4P91A

Crystal structure of the nogo-receptor-2 (27-330)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
286
structure length
286
Chain Sequence
PSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRSLRPGTFGPNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRTLRDTDFQACPPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reticulon-4 receptor-like 2
publication title Crystal structure of the Nogo-receptor-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 85
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4p91A00
1OTMA 3ZYOA 3W3NA 2JE1A 2A0ZA 5CMNA 1A9NA 4CILA 2Z63A 3E2JA 3SB4A 5A5CA 4PERA 2IFGA 4FS7A 2CA6A 4R58A 1P9AG 3WN4A 4UFRA 3G3BA 2JQDA 5AZ5A 1P8TA 1KOHA 5AWDA 3WPBA 2XWTC 2Y5QA 4P91A 3JB9j 3E4GA 4GLPA 1DFJI 3OGKB 4LI1A 4BSUA 4Z64C 4Z94G 1FO1A 1DS9A 1M9LA 3W3KA 1H6TA 3FXIA 3RFJA 4NKGA 4YEBB 4CC4A 3P72A 1M10B 2UZYA 2Q4GW 3E3ZA 5IYXC 3BZ5A 2P1NB 1A4YA 4R09A 2BEXA 4NKHA 3ZYIA 1D0BA 1SQ0B 3WPEA 2RA8A 3O53A 1H6UA 4XGOA 4J4LA 3CIYA 4MN8B 3W3LA 3KJ4A 1KOOA 5B0TA 2R9UA 2P1OB 1K5DC 4J0MA 5HDHA 4R5CA 4RCWA 4CC4C 4ECNA 4FCGA 3OJAB 3OGLB 1M9SA 4V2CA 4XOSA 1U0ND 1GWBA 5B0NA 4QXEA 1O6TA 3RW7A 2ASTB 1OGQA 2Z7XB 3CIGA 4U09A 4M7EA 5IJCA 3PMHG 1OOKG 1IO0A 3UL7A 4CNCA 4KT1A 4Q3IA 2WQWA 4IM6A 3UL9A 4FD0A 3W3JA 4P8SA 3WPHA 4HQ1A 4U08A 1YRGA 4WYKA 3TSRE 2ID5A 2RR6A 3UN9A 2OMWA 4BSRA 4LSAA 2OMVA 1XEUA 1JL5A 5GS2B 5HZLB 3GOZA 4ARNA 4FMZA 2O6RA 3W3MA 4RWTC 3REZA 4M7EC 5FTTB 2O6QA 4PKIG 1PGVA 2WFHA 4Q62A 4KNGA 4AY9X 1O6SA 5GS0A 1FQVA 4BSSA 3RFEA 2V9TB 4Z61C 2Z62A 1XCDA 2P1QB 4EZGA 4AW4A 3WPIA 2ASSB 4C2BB 4U7LA 1W8AA 5GQRK 3E6JA 1G9UA 4Q3GA 5B4PA 2FT3A 3RGZA 4QC0A 5GMGA 2OMTA 3DZEA 3RGXA 4CP6A 2Z82A 1ZIWA 3UL8A 5AWCA 1FT8A 4Z8GA 4L3FA 3G3AA 1XKUA 4LSCA 4KXFB 4XSQA 4LXSA 4TZHA 1O6VA 3M18A 2WQXA 3G39A 1LTXA 3G06A 4U06A 1QYYA 3C6NB 3RIZA 2Z81A 3G04C 4H09A 3VQ1A 4MQWX 4ARRA 3ZYJA 4B8CD 3ULAA 4OQTA 4I6JB 4C2AB 4CNMA 3OJAA 1OZNA 3O6NA 2WQVA 5D3IA 1WWLA 4R0AA 4RCAB 4V2EA 2BNHA 3W3GA 2Z7XA 4V2DA 4ECOA 4L3AA 2UZXA 4LI2A 4PQ8A 1DCEA 2OMYA 3CVRA 4FDWA 4LSXA 4R08A 2JE0A 3VQ2A 2ELLA 2V70A 1M0ZA 3WPFA 2OMZA 5LFNA 3ZYNA 1K5GC 2Z66A 4R6GA 2O6SA 4BV4R 4FHOA 4R6AA 2XOTA 4Z79A 2Z64A 3ULVA 3WPDA 1OTOA 3M19A 4WP6A 4Y61B 1FS2A 3RW6A 2OMXA 4R6FA 3OGMB 4K17A 1OTNA 4R6JA 3C6OB 4G8AA 2Z65A 4LSXC 4QBZA 4LXRA 4R5DA 5AWAA 4R07A 3C6PB 5CMPA 3RFSA 2WQUA 4PEQB 3WPCA 3RJ0A 1XECA 3ULUA 3WPGA 5IJBA 1Z7XW 5AWBA 1XWDC 1P8VA 2OMUA 2P1MB 5GMHA 4PSJA 4GT6A 5IJDA 2P1PB 3A79B 5GMFA 2V9SA
chains in the Genus database with same CATH superfamily
1OTMA 3ZYOA 3W3NA 4NZRM 2JE1A 2A0ZA 5CMNA 1A9NA 4CILA 2Z63A 3E2JA 3SB4A 5A5CA 4PERA 2IFGA 4FS7A 2CA6A 4R58A 1P9AG 3WN4A 4UFRA 3G3BA 2JQDA 5AZ5A 1P8TA 1KOHA 5AWDA 3WPBA 2XWTC 2Y5QA 4P91A 3JB9j 3E4GA 4GLPA 1DFJI 3OGKB 4LI1A 4BSUA 4Z64C 4Z94G 1FO1A 1DS9A 1M9LA 3W3KA 1H6TA 3FXIA 3RFJA 4NKGA 4YEBB 4CC4A 3P72A 1M10B 2UZYA 2Q4GW 3E3ZA 5IYXC 3BZ5A 2P1NB 1A4YA 4R09A 2BEXA 4NKHA 3ZYIA 1D0BA 1SQ0B 3WPEA 2RA8A 3O53A 1H6UA 4XGOA 4J4LA 3CIYA 4MN8B 3W3LA 3KJ4A 1KOOA 5B0TA 2R9UA 2P1OB 1K5DC 4J0MA 5HDHA 4R5CA 4RCWA 4CC4C 4ECNA 4FCGA 3OJAB 3OGLB 1M9SA 4V2CA 4XOSA 1U0ND 1GWBA 5B0NA 4QXEA 1O6TA 3RW7A 2ASTB 1OGQA 2Z7XB 3CIGA 4U09A 4M7EA 5IJCA 3PMHG 1OOKG 1IO0A 3UL7A 4CNCA 4KT1A 4Q3IA 2WQWA 4IM6A 3UL9A 4FD0A 3W3JA 4P8SA 3WPHA 4HQ1A 4U08A 1YRGA 4WYKA 3TSRE 2ID5A 2RR6A 3UN9A 2OMWA 4BSRA 4LSAA 2OMVA 1XEUA 1JL5A 5GS2B 5HZLB 3GOZA 4ARNA 4FMZA 2O6RA 3W3MA 4RWTC 3REZA 4M7EC 5FTTB 2O6QA 4PKIG 1PGVA 2WFHA 4Q62A 4KNGA 4AY9X 1O6SA 5GS0A 1FQVA 4BSSA 3RFEA 4NZTM 2V9TB 4Z61C 2Z62A 1XCDA 2P1QB 4EZGA 4AW4A 3WPIA 2ASSB 4C2BB 4U7LA 1W8AA 5GQRK 3E6JA 1G9UA 4Q3GA 5B4PA 2FT3A 3RGZA 4QC0A 5GMGA 2OMTA 3DZEA 3RGXA 4CP6A 2Z82A 1ZIWA 3UL8A 5AWCA 1FT8A 4Z8GA 4L3FA 3G3AA 1XKUA 4LSCA 4KXFB 4XSQA 4LXSA 4TZHA 1O6VA 3M18A 2WQXA 3G39A 1LTXA 3G06A 4U06A 1QYYA 3C6NB 3RIZA 2Z81A 3G04C 4H09A 3VQ1A 4MQWX 4ARRA 3ZYJA 4B8CD 3ULAA 4OQTA 4I6JB 4C2AB 4CNMA 3OJAA 1OZNA 3O6NA 2WQVA 5D3IA 1WWLA 4R0AA 4RCAB 4V2EA 2BNHA 3W3GA 2Z7XA 4V2DA 4ECOA 4L3AA 2UZXA 4LI2A 4PQ8A 1DCEA 2OMYA 3CVRA 4FDWA 4LSXA 4R08A 2JE0A 3VQ2A 2ELLA 2V70A 1M0ZA 3WPFA 2OMZA 5LFNA 3ZYNA 1K5GC 2Z66A 4R6GA 2O6SA 4BV4R 4FHOA 4R6AA 2XOTA 4Z79A 2Z64A 3ULVA 3WPDA 1OTOA 3M19A 4WP6A 4Y61B 1FS2A 3RW6A 2OMXA 4R6FA 3OGMB 4K17A 1OTNA 4R6JA 3C6OB 4G8AA 2Z65A 4LSXC 4QBZA 4LXRA 4R5DA 5AWAA 4R07A 3C6PB 5CMPA 3RFSA 2WQUA 4PEQB 3WPCA 3RJ0A 1XECA 3ULUA 3WPGA 5IJBA 1Z7XW 5AWBA 1XWDC 1P8VA 2OMUA 2P1MB 5GMHA 4PSJA 4GT6A 5IJDA 2P1PB 3A79B 5GMFA 2V9SA
chains in the Genus database with same CATH topology
1OTMA 3ZYOA 3W3NA 2JE1A 2A0ZA 5CMNA 1A9NA 4CILA 2Z63A 3E2JA 3SB4A 5A5CA 4PERA 2IFGA 4FS7A 2CA6A 4R58A 1P9AG 3WN4A 4UFRA 3G3BA 2JQDA 5AZ5A 1P8TA 1KOHA 5AWDA 3WPBA 2XWTC 2Y5QA 4P91A 3JB9j 3E4GA 4GLPA 1DFJI 3OGKB 4LI1A 4BSUA 4Z64C 4Z94G 1FO1A 1DS9A 1M9LA 3W3KA 1H6TA 3FXIA 3RFJA 4NKGA 4YEBB 4CC4A 3P72A 1M10B 2UZYA 2Q4GW 3E3ZA 5IYXC 3BZ5A 2P1NB 1A4YA 4R09A 2BEXA 4NKHA 3ZYIA 1D0BA 1SQ0B 3WPEA 2RA8A 3O53A 1H6UA 4XGOA 4J4LA 3CIYA 4MN8B 3W3LA 3KJ4A 1KOOA 5B0TA 2R9UA 2P1OB 1K5DC 4J0MA 5HDHA 4R5CA 4RCWA 4CC4C 4ECNA 4FCGA 3OJAB 3OGLB 1M9SA 4V2CA 4XOSA 1U0ND 1GWBA 5B0NA 4QXEA 1O6TA 3RW7A 2ASTB 1OGQA 2Z7XB 3CIGA 4U09A 4M7EA 5IJCA 3PMHG 1OOKG 1IO0A 3UL7A 4CNCA 4KT1A 4Q3IA 2WQWA 4IM6A 3UL9A 4FD0A 3W3JA 4P8SA 3WPHA 4HQ1A 4U08A 1YRGA 4WYKA 3TSRE 2ID5A 2RR6A 3UN9A 2OMWA 4BSRA 4LSAA 2OMVA 1XEUA 1JL5A 5GS2B 5HZLB 3GOZA 4ARNA 4FMZA 2O6RA 3W3MA 4RWTC 3REZA 4M7EC 5FTTB 2O6QA 4PKIG 1PGVA 2WFHA 4Q62A 4KNGA 4AY9X 1O6SA 5GS0A 1FQVA 4BSSA 3RFEA 2V9TB 4Z61C 2Z62A 1XCDA 2P1QB 4EZGA 4AW4A 3WPIA 2ASSB 4C2BB 4U7LA 1W8AA 5GQRK 3E6JA 1G9UA 4Q3GA 5B4PA 2FT3A 3RGZA 4QC0A 5GMGA 2OMTA 3DZEA 3RGXA 4CP6A 2Z82A 1ZIWA 3UL8A 5AWCA 1FT8A 4Z8GA 4L3FA 3G3AA 1XKUA 4LSCA 4KXFB 4XSQA 4LXSA 4TZHA 1O6VA 3M18A 2WQXA 3G39A 1LTXA 3G06A 4U06A 1QYYA 3C6NB 3RIZA 2Z81A 3G04C 4H09A 3VQ1A 4MQWX 4ARRA 3ZYJA 4B8CD 3ULAA 4OQTA 4I6JB 4C2AB 4CNMA 3OJAA 1OZNA 3O6NA 2WQVA 5D3IA 1WWLA 4R0AA 4RCAB 4V2EA 2BNHA 3W3GA 2Z7XA 4V2DA 4ECOA 4L3AA 2UZXA 4LI2A 4PQ8A 1DCEA 2OMYA 3CVRA 4FDWA 4LSXA 4R08A 2JE0A 3VQ2A 2ELLA 2V70A 1M0ZA 3WPFA 2OMZA 5LFNA 3ZYNA 1K5GC 2Z66A 4R6GA 2O6SA 4BV4R 4FHOA 4R6AA 2XOTA 4Z79A 2Z64A 3ULVA 3WPDA 1OTOA 3M19A 4WP6A 4Y61B 1FS2A 3RW6A 2OMXA 4R6FA 3OGMB 4K17A 1OTNA 4R6JA 3C6OB 4G8AA 2Z65A 4LSXC 4QBZA 4LXRA 4R5DA 5AWAA 4R07A 3C6PB 5CMPA 3RFSA 2WQUA 4PEQB 3WPCA 3RJ0A 1XECA 3ULUA 3WPGA 5IJBA 1Z7XW 5AWBA 1XWDC 1P8VA 2OMUA 2P1MB 5GMHA 4PSJA 4GT6A 5IJDA 2P1PB 3A79B 5GMFA 2V9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTM A;  3ZYO A;  3W3N A;  2JE1 A;  2A0Z A;  5CMN A;  1A9N A;  4CIL A;  2Z63 A;  3E2J A;  3SB4 A;  5A5C A;  4PER A;  2IFG A;  4FS7 A;  2CA6 A;  4R58 A;  1P9A G;  3WN4 A;  4UFR A;  3G3B A;  2JQD A;  5AZ5 A;  1P8T A;  1KOH A;  5AWD A;  3WPB A;  2XWT C;  2Y5Q A;  4P91 A;  3JB9 j;  3E4G A;  4GLP A;  1DFJ I;  3OGK B;  4LI1 A;  4BSU A;  4Z64 C;  4Z94 G;  1FO1 A;  1DS9 A;  1M9L A;  3W3K A;  1H6T A;  3FXI A;  3RFJ A;  4NKG A;  4YEB B;  4CC4 A;  3P72 A;  1M10 B;  2UZY A;  2Q4G W;  3E3Z A;  5IYX C;  3BZ5 A;  2P1N B;  1A4Y A;  4R09 A;  2BEX A;  4NKH A;  3ZYI A;  1D0B A;  1SQ0 B;  3WPE A;  2RA8 A;  3O53 A;  1H6U A;  4XGO A;  4J4L A;  3CIY A;  4MN8 B;  3W3L A;  3KJ4 A;  1KOO A;  5B0T A;  2R9U A;  2P1O B;  1K5D C;  4J0M A;  5HDH A;  4R5C A;  4RCW A;  4CC4 C;  4ECN A;  4FCG A;  3OJA B;  3OGL B;  1M9S A;  4V2C A;  4XOS A;  1U0N D;  1GWB A;  5B0N A;  4QXE A;  1O6T A;  3RW7 A;  2AST B;  1OGQ A;  2Z7X B;  3CIG A;  4U09 A;  4M7E A;  5IJC A;  3PMH G;  1OOK G;  1IO0 A;  3UL7 A;  4CNC A;  4KT1 A;  4Q3I A;  2WQW A;  4IM6 A;  3UL9 A;  4FD0 A;  3W3J A;  4P8S A;  3WPH A;  4HQ1 A;  4U08 A;  1YRG A;  4WYK A;  3TSR E;  2ID5 A;  2RR6 A;  3UN9 A;  2OMW A;  4BSR A;  4LSA A;  2OMV A;  1XEU A;  1JL5 A;  5GS2 B;  5HZL B;  3GOZ A;  4ARN A;  4FMZ A;  2O6R A;  3W3M A;  4RWT C;  3REZ A;  4M7E C;  5FTT B;  2O6Q A;  4PKI G;  1PGV A;  2WFH A;  4Q62 A;  4KNG A;  4AY9 X;  1O6S A;  5GS0 A;  1FQV A;  4BSS A;  3RFE A;  2V9T B;  4Z61 C;  2Z62 A;  1XCD A;  2P1Q B;  4EZG A;  4AW4 A;  3WPI A;  2ASS B;  4C2B B;  4U7L A;  1W8A A;  5GQR K;  3E6J A;  1G9U A;  4Q3G A;  5B4P A;  2FT3 A;  3RGZ A;  4QC0 A;  5GMG A;  2OMT A;  3DZE A;  3RGX A;  4CP6 A;  2Z82 A;  1ZIW A;  3UL8 A;  5AWC A;  1FT8 A;  4Z8G A;  4L3F A;  3G3A A;  1XKU A;  4LSC A;  4KXF B;  4XSQ A;  4LXS A;  4TZH A;  1O6V A;  3M18 A;  2WQX A;  3G39 A;  1LTX A;  3G06 A;  4U06 A;  1QYY A;  3C6N B;  3RIZ A;  2Z81 A;  3G04 C;  4H09 A;  3VQ1 A;  4MQW X;  4ARR A;  3ZYJ A;  4B8C D;  3ULA A;  4OQT A;  4I6J B;  4C2A B;  4CNM A;  3OJA A;  1OZN A;  3O6N A;  2WQV A;  5D3I A;  1WWL A;  4R0A A;  4RCA B;  4V2E A;  2BNH A;  3W3G A;  2Z7X A;  4V2D A;  4ECO A;  4L3A A;  2UZX A;  4LI2 A;  4PQ8 A;  1DCE A;  2OMY A;  3CVR A;  4FDW A;  4LSX A;  4R08 A;  2JE0 A;  3VQ2 A;  2ELL A;  2V70 A;  1M0Z A;  3WPF A;  2OMZ A;  5LFN A;  3ZYN A;  1K5G C;  2Z66 A;  4R6G A;  2O6S A;  4BV4 R;  4FHO A;  4R6A A;  2XOT A;  4Z79 A;  2Z64 A;  3ULV A;  3WPD A;  1OTO A;  3M19 A;  4WP6 A;  4Y61 B;  1FS2 A;  3RW6 A;  2OMX A;  4R6F A;  3OGM B;  4K17 A;  1OTN A;  4R6J A;  3C6O B;  4G8A A;  2Z65 A;  4LSX C;  4QBZ A;  4LXR A;  4R5D A;  5AWA A;  4R07 A;  3C6P B;  5CMP A;  3RFS A;  2WQU A;  4PEQ B;  3WPC A;  3RJ0 A;  1XEC A;  3ULU A;  3WPG A;  5IJB A;  1Z7X W;  5AWB A;  1XWD C;  1P8V A;  2OMU A;  2P1M B;  5GMH A;  4PSJ A;  4GT6 A;  5IJD A;  2P1P B;  3A79 B;  5GMF A;  2V9S A; 
#chains in the Genus database with same CATH topology
 1OTM A;  3ZYO A;  3W3N A;  4NZR M;  2JE1 A;  2A0Z A;  5CMN A;  1A9N A;  4CIL A;  2Z63 A;  3E2J A;  3SB4 A;  5A5C A;  4PER A;  2IFG A;  4FS7 A;  2CA6 A;  4R58 A;  1P9A G;  3WN4 A;  4UFR A;  3G3B A;  2JQD A;  5AZ5 A;  1P8T A;  1KOH A;  5AWD A;  3WPB A;  2XWT C;  2Y5Q A;  4P91 A;  3JB9 j;  3E4G A;  4GLP A;  1DFJ I;  3OGK B;  4LI1 A;  4BSU A;  4Z64 C;  4Z94 G;  1FO1 A;  1DS9 A;  1M9L A;  3W3K A;  1H6T A;  3FXI A;  3RFJ A;  4NKG A;  4YEB B;  4CC4 A;  3P72 A;  1M10 B;  2UZY A;  2Q4G W;  3E3Z A;  5IYX C;  3BZ5 A;  2P1N B;  1A4Y A;  4R09 A;  2BEX A;  4NKH A;  3ZYI A;  1D0B A;  1SQ0 B;  3WPE A;  2RA8 A;  3O53 A;  1H6U A;  4XGO A;  4J4L A;  3CIY A;  4MN8 B;  3W3L A;  3KJ4 A;  1KOO A;  5B0T A;  2R9U A;  2P1O B;  1K5D C;  4J0M A;  5HDH A;  4R5C A;  4RCW A;  4CC4 C;  4ECN A;  4FCG A;  3OJA B;  3OGL B;  1M9S A;  4V2C A;  4XOS A;  1U0N D;  1GWB A;  5B0N A;  4QXE A;  1O6T A;  3RW7 A;  2AST B;  1OGQ A;  2Z7X B;  3CIG A;  4U09 A;  4M7E A;  5IJC A;  3PMH G;  1OOK G;  1IO0 A;  3UL7 A;  4CNC A;  4KT1 A;  4Q3I A;  2WQW A;  4IM6 A;  3UL9 A;  4FD0 A;  3W3J A;  4P8S A;  3WPH A;  4HQ1 A;  4U08 A;  1YRG A;  4WYK A;  3TSR E;  2ID5 A;  2RR6 A;  3UN9 A;  2OMW A;  4BSR A;  4LSA A;  2OMV A;  1XEU A;  1JL5 A;  5GS2 B;  5HZL B;  3GOZ A;  4ARN A;  4FMZ A;  2O6R A;  3W3M A;  4RWT C;  3REZ A;  4M7E C;  5FTT B;  2O6Q A;  4PKI G;  1PGV A;  2WFH A;  4Q62 A;  4KNG A;  4AY9 X;  1O6S A;  5GS0 A;  1FQV A;  4BSS A;  3RFE A;  4NZT M;  2V9T B;  4Z61 C;  2Z62 A;  1XCD A;  2P1Q B;  4EZG A;  4AW4 A;  3WPI A;  2ASS B;  4C2B B;  4U7L A;  1W8A A;  5GQR K;  3E6J A;  1G9U A;  4Q3G A;  5B4P A;  2FT3 A;  3RGZ A;  4QC0 A;  5GMG A;  2OMT A;  3DZE A;  3RGX A;  4CP6 A;  2Z82 A;  1ZIW A;  3UL8 A;  5AWC A;  1FT8 A;  4Z8G A;  4L3F A;  3G3A A;  1XKU A;  4LSC A;  4KXF B;  4XSQ A;  4LXS A;  4TZH A;  1O6V A;  3M18 A;  2WQX A;  3G39 A;  1LTX A;  3G06 A;  4U06 A;  1QYY A;  3C6N B;  3RIZ A;  2Z81 A;  3G04 C;  4H09 A;  3VQ1 A;  4MQW X;  4ARR A;  3ZYJ A;  4B8C D;  3ULA A;  4OQT A;  4I6J B;  4C2A B;  4CNM A;  3OJA A;  1OZN A;  3O6N A;  2WQV A;  5D3I A;  1WWL A;  4R0A A;  4RCA B;  4V2E A;  2BNH A;  3W3G A;  2Z7X A;  4V2D A;  4ECO A;  4L3A A;  2UZX A;  4LI2 A;  4PQ8 A;  1DCE A;  2OMY A;  3CVR A;  4FDW A;  4LSX A;  4R08 A;  2JE0 A;  3VQ2 A;  2ELL A;  2V70 A;  1M0Z A;  3WPF A;  2OMZ A;  5LFN A;  3ZYN A;  1K5G C;  2Z66 A;  4R6G A;  2O6S A;  4BV4 R;  4FHO A;  4R6A A;  2XOT A;  4Z79 A;  2Z64 A;  3ULV A;  3WPD A;  1OTO A;  3M19 A;  4WP6 A;  4Y61 B;  1FS2 A;  3RW6 A;  2OMX A;  4R6F A;  3OGM B;  4K17 A;  1OTN A;  4R6J A;  3C6O B;  4G8A A;  2Z65 A;  4LSX C;  4QBZ A;  4LXR A;  4R5D A;  5AWA A;  4R07 A;  3C6P B;  5CMP A;  3RFS A;  2WQU A;  4PEQ B;  3WPC A;  3RJ0 A;  1XEC A;  3ULU A;  3WPG A;  5IJB A;  1Z7X W;  5AWB A;  1XWD C;  1P8V A;  2OMU A;  2P1M B;  5GMH A;  4PSJ A;  4GT6 A;  5IJD A;  2P1P B;  3A79 B;  5GMF A;  2V9S A; 
#chains in the Genus database with same CATH homology
 1OTM A;  3ZYO A;  3W3N A;  2JE1 A;  2A0Z A;  5CMN A;  1A9N A;  4CIL A;  2Z63 A;  3E2J A;  3SB4 A;  5A5C A;  4PER A;  2IFG A;  4FS7 A;  2CA6 A;  4R58 A;  1P9A G;  3WN4 A;  4UFR A;  3G3B A;  2JQD A;  5AZ5 A;  1P8T A;  1KOH A;  5AWD A;  3WPB A;  2XWT C;  2Y5Q A;  4P91 A;  3JB9 j;  3E4G A;  4GLP A;  1DFJ I;  3OGK B;  4LI1 A;  4BSU A;  4Z64 C;  4Z94 G;  1FO1 A;  1DS9 A;  1M9L A;  3W3K A;  1H6T A;  3FXI A;  3RFJ A;  4NKG A;  4YEB B;  4CC4 A;  3P72 A;  1M10 B;  2UZY A;  2Q4G W;  3E3Z A;  5IYX C;  3BZ5 A;  2P1N B;  1A4Y A;  4R09 A;  2BEX A;  4NKH A;  3ZYI A;  1D0B A;  1SQ0 B;  3WPE A;  2RA8 A;  3O53 A;  1H6U A;  4XGO A;  4J4L A;  3CIY A;  4MN8 B;  3W3L A;  3KJ4 A;  1KOO A;  5B0T A;  2R9U A;  2P1O B;  1K5D C;  4J0M A;  5HDH A;  4R5C A;  4RCW A;  4CC4 C;  4ECN A;  4FCG A;  3OJA B;  3OGL B;  1M9S A;  4V2C A;  4XOS A;  1U0N D;  1GWB A;  5B0N A;  4QXE A;  1O6T A;  3RW7 A;  2AST B;  1OGQ A;  2Z7X B;  3CIG A;  4U09 A;  4M7E A;  5IJC A;  3PMH G;  1OOK G;  1IO0 A;  3UL7 A;  4CNC A;  4KT1 A;  4Q3I A;  2WQW A;  4IM6 A;  3UL9 A;  4FD0 A;  3W3J A;  4P8S A;  3WPH A;  4HQ1 A;  4U08 A;  1YRG A;  4WYK A;  3TSR E;  2ID5 A;  2RR6 A;  3UN9 A;  2OMW A;  4BSR A;  4LSA A;  2OMV A;  1XEU A;  1JL5 A;  5GS2 B;  5HZL B;  3GOZ A;  4ARN A;  4FMZ A;  2O6R A;  3W3M A;  4RWT C;  3REZ A;  4M7E C;  5FTT B;  2O6Q A;  4PKI G;  1PGV A;  2WFH A;  4Q62 A;  4KNG A;  4AY9 X;  1O6S A;  5GS0 A;  1FQV A;  4BSS A;  3RFE A;  2V9T B;  4Z61 C;  2Z62 A;  1XCD A;  2P1Q B;  4EZG A;  4AW4 A;  3WPI A;  2ASS B;  4C2B B;  4U7L A;  1W8A A;  5GQR K;  3E6J A;  1G9U A;  4Q3G A;  5B4P A;  2FT3 A;  3RGZ A;  4QC0 A;  5GMG A;  2OMT A;  3DZE A;  3RGX A;  4CP6 A;  2Z82 A;  1ZIW A;  3UL8 A;  5AWC A;  1FT8 A;  4Z8G A;  4L3F A;  3G3A A;  1XKU A;  4LSC A;  4KXF B;  4XSQ A;  4LXS A;  4TZH A;  1O6V A;  3M18 A;  2WQX A;  3G39 A;  1LTX A;  3G06 A;  4U06 A;  1QYY A;  3C6N B;  3RIZ A;  2Z81 A;  3G04 C;  4H09 A;  3VQ1 A;  4MQW X;  4ARR A;  3ZYJ A;  4B8C D;  3ULA A;  4OQT A;  4I6J B;  4C2A B;  4CNM A;  3OJA A;  1OZN A;  3O6N A;  2WQV A;  5D3I A;  1WWL A;  4R0A A;  4RCA B;  4V2E A;  2BNH A;  3W3G A;  2Z7X A;  4V2D A;  4ECO A;  4L3A A;  2UZX A;  4LI2 A;  4PQ8 A;  1DCE A;  2OMY A;  3CVR A;  4FDW A;  4LSX A;  4R08 A;  2JE0 A;  3VQ2 A;  2ELL A;  2V70 A;  1M0Z A;  3WPF A;  2OMZ A;  5LFN A;  3ZYN A;  1K5G C;  2Z66 A;  4R6G A;  2O6S A;  4BV4 R;  4FHO A;  4R6A A;  2XOT A;  4Z79 A;  2Z64 A;  3ULV A;  3WPD A;  1OTO A;  3M19 A;  4WP6 A;  4Y61 B;  1FS2 A;  3RW6 A;  2OMX A;  4R6F A;  3OGM B;  4K17 A;  1OTN A;  4R6J A;  3C6O B;  4G8A A;  2Z65 A;  4LSX C;  4QBZ A;  4LXR A;  4R5D A;  5AWA A;  4R07 A;  3C6P B;  5CMP A;  3RFS A;  2WQU A;  4PEQ B;  3WPC A;  3RJ0 A;  1XEC A;  3ULU A;  3WPG A;  5IJB A;  1Z7X W;  5AWB A;  1XWD C;  1P8V A;  2OMU A;  2P1M B;  5GMH A;  4PSJ A;  4GT6 A;  5IJD A;  2P1P B;  3A79 B;  5GMF A;  2V9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...