4P8SA

Crystal structure of nogo-receptor-2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
282
Chain Sequence
PSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRSLRPGTFGPNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRTLRDTDFQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reticulon-4 receptor-like 2
publication title Crystal structure of the Nogo-receptor-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 86
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4p8sA00
3VQ1A 1A4YA 2ASTB 4BSRA 4BSUA 4CC4C 2IFGA 3RW7A 1O6VA 4M7EA 3M18A 3OGMB 4V2EA 5B4PA 3UN9A 3ULAA 5GS2B 3M19A 2WQXA 4FHOA 4EZGA 4V2DA 4B8CD 4AW4A 4L3FA 4R6GA 5CMNA 4WYKA 1A9NA 4RWTC 3RGZA 1XWDC 3C6OB 1DFJI 2OMZA 3RFSA 5IJCA 4K17A 3SB4A 3G39A 2UZXA 4YEBB 2BEXA 3WPIA 3CIYA 2P1NB 5IJBA 4LI1A 5B0TA 5GMFA 2JE1A 4ARRA 1OZNA 5FTTB 4KT1A 4U7LA 2OMVA 4Z79A 3W3NA 2ASSB 4FD0A 2Z65A 1OOKG 2OMXA 4UFRA 5GQRK 2P1PB 3G06A 4R58A 3UL7A 2V9TB 1FT8A 4Z61C 3W3JA 3JB9j 3PMHG 1XKUA 4MN8B 4CILA 3P72A 3ULVA 3WPDA 4R6JA 2A0ZA 1JL5A 4R09A 5AWDA 1KOHA 2Q4GW 4I6JB 4XOSA 3ZYIA 2P1QB 5IYXC 4LI2A 1H6UA 2OMTA 4FDWA 4R5DA 4V2CA 5AWAA 3REZA 3TSRE 2Z81A 1Z7XW 4R07A 1OTOA 3WPCA 2XWTC 3G04C 4U09A 4Y61B 2Z82A 3O6NA 3OJAB 3UL8A 2RR6A 4IM6A 2UZYA 5GS0A 1W8AA 4R5CA 4L3AA 3W3KA 4R0AA 4NKGA 3WN4A 4LSCA 1O6TA 4C2BB 3ZYJA 3G3AA 4PQ8A 4U08A 2Z7XB 2CA6A 4R08A 4LSXA 1K5DC 2WQVA 2Z66A 3E2JA 3ULUA 1XECA 4HQ1A 3RFJA 2XOTA 4QBZA 2O6QA 4ECOA 4R6FA 3ZYNA 1WWLA 4FCGA 2Y5QA 3WPBA 3W3LA 3RW6A 4M7EC 4GT6A 4PEQB 1FS2A 5B0NA 2WQWA 4Z8GA 1ZIWA 1FO1A 3FXIA 2Z63A 3WPEA 4CP6A 4Z94G 5IJDA 3RIZA 1U0ND 1P8VA 3E6JA 1OGQA 4CC4A 4LSXC 4U06A 1XCDA 3CVRA 3RFEA 5A5CA 5HZLB 3KJ4A 3CIGA 4FS7A 4PERA 1M9SA 5AZ5A 1P9AG 5HDHA 4FMZA 3OJAA 3OGLB 4C2AB 4Z64C 4R6AA 4PSJA 2OMYA 4LSAA 2P1MB 4RCAB 4WP6A 5AWBA 5AWCA 2Z7XA 1QYYA 2JE0A 2R9UA 1P8TA 4LXRA 4ECNA 2WQUA 2V70A 3C6NB 2OMWA 1G9UA 4TZHA 4RCWA 3RJ0A 3G3BA 4Q3IA 4KNGA 3E4GA 2WFHA 4NKHA 1DCEA 3A79B 4AY9X 2BNHA 2RA8A 1OTNA 2O6SA 4OQTA 4J4LA 4QC0A 1PGVA 3RGXA 3UL9A 3C6PB 1YRGA 3ZYOA 3BZ5A 1M10B 4Q62A 2ID5A 3E3ZA 4G8AA 1D0BA 5GMGA 1O6SA 1DS9A 4J0MA 2JQDA 4KXFB 1SQ0B 3WPFA 4ARNA 4CNMA 2FT3A 5D3IA 4H09A 2P1OB 1XEUA 2Z64A 3VQ2A 4BV4R 2V9SA 1K5GC 1FQVA 4BSSA 2OMUA 5CMPA 1LTXA 4XGOA 4LXSA 3WPGA 3W3GA 3DZEA 5LFNA 3GOZA 1KOOA 4QXEA 1M9LA 1OTMA 4PKIG 3OGKB 4P91A 4MQWX 3W3MA 1H6TA 1IO0A 4Q3GA 3WPHA 5GMHA 2ELLA 4XSQA 2O6RA 4P8SA 2Z62A 1M0ZA 4GLPA 4CNCA 1GWBA 3O53A
chains in the Genus database with same CATH superfamily
3VQ1A 1A4YA 2ASTB 4BSRA 4BSUA 4CC4C 2IFGA 3RW7A 1O6VA 4M7EA 3M18A 3OGMB 4V2EA 5B4PA 3UN9A 3ULAA 5GS2B 3M19A 2WQXA 4FHOA 4EZGA 4V2DA 4B8CD 4AW4A 4L3FA 4R6GA 5CMNA 4WYKA 1A9NA 4RWTC 3RGZA 1XWDC 3C6OB 1DFJI 2OMZA 3RFSA 5IJCA 4K17A 3SB4A 3G39A 2UZXA 4YEBB 2BEXA 3WPIA 3CIYA 2P1NB 5IJBA 4LI1A 5B0TA 5GMFA 2JE1A 4ARRA 1OZNA 5FTTB 4KT1A 4U7LA 2OMVA 4Z79A 3W3NA 2ASSB 4FD0A 2Z65A 1OOKG 2OMXA 4UFRA 5GQRK 2P1PB 3G06A 4R58A 3UL7A 2V9TB 1FT8A 4Z61C 3W3JA 3JB9j 3PMHG 1XKUA 4MN8B 4CILA 3P72A 3ULVA 3WPDA 4R6JA 2A0ZA 1JL5A 4R09A 5AWDA 1KOHA 2Q4GW 4I6JB 4XOSA 3ZYIA 2P1QB 5IYXC 4LI2A 1H6UA 2OMTA 4FDWA 4R5DA 4V2CA 5AWAA 3REZA 3TSRE 2Z81A 1Z7XW 4R07A 1OTOA 3WPCA 2XWTC 3G04C 4U09A 4Y61B 2Z82A 3O6NA 3OJAB 3UL8A 2RR6A 4IM6A 2UZYA 5GS0A 1W8AA 4R5CA 4L3AA 3W3KA 4R0AA 4NKGA 3WN4A 4LSCA 1O6TA 4C2BB 3ZYJA 3G3AA 4PQ8A 4U08A 2Z7XB 2CA6A 4R08A 4LSXA 1K5DC 2WQVA 2Z66A 3E2JA 3ULUA 1XECA 4HQ1A 3RFJA 2XOTA 4QBZA 2O6QA 4ECOA 4R6FA 3ZYNA 1WWLA 4FCGA 2Y5QA 3WPBA 3W3LA 3RW6A 4M7EC 4GT6A 4PEQB 1FS2A 5B0NA 2WQWA 4Z8GA 1ZIWA 1FO1A 3FXIA 2Z63A 3WPEA 4CP6A 4Z94G 5IJDA 3RIZA 1U0ND 1P8VA 3E6JA 1OGQA 4CC4A 4LSXC 4U06A 1XCDA 3CVRA 3RFEA 5A5CA 5HZLB 3KJ4A 3CIGA 4FS7A 4PERA 1M9SA 5AZ5A 1P9AG 5HDHA 4FMZA 3OJAA 3OGLB 4C2AB 4NZTM 4Z64C 4R6AA 4PSJA 2OMYA 4LSAA 2P1MB 4RCAB 4WP6A 5AWBA 5AWCA 2Z7XA 1QYYA 2JE0A 2R9UA 1P8TA 4LXRA 4ECNA 2WQUA 2V70A 3C6NB 2OMWA 1G9UA 4TZHA 4RCWA 3RJ0A 3G3BA 4Q3IA 4KNGA 3E4GA 2WFHA 4NKHA 1DCEA 3A79B 4AY9X 2BNHA 2RA8A 1OTNA 2O6SA 4OQTA 4J4LA 4QC0A 1PGVA 3RGXA 3UL9A 3C6PB 1YRGA 3ZYOA 3BZ5A 1M10B 4Q62A 2ID5A 3E3ZA 4G8AA 1D0BA 5GMGA 1O6SA 1DS9A 4J0MA 2JQDA 4KXFB 1SQ0B 3WPFA 4ARNA 4CNMA 2FT3A 5D3IA 4H09A 2P1OB 1XEUA 2Z64A 3VQ2A 4BV4R 2V9SA 1K5GC 1FQVA 4BSSA 4NZRM 2OMUA 5CMPA 1LTXA 4XGOA 4LXSA 3WPGA 3W3GA 3DZEA 5LFNA 3GOZA 1KOOA 4QXEA 1M9LA 1OTMA 4PKIG 3OGKB 4P91A 4MQWX 3W3MA 1H6TA 1IO0A 4Q3GA 3WPHA 5GMHA 2ELLA 4XSQA 2O6RA 4P8SA 2Z62A 1M0ZA 4GLPA 4CNCA 1GWBA 3O53A
chains in the Genus database with same CATH topology
3VQ1A 1A4YA 2ASTB 4BSRA 4BSUA 4CC4C 2IFGA 3RW7A 1O6VA 4M7EA 3M18A 3OGMB 4V2EA 5B4PA 3UN9A 3ULAA 5GS2B 3M19A 2WQXA 4FHOA 4EZGA 4V2DA 4B8CD 4AW4A 4L3FA 4R6GA 5CMNA 4WYKA 1A9NA 4RWTC 3RGZA 1XWDC 3C6OB 1DFJI 2OMZA 3RFSA 5IJCA 4K17A 3SB4A 3G39A 2UZXA 4YEBB 2BEXA 3WPIA 3CIYA 2P1NB 5IJBA 4LI1A 5B0TA 5GMFA 2JE1A 4ARRA 1OZNA 5FTTB 4KT1A 4U7LA 2OMVA 4Z79A 3W3NA 2ASSB 4FD0A 2Z65A 1OOKG 2OMXA 4UFRA 5GQRK 2P1PB 3G06A 4R58A 3UL7A 2V9TB 1FT8A 4Z61C 3W3JA 3JB9j 3PMHG 1XKUA 4MN8B 4CILA 3P72A 3ULVA 3WPDA 4R6JA 2A0ZA 1JL5A 4R09A 5AWDA 1KOHA 2Q4GW 4I6JB 4XOSA 3ZYIA 2P1QB 5IYXC 4LI2A 1H6UA 2OMTA 4FDWA 4R5DA 4V2CA 5AWAA 3REZA 3TSRE 2Z81A 1Z7XW 4R07A 1OTOA 3WPCA 2XWTC 3G04C 4U09A 4Y61B 2Z82A 3O6NA 3OJAB 3UL8A 2RR6A 4IM6A 2UZYA 5GS0A 1W8AA 4R5CA 4L3AA 3W3KA 4R0AA 4NKGA 3WN4A 4LSCA 1O6TA 4C2BB 3ZYJA 3G3AA 4PQ8A 4U08A 2Z7XB 2CA6A 4R08A 4LSXA 1K5DC 2WQVA 2Z66A 3E2JA 3ULUA 1XECA 4HQ1A 3RFJA 2XOTA 4QBZA 2O6QA 4ECOA 4R6FA 3ZYNA 1WWLA 4FCGA 2Y5QA 3WPBA 3W3LA 3RW6A 4M7EC 4GT6A 4PEQB 1FS2A 5B0NA 2WQWA 4Z8GA 1ZIWA 1FO1A 3FXIA 2Z63A 3WPEA 4CP6A 4Z94G 5IJDA 3RIZA 1U0ND 1P8VA 3E6JA 1OGQA 4CC4A 4LSXC 4U06A 1XCDA 3CVRA 3RFEA 5A5CA 5HZLB 3KJ4A 3CIGA 4FS7A 4PERA 1M9SA 5AZ5A 1P9AG 5HDHA 4FMZA 3OJAA 3OGLB 4C2AB 4Z64C 4R6AA 4PSJA 2OMYA 4LSAA 2P1MB 4RCAB 4WP6A 5AWBA 5AWCA 2Z7XA 1QYYA 2JE0A 2R9UA 1P8TA 4LXRA 4ECNA 2WQUA 2V70A 3C6NB 2OMWA 1G9UA 4TZHA 4RCWA 3RJ0A 3G3BA 4Q3IA 4KNGA 3E4GA 2WFHA 4NKHA 1DCEA 3A79B 4AY9X 2BNHA 2RA8A 1OTNA 2O6SA 4OQTA 4J4LA 4QC0A 1PGVA 3RGXA 3UL9A 3C6PB 1YRGA 3ZYOA 3BZ5A 1M10B 4Q62A 2ID5A 3E3ZA 4G8AA 1D0BA 5GMGA 1O6SA 1DS9A 4J0MA 2JQDA 4KXFB 1SQ0B 3WPFA 4ARNA 4CNMA 2FT3A 5D3IA 4H09A 2P1OB 1XEUA 2Z64A 3VQ2A 4BV4R 2V9SA 1K5GC 1FQVA 4BSSA 2OMUA 5CMPA 1LTXA 4XGOA 4LXSA 3WPGA 3W3GA 3DZEA 5LFNA 3GOZA 1KOOA 4QXEA 1M9LA 1OTMA 4PKIG 3OGKB 4P91A 4MQWX 3W3MA 1H6TA 1IO0A 4Q3GA 3WPHA 5GMHA 2ELLA 4XSQA 2O6RA 4P8SA 2Z62A 1M0ZA 4GLPA 4CNCA 1GWBA 3O53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ1 A;  1A4Y A;  2AST B;  4BSR A;  4BSU A;  4CC4 C;  2IFG A;  3RW7 A;  1O6V A;  4M7E A;  3M18 A;  3OGM B;  4V2E A;  5B4P A;  3UN9 A;  3ULA A;  5GS2 B;  3M19 A;  2WQX A;  4FHO A;  4EZG A;  4V2D A;  4B8C D;  4AW4 A;  4L3F A;  4R6G A;  5CMN A;  4WYK A;  1A9N A;  4RWT C;  3RGZ A;  1XWD C;  3C6O B;  1DFJ I;  2OMZ A;  3RFS A;  5IJC A;  4K17 A;  3SB4 A;  3G39 A;  2UZX A;  4YEB B;  2BEX A;  3WPI A;  3CIY A;  2P1N B;  5IJB A;  4LI1 A;  5B0T A;  5GMF A;  2JE1 A;  4ARR A;  1OZN A;  5FTT B;  4KT1 A;  4U7L A;  2OMV A;  4Z79 A;  3W3N A;  2ASS B;  4FD0 A;  2Z65 A;  1OOK G;  2OMX A;  4UFR A;  5GQR K;  2P1P B;  3G06 A;  4R58 A;  3UL7 A;  2V9T B;  1FT8 A;  4Z61 C;  3W3J A;  3JB9 j;  3PMH G;  1XKU A;  4MN8 B;  4CIL A;  3P72 A;  3ULV A;  3WPD A;  4R6J A;  2A0Z A;  1JL5 A;  4R09 A;  5AWD A;  1KOH A;  2Q4G W;  4I6J B;  4XOS A;  3ZYI A;  2P1Q B;  5IYX C;  4LI2 A;  1H6U A;  2OMT A;  4FDW A;  4R5D A;  4V2C A;  5AWA A;  3REZ A;  3TSR E;  2Z81 A;  1Z7X W;  4R07 A;  1OTO A;  3WPC A;  2XWT C;  3G04 C;  4U09 A;  4Y61 B;  2Z82 A;  3O6N A;  3OJA B;  3UL8 A;  2RR6 A;  4IM6 A;  2UZY A;  5GS0 A;  1W8A A;  4R5C A;  4L3A A;  3W3K A;  4R0A A;  4NKG A;  3WN4 A;  4LSC A;  1O6T A;  4C2B B;  3ZYJ A;  3G3A A;  4PQ8 A;  4U08 A;  2Z7X B;  2CA6 A;  4R08 A;  4LSX A;  1K5D C;  2WQV A;  2Z66 A;  3E2J A;  3ULU A;  1XEC A;  4HQ1 A;  3RFJ A;  2XOT A;  4QBZ A;  2O6Q A;  4ECO A;  4R6F A;  3ZYN A;  1WWL A;  4FCG A;  2Y5Q A;  3WPB A;  3W3L A;  3RW6 A;  4M7E C;  4GT6 A;  4PEQ B;  1FS2 A;  5B0N A;  2WQW A;  4Z8G A;  1ZIW A;  1FO1 A;  3FXI A;  2Z63 A;  3WPE A;  4CP6 A;  4Z94 G;  5IJD A;  3RIZ A;  1U0N D;  1P8V A;  3E6J A;  1OGQ A;  4CC4 A;  4LSX C;  4U06 A;  1XCD A;  3CVR A;  3RFE A;  5A5C A;  5HZL B;  3KJ4 A;  3CIG A;  4FS7 A;  4PER A;  1M9S A;  5AZ5 A;  1P9A G;  5HDH A;  4FMZ A;  3OJA A;  3OGL B;  4C2A B;  4Z64 C;  4R6A A;  4PSJ A;  2OMY A;  4LSA A;  2P1M B;  4RCA B;  4WP6 A;  5AWB A;  5AWC A;  2Z7X A;  1QYY A;  2JE0 A;  2R9U A;  1P8T A;  4LXR A;  4ECN A;  2WQU A;  2V70 A;  3C6N B;  2OMW A;  1G9U A;  4TZH A;  4RCW A;  3RJ0 A;  3G3B A;  4Q3I A;  4KNG A;  3E4G A;  2WFH A;  4NKH A;  1DCE A;  3A79 B;  4AY9 X;  2BNH A;  2RA8 A;  1OTN A;  2O6S A;  4OQT A;  4J4L A;  4QC0 A;  1PGV A;  3RGX A;  3UL9 A;  3C6P B;  1YRG A;  3ZYO A;  3BZ5 A;  1M10 B;  4Q62 A;  2ID5 A;  3E3Z A;  4G8A A;  1D0B A;  5GMG A;  1O6S A;  1DS9 A;  4J0M A;  2JQD A;  4KXF B;  1SQ0 B;  3WPF A;  4ARN A;  4CNM A;  2FT3 A;  5D3I A;  4H09 A;  2P1O B;  1XEU A;  2Z64 A;  3VQ2 A;  4BV4 R;  2V9S A;  1K5G C;  1FQV A;  4BSS A;  2OMU A;  5CMP A;  1LTX A;  4XGO A;  4LXS A;  3WPG A;  3W3G A;  3DZE A;  5LFN A;  3GOZ A;  1KOO A;  4QXE A;  1M9L A;  1OTM A;  4PKI G;  3OGK B;  4P91 A;  4MQW X;  3W3M A;  1H6T A;  1IO0 A;  4Q3G A;  3WPH A;  5GMH A;  2ELL A;  4XSQ A;  2O6R A;  4P8S A;  2Z62 A;  1M0Z A;  4GLP A;  4CNC A;  1GWB A;  3O53 A; 
#chains in the Genus database with same CATH topology
 3VQ1 A;  1A4Y A;  2AST B;  4BSR A;  4BSU A;  4CC4 C;  2IFG A;  3RW7 A;  1O6V A;  4M7E A;  3M18 A;  3OGM B;  4V2E A;  5B4P A;  3UN9 A;  3ULA A;  5GS2 B;  3M19 A;  2WQX A;  4FHO A;  4EZG A;  4V2D A;  4B8C D;  4AW4 A;  4L3F A;  4R6G A;  5CMN A;  4WYK A;  1A9N A;  4RWT C;  3RGZ A;  1XWD C;  3C6O B;  1DFJ I;  2OMZ A;  3RFS A;  5IJC A;  4K17 A;  3SB4 A;  3G39 A;  2UZX A;  4YEB B;  2BEX A;  3WPI A;  3CIY A;  2P1N B;  5IJB A;  4LI1 A;  5B0T A;  5GMF A;  2JE1 A;  4ARR A;  1OZN A;  5FTT B;  4KT1 A;  4U7L A;  2OMV A;  4Z79 A;  3W3N A;  2ASS B;  4FD0 A;  2Z65 A;  1OOK G;  2OMX A;  4UFR A;  5GQR K;  2P1P B;  3G06 A;  4R58 A;  3UL7 A;  2V9T B;  1FT8 A;  4Z61 C;  3W3J A;  3JB9 j;  3PMH G;  1XKU A;  4MN8 B;  4CIL A;  3P72 A;  3ULV A;  3WPD A;  4R6J A;  2A0Z A;  1JL5 A;  4R09 A;  5AWD A;  1KOH A;  2Q4G W;  4I6J B;  4XOS A;  3ZYI A;  2P1Q B;  5IYX C;  4LI2 A;  1H6U A;  2OMT A;  4FDW A;  4R5D A;  4V2C A;  5AWA A;  3REZ A;  3TSR E;  2Z81 A;  1Z7X W;  4R07 A;  1OTO A;  3WPC A;  2XWT C;  3G04 C;  4U09 A;  4Y61 B;  2Z82 A;  3O6N A;  3OJA B;  3UL8 A;  2RR6 A;  4IM6 A;  2UZY A;  5GS0 A;  1W8A A;  4R5C A;  4L3A A;  3W3K A;  4R0A A;  4NKG A;  3WN4 A;  4LSC A;  1O6T A;  4C2B B;  3ZYJ A;  3G3A A;  4PQ8 A;  4U08 A;  2Z7X B;  2CA6 A;  4R08 A;  4LSX A;  1K5D C;  2WQV A;  2Z66 A;  3E2J A;  3ULU A;  1XEC A;  4HQ1 A;  3RFJ A;  2XOT A;  4QBZ A;  2O6Q A;  4ECO A;  4R6F A;  3ZYN A;  1WWL A;  4FCG A;  2Y5Q A;  3WPB A;  3W3L A;  3RW6 A;  4M7E C;  4GT6 A;  4PEQ B;  1FS2 A;  5B0N A;  2WQW A;  4Z8G A;  1ZIW A;  1FO1 A;  3FXI A;  2Z63 A;  3WPE A;  4CP6 A;  4Z94 G;  5IJD A;  3RIZ A;  1U0N D;  1P8V A;  3E6J A;  1OGQ A;  4CC4 A;  4LSX C;  4U06 A;  1XCD A;  3CVR A;  3RFE A;  5A5C A;  5HZL B;  3KJ4 A;  3CIG A;  4FS7 A;  4PER A;  1M9S A;  5AZ5 A;  1P9A G;  5HDH A;  4FMZ A;  3OJA A;  3OGL B;  4C2A B;  4NZT M;  4Z64 C;  4R6A A;  4PSJ A;  2OMY A;  4LSA A;  2P1M B;  4RCA B;  4WP6 A;  5AWB A;  5AWC A;  2Z7X A;  1QYY A;  2JE0 A;  2R9U A;  1P8T A;  4LXR A;  4ECN A;  2WQU A;  2V70 A;  3C6N B;  2OMW A;  1G9U A;  4TZH A;  4RCW A;  3RJ0 A;  3G3B A;  4Q3I A;  4KNG A;  3E4G A;  2WFH A;  4NKH A;  1DCE A;  3A79 B;  4AY9 X;  2BNH A;  2RA8 A;  1OTN A;  2O6S A;  4OQT A;  4J4L A;  4QC0 A;  1PGV A;  3RGX A;  3UL9 A;  3C6P B;  1YRG A;  3ZYO A;  3BZ5 A;  1M10 B;  4Q62 A;  2ID5 A;  3E3Z A;  4G8A A;  1D0B A;  5GMG A;  1O6S A;  1DS9 A;  4J0M A;  2JQD A;  4KXF B;  1SQ0 B;  3WPF A;  4ARN A;  4CNM A;  2FT3 A;  5D3I A;  4H09 A;  2P1O B;  1XEU A;  2Z64 A;  3VQ2 A;  4BV4 R;  2V9S A;  1K5G C;  1FQV A;  4BSS A;  4NZR M;  2OMU A;  5CMP A;  1LTX A;  4XGO A;  4LXS A;  3WPG A;  3W3G A;  3DZE A;  5LFN A;  3GOZ A;  1KOO A;  4QXE A;  1M9L A;  1OTM A;  4PKI G;  3OGK B;  4P91 A;  4MQW X;  3W3M A;  1H6T A;  1IO0 A;  4Q3G A;  3WPH A;  5GMH A;  2ELL A;  4XSQ A;  2O6R A;  4P8S A;  2Z62 A;  1M0Z A;  4GLP A;  4CNC A;  1GWB A;  3O53 A; 
#chains in the Genus database with same CATH homology
 3VQ1 A;  1A4Y A;  2AST B;  4BSR A;  4BSU A;  4CC4 C;  2IFG A;  3RW7 A;  1O6V A;  4M7E A;  3M18 A;  3OGM B;  4V2E A;  5B4P A;  3UN9 A;  3ULA A;  5GS2 B;  3M19 A;  2WQX A;  4FHO A;  4EZG A;  4V2D A;  4B8C D;  4AW4 A;  4L3F A;  4R6G A;  5CMN A;  4WYK A;  1A9N A;  4RWT C;  3RGZ A;  1XWD C;  3C6O B;  1DFJ I;  2OMZ A;  3RFS A;  5IJC A;  4K17 A;  3SB4 A;  3G39 A;  2UZX A;  4YEB B;  2BEX A;  3WPI A;  3CIY A;  2P1N B;  5IJB A;  4LI1 A;  5B0T A;  5GMF A;  2JE1 A;  4ARR A;  1OZN A;  5FTT B;  4KT1 A;  4U7L A;  2OMV A;  4Z79 A;  3W3N A;  2ASS B;  4FD0 A;  2Z65 A;  1OOK G;  2OMX A;  4UFR A;  5GQR K;  2P1P B;  3G06 A;  4R58 A;  3UL7 A;  2V9T B;  1FT8 A;  4Z61 C;  3W3J A;  3JB9 j;  3PMH G;  1XKU A;  4MN8 B;  4CIL A;  3P72 A;  3ULV A;  3WPD A;  4R6J A;  2A0Z A;  1JL5 A;  4R09 A;  5AWD A;  1KOH A;  2Q4G W;  4I6J B;  4XOS A;  3ZYI A;  2P1Q B;  5IYX C;  4LI2 A;  1H6U A;  2OMT A;  4FDW A;  4R5D A;  4V2C A;  5AWA A;  3REZ A;  3TSR E;  2Z81 A;  1Z7X W;  4R07 A;  1OTO A;  3WPC A;  2XWT C;  3G04 C;  4U09 A;  4Y61 B;  2Z82 A;  3O6N A;  3OJA B;  3UL8 A;  2RR6 A;  4IM6 A;  2UZY A;  5GS0 A;  1W8A A;  4R5C A;  4L3A A;  3W3K A;  4R0A A;  4NKG A;  3WN4 A;  4LSC A;  1O6T A;  4C2B B;  3ZYJ A;  3G3A A;  4PQ8 A;  4U08 A;  2Z7X B;  2CA6 A;  4R08 A;  4LSX A;  1K5D C;  2WQV A;  2Z66 A;  3E2J A;  3ULU A;  1XEC A;  4HQ1 A;  3RFJ A;  2XOT A;  4QBZ A;  2O6Q A;  4ECO A;  4R6F A;  3ZYN A;  1WWL A;  4FCG A;  2Y5Q A;  3WPB A;  3W3L A;  3RW6 A;  4M7E C;  4GT6 A;  4PEQ B;  1FS2 A;  5B0N A;  2WQW A;  4Z8G A;  1ZIW A;  1FO1 A;  3FXI A;  2Z63 A;  3WPE A;  4CP6 A;  4Z94 G;  5IJD A;  3RIZ A;  1U0N D;  1P8V A;  3E6J A;  1OGQ A;  4CC4 A;  4LSX C;  4U06 A;  1XCD A;  3CVR A;  3RFE A;  5A5C A;  5HZL B;  3KJ4 A;  3CIG A;  4FS7 A;  4PER A;  1M9S A;  5AZ5 A;  1P9A G;  5HDH A;  4FMZ A;  3OJA A;  3OGL B;  4C2A B;  4Z64 C;  4R6A A;  4PSJ A;  2OMY A;  4LSA A;  2P1M B;  4RCA B;  4WP6 A;  5AWB A;  5AWC A;  2Z7X A;  1QYY A;  2JE0 A;  2R9U A;  1P8T A;  4LXR A;  4ECN A;  2WQU A;  2V70 A;  3C6N B;  2OMW A;  1G9U A;  4TZH A;  4RCW A;  3RJ0 A;  3G3B A;  4Q3I A;  4KNG A;  3E4G A;  2WFH A;  4NKH A;  1DCE A;  3A79 B;  4AY9 X;  2BNH A;  2RA8 A;  1OTN A;  2O6S A;  4OQT A;  4J4L A;  4QC0 A;  1PGV A;  3RGX A;  3UL9 A;  3C6P B;  1YRG A;  3ZYO A;  3BZ5 A;  1M10 B;  4Q62 A;  2ID5 A;  3E3Z A;  4G8A A;  1D0B A;  5GMG A;  1O6S A;  1DS9 A;  4J0M A;  2JQD A;  4KXF B;  1SQ0 B;  3WPF A;  4ARN A;  4CNM A;  2FT3 A;  5D3I A;  4H09 A;  2P1O B;  1XEU A;  2Z64 A;  3VQ2 A;  4BV4 R;  2V9S A;  1K5G C;  1FQV A;  4BSS A;  2OMU A;  5CMP A;  1LTX A;  4XGO A;  4LXS A;  3WPG A;  3W3G A;  3DZE A;  5LFN A;  3GOZ A;  1KOO A;  4QXE A;  1M9L A;  1OTM A;  4PKI G;  3OGK B;  4P91 A;  4MQW X;  3W3M A;  1H6T A;  1IO0 A;  4Q3G A;  3WPH A;  5GMH A;  2ELL A;  4XSQ A;  2O6R A;  4P8S A;  2Z62 A;  1M0Z A;  4GLP A;  4CNC A;  1GWB A;  3O53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...