology
2XX5A 3KE6A 4L91A 2YE2A 2O1VA 2QG2A 2YEJA 4H7QA 4MBCA 2Q8GA 2ZBKB 2YE8A 3O2FA 3B28A 2Q8IA 1UYCA 1TC6A 1AJ6A 1AH8A 4YKQA 1UYHA 5FWKA 4HY6A 2GFDA 4E02A 2WI1A 4GQTA 3C11A 3LNUA 2IOQA 3BMYA 4E00A 2XX2A 2XDSA 2CG9A 2XCMA 4WUBA 4AS9A 2BU5A 5M4PA 1US7A 2YEAA 3TZ2A 4HZ0A 2E0AA 3MNRP 3K99A 4EEHA 2ZDXA 1B63A 2YI6A 5CTYA 1UYFA 3HEKA 4LWGA 4BQJA 4ZKIA 2YI5A 2CCSA 1MU5A 4YKXA 4MP2A 4FCPA 4EGKA 3RLRA 3ZKBA 3BM9A 4XTJA 2CGFA 4GGLA 3CGYA 2YEHA 2YEFA 2ZKJA 3R4MA 2XJGA 2Q8HA 2Q2EB 2YE9A 3QTFA 3VHAA 4Q20A 1YC4A 1Y8NA 5IN9A 5M4EA 2YEDA 4XIPA 1Y4SA 3R92A 3TZ0A 4XDMA 2GQPA 1YT1A 3T0ZA 1TH8A 1S14A 1Z5AA 1YERA 1MX0A 3K60A 1ZXNA 2WERA 2XHXA 3FT8A 4BIUA 1U0ZA 4FMTA 4WUCA 1GJVA 3A0WA 4BQGA 4MPNA 1THNA 2YGAA 4O04A 2BRCA 5D7CA 4PL9A 4FCQA 1KZNA 5D7RA 2PNRA 3Q5LA 2XDKA 4JAVA 1YETA 2YI0A 4MP7A 2IWUA 4GT8A 4YKZA 4KQVA 5J71A 4UROA 4E01A 4MPCA 5FNFA 2VW5A 4GEEA 4NH8A 3A0TA 2WI2A 4KSHA 3ZKDA 4GFNA 1L0OA 4ASFA 4KTNA 2YKCA 4URMA 1B62A 2YKIA 4CWTA 4EM7A 2QFOA 3T2SA 3D2RA 4R3AA 2XHRA 3NMQA 1BXDA 2BU6A 4B6CA 2WI6A 2CCUA 4V26A 4KSGA 3TZ5A 3EKRA 1YC3A 2BSMA 2K5BA 4HZ5A 1I5CA 2QF6A 4PU9A 4MPEA 4MOTA 3ZXOA 2JJCA 4KP4A 1AH6A 1I5AA 1EA6A 3G7BA 3PEJA 4GCZA 3G7EA 5D6PA 1UYIA 4O09A 5J6AA 3T10A 4X9LA 4JASA 4EGHA 1UYLA 3TUHA 5GGZA 1UYMA 1I58A 2XX4A 3QDDA 3GIEA 1U2OA 3CRLA 2EXLA 2YEEA 4ASAA 1GKZA 1TBWA 2O1UA 4PRVA 4HYPA 4YKYA 2XDXA 5M4NA 1Y4UA 4B7PA 1YT0A 5F5RA 4K4OA 2BYHA 4U93A 2YE6A 2YK2A 4CE2A 3RLQA 5BODA 4W7TA 1TILA 2WEQA 5FNDA 4HY1A 4NH7A 3R4OA 3Q5JA 4R3MA 2VCJA 4JQLA 3C0EA 4ZVIA 4CWFA 1NHJA 2IOPA 2AKPA 3PEHA 2BZ5A 5C93A 3INXA 5D7DA 2IWXA 4U7OA 3VHCA 2XABA 3A0RA 1UYGA 1YC1A 1B3QA 4P7AA 4EFUA 4O05A 1AM1A 5F3KA 4R1FA 3K98A 5M4KA 2IWSA 3CWVA 1Z5BA 4L8ZA 2WI5A 2JKIA 4XIRA 2YEGA 4AWOA 4CWQA 5CTXA 2BU7A 1NHHA 2WI3A 2XD6A 2ZDYA 4XC0A 1H7SA 1JM6A 2CCTA 3JZ3A 2HCHA 3RLPA 4NH9A 2WEPA 2Q8FA 2YK9A 3VADA 1TIDA 4XD8A 4V25A 3RKZA 1PVGA 3HYYA 2YE5A 3GIGA 3INWA 2YKEA 3G75A 4FPPA 3VHDA 3IEDA 3B26A 2XK2A 4EMVA 3EHJA 3OMUA 3CGZA 4XCLA 3GIFA 2BREA 3EHFA 4XKKA 2YJWA 1QZRA 4CWPA 4I5SA 3R4PA 2YEIA 4YKUA 3ZXQA 3DGEA 4CWRA 3O6OA 5D6QA 1ID0A 3A0XA 4FCRA 2YI7A 3FV5A 4ASGA 5M4HA 3OWDA 4CWSA 4P8OA 3HZ5A 1YS3A 3D0BA 3FT5A 3OW6A 4L90A 3H4LA 1ZXMA 5IDJA 2BT0A 4CE3A 1QY8A 1Z59A 3HHUA 4XITA 4URLA 1QYEA 1AMWA 1GKXA 2O1WA 3O0IA 2XJXA 2YGEA 3D36A 3EHHA 1Y8PA 3OPDA 3ZM7A 2VCIA 3HYZA 4YKRA 3EKOA 2C2AA 1UYDA 2VWCA 1YSRA 2BYIA 1I5DA 2BTZA 3LPSA 4H85A 2YE3A 5CTWA 1BGQA 4XKAA 1YT2A 3A0YA 3U67A 2WI7A 4XCJA 1Z5CA 3EHGA 3SL2A 3R4NA 4HXWA 1ZWHA 2YE4A 4BAEA 2HG1A 4LP0A 5IDMA 1EI1A 4H81A 2YGFA 4CE1A 2YKBA 5L3JA 4LWEA 4U7NA 1UY8A 4QPJA 1BYQA 4LWFA 1OSFA 2YEBA 1KIJA 4WUDA 3T1KA 4BXIA 3Q5KA 4O0BA 2XHTA 2FWYA 3WQ9A 1UYKA 5CF0A 5M4MA 1S16A 3U2KA 4CWOA 2CH4A 5BOCA 2XDUA 3K97A 1YESA 4EFTA 4L94A 4LPBA 2YECA 4ASBA 2ESAA 4XE2A 2FYPA 2HKJA 2YKJA 4DUHA 3B24A 4MB9A 2H55A 4YKWA 2BU2A 4URNA 4KFGA 3H80A 4DZYA 5CTUA 1UY9A 4EGIA 1I59A 4LWIA 5CPHA 3GIGB 5FNCA 2YE7A 2XJJA 1I5BA 3T0HA 3U2DA 3WHAA 1BKNA 3OWBA 4AWQA 1YSZA 4LWHA 4BIZA 4HXZA 3B27A 3TTZA 1UY7A 3HZ1A 2IORA 2BU8A 2XDLA 4CWNA 4O07A 1NHIA 1UYEA 1H7UA 4L93A 1ZW9A 3R91A 4HYMA 1Y8OA 3CRKA 2WI4A 4JAUA 1R62A 1TC0A 2QG0A 4QPKA 2FXSA 1A4HA 2UWDA 4AWPA 1UY6A 3B25A 4PRXA 4XKOA 2H8MA 3TZ4A 4XIQA 2YJXA 4YKTA 3A0ZA 2FWZA 4I3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XX5 A;  3KE6 A;  4L91 A;  2YE2 A;  2O1V A;  2QG2 A;  2YEJ A;  4H7Q A;  4MBC A;  2Q8G A;  2ZBK B;  2YE8 A;  3O2F A;  3B28 A;  2Q8I A;  1UYC A;  1TC6 A;  1AJ6 A;  1AH8 A;  4YKQ A;  1UYH A;  5FWK A;  4HY6 A;  2GFD A;  4E02 A;  2WI1 A;  4GQT A;  3C11 A;  3LNU A;  2IOQ A;  3BMY A;  4E00 A;  2XX2 A;  2XDS A;  2CG9 A;  2XCM A;  4WUB A;  4AS9 A;  2BU5 A;  5M4P A;  1US7 A;  2YEA A;  3TZ2 A;  4HZ0 A;  2E0A A;  3MNR P;  3K99 A;  4EEH A;  2ZDX A;  1B63 A;  2YI6 A;  5CTY A;  1UYF A;  3HEK A;  4LWG A;  4BQJ A;  4ZKI A;  2YI5 A;  2CCS A;  1MU5 A;  4YKX A;  4MP2 A;  4FCP A;  4EGK A;  3RLR A;  3ZKB A;  3BM9 A;  4XTJ A;  2CGF A;  4GGL A;  3CGY A;  2YEH A;  2YEF A;  2ZKJ A;  3R4M A;  2XJG A;  2Q8H A;  2Q2E B;  2YE9 A;  3QTF A;  3VHA A;  4Q20 A;  1YC4 A;  1Y8N A;  5IN9 A;  5M4E A;  2YED A;  4XIP A;  1Y4S A;  3R92 A;  3TZ0 A;  4XDM A;  2GQP A;  1YT1 A;  3T0Z A;  1TH8 A;  1S14 A;  1Z5A A;  1YER A;  1MX0 A;  3K60 A;  1ZXN A;  2WER A;  2XHX A;  3FT8 A;  4BIU A;  1U0Z A;  4FMT A;  4WUC A;  1GJV A;  3A0W A;  4BQG A;  4MPN A;  1THN A;  2YGA A;  4O04 A;  2BRC A;  5D7C A;  4PL9 A;  4FCQ A;  1KZN A;  5D7R A;  2PNR A;  3Q5L A;  2XDK A;  4JAV A;  1YET A;  2YI0 A;  4MP7 A;  2IWU A;  4GT8 A;  4YKZ A;  4KQV A;  5J71 A;  4URO A;  4E01 A;  4MPC A;  5FNF A;  2VW5 A;  4GEE A;  4NH8 A;  3A0T A;  2WI2 A;  4KSH A;  3ZKD A;  4GFN A;  1L0O A;  4ASF A;  4KTN A;  2YKC A;  4URM A;  1B62 A;  2YKI A;  4CWT A;  4EM7 A;  2QFO A;  3T2S A;  3D2R A;  4R3A A;  2XHR A;  3NMQ A;  1BXD A;  2BU6 A;  4B6C A;  2WI6 A;  2CCU A;  4V26 A;  4KSG A;  3TZ5 A;  3EKR A;  1YC3 A;  2BSM A;  2K5B A;  4HZ5 A;  1I5C A;  2QF6 A;  4PU9 A;  4MPE A;  4MOT A;  3ZXO A;  2JJC A;  4KP4 A;  1AH6 A;  1I5A A;  1EA6 A;  3G7B A;  3PEJ A;  4GCZ A;  3G7E A;  5D6P A;  1UYI A;  4O09 A;  5J6A A;  3T10 A;  4X9L A;  4JAS A;  4EGH A;  1UYL A;  3TUH A;  5GGZ A;  1UYM A;  1I58 A;  2XX4 A;  3QDD A;  3GIE A;  1U2O A;  3CRL A;  2EXL A;  2YEE A;  4ASA A;  1GKZ A;  1TBW A;  2O1U A;  4PRV A;  4HYP A;  4YKY A;  2XDX A;  5M4N A;  1Y4U A;  4B7P A;  1YT0 A;  5F5R A;  4K4O A;  2BYH A;  4U93 A;  2YE6 A;  2YK2 A;  4CE2 A;  3RLQ A;  5BOD A;  4W7T A;  1TIL A;  2WEQ A;  5FND A;  4HY1 A;  4NH7 A;  3R4O A;  3Q5J A;  4R3M A;  2VCJ A;  4JQL A;  3C0E A;  4ZVI A;  4CWF A;  1NHJ A;  2IOP A;  2AKP A;  3PEH A;  2BZ5 A;  5C93 A;  3INX A;  5D7D A;  2IWX A;  4U7O A;  3VHC A;  2XAB A;  3A0R A;  1UYG A;  1YC1 A;  1B3Q A;  4P7A A;  4EFU A;  4O05 A;  1AM1 A;  5F3K A;  4R1F A;  3K98 A;  5M4K A;  2IWS A;  3CWV A;  1Z5B A;  4L8Z A;  2WI5 A;  2JKI A;  4XIR A;  2YEG A;  4AWO A;  4CWQ A;  5CTX A;  2BU7 A;  1NHH A;  2WI3 A;  2XD6 A;  2ZDY A;  4XC0 A;  1H7S A;  1JM6 A;  2CCT A;  3JZ3 A;  2HCH A;  3RLP A;  4NH9 A;  2WEP A;  2Q8F A;  2YK9 A;  3VAD A;  1TID A;  4XD8 A;  4V25 A;  3RKZ A;  1PVG A;  3HYY A;  2YE5 A;  3GIG A;  3INW A;  2YKE A;  3G75 A;  4FPP A;  3VHD A;  3IED A;  3B26 A;  2XK2 A;  4EMV A;  3EHJ A;  3OMU A;  3CGZ A;  4XCL A;  3GIF A;  2BRE A;  3EHF A;  4XKK A;  2YJW A;  1QZR A;  4CWP A;  4I5S A;  3R4P A;  2YEI A;  4YKU A;  3ZXQ A;  3DGE A;  4CWR A;  3O6O A;  5D6Q A;  1ID0 A;  3A0X A;  4FCR A;  2YI7 A;  3FV5 A;  4ASG A;  5M4H A;  3OWD A;  4CWS A;  4P8O A;  3HZ5 A;  1YS3 A;  3D0B A;  3FT5 A;  3OW6 A;  4L90 A;  3H4L A;  1ZXM A;  5IDJ A;  2BT0 A;  4CE3 A;  1QY8 A;  1Z59 A;  3HHU A;  4XIT A;  4URL A;  1QYE A;  1AMW A;  1GKX A;  2O1W A;  3O0I A;  2XJX A;  2YGE A;  3D36 A;  3EHH A;  1Y8P A;  3OPD A;  3ZM7 A;  2VCI A;  3HYZ A;  4YKR A;  3EKO A;  2C2A A;  1UYD A;  2VWC A;  1YSR A;  2BYI A;  1I5D A;  2BTZ A;  3LPS A;  4H85 A;  2YE3 A;  5CTW A;  1BGQ A;  4XKA A;  1YT2 A;  3A0Y A;  3U67 A;  2WI7 A;  4XCJ A;  1Z5C A;  3EHG A;  3SL2 A;  3R4N A;  4HXW A;  1ZWH A;  2YE4 A;  4BAE A;  2HG1 A;  4LP0 A;  5IDM A;  1EI1 A;  4H81 A;  2YGF A;  4CE1 A;  2YKB A;  5L3J A;  4LWE A;  4U7N A;  1UY8 A;  4QPJ A;  1BYQ A;  4LWF A;  1OSF A;  2YEB A;  1KIJ A;  4WUD A;  3T1K A;  4BXI A;  3Q5K A;  4O0B A;  2XHT A;  2FWY A;  3WQ9 A;  1UYK A;  5CF0 A;  5M4M A;  1S16 A;  3U2K A;  4CWO A;  2CH4 A;  5BOC A;  2XDU A;  3K97 A;  1YES A;  4EFT A;  4L94 A;  4LPB A;  2YEC A;  4ASB A;  2ESA A;  4XE2 A;  2FYP A;  2HKJ A;  2YKJ A;  4DUH A;  3B24 A;  4MB9 A;  2H55 A;  4YKW A;  2BU2 A;  4URN A;  4KFG A;  3H80 A;  4DZY A;  5CTU A;  1UY9 A;  4EGI A;  1I59 A;  4LWI A;  5CPH A;  3GIG B;  5FNC A;  2YE7 A;  2XJJ A;  1I5B A;  3T0H A;  3U2D A;  3WHA A;  1BKN A;  3OWB A;  4AWQ A;  1YSZ A;  4LWH A;  4BIZ A;  4HXZ A;  3B27 A;  3TTZ A;  1UY7 A;  3HZ1 A;  2IOR A;  2BU8 A;  2XDL A;  4CWN A;  4O07 A;  1NHI A;  1UYE A;  1H7U A;  4L93 A;  1ZW9 A;  3R91 A;  4HYM A;  1Y8O A;  3CRK A;  2WI4 A;  4JAU A;  1R62 A;  1TC0 A;  2QG0 A;  4QPK A;  2FXS A;  1A4H A;  2UWD A;  4AWP A;  1UY6 A;  3B25 A;  4PRX A;  4XKO A;  2H8M A;  3TZ4 A;  4XIQ A;  2YJX A;  4YKT A;  3A0Z A;  2FWZ A;  4I3H A; 
#chains in the Genus database with same CATH topology
 2XX5 A;  3KE6 A;  4L91 A;  2YE2 A;  2O1V A;  2QG2 A;  2YEJ A;  4H7Q A;  4MBC A;  2Q8G A;  2ZBK B;  2YE8 A;  3O2F A;  2HHI A;  3B28 A;  2Q8I A;  1UYC A;  1TC6 A;  1AJ6 A;  1AH8 A;  4YKQ A;  1UYH A;  5FWK A;  4HY6 A;  2GFD A;  4E02 A;  2WI1 A;  4GQT A;  3C11 A;  3LNU A;  2IOQ A;  3BMY A;  4E00 A;  2XX2 A;  2XDS A;  2CG9 A;  2XCM A;  4WUB A;  4AS9 A;  2BU5 A;  5M4P A;  1US7 A;  2YEA A;  3TZ2 A;  4HZ0 A;  2E0A A;  3MNR P;  3K99 A;  1F51 A;  4EEH A;  2ZDX A;  1B63 A;  2YI6 A;  5CTY A;  1UYF A;  3HEK A;  4LWG A;  3S5T A;  4BQJ A;  4ZKI A;  2YI5 A;  2CCS A;  1MU5 A;  4YKX A;  4MP2 A;  4FCP A;  4EGK A;  3RLR A;  3ZKB A;  3BM9 A;  4XTJ A;  2CGF A;  1IXM A;  4GGL A;  3CGY A;  2YEH A;  2YEF A;  2ZKJ A;  3R4M A;  2XJG A;  2Q8H A;  2Q2E B;  2YE9 A;  3QTF A;  3VHA A;  4Q20 A;  1YC4 A;  1Y8N A;  5IN9 A;  5M4E A;  2YED A;  4XIP A;  1Y4S A;  3R92 A;  3TZ0 A;  4XDM A;  2GQP A;  1YT1 A;  3T0Z A;  1TH8 A;  1S14 A;  1Z5A A;  2C1G A;  1YER A;  1MX0 A;  3K60 A;  1ZXN A;  2WER A;  2XHX A;  3FT8 A;  4BIU A;  1U0Z A;  4FMT A;  4WUC A;  1GJV A;  3A0W A;  3LMM A;  4BQG A;  4MPN A;  1THN A;  2YGA A;  4O04 A;  2BRC A;  5D7C A;  4PL9 A;  4FCQ A;  1KZN A;  5D7R A;  2PNR A;  3Q5L A;  2XDK A;  4JAV A;  1YET A;  2FTK A;  2YI0 A;  4MP7 A;  2IWU A;  4GT8 A;  4YKZ A;  4KQV A;  5J71 A;  4URO A;  4E01 A;  4MPC A;  5FNF A;  2VW5 A;  4GEE A;  4NH8 A;  3A0T A;  2WI2 A;  4KSH A;  3ZKD A;  4GFN A;  1L0O A;  4ASF A;  4KTN A;  2YKC A;  4URM A;  1B62 A;  2YKI A;  4CWT A;  4EM7 A;  2QFO A;  3T2S A;  3D2R A;  4R3A A;  2XHR A;  3NMQ A;  4E72 A;  1BXD A;  2BU6 A;  4B6C A;  2WI6 A;  2CCU A;  4V26 A;  4KSG A;  3TZ5 A;  3EKR A;  1YC3 A;  2BSM A;  2K5B A;  4HZ5 A;  1I5C A;  2QF6 A;  4PU9 A;  4MPE A;  4MOT A;  5JEN A;  3ZXO A;  2JJC A;  4KP4 A;  1AH6 A;  1I5A A;  1EA6 A;  3G7B A;  3PEJ A;  4GCZ A;  3G7E A;  5D6P A;  1UYI A;  4O09 A;  5J6A A;  3T10 A;  4X9L A;  4JAS A;  4EGH A;  1UYL A;  3TUH A;  5GGZ A;  1UYM A;  1I58 A;  2XX4 A;  3QDD A;  3GIE A;  1U2O A;  3CRL A;  2EXL A;  2YEE A;  4ASA A;  1GKZ A;  1TBW A;  2O1U A;  4PRV A;  4HYP A;  4YKY A;  2XDX A;  5M4N A;  1Y4U A;  4B7P A;  1YT0 A;  5F5R A;  4K4O A;  2BYH A;  4U93 A;  2YE6 A;  2YK2 A;  4CE2 A;  3RLQ A;  5BOD A;  4W7T A;  1TIL A;  2WEQ A;  5FND A;  4HY1 A;  4NH7 A;  3R4O A;  3Q5J A;  4R3M A;  2VCJ A;  4JQL A;  3C0E A;  4ZVI A;  4CWF A;  1NHJ A;  2IOP A;  2AKP A;  3PEH A;  2BZ5 A;  5C93 A;  3INX A;  5D7D A;  2IWX A;  4U7O A;  3VHC A;  2XAB A;  3A0R A;  1UYG A;  1YC1 A;  1B3Q A;  4P7A A;  4EFU A;  4O05 A;  1AM1 A;  5F3K A;  4R1F A;  3K98 A;  5M4K A;  2IWS A;  3CWV A;  1Z5B A;  4L8Z A;  2WI5 A;  2JKI A;  4XIR A;  2YEG A;  4AWO A;  4CWQ A;  5CTX A;  2BU7 A;  1NHH A;  2WI3 A;  2XD6 A;  2ZDY A;  4XC0 A;  1H7S A;  1JM6 A;  2CCT A;  3JZ3 A;  2HCH A;  3RLP A;  4NH9 A;  2WEP A;  2Q8F A;  2YK9 A;  3VAD A;  1TID A;  4XD8 A;  4V25 A;  3RKZ A;  1PVG A;  3HYY A;  2YE5 A;  3GIG A;  3INW A;  2YKE A;  3G75 A;  4FPP A;  3VHD A;  3IED A;  3B26 A;  2XK2 A;  4EMV A;  3EHJ A;  3OMU A;  3CGZ A;  4XCL A;  3GIF A;  2BRE A;  3EHF A;  4XKK A;  2YJW A;  1QZR A;  4CWP A;  4I5S A;  3R4P A;  2YEI A;  4YKU A;  3ZXQ A;  3DGE A;  4CWR A;  3O6O A;  5D6Q A;  1ID0 A;  3A0X A;  4FCR A;  2YI7 A;  3FV5 A;  4ASG A;  5M4H A;  3OWD A;  4CWS A;  4P8O A;  3HZ5 A;  1YS3 A;  3D0B A;  3FT5 A;  3OW6 A;  4L90 A;  3H4L A;  1ZXM A;  5IDJ A;  2BT0 A;  4CE3 A;  1QY8 A;  1Z59 A;  3HHU A;  3CYG A;  4XIT A;  4URL A;  1QYE A;  1AMW A;  1GKX A;  2O1W A;  3O0I A;  2XJX A;  2YGE A;  3D36 A;  3EHH A;  1Y8P A;  3OPD A;  3ZM7 A;  2VCI A;  2C1I A;  3HYZ A;  4YKR A;  3EKO A;  2C2A A;  1UYD A;  2VWC A;  1YSR A;  2BYI A;  1I5D A;  2BTZ A;  3LPS A;  4H85 A;  2YE3 A;  5CTW A;  1BGQ A;  4XKA A;  1YT2 A;  3A0Y A;  3U67 A;  2WI7 A;  4XCJ A;  1Z5C A;  3EHG A;  3SL2 A;  3R4N A;  4HXW A;  1ZWH A;  2YE4 A;  4BAE A;  2HG1 A;  4LP0 A;  5IDM A;  1EI1 A;  4H81 A;  2YGF A;  4CE1 A;  2YKB A;  5L3J A;  4LWE A;  4U7N A;  1UY8 A;  4QPJ A;  1BYQ A;  4LWF A;  1OSF A;  2YEB A;  1KIJ A;  4WUD A;  3T1K A;  4BXI A;  3Q5K A;  4O0B A;  2XHT A;  2FWY A;  3WQ9 A;  1UYK A;  5CF0 A;  5M4M A;  1S16 A;  3U2K A;  4CWO A;  2CH4 A;  5BOC A;  2XDU A;  3K97 A;  1YES A;  4EFT A;  4L94 A;  4LPB A;  2YEC A;  4ASB A;  2ESA A;  4XE2 A;  2FYP A;  2HKJ A;  2YKJ A;  4DUH A;  3B24 A;  4MB9 A;  2H55 A;  4YKW A;  2BU2 A;  4URN A;  4KFG A;  3H80 A;  4DZY A;  5CTU A;  1UY9 A;  4EGI A;  1I59 A;  4LWI A;  5CPH A;  3GIG B;  5FNC A;  2YE7 A;  2XJJ A;  1I5B A;  3T0H A;  3U2D A;  3WHA A;  1BKN A;  3OWB A;  4AWQ A;  1YSZ A;  4LWH A;  4BIZ A;  4HXZ A;  3B27 A;  3TTZ A;  1UY7 A;  3HZ1 A;  2IOR A;  2BU8 A;  2XDL A;  4CWN A;  4O07 A;  1NHI A;  1UYE A;  1H7U A;  4L93 A;  1ZW9 A;  3R91 A;  4HYM A;  1Y8O A;  3CRK A;  2WI4 A;  4JAU A;  1R62 A;  1TC0 A;  2QG0 A;  4QPK A;  2FXS A;  1A4H A;  2UWD A;  4AWP A;  1UY6 A;  3B25 A;  4PRX A;  4XKO A;  2H8M A;  3TZ4 A;  4XIQ A;  2YJX A;  4YKT A;  3A0Z A;  2FWZ A;  4I3H A; 
#chains in the Genus database with same CATH homology
 2XX5 A;  3KE6 A;  4L91 A;  2YE2 A;  2O1V A;  2QG2 A;  2YEJ A;  4H7Q A;  4MBC A;  2Q8G A;  2ZBK B;  2YE8 A;  3O2F A;  3B28 A;  2Q8I A;  1UYC A;  1TC6 A;  1AJ6 A;  1AH8 A;  4YKQ A;  1UYH A;  5FWK A;  4HY6 A;  2GFD A;  4E02 A;  2WI1 A;  4GQT A;  3C11 A;  3LNU A;  2IOQ A;  3BMY A;  4E00 A;  2XX2 A;  2XDS A;  2CG9 A;  2XCM A;  4WUB A;  4AS9 A;  2BU5 A;  5M4P A;  1US7 A;  2YEA A;  3TZ2 A;  4HZ0 A;  2E0A A;  3MNR P;  3K99 A;  4EEH A;  2ZDX A;  1B63 A;  2YI6 A;  5CTY A;  1UYF A;  3HEK A;  4LWG A;  4BQJ A;  4ZKI A;  2YI5 A;  2CCS A;  1MU5 A;  4YKX A;  4MP2 A;  4FCP A;  4EGK A;  3RLR A;  3ZKB A;  3BM9 A;  4XTJ A;  2CGF A;  4GGL A;  3CGY A;  2YEH A;  2YEF A;  2ZKJ A;  3R4M A;  2XJG A;  2Q8H A;  2Q2E B;  2YE9 A;  3QTF A;  3VHA A;  4Q20 A;  1YC4 A;  1Y8N A;  5IN9 A;  5M4E A;  2YED A;  4XIP A;  1Y4S A;  3R92 A;  3TZ0 A;  4XDM A;  2GQP A;  1YT1 A;  3T0Z A;  1TH8 A;  1S14 A;  1Z5A A;  1YER A;  1MX0 A;  3K60 A;  1ZXN A;  2WER A;  2XHX A;  3FT8 A;  4BIU A;  1U0Z A;  4FMT A;  4WUC A;  1GJV A;  3A0W A;  4BQG A;  4MPN A;  1THN A;  2YGA A;  4O04 A;  2BRC A;  5D7C A;  4PL9 A;  4FCQ A;  1KZN A;  5D7R A;  2PNR A;  3Q5L A;  2XDK A;  4JAV A;  1YET A;  2YI0 A;  4MP7 A;  2IWU A;  4GT8 A;  4YKZ A;  4KQV A;  5J71 A;  4URO A;  4E01 A;  4MPC A;  5FNF A;  2VW5 A;  4GEE A;  4NH8 A;  3A0T A;  2WI2 A;  4KSH A;  3ZKD A;  4GFN A;  1L0O A;  4ASF A;  4KTN A;  2YKC A;  4URM A;  1B62 A;  2YKI A;  4CWT A;  4EM7 A;  2QFO A;  3T2S A;  3D2R A;  4R3A A;  2XHR A;  3NMQ A;  1BXD A;  2BU6 A;  4B6C A;  2WI6 A;  2CCU A;  4V26 A;  4KSG A;  3TZ5 A;  3EKR A;  1YC3 A;  2BSM A;  2K5B A;  4HZ5 A;  1I5C A;  2QF6 A;  4PU9 A;  4MPE A;  4MOT A;  3ZXO A;  2JJC A;  4KP4 A;  1AH6 A;  1I5A A;  1EA6 A;  3G7B A;  3PEJ A;  4GCZ A;  3G7E A;  5D6P A;  1UYI A;  4O09 A;  5J6A A;  3T10 A;  4X9L A;  4JAS A;  4EGH A;  1UYL A;  3TUH A;  5GGZ A;  1UYM A;  1I58 A;  2XX4 A;  3QDD A;  3GIE A;  1U2O A;  3CRL A;  2EXL A;  2YEE A;  4ASA A;  1GKZ A;  1TBW A;  2O1U A;  4PRV A;  4HYP A;  4YKY A;  2XDX A;  5M4N A;  1Y4U A;  4B7P A;  1YT0 A;  5F5R A;  4K4O A;  2BYH A;  4U93 A;  2YE6 A;  2YK2 A;  4CE2 A;  3RLQ A;  5BOD A;  4W7T A;  1TIL A;  2WEQ A;  5FND A;  4HY1 A;  4NH7 A;  3R4O A;  3Q5J A;  4R3M A;  2VCJ A;  4JQL A;  3C0E A;  4ZVI A;  4CWF A;  1NHJ A;  2IOP A;  2AKP A;  3PEH A;  2BZ5 A;  5C93 A;  3INX A;  5D7D A;  2IWX A;  4U7O A;  3VHC A;  2XAB A;  3A0R A;  1UYG A;  1YC1 A;  1B3Q A;  4P7A A;  4EFU A;  4O05 A;  1AM1 A;  5F3K A;  4R1F A;  3K98 A;  5M4K A;  2IWS A;  3CWV A;  1Z5B A;  4L8Z A;  2WI5 A;  2JKI A;  4XIR A;  2YEG A;  4AWO A;  4CWQ A;  5CTX A;  2BU7 A;  1NHH A;  2WI3 A;  2XD6 A;  2ZDY A;  4XC0 A;  1H7S A;  1JM6 A;  2CCT A;  3JZ3 A;  2HCH A;  3RLP A;  4NH9 A;  2WEP A;  2Q8F A;  2YK9 A;  3VAD A;  1TID A;  4XD8 A;  4V25 A;  3RKZ A;  1PVG A;  3HYY A;  2YE5 A;  3GIG A;  3INW A;  2YKE A;  3G75 A;  4FPP A;  3VHD A;  3IED A;  3B26 A;  2XK2 A;  4EMV A;  3EHJ A;  3OMU A;  3CGZ A;  4XCL A;  3GIF A;  2BRE A;  3EHF A;  4XKK A;  2YJW A;  1QZR A;  4CWP A;  4I5S A;  3R4P A;  2YEI A;  4YKU A;  3ZXQ A;  3DGE A;  4CWR A;  3O6O A;  5D6Q A;  1ID0 A;  3A0X A;  4FCR A;  2YI7 A;  3FV5 A;  4ASG A;  5M4H A;  3OWD A;  4CWS A;  4P8O A;  3HZ5 A;  1YS3 A;  3D0B A;  3FT5 A;  3OW6 A;  4L90 A;  3H4L A;  1ZXM A;  5IDJ A;  2BT0 A;  4CE3 A;  1QY8 A;  1Z59 A;  3HHU A;  4XIT A;  4URL A;  1QYE A;  1AMW A;  1GKX A;  2O1W A;  3O0I A;  2XJX A;  2YGE A;  3D36 A;  3EHH A;  1Y8P A;  3OPD A;  3ZM7 A;  2VCI A;  3HYZ A;  4YKR A;  3EKO A;  2C2A A;  1UYD A;  2VWC A;  1YSR A;  2BYI A;  1I5D A;  2BTZ A;  3LPS A;  4H85 A;  2YE3 A;  5CTW A;  1BGQ A;  4XKA A;  1YT2 A;  3A0Y A;  3U67 A;  2WI7 A;  4XCJ A;  1Z5C A;  3EHG A;  3SL2 A;  3R4N A;  4HXW A;  1ZWH A;  2YE4 A;  4BAE A;  2HG1 A;  4LP0 A;  5IDM A;  1EI1 A;  4H81 A;  2YGF A;  4CE1 A;  2YKB A;  5L3J A;  4LWE A;  4U7N A;  1UY8 A;  4QPJ A;  1BYQ A;  4LWF A;  1OSF A;  2YEB A;  1KIJ A;  4WUD A;  3T1K A;  4BXI A;  3Q5K A;  4O0B A;  2XHT A;  2FWY A;  3WQ9 A;  1UYK A;  5CF0 A;  5M4M A;  1S16 A;  3U2K A;  4CWO A;  2CH4 A;  5BOC A;  2XDU A;  3K97 A;  1YES A;  4EFT A;  4L94 A;  4LPB A;  2YEC A;  4ASB A;  2ESA A;  4XE2 A;  2FYP A;  2HKJ A;  2YKJ A;  4DUH A;  3B24 A;  4MB9 A;  2H55 A;  4YKW A;  2BU2 A;  4URN A;  4KFG A;  3H80 A;  4DZY A;  5CTU A;  1UY9 A;  4EGI A;  1I59 A;  4LWI A;  5CPH A;  3GIG B;  5FNC A;  2YE7 A;  2XJJ A;  1I5B A;  3T0H A;  3U2D A;  3WHA A;  1BKN A;  3OWB A;  4AWQ A;  1YSZ A;  4LWH A;  4BIZ A;  4HXZ A;  3B27 A;  3TTZ A;  1UY7 A;  3HZ1 A;  2IOR A;  2BU8 A;  2XDL A;  4CWN A;  4O07 A;  1NHI A;  1UYE A;  1H7U A;  4L93 A;  1ZW9 A;  3R91 A;  4HYM A;  1Y8O A;  3CRK A;  2WI4 A;  4JAU A;  1R62 A;  1TC0 A;  2QG0 A;  4QPK A;  2FXS A;  1A4H A;  2UWD A;  4AWP A;  1UY6 A;  3B25 A;  4PRX A;  4XKO A;  2H8M A;  3TZ4 A;  4XIQ A;  2YJX A;  4YKT A;  3A0Z A;  2FWZ A;  4I3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...