4P9HH

Crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv-1 and soluble cd4 d1d2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
231
structure length
215
Chain Sequence
QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAVNWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLISAVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTYDKWSGLHHDGVMAFSSWGQGTLISVSAASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Antibody 8ANC195 Reveals a Site of Broad Vulnerability on the HIV-1 Envelope Spike.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 37
structure length 215
sequence length 231
ec nomenclature
pdb deposition date 2014-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hH01
4MNGE 2ZCLL 1IAOA 5TDOB 3BQUC 5ERWB 1DUZA 2O5ZL 5DR5H 1A1MA 2E6QA 1BVKA 2VLKD 5KSAA 2Y07L 3VXTB 4BFIB 5FHBH 5KSBA 1LEKB 1MRFL 5EU5B 4AJ0A 2PN5A 3VWJC 3IRPX 4ZSOA 3MBEC 1A7NL 3JTTB 1JF5A 2DI9A 2H3NB 3ALXA 5CZVH 1BGXH 4JDZA 5HYJB 1PW3A 5E8PB 3TO2A 4BK4A 5JXAL 4X6DF 1ZLWH 5IB1A 3ARDC 4TQEH 3TWCH 3E8UL 5EU4B 3KGRA 3UJJL 4PJ9D 2F5BH 4P4KB 4U2ZA 1GZQA 3X14A 1H3GA 1FN4A 4GAJL 5SX4I 3L5IA 3O3DA 2GFBB 4XI5D 4U1NA 4R2GB 1KCVL 2OTWB 3K80A 5DD5L 3KG5A 2DYPA 2VLMD 1KEGL 3DURA 3NH7H 3MRQB 3F8UB 2V2XB 4C55A 1MCPL 4GKSB 3MODL 4PJ5E 4APQA 2YD3A 4JG0L 4F7PB 4X4MA 5ALBH 2EE6A 3EGSB 1YNKL 1BIIB 3FT3A 4RSVA 5L2JB 1U8KA 1T80A 1KACB 4X9HA 3GM8A 4DN4H 3FFCD 5DJAA 4R26H 1IAIH 1EFQA 1NDMB 4L4TE 3ZT5A 1TTUA 4OCRL 4YAQA 1G7HB 2CDEA 4I0KA 5D72L 5C7XL 3RNQA 1WQVT 1NGWA 2XFXB 4JM2F 5FYJE 1C12B 3EO1A 4XP5L 2DQFA 5J1AA 3FO2B 1FDLL 2D9QB 4G8GB 3B2VL 3LD8B 3MRIB 4RRPG 3BPNC 2AJXH 4MGXA 1AO7E 3B43A 1CGTA 2R2HA 1IQDA 2BHUA 2XTJE 4GMSH 1K2DA 3QHTC 3MLRH 4IHOA 5C9JB 4NZUH 4WO4A 4Q6IB 4P2OA 5FAAA 4JO2L 1JI2A 1BPVA 4JO1H 4I3SH 1HHHB 1TCMA 1CXFA 4FFZL 4EI6B 2AJVL 4TULL 4PG2C 4MXWL 1YJDH 5AZ2H 5F9WB 1OD9A 2Y4SA 1HDMA 5IFAL 3VRLE 1BM3L 2YSSB 3RVTD 3FB8A 2GKIA 1JGVH 4OQTA 3TJEL 5KSUB 5D7JA 3AAZA 1JTOA 2DI7A 3QXWA 2HTLC 1NAMB 3CH1B 1FCCA 3QIBC 5CJQL 4RGMB 1JZ5A 3ZO0A 3L7EA 2B4CC 4XWOC 3PV6B 3HI1A 3B8SA 5D96C 5KVDL 1NFDB 4LDOB 3JV5A 3VXSA 3U9UA 4IS6A 5TFSL 4I48A 2H6PA 3IKCB 1NEUA 3CVHH 2OZ4L 3ZMRA 5HYIA 5DJYB 5C0FB 4WCYH 5F1OB 3OB0K 4HT1L 4KKCC 5ACMA 1FH5L 1HKLH 1LILA 2X7LA 5IM7A 2E9JA 4YDKL 4ZFFA 3Q5YA 4G9DB 5BRZB 1FYHB 1DQJB 1FNFA 4PRAA 1ZHBB 3WLWC 4NNPL 4P46C 1ZHKB 4K2UL 1QBAA 1GGCL 5BCAA 4OCYL 1VEPA 1EZVY 5BZWB 4HF5H 1EEYB 1ZSDB 4FFVD 1ODAA 3N1MC 4RBPK 2V5MA 1NDGB 3SOBH 1AGDA 2NZ9D 3CXDL 3P77A 1UB6B 2KQMA 4PJEA 3V5HA 3IJYA 1MREL 3LKPA 3ULVD 5HHXH 4PRNA 1XR8B 3W82A 1XF5A 3V5DA 3NABL 1FJ1A 4MCYB 1X5ZA 3QDMB 2HTKC 4OIBA 5IVXE 4EI5C 5B38G 3ZKQD 5I1AA 4HMCA 2OJZL 3GRWH 3HC4H 1A7QH 4Y5XB 2ILLA 1LNUB 1JHLH 4PGDB 4JPWL 1ND0A 4KXZH 2VC2L 4OF0A 2AJZB 3IDGA 3QEQE 5HJ3B 3FTGA 5FDWB 3SGDI 2XTLA 4WTWA 3MOBL 3HZVB 4JFDE 2FLRT 3JTSA 4CVXA 2XTJC 4KMTH 3GMMA 2GITB 3ME0A 2YKLL 5HHVL 2CPCA 4NWUL 4JPIA 4OLUH 4J3UA 4M7KH 3ILPA 2W92A 4XCNA 2I07B 3OGCA 1R24B 4ODHH 4ODUB 1PYWA 4AH2B 2D0HA 1R3KB 3CFDB 2VDOL 2VDNL 1CG9A 1V7ML 4JZNB 3FQXB 1HYSD 3D48R 4FQHB 5D7LA 4Z7OF 2NY6C 3BN9D 3O11B 3SHSA 4L3CB 2LVEA 4TVPE 4Z7VE 1C16A 5F97E 1B4JH 1ZGLA 2ZUWA 1HCFX 4NWTH 4HLZH 4M8VA 2C26A 3FB6A 3GMRB 2DJUA 1I1CA 1J11A 1EEZB 1JP5A 5HGAA 1FLTX 4Y4KA 3MRLA 2XQYK 4H5SB 2QHLA 1CQKA 4NZRH 4HEPG 4M4PA 4JM4L 4F9LA 4HXBH 3CVHA 3C9NB 3EO9L 5KJRL 5F9AC 4C56A 1F6AB 1HHGB 2ARJQ 1NCAL 3MR9A 3PDDA 4J23A 4Z0XA 5BV7L 2JCCB 3T3PE 2UWEE 3QULB 4ONOA 3LHPL 4P59L 1FAKT 3S34L 3MJ9L 1IRAY 5ITFA 1CBVH 5FCUH 4NT6A 1KFAL 4IDJL 5C6PB 3K8KA 4D9LH 1QHOA 3SDDC 4OZHB 2BVPA 3WS3B 4JRYB 2DWEA 4Y16D 3KPQA 5K9QI 2DICA 3T2OA 4O2FA 1AP2A 1CYGA 1FGNH 1JN6A 2LTQB 7FABL 4HH9B 1ZXQA 1AHWB 1WIPA 2H26A 1I8MA 1ZMYA 4JQVA 5D6CB 1GYAA 4H0GA 4KV5F 3ES6A 1HN1A 5GS0H 2FLBT 1AE6L 2HRPH 2XT1B 4HUKB 4MJ5B 3UAJD 4LPXA 4NDMB 2EYTB 4FTVD 3ULUE 1CE1H 2G9HB 2FHCA 3MV8D 3PWVB 2JCCF 4WI8A 4LHJB 2DJSA 1YEKH 1LE5B 4YHOH 3KR3H 3EHBC 3FZUC 2IPTL 3LKQB 1H8SA 3GMNA 4MXVE 3B5GA 3D2UD 1MJ7L 1F4XL 3MRNB 1EUTA 1MHPH 5FEBA 3GRWA 5B8CB 3O6ML 3IU3A 4OZHF 1YPZB 1MH5A 1J7VR 1KLUB 4LU5H 1ZHLA 3WNMA 5HYSA 5E7FA 4JHAH 2R4RH 4IRJA 3B2UC 3RGVB 5L8KB 3CMGA 5DLMH 4NRZB 5IWLC 3P0VH 3TZVD 2EE2A 4K71B 4YPGB 1UM4L 4XVSH 3PGDB 2DQEH 3KWWB 4PJIE 5SWSE 1KCUH 1MHHA 1D6EB 5IJVA 1RQ5A 2C1PA 4XZUB 3WEXB 4HWUA 4ODSL 3OKDA 4UQ2B 3T2QA 3C09B 1UM5H 1CE6A 2XG4A 4C59B 2LAGB 4N8CL 2G60L 4QTHB 4ODBD 5CCKH 1JGLH 4U6VH 2WBKA 4KJWC 4MNQE 1QFWL 1RUML 4LNRA 5IW3A 1IGJA 4LOUD 5ETUB 4RISL 5DDHA 2X42A 3NCYP 5GRXG 1UH3A 5FUOH 4W81A 3SE3A 5FO7A 4XH2A 5IMLA 1FGVH 4AENA 1MIEL 3QUZA 3W0WE 4JE4B 1QNZL 3WN5C 1WC7A 6CGTA 3DX7B 3T65B 4XVTH 5DD3H 5A3ID 1S7TB 4ETQA 1SVZA 4PJGA 3I9GH 4A6YB 5ACZB 3LVEA 5KSAD 2GEEA 4QGYA 3BMWA 5FIEA 1CL7L 1MHCA 2J3SA 4I3GA 5IG7A 4MX7A 3EDKA 2XNAB 3BRGC 2CIKA 5C0RH 2DM2A 2X4QB 4MYWB 2COQA 4OUUB 3V6ZA 2APFA 1WAAE 1F3JB 1FRGL 4N90D 1UKTA 1JYXA 3WNLA 2VDRL 1MJUL 5HDLA 2MCPL 3O2VL 5DUML 4JO4H 3HLAA 5GJSL 4PYGA 1B2WL 3MYJA 3PABA 2NY4C 4ODVL 4ZS6C 5GS2H 2BNQB 4P4RA 4LGSB 1RV6X 3BN3B 4UDTA 3BP7A 5JW4N 1GGBL 3O8XC 43CAA 3IFNL 2FO4B 1NMBH 4XMLH 3RX7A 3MLWH 2DYPD 1WWWX 4HK3J 3ULUC 4U3HA 2Z4QB 3QUYB 4XVUD 5FYKE 4APQD 4M7LL 4P2CG 4AM0B 2EZ0D 1A4KB 1IEAB 5AWNH 5CP7B 1JHKL 5LCVH 2FO1A 2HN7B 3WJLC 1QLFB 2P44B 2HVKA 5GGVY 2CIIB 5C0GA 3DVIA 4FNLH 4UIKH 2BZDA 1A02N 5D1ZC 3MRPB 2ERJC 3CK0H 3PWPE 4PLJC 4AMKL 2I9TA 4FQIH 4KHTH 4BSVA 4LSSH 3MLVL 4OLXL 4JRXA 5TPWL 5E00B 1SYSA 2WAHA 3MGOA 3MYZA 1P4BL 4JFQA 3HS0A 3RJDA 4P3DB 2HT4D 4TTDD 1V8HA 3U83A 3D25B 3GNML 3P11H 5DD1L 4HWNA 1D5IH 1I7TA 5FA3A 1A9BA 1KELL 2EIZB 4MCZA 4WO4D 4P2OD 5BV7C 4GS7B 1LO5A 1FAIH 4DJMA 2H2SD 3BPOC 4HKJB 1NGXA 3ARYA 2AV1A 3I6LD 5T5FH 1WBXB 1N59A 4ONFL 2BOBA 5C0JB 2CGRH 1NLBH 3STLA 4D8PA 4H8WL 4PRHE 1EHAA 1FNEB 3PDOA 1YY8A 4OD3L 1G9MC 3U4AA 1RK0B 2A9NH 4HIXL 5BVJB 5D7JD 1EO8H 1RMFH 2AEQH 3N0PB 4NBYB 4G6KH 2HRLA 1QLEH 4MD4A 4JQXC 1NAML 2ICEA 3PJSA 1N6QL 2R9HD 3NAAL 5ECJE 1CICB 4XP1H 3RX5A 4C4KT 5EU6A 4KK8D 1JFQH 1ZVHA 4TOYH 3TYGL 4G9FA 2P8LB 5ILTL 3U7YL 5ESQB 3QQ3B 3GSUA 4N68A 4JDTH 4WHYH 2DLFH 1U3ZA 3GHBL 3VXSD 3HFML 2YMXH 4KROC 2IG2H 1KTRL 3L3JA 3MRMB 5ADPH 3WFDH 1TIUA 2B39A 1P84K 2VLLA 1JGUL 4WI9A 3X17A 3GGWB 1JTPA 4CW1A 2GT9A 2WLZA 2W38A 1NCTA 4NM8H 4K94L 4M1GL 1CXLA 1NGQL 1PKQE 1FNHA 1Y6NR 5C9KA 35C8L 3VI4E 2F53B 2HLFC 4K3DL 3PWLB 1EVTC 5J12B 2YK1H 3PGFL 5ICXA 1K8DB 1T1WB 4LF3B 2W1NA 4YXLL 1BAFH 1A6AA 1AXTL 4J3TA 4UQ3A 4MNHA 2RR3A 5B38B 5EZIL 2MFNA 1CGUA 4IOIA 2SEBB 1Q8MA 4HFUL 5FYLL 3FO1B 5GS3A 3UDWC 3TYFA 1U95B 2C7UA 2XWTB 4KDWA 4D0CA 3CFCH 3WHE1 3O4LB 5I71B 3KPPB 3C08H 5EBWB 1J5OH 3EYVB 4XCEA 1MRDH 2VLJB 4QY8A 1QQDB 3K81A 1H3TA 2QL1A 1WCBB 2D03L 4JFPA 5HDQL 4QHNA 4O4YH 3SE8H 5I9QC 4CN4A 2IAMA 3LEYL 2A77L 2W9EH 3FB7A 4PJAB 3FQNA 5EB9A 1RAMA 5IB2B 1FPTH 3HPJA 2AJ3B 4YX2H 2P5WA 2BY2A 3DXAE 1QSFE 4I18B 3X11B 3UBXA 2VITA 3PE9A 4M1DL 3PXHA 2JJSA 1MFDH 2VLKB 3FQWB 4Y8DC 5JLZB 4LLMB 1V05A 4OM1L 1JUFB 4C83A 2BNUA 4L4VA 4WHTB 5GRVK 1D9KC 5EZJA 2DIAA 5D7KD 2ZZUT 3SKNB 1I9RH 4JFEA 2ZSVB 4RMTA 2X2YA 2XXMB 1WIOA 5LBSH 3RUGB 1NEZB 4KDTA 5E6ZA 5BXFB 3EDEA 1AQDA 1KBGL 4YE4L 4UAOB 4WW2F 5DMJB 5EBMB 2NY0C 3TBWB 5D7SL 2JK5A 5JZ7D 1QBLL 4JCMA 4RNRB 4JANA 4LSTL 1AKJA 2OK0L 1EAPA 3C5ZA 4FXKB 3UZEA 4RX4A 4NYLB 3C6SB 3QPQD 1TVHB 4PJ8A 5D7LD 4PB9L 4XP6L 4JM2C 5IVZB 4Z7QF 5GRYA 1ORSB 4XPBH 4CVWA 5KTEH 3K0WA 2BXZA 3K7UA 2CDFA 1CGWA 3CVIH 4NRYA 1KTDB 4AIOA 2NW3A 2YC1B 5D70H 1WFTA 2P43B 2FX9H 1VEMA 3B83A 1FFOB 3RUGF 3WNOA 1HXYA 4Y4KD 1S7RB 2FX7H 1L6XA 1AFVL 4NQTA 1RJLA 4KI1A 5GS1A 3WIIL 2ATKB 3SE4A 4OTXL 2GYSA 3VD4A 1D7FA 1FVDB 1MCWW 4C56D 3OKNB 3GJEB 1VGEL 1CI5A 3G6AA 2O5YH 4YLQT 3HI6H 2DDQH 2NY1C 2QADB 3OKLB 4Z7OE 1QR1B 3I50L 3I6GB 3K1KC 5DRWB 2CLRA 2GY7B 1OOAA 1WBYA 2Y36H 1DUYA 1SJHA 3I75A 4K8RH 5IHZA 4QYOA 5F89A 1M7IB 4NJAL 4OFVA 3VGDA 1NMCC 1B90A 2HWZH 3KPTA 4PRIB 1DEEB 2AJUH 2IGFH 4F7CA 3B9EA 4NZJA 1Q1JL 5MEQB 1MUJB 4IIQB 1MCWM 3DROA 3IDUA 4GBXA 5IIEA 4NKIL 3MCLL 1NAKH 1IQWH 3KLAB 5E2VL 3WFBH 4D0BB 2O5XL 3PQYA 1S9VB 5KBNC 1UEYA 2Z8WC 5J11B 1BWWA 3H9SB 5TF1L 2P4AB 2FWOB 3F62A 3DV6A 1CF8H 1H3PL 1CDGA 2PKDA 2Z0BA 3GMLA 4H8WC 1G9EA 4HS8L 4TNVK 5HGDA 3JUZA 4DUVA 5MI0C 1FL6B 3TJHD 1W8NA 2E7LA 4QT5B 4YDJB 5MHSD 1W0WA 3CFJB 4MQ7A 3REWB 1ZHNB 4RGMC 5I15L 4U1HB 3ARVA 4P2QA 2BSED 3BISA 3MACL 3EJZD 1X3DA 4IRJD 3KPRE 5LVEA 2ED9A 1IGYA 4X6EB 5I16A 1KULA 1EBPA 4KV5E 3VD9A 1F4WH 3F12B 3WO4B 4DKAA 4LPWA 2ADFH 4X6FA 3MREA 5I8EB 4AQOA 4YR6B 3U7AA 1JNNL 4UNUA 3TBTA 5J9PB 3NZHL 2FEDC 2JCCE 1S9KC 1U58B 4LKXA 5HGHB 5T5NG 4E0RA 1V7NL 1X7QB 4EBQL 4M6MH 2XACC 4GKZB 2YPVL 2JF1A 4K94C 4G6JL 3BHBA 4OF5A 4PRDB 3H3PL 2XZZA 4ONHB 5C2BL 3KXFA 4OF6A 4ODWA 2UZIH 3PG2A 5B39A 1VKXB 2GK0B 2NXZD 5I1EH 4Q9CA 3GIVB 1FBIL 4HWBH 2AEWA 3GSVA 1M05B 2DF3A 2W07A 4TSAL 3AUVA 3X3GL 2G5RA 1Y18B 3T04D 3D3VE 4HS6B 4QRSA 3VFRB 4RWHA 5D1XC 5TE6L 3QUZD 5KAQG 1LWRA 3RIAF 5IBUG 2YEZB 1FZMB 1I1RA 3RKDC 5HHPB 5LGHH 4EDWL 4OZIF 2IADA 2WWKT 3UROR 4FABH 5GRUL 1DQQA 3L7FA 3DBXA 4KI5D 4R0LB 4A6YL 1W72B 3KYNA 3HMWL 4HMDA 1SBSL 1T7VA 3CFEB 3S3PA 4JAMA 2ICES 4FFWD 5DJDA 4JGMA 1OSZB 1DBBL 1ZA6B 3TIEB 3LPFA 3NIDF 4Y5XC 4QRRE 5BO1L 3HTLX 3DETD 2NXYD 3PV7A 3RL2A 1OB1B 4YJZL 4TN9A 1HZHL 3CUPA 3EYOB 4L8CB 3SJVA 3ULVF 5KVFH 5EN2A 2VDPH 5F88B 3FN3A 3CDGB 3HG1D 2AK4A 3R8BB 3TA3B 1KOAA 1RZGB 4RA0C 3Q2CA 2OQJA 3RZCC 5GS0D 1RJZB 5EO0A 2FGZA 1P4IH 3LZFH 3NFSH 1S5HB 2E5EA 3ARTA 3FO9A 4DVRH 2HJFB 4NOFA 2GJ6E 3VI3F 2AKRB 3UTPE 2E8ZA 2HT3D 5FF6B 1QKZH 1ONQB 4PR5B 5CIPB 4WEMB 3MO1B 2X4OA 3ORJA 4KVCH 3AM8C 5I8OH 2WANA 2ICWB 1OSPH 1MCEA 3VMNA 1GGUA 1AI1L 1H8NA 3LAFA 3U4BH 2NY7H 4X8JA 3RTQB 3AXLB 3WJJC 1HILA 1DQTA 5D2NA 2NNAB 5DC4B 3MLTB 1BFVH 4JRXD 1EGJL 5LKNA 1A1OA 3MV7A 1IGCL 3Q48A 4X6CA 2VQ1B 1KPRB 1U91A 1IGTB 2BDNH 2EC9T 4HJ0D 1ITCA 2XKUA 3RWCB 1OLZA 3K46A 3RVWC 4F2MA 3KPSE 1YECH 4E42A 4MDJA 4PJCB 1DCLA 5FM5O 3BUYA 4GQ9L 3VFNB 3QEGH 4S1QL 4HWBA 2FRGP 2XZCH 1LE9B 4WUKL 1GPOL 3VXME 4JPKL 3QUKA 2LTQC 2VOTA 4FTVB 3QIWB 3RWIB 3RA7L 2KH2B 3MV8B 3OJDB 4PBWD 4I2XE 3BP6A 4XBGB 3VFWA 5I1CH 3P4MB 1TPXC 5EU6D 3I02A 3FONB 4Z7NF 3QO0A 2B4CH 4G9FD 3ESVF 5DHYA 5C09A 4AL8H 3U0PA 3QNXB 5HPMA 5D7IB 4MD5B 1UWXK 1BVLB 2B5IB 5FGBA 5GSRB 2IH3B 2APBA 4HFWB 3MV9A 5DJCB 2FH8A 5SV4A 1S5IL 2P49B 2VDML 5ADOH 3LN5A 1MPAL 1EO7A 1KTLB 4XAKD 5I19L 2F54D 2FBJH 1N0XL 5HHQB 4BZ1H 4HIHB 4KZDH 1NCBH 1OT2A 1UC6A 4XXDB 1D5XA 3ARDA 5GGVH 1EMTL 3F7PC 5B3JF 5GRVL 5D4QA 4FQCL 4G5ZH 2BVTA 3A6CL 3N1FC 1FZJB 2YRPA 5FA4A 2BCKB 4S10A 2A38A 4Y4HB 3QB7C 1VACA 4WY7L 1MCFA 4MJ6A 1I3GL 5J13C 2R39A 5DC9B 3GUTB 1U8NB 3RZWA 5MEOB 4HUVB 3H42L 1H5BA 1I8KA 1Z9SA 1B0GA 5B21A 3MCG1 3ILQD 1HI6B 3GSOA 3INUL 4NN6B 5EORL 3IFLL 2DRUA 4RMUA 1U8OA 3TPKA 4BA8A 3MUGA 1KIPA 1TTGA 4XRCB 5GZND 5IEHA 4JY6B 1A21A 5E8OA 2IAMD 5DRZB 4HUWA 2IF7A 3HNSL 4JFZH 1ES0A 3LH2L 3QBTB 3OKMB 1K8IB 5DZOA 2R0ZH 4ERSH 4YHZH 3V0VA 5K9KA 4K3HA 4M7JL 3G5VB 2P5WD 4XP4L 4DN3L 2V6HA 1E4WL 5I1JH 4XNMB 1ACYL 5T1DL 1BQLH 1Q0YL 1XGYL 3DLQR 3IDXH 1T20A 4OV6F 3CLEL 4LLDA 4HLZG 4Q58C 3JWOC 4L4VD 3D69A 2ZCLH 4NPYA 5D2LA 5TDNA 2O5ZH 4LLVA 4JFED 3AVEA 3LSOA 3VXOA 4K7PL 4NO0B 2Y07H 3SDYL 3WIHL 4QXTB 5DYOA 4Q0XL 4EKXA 2E7CA 1MRFH 1CIDA 4HUXA 3G5YA 4PG2A 1XGQA 5LGKA 4RGNB 4PD4J 5IB1B 5BZDB 4DOHB 5IEKA 2F53E 3TO4C 1AKJD 3C5ZD 4RX4D 43C9A 5JXAH 4PGJA 4PJ8D 1CFSA 3E8UH 1FNGB 3UJJH 3TCXA 5T1MB 4DEPC 3U2SA 4IRSB 2Y6SD 3DURB 2XXCB 4ZOAA 2AGJL 4ZQKB 5KSBF 4GAJH 2MQ3A 3ZE1F 5JOPE 2NX5A 2OTPA 1GIGL 1AY1L 1ACZA 1KCVH 5E03A 2Q7YA 5CS7A 5DD5H 1ZLVK 2X4UB 5I76A 1KEGH 1OAYL 5DZLA 1U8KB 2WIIB 2X4RB 4Y1AA 3RAJL 2PYEA 1MCPH 3H7BA 3LN4A 1C5BL 2OP4L 3DO7B 3MODH 1OARL 3SKOA 5GISL 2P5EA 1YNKH 1F90L 2FATL 3M8OL 3QUXA 1GZPA 4NHCL 3RX8A 4OV5B 1NPUA 4OCRH 5D72H 5DK2A 2HJKA 3TN0B 3MRDA 5C7XH 1Q9LB 1KN2L 2DQJL 4Z7QE 5IW6A 2YHGA 4HK0B 4XP5H 3O9WA 2A1WL 1FDLH 4NKMA 3B2VH 4HGWA 2FEEI 4IHOB 5EC1A 5BS0B 1U8IB 5C07A 3RNKA 2C4FT 1JPSL 3TT1L 1R5VA 3GB7A 5A2JH 3W5NA 3S36X 2FIKB 2B1AL 1JPFB 2X4NA 1JF6A 5EUOB 1A7OL 1CN4A 1S7VB 3RUGE 4ETYA 4G3YL 1JZ4A 3LMJL 5CZXC 3X3FL 1IL1B 4GBXD 2JKXA 4JO2H 3QNZB 3X12A 3NPZB 4L8BA 4D9RD 2OBGA 4FXGA 3AMLA 3PQYD 5FM4A 3FB8B 4FFZH 1GAFL 2AJVH 4TULH 1UT9A 2VKWA 1BBJB 4UNTA 2ESVA 1Q9OA 3QFDB 2Z93A 3VWKA 1F4AA 5IFAH 3BD5A 1BM3H 1ULVA 3PWNA 3ECBB 3EOYG 2VLME 3TJEH 1WT5C 4PJFB 5IKCA 4M8QB 2A6JA 1G84A 1Z0NA 2PW2A 3DIFA 4QWWD 1IGML 3SGKA 4LRNH 1NFKA 1I1AA 5SX5K 4X9IA 1HXMA 1E4XI 3H9YA 4JPVL 5CJQH 4P2QD 2QHRL 3FFCE 3S37X 3RU8L 1L9MA 4CGTA 2WBWB 3JVGA 1P4LA 5JPNA 1A64A 2OSLA 1ADQL 5KVDH 2ZUYA 1TZHB 3T8XA 4Y4FC 5TJWK 4TPRL 4U0RC 2VZTA 1DLFL 5TFSH 2VQTA 5KSVB 2OZ4H 1YEGL 3IAQA 3KPNA 4PRAB 1JF1B 4HT1H 2XKSA 3E2HB 5T3ZL 4MSWA 5IBUB 1FH5H 2PO6A 3PWJB 4YDKH 4HWEL 5T5NF 3MCKB 3KXFD 4JKLA 1ZT1B 5DJ2B 1MIML 3BT2L 2AQ2A 2YWZA 5KS9E 1ZT4B 4NNPH 5J12C 3Q6GL 4X5WB 2OJEB 4K2UH 2QSTA 4X5XA 1GGCH 4OCYH 4QTIL 4I0PB 3AB0B 1BZQK 2CDGB 5I18L 2R1WA 3QQ4A 3IJYB 4ENED 3F5WA 1IARB 3IDNA 2Y72A 4KC3B 4P9HL 3SCMB 5DSCA 3CXDH 3KPLB 1FVCA 1FYTB 4XMKL 3L5HA 1YN6A 2VYRE 1MREH 1VPOL 5KAQF 3U7WL 4L9LA 3U6RA 2XQBL 5I1AB 2IFFL 3W9EA 3NABH 3L6FA 1W72L 4WJ5A 1QA9B 5IBLC 2B20A 4NCC1 2NY5L 1ND0B 4KZEL 3BKJL 1PQZB 4NKOB 3IDGB 2OJZH 3O3AA 3TBSA 3QCVL 2R23B 5H35A 4I18C 4L8DA 1LDPL 3GSXA 4L3EA 3NVQA 4K8RD 4ALAL 2VB5A 3QSKB 2FJFB 3CFKB 4PJEF 4JPWH 1AQKL 3IDIB 2VC2H 4YNYB 3V79C 2FNBA 3SJVD 4UMGA 1CGSL 5DUPL 1I1FB 4N0CD 4J12A 3MOBH 5I0ZA 4JJ5B 1X5GA 4FZEL 2AK4D 3FMGL 4YUEL 5EU7E 1PYWB 1R0AL 4JKKA 2YKLH 1OAZL 5HHVH 2JIXB 4NWUH 4OZIE 5DVKA 2HFGL 2MOVA 4V2CB 4F8QA 4NN7B 5D7LB 3D39A 3KYMA 2AAVA 1A6UL 5LG1A 4LHQB 5HDBF 2VDNH 2VDOH 4PJ9C 3I2CL 3V6FB 1V7MH 1UXWA 4OBRA 5IVOA 1RZIA 3CX5J 3NIDE 1N3NA 4YHIA 1S7QB 2IQ9L 3ULVE 3MOQA 3D0VB 3FQUA 4PJXA 2QSCH 2FB4L 4CU6A 2NY2B 5JMRA 1RY7B 1T04A 1SY6H 2C5DC 3O6LL 2V2WB 3MV7D 1X4YA 4JM4H 5I74B 1R3HA 5JO5A 4OGXL 3EO9H 2OZ4A 5KJRH 3HR6A 3BP4A 2ZG2A 4DAGL 1Y0LB 3U46B 3VI3E 1NCAH 4PGEA 3H7LA 4TUKH 3WFZA 5JNYB 5BV7H 1OGTA 3VCLB 3L9RA 1G7QA 1T4KA 1MQKH 4GXUM 1XF3B 3VG9B 3LHPH 4P59H 2GTWB 8CGTA 2BSRB 1X4XA 3CJJA 3VRJA 3HUJB 4AY0A 1AP2B 3MJ9H 4UOW0 2A6KA 4YO0B 4ZO6A 3SDCA 4JFHD 1OGAB 1KFAH 4IDJH 3AREA 1KTKE 4MQSB 1KIUA 5DMIL 2R15A 5EO9A 1AGCB 4JREB 3D6GA 3BSZL 3ES6B 3TGXA 1QSEB 1G9MH 3HCVB 4JO3L 7FABH 3MBXL 1QYGL 4P2RB 5D1QA 3MRCA 4YDIL 1AE6H 3RVTC 5EULV 4TVSa 5J11C 1KJVB 2CK2A 1HQ4A 5C09D 2VQUA 3C8DA 5E2WH 3O3EA 2IPTH 2ZUXA 3PF2A 5E8EB 3JBG7 3D0LA 1MJ7H 1F4XH 3IGAB 3MV9D 5ICYA 3O6MH 4C58B 4F7EA 1XZ0B 4Q74A 4FHBD 4UT9L 5EIIA 4OLEA 3OPZL 4PTUB 4UU9B 3Q1SL 1D5BA 4AQ1B 1DE4B 4DK3A 3HC0A 5EBLA 1QO3A 3VE0A 2L0DA 5I6XB 5C0CE 1A47A 3BESR 3ARDD 1MSPA 4HAFA 4ORZC 2APWA 5IJVB 1BVZA 1YQ2A 3F6IA 3GMPA 3PIQB 4M03A 4Z7NE 3O6FB 5B4MD 1IAMA 2AW2A 3N50A 5EU7C 5I2IB 2VN7A 4ZPTA 1H0DA 2GUOB 3BUTA 3DMMB 4Z78B 1FNSH 5I30H 5KN5A 1MAJA 4HDIB 4XCYB 4N8CH 2G60H 1E27B 3BIAX 4FFVC 1Q9WA 4GG8A 1AXSA 5T33H 1LEIA 3UYRH 5FO7B 1P7QA 1G9NC 1RUMH 4RMRA 4FTVE 2Q1EA 5EC2B 3MV8E 4CMHB 2R56H 4RISH 2Z8SA 1WC7B 5C0DA 2PTTA 5DJ8B 2YR3A 2BNRA 1G6RB 5B3JE 1QR4A 3ULVC 1MFCH 3ZDZF 1RZ7L 3LN9A 5IB5B 4P9HC 2MCG1 2C9AA 3HE7B 1QNZH 2HP4A 5CINL 5I1KL 3ALPA 2EIBA 2DIBA 3QFJB 4M93B 1MHCB 2DQTL 4URTB 4XCCL 4R0LC 5E1AA 2GHWB 2DN7A 2NY5C 5FB8A 2OXHA 1LK2A 3UJTL 1B9ZA 3S4SA 3MJ9A 5IV2A 5GHWL 3HG1B 2F9BT 1RUAL 2CK0L 1BD2B 3OGOE 2VDRH 1ORQB 4FA8A 1MJUH 4TRPH 2MCPH 2IMMA 3O2VH 1UJTA 1W0VB 4UDTB 5DUMH 5GJSH 1B2WH 3G6JB 3QJFA 3ZYJA 1F8TL 3LDBC 2GCYA 4KI5F 4PJGF 2ZG1A 4ODVH 5DD0H 4L29B 3OKEA 3TH3T 5K9OA 4UIMB 4ZTOL 5ACLA 2NX5D 1HYSC 1GGBH 3OAUL 3IFNH 4ZFOB 1IM9B 1P1ZA 4U3XA 3PHQA 3ARZA 4N0FA 2ADJA 4A2LA 4Y1AD 4Z18A 2PYED 4TUJA 1OF2A 1RJYA 5C0GB 4M7LH 3DX6A 5GRWA 3BFOA 1RU9L 3V95A 1IT9L 2P5ED 2Y25A 3VXPB 4F15B 4ZUSA 5C8JB 2H41A 3C5SB 3QUXD 4LDEB 5DVMA 4ZNEA 1CFVL 4NO5B 4KKCD 4KJQD 4JRXB 5FECA 4PJDA 2YPLE 5D5MB 4PLOB 1WWAX 4NM4L 4KKAD 4P5KA 4U6YB 3RTQC 2VMFA 5HHOB 3O9WD 5KSBE 3MLVH 4OLXH 3TC9A 4ZOCA 5TPWH 3ZE1E 5C07D 4QHMB 1R3JB 1NJ9A 1DLHB 1P4BH 2F58L 4HJGB 4ZSOE 1NUGA 1LO5B 2XICA 3TIDB 3GNMH 4JFFB 2G5BA 1FQ9C 4N90E 1S9WA 4PY8I 5L6YL 3GMQA 1YZZA 4XNZB 1KELH 4G8FA 3MROB 3UTTA 3E6HA 1AR2A 2IPKA 2WBJA 2ZUVA 4KK5C 2WUCL 2FYYB 2ZPKL 1IKNA 4Y16C 3OB0H 2CKNA 4CVUA 4BUGA 3WUWG 2AJSL 3DECA 3PDOB 3C8KB 1MFNA 2XWBA 3I3DA 3UTSD 3GK8L 2ESVD 2ZSWB 4ONFH 3VWKD 5ESAB 3L5JA 1BX2B 1MAKA 2W0PA 3EYUH 2ICEB 4O2EB 4BYHA 4H8WH 4XXCC 3IDMA 3TCLA 3WFHB 4N8VA 4OD3H 5EU6B 3UAJC 4F33A 4HIXH 3VXRE 4RBPH 3A6BL 1NAMH 1I1AD 4X4ME 1N6QH 3NAAH 5TQ0L 4XPHL 3SBWC 5GGUA 1ZLSL 3TYGH 4D3CL 2EDQA 4P99A 5ILTH 3U7YH 5JHDB 5TDOA 5ERWA 3WXWL 5ID1A 1DQML 1IEBB 3GHBH 2FJGA 3EOTL 3HFMH 4WV1B 3VXTA 3WDHA 1YMMB 2F54B 4CW1B 5LJYH 2AVGA 1LEKA 2P8PB 5EU5A 1FZKB 1JGUH 4ZMAT 1I8IB 4X7SL 5J1SC 3T0BA 3VGAC 1EUUA 1MCKA 3JTTA 1SBBA 5DC0A 2R69H 2H3NA 3TZVC 3ZYOA 5HYJA 2PO6D 4K94H 3KLSA 4M1GH 1XF2B 5CFHA 2ED7A 4LIQL 3QAZB 35C8H 4K3DH 5EU4A 2UZXB 7CGTA 3PGFH 5CMAB 5BJTB 1IKFH 3I6LE 4P4KA 3TYFB 1SJVA 3OMZA 5L8JB 3MNVB 1IILE 1NL0L 2C7UB 3TVMB 4G42A 5EZIH 2GFBA 4HAGA 1RZFL 2ZNXA 2OTWA 4Y5VA 4HFUH 5FYLH 3O0RL 4JFPB 3ZTJG 3MRQA 5L0QC 2V2XA 1S9YB 4GKSA 2IAMB 3DVFA 4JCLA 4LOUC 4NZDA 4EVNB 3HI5L 4NN6C 3IYLW 4F7PA 2C4XA 2APTA 3EGSA 3Q6FA 2J5LC 4PV8B 2DQUL 3CDYA 5BOZG 1VFBB 5L2JA 2D03H 4IMKA 1QSZA 1NDMA 1G7HA 4ESKA 3LEYH 2A77H 3FRPA 1F2QA 5JIIA 4OB5H 3VXSE 2XFXA 1C12A 5A3IC 3BWAB 5EOQH 4G8GA 2YUVA 4I8DA 5D93B 5IB3B 2AJYL 3MRIA 4M1DH 4L3ED 1BECA 2YBRA 2FD6L 1L9NA 1M4KA 4OM1H 5HI4D 3ZKSD 5C9JA 4Q6IA 3STZB 4QRQB 1TVBA 3P9LB 4HWZB 3DSFL 4EJ1C 4KJPC 1HHHA 3S35L 4EI6A 5DJ6B 3S37L 4RGNC 4YE4H 3D39D 3T0VA 1KG0B 1QBLH 3BVNA 1WFUA 4LSTH 2YSSA 1UGNA 2UYLB 2OMNA 4XB8A 5KSUA 3RWDB 3M1BB 4XP6H 3E6FB 4PJEE 3HNVL 3ZHLA 1NAMA 5CJ5A 4UDUB 3CH1A 4XVUC 2D0FA 4JDVB 3PV6A 2H8PB 1DANU 4H88L 2HAZA 1IC4H 1NFDA 4K55A 3QIUA 2XY1A 3MRFA 4E5XB 4WU7A 3DI2B 4CKVX 1AFVH 3IKCA 3HR5B 4OBSA 4OTXH 5HDBE 1V5JA 2J6EL 5DJYA 1WBYB 5B3NA 5C0FA 1T2QH 3OQ3B 1VGEH 3VFUB 1OL0A 1NCDL 3RWGB 5D7KE 3UTZA 3GKWL 3I50H 3VXQB 4G9DA 5BRZA 3C8HA 3WLBB 1DQJA 2HT4C 4TTDC 1ZHBA 4F7CB 3MLYL 3QJHB 4KJWD 1ZHKA 5J6GB 3SDCD 2E9IA 3ARED 2D0GA 4NJAH 4WO4C 3DROB 4P2OC 5BZWA 5IIEB 1EEYA 5E08L 1ZSDA 4GRLA 4DGVL 2VLRB 3OHXA 2H2SC 1NDGA 5T1KB 5FOBB 1Q1JH 4Y19B 1RZJC 3TP4A 1F6FB 1IC7L 2VXUL 1YEHL 4YIQB 5D1QD 3DV6B 4NKIH 1UZ6F 3MCLH 5E2VH 3MUJA 1CCZA 2O5XH 3ULSB 4KRPB 5HHNB 2VXSL 5TF1H 5DVLA 2HJLB 4QCIA 3RPIB 4MCYA 1VFMA 1H3PH 2R9HC 4EZMA 2GI7A 3QDMA 1W0WB 4HS8H 4MQ7B 2HH0L 4P2QB 3WBDA 1NMAL 4AK1A 5CJXA 1RIHL 2V5RA 5MERB 1N4XL 1KV3A 5FFLA 2IMNA 3KPOA 1LNUA 1QHPA 2XI9A 4PGDA 4X6FB 1WZKA 3GDBA 3NPSC 4TUOB 4C56E 2AJZA 3O6KL 5HJ3A 3MACH 1RFDL 2F15A 3HZVA 4MJ4A 2YD6A 2R8SL 2GITA 3BKYL 1JNNH 2CR3A 2WZPD 4ZO8A 5AZEL 1NFIB 4O58H 2I07A 3BHBB 1YEJL 1R24A 3L3DB 4ODUA 1V7NH 4EBQH 4AH2A 1YNTB 1R3KA 3CFDA 5C08B 3E2HC 3KHQA 1A7BA 2P8MB 2YPVH 4CDHA 4WUUE 1G7IB 4G6JH 4JZNA 3FQXA 3H3PH 3OJVC 1M1SA 5C2BH 1Q9KB 3GSVB 4FQ1L 4FQHA 3CC5B 4G80B 3HZYB 4L3CA 1P7QD 4GT7A 3G5ZA 4DW2L 1FBIH 1UYWL 5KVGH 2BC4A 3L95B 3CAFA 4ZNCD 4TSAH 3X3GH 4PP1D 1G6RL 2BNRD 3R8QA 4NQCB 3NCFB 3RY4A 3FCTB 5TE6H 1EEZA 3MRHA 1NC2B 3QO1A 4P5MB 4EXKA 3L7FB 4H5SA 5DEZA 3UTOA 5MHSE 4QXWA 2W59A 4EDWH 3KYKL 3O2DH 1GSMA 3C9NA 2GJZB 5GRUH 1F6AA 1HHGA 4QO1A 3S97C 3D87B 4A6YH 5GXBB 3OXSB 3HMWH 4ZXBB 2YD1A 4XAWL 4ISVB 1SBSH 4ELMA 1L6ZA 4IJ3B 3OKOB 5E99L 1DBBH 2ARJB 2P45B 5BO1H 3VFGL 2KUTA 4NCDA 4S11A 3WS3A 5DEGB 5ISZE 2VWEE 1HZHH 5M7QA 2OQJB 3ZDZE 5FV1L 5F6HI 4LEOB 5F93C 1NLDL 1JMXA 4U6XB 1F2XK 4HH9A 1AHWA 1RHHA 1TDQA 2A6IB 5D6CA 3QDGA 5DMGD 5JZ7C 3SGEI 5JR1L 4MJ5A 2HKFL 4GAGH 2HFEB 2EYTA 4NDMA 1U92A 5E7BA 2G9HA 5DJXB 4ZFOL 1EVUA 3QPQC 4NN7C 3PWVA 4NIKB 4NC0B 3CSPA 4NFDA 1LE5A 3S6CA 4KROD 3AMKA 4MA7L 3MRNA 5DD6B 3VRIA 2CD0A 5B8CA 4KPHH 5CHNB 4FQ2L 3T0EE 3T4YB 1YPZA 4FQJH 4NZTH 1KLUA 3P9MB 3LV3B 5L2KB 3BH9A 4Y4KC 2V2TB 3LPWA 4WFED 2XA8L 5CGMA 1AI1H 3WUWB 1MF2H 5M95B 4PJGE 5FHAL 3RGVA 4F9LC 3RJQB 2BRRL 4NRZA 1U91B 2R1XA 5D8JL 3WHXB 4KQ3L 4YPGA 1MEXL 3K4DA 1EGJH 3VU2A 5IGXL 2AQ1A 3KWWA 1KB5B 1IGCH 1RK1B 2EDWA 5I74C 2N1KA 4M7ZC 1FFPB 3BIKB 1D6EA 3BZEB 4XZUA 3P4NB 3WEXA 5IESH 4UQ2A 2I27N 4I5BB 2WBJD 5T3XL 3HMXL 4YHPB 4QTHA 2VUOA 4KU1A 1PG7H 1SEQL 1D3CA 4GQ9H 5BVPL 3T0WA 5ETUA 4S1QH 1S9XB 2ITCB 4WUKH 1GPOH 1ZAGA 4JPKH 4X6CF 3VFWB 2YD8A 2OLDA 4MQXD 2EDHA 3RA7H 5JA9A 5DHYB 5C09B 4NKDB 4J3WA 4Z7WA 1JRHH 3DX7A 3T65A 3CFBB 5KZCB 5L88L 4N0UB 2VZ3A 4M9PA 2AXGB 1M7DA 4R7DB 4LAQL 4ZFZB 2YXFA 3NCCB 3OG6B 4ZODA 1CLZL 3QG6A 1IJ9A 3NTCL 4PS4L 4A6YA 2J8OA 5ACZA 1EHLL 5E5UB 4DTGL 3MPCA 2VXVH 2F19L 3EJZC 4IRJC 2X4QA 1S5IH 2VDMH 4JB9L 1ZA3B 2BSTA 3ZDYF 4YBLB 1MFAL 4OUUA 3DYMA 3PXJA 4LARL 1F3JA 5I19H 1KF9B 5HYJD 1N0XH 5EOCJ 3T2PA 1QP1A 2IPUG 2V7HA 3MJ7B 4CJ0A 3MRRB 3ZYZA 2CMRH 5AD0B 2E7BA 4GAYB 2VWEC 1EMTH 2OTUB 4MJ6B 5TQ2L 2UVFA 3EZJB 2BNQA 4FQCH 1TNMA 3A6CH 4P4KD 2PF6A 3VMOA 1B0GB 4KRLB 4WI2A 3LY6A 4I4WB 4LKCB 1CFBA 4R2GD 4WY7H 5JHLH 1U93B 5CKAA 2DLIA 3EAKA 1RSFA 1KIPB 3H42H 2V5YA 2V17L 4MZ3A 1KXVC 4DFIA 2Z4QA 3QUYA 4PJ7A 3UZVB 5F7UA 3INUH 5EORH 3QXUA 1NCWL 3IFLH 4AM0A 4R9HA 2CRIA 1A4KA 1IEAA 4HS3B 5CP7A 3SE3C 3W81A 5F1SA 4N5UA 2HN7A 5EU6E 5TH2B 3JWDL 5F71A 3QUZC 3IB4A 4K23L 4G9FE 3F7QA 2CIIA 3HNSH 5DGQA 3LH2H 2QR0B 4GRWB 2K7PA 2W0KA 4HC1L 3V9FA 1KC5L 2W60B 1VSCA 2YA2A 2VN4A 4XP4H 4DN3H 4G8GD 2EEAA 1E4WH 3HE7C 1ACYH 1LO2L 2IJ0C 5E00A 3LQAC 4KI5C 1Q0YH 1EGJA 2BSSB 1OPGL 1H8OA 4P3DA 4M93C 5DYOB 2DI8A 3D25A 4XAKE 4FFWC 1INEL 1KJ3L 1HIML 3VFMA 2DLHA 5F9OL 2EIZA 1PLGL 3DETC 2NXYC 4K7PH 3SDYH 3WIHH 1MCRA 4Q0XH 2O26U 4J4PA 2AEPL 4HKJA 3QI9B 1QUNA 4XPTL 3GSQA 5C0JA 1CFSB 1L7TH 5IMMB 4KVNL 2QQLL 4P48A 3RI5K 5AEAA 4DZ8B 1U41A 1FNEA 4AEIL 1RK0A 4NP4L 1F3RB 5D2LF 2NX5B 1MLBA 1KCSL 5C0AB 5IHBA 4ZG1A 3S4SG 2NY3B 3ARQA 2AGJH 1CD0A 2P1YA 4LCWB 1CICA 1CVRA 4Y1AB 2PYEB 1WJ3A 3LN4B 4M6NL 2J88L 2P8LA 1GIGH 1AY1H 5ESQA 1EHXA 2BY1A 3QQ3A 3SKOB 2Q76B 1OAYH 4R96B 3BI9X 3QIUD 1GZPB 4HQQL 1C5BH 2OP4H 2P5WE 5IBTL 3IDJB 3G5XB 2HJKB 3MRMA 3G6DL 2MMXA 1L0XA 1OARH 5GISH 5ID0A 3IU4L 4OGZA 1F90H 4F15C 2FATH 3M8OH 2DTSA 4MA1B 2ZCKL 3GGWA 2CXKA 3QXAB 4NQXB 3WYRA 1F3DJ 3FRUA 5HI3D 1JV5B 3AY4A 4NHCH 4L4VE 5EC1B 3ARRA 4UUJB 5C86A 1KN2H 4JFEE 2DQJH 3KLHD 1R5VB 2A1WH 5E6IA 3PWLA 1WCQA 1XCTB 5I75B 4XX1E 1K8DA 3BEVB 4LF3A 4IEFB 3FL7A 2Q86B 5I73B 2J4WL 4S0SD 1JPSH 3Q3GB 3FAXA 3GSRB 3TT1H 5SWZB 4WTXA 5MP6L 4I77L 3QP3A 4GRLD 2B1AH 1A7OH 2SEBA 1WBZB 4OFDA 2FGWL 4G3YH 1UH2A 1DBAH 3FO1A 3LMJH 3UTSB 3X3FH 5FYLD 3ARFA 2A0LD 1U3JA 1U95A 2XWTA 4F7MA 3O4LA 3KPPA 5AUMB 2YPKB 3EYVA 1GAFH 2VLJA 4JQIL 3VXUB 5FV2A 1QQDA 1WCBA 3NFNB 2DBLL 3LPGA 1N8ZB 1LMKA 3AS1A 5I1HL 3QDMD 2V7NB 4PJAA 1G0XA 5EOTB 4MDIB 5LXGL 4OLVL 3K74B 1J1XL 4ACPA 1IGMH 3HE6A 1I75A 4JPVH 3FQWA 5FGCE 2QHRH 4CN6A 2CJUL 2JJWA 4LLMA 5JLZA 1QLRB 3RU8H 3F7YA 1JUFA 3QDAA 4HBCL 5DI8A 3SKNA 1ADQH 4AEFA 4MQTB 2ZSVA 3KPNB 1UZ6E 1T1ZB 4AZ8A 3WIHA 1I7UA 1NEZA 4TPRH 3TBYB 5BXFA 3D1MC 4P2YA 5JQ6L 2IWGA 1YEGH 2PNDA 4R8WL 1F5WA 5EBMA 5J56B 3U4EB 3NGBC 1U8MB 5T3ZH 5BOPA 3B9DA 4Z95L 3C2AL 4FXKA 3B9VA 4XWGL 3U30B 1PZ5A 4NYLA 3C6SA 3QAZC 1TVHA 1HHKB 1HE7A 3BT2H 2FECI 2NR6D 1NBZB 1YC8A 5IVZA 3MJ6A 3Q6GH 4D9RE 1ORSA 2DQCL 3PQYE 3BZ4B 5J4MA 3ZSTA 5J3HD 2VISB 2YD9A 4QTIH 3ILQC 1EV2E 1FP5A 2ZUQB 2NQCA 1KTDA 1YN6B 3BD3A 5FKPB 4TSCL 4CVZB 3QT2A 1C7SA 2PTVA 1BEYL 2YC1A 1JGEB 4PJBA 4P9HH 2LU3A 3W9EB 1FFOA 3MRGA 1BFSA 2QKIB 2IAMC 4XMKH 4QF1A 4ZOEA 3BP5B 3K2UL 2DQHL 5L9DL 2ATKA 3OKKB 1VPOH 3U7WH 3HHRB 1I9IL 2XQBH 1FVDA 2IFFH 3DUUB 3OKNA 3FO0L 3HB3D 2MHAB 1HCVA 2WK2A 5E24E 3E0GA 2JJSC 2NY5H 2E9WA 3OKLA 4UTAL 1QR1A 3I6GA 1KPVB 5DRWA 1OVZA 4KZEH 3BKJH 3KJ4B 3FAWA 3QCVH 1DL7L 5KANI 5D93C 4EDXB 5DMKA 1M7IA 4OLYL 4ALAH 3L3GB 1OCWL 1AQKH 1JIBA 1DEEA 3MGTB 4PRIA 1KUMA 3TNNA 4KDTC 1CGSH 5DUPH 4OGAC 3FRPG 5MEQA 1MUJA 2IALA 4IIQA 4FZEH 4ORGB 3FMGH 4YUEH 3QDGD 3KXFE 3D39B 4P0DA 1R0AH 1OAZH 3UTQB 3MLSL 3REVA 2HFGH 1FC1A 1KLFA 3KLAA 4LFHD 2HMIC 4D0BA 1S9VA 1WZMA 1YA5A 2CUHA 3QQ9D 3H9SA 5TE4L 5GPRA 5TE7L 3BRDA 3QDJB 2FWOA 4OZGB 1N3NB 1A6UH 4IOSD 3NOIA 2C3WA 3I2CH 4BFBD 2D7QA 4LCUA 5IVXA 1YYLH 1KENL 1QRNB 4YK4C 3FT2B 4IMLA 2E7HA 4CAGA 4MA8L 5CIPH 1FL6A 3O41B 3S96B 3D9AL 3FQUB 3FKUS 3QXDA 4QT5A 4YDJA 3WMSA 3U1SL 1ZGLP 2IQ9H 2EYRB 3CFJA 1AJ7L 4NFCA 1ZHNA 4MXQD 5DRNA 1T04B 2B1HH 5IK3A 1Z9LA 3OJ2C 5GS1C 5ITBL 5DK3A 2FB4H 4NBZB 3RGVD 1R3HB 1ADQA 3F12A 3UXFA 3BP4B 2VL5B 2KDGA 4Y5YB 5HVFB 5E5MA 4X5LA 5I8EA 3K3QA 4OAWB 4YR6A 5F7NC 3P40A 5E94B 1KB5L 1MVUB 3O6LH 5J9PA 3C60B 3BGFB 1UWXH 1U58A 1L4IA 4OGXH 3BGAA 5HGHA 4E41B 4DAGH 1X7QA 3SJVE 1B6UA 4GKZA 1WEJL 1I1YB 3T1FB 1UJ3A 3LQMA 3SDCB 5C6TL 5CSZA 3GSWB 4PRDA 2KPNA 4PJXF 1T22B 2AK4E 2E6JA 4ONHA 1PY9A 5CGYD 1VKXA 4Z7VA 2GK0A 2R0LL 3GIVA 2WP3T 3O2WL 4GBXC 5D1QB 1DQDL 4EQ3A 1I7ZB 3BSZH 1M05A 5CP3H 4JO3H 3MBXH 1QYGH 4HS6A 3VFRA 2BOCB 4HIJB 2X4TA 5IMKA 4U7KA 4YDIH 2YEZA 4CBPA 4XT1C 1FZMA 1S7UB 5HHPA 4XP9L 2AS5M 1J12A 5ICYB 2FJHB 4OD2A 4QWWC 3U0WL 4R0LA 4PIRF 2UWEA 1W72A 3LS4L 4XC3L 1H9VA 3CFEA 5D2NE 2V5SA 3VE0B 1OSZA 1G7JA 1ZA6A 3TIEA 3MV7E 1WZLA 3ISWA 3WNKA 4UT9H 1S7SB 3OPZH 4X6CE 2RCSH 5CD3B 1OB1A 3EYOA 3Q1SH 3PHOB 4YBQC 4FQQB 4L8CA 1X5AA 2DQGL 3B3IB 3PL6B 5F88A 3C5JB 2AXFB 1J18A 1Z9MA 3CFIC 3FQRB 3CDGA 1EO5A 1HNGA 1QEWA 3TA3A 4NUGL 1P7KB 2VABB 1RZGA 3NCJL 3UC0L 4L8SB 2BNQD 5LAXA 4U7MA 1RJZA 1OTUD 5FYJU 5CLWA 4JFHE 4P5TB 1Z2KA 2YN3A 4OZFA 1S5HA 4NHUB 3RL1B 4D94A 2XQYG 2BFVL 2HJFA 5TGBB 2AKRA 3QUYD 1T2JA 5FF6A 3DNKA 1ONQA 4PV9B 3ZDYE 4PR5A 5CIPA 5IROA 4ENEC 3PP4L 4ZFGL 2R0WL 2AV7B 3BZFB 2ICWA 2ADGB 5DHXB 4M4RA 3DTXB 4NQEB 1FFQA 2XN9B 4WI3A 4JVWA 3RTQA 3AXLA 4G7YH 4W68A 1JI1A 1RZ7H 3C6LB 1VESA 2NNAA 3MV9E 3MLTA 3OR7B 1ZLVH 4ZUUA 5CINH 5I1KH 1Z3GL 3GI9L 1EEUA 4D9QD 5E5RB 2DQTH 1KPRA 4XCCH 4JR9L 4QGTA 3H3BC 4GKOA 2ICCA 4K8RC 3WKNA 4DCQB 2XV6B 3RWCA 4X4YB 1CFNB 5CEXB 3WFCL 3GZKA 4J4PD 5MEPB 3R4DA 3H0TB 4MNQA 3UJTH 4AG4H 1S7WB 4PJCA 2NCMA 3ROLA 1N5AB 5GHWH 2VZ1A 3VFNA 2ADIB 2CK0H 1DQLL 1LE9A 5F3BA 5K33A 5CP3A 1T5XB 1QFOA 4WTZA 3VA6A 4EOWL 3RQ3A 3QIWA 3RWIA 1F8TH 3O4OB 1FLRL 1JL8A 3OJDA 4HULB 4PPTA 2E9BA 3ZTNL 4QEGA 2EH8L 1CZ8L 4XBGA 1CICD 5ELIA 3P4MA 5JW4R 4PJHB 1X5HA 4ZTOH 1AGBB 1YN7B 5JMOC 1J8KA 3OAUH 3T3MF 5I17A 3HKFA 3QNXA 5IP4A 5D7IA 4MD5A 4AIXA 5JDJA 3EJYD 3OAZK 1C8PA 1BVLA 5GSRA 3K8MA 2IH3A 4U1GB 4HFWA 5DJCA 3QRGL 4X0KB 1RU9H 4LFHG 1IT9H 2X70B 1PJ9A 3QHFL 4CMMB 3KJ6L 1UADC 5D2NC 5E4IA 2ZG3A 5IUSA 3DI3B 3RWHA 3FN0L 1INDL 5D2LE 2VNCA 1QOKA 3A67L 1NJ9B 3DARA 5SX5H 5HHQA 4WEBL 4MLIA 1TJGL 4HIHA 4NM4H 4ZYKB 1XF4B 2YZ8A 1GHFH 4XXDA 5E8DH 5E6ID 3UEZA 3CXHK 2ED8A 5H94B 2ZNWA 4JY5L 3CZJA 3GMQB 1PY4A 5GRJL 3SQOL 4NJ9L 1FZJA 2BJML 2F58H 2BCKA 5DHVB 2WBJB 4GLRI 4Y4HA 4ZD3L 5L6YH 1U8NA 3B5HA 4NQDB 5MEOA 1LHZA 4U3CA 2YA1A 3ARFD 4HUVA 4KRMB 5FUCC 1Q0XL 1YNLL 2WUCH 2ZPKH 3O4LD 4GW5B 1B3JA 3IDMB 2AJSH 1JZ8A 2VLJD 1JGDB 2Q8AL 5CEZD 3M17B 4AIZB 4XRCA 3GK8H 4JY6A 4BKLB 4PGZA 4OQ1A 3B9KB 4BQ8A 3OKMA 1K8IA 2WINA 1PSKL 2WIMA 2I24N 5J89A 5GGUB 5EA0L 4RMSA 3JV4B 2J8UB 2PYEE 3G5VA 3KPMB 5CSGA 3RFZC 4JY4B 2Y06L 4XNMA 5EZOL 3HE6D 4FG6D 2P5EE 5ID1B 5TQ0H 2FJGB 3QWOB 1ZLSH 5FGBC 4PYHA 4MMXC 4D3CH 1SEBB 4EN3B 3GO1L 3WXWH 4XCFL 3EOTH 4NO0A 1UEMA 4QXTA 2D7OA 3NFPB 2LQRA 5CGTA 5C07E 3RRQA 4X7SH 4LPCA 4PTTB 5BZDA 1S78D 2HA1A 4UT6L 4NGHL 2EDYA 5A43C 2BVUA 3BEWB 5B4MC 1RZ8B 2WNGA 4M62L 4LLYB 4LIQH 4G42B 4LCCA 5CLTA 2YUZA 4G6FB 1FNGA 1HYRC 4Y5VB 5T1MA 1CD9B 4IRSA 5FK9A 1A3QA 1H5BC 4ZQKA 1NL0H 1YMHB 2ESVE 3QPXL 1DVFB 1RZFH 3HAEB 3Q6FB 2X4UA 2WIIA 3O0RH 1AC0A 2HFFB 2X4RA 5T1LA 2K1MA 3DO7A 3HI5H 2XWJB 3EOAB 2YD4A 4I0CC 2MKLC 2DQUH 5C71A 4M1CD 4GMSL 4P57B 3V7MA 3NN8B 4NNYB 4OV5A 3TN0A 4ODXB 2WSKA 2YBRB 1Q9LA 5DQDL 2QADD 2YRZA 3TPUB 1NQBA 1F4YH 2QJDA 4CJ1A 4HK0A 4J1UB 4KGJA 4BELD 3WDIA 5DJ0B 5IQ9B 1HH9B 2IFGA 2AJYH 5BS0A 1U8IA 1TVBB 5LQBL 2FD6H 5IHUL 4PRID 3U48A 1BF2A 2FIKA 1JPFA 5EUOA 3CD4A 3IETB 1S7VA 3AU1B 3VW3H 4LHUG 1FHGA 4JHWL 2VDLL 1IL1A 1KJ2B 2ZP0T 3QNZA 5IF0B 1JRHI 3BVNB 3DSFH 4NQSB 4YFLF 3S35H 3QI9C 3H9SD 1DN0B 2VXQH 1BBJA 2D4DA 3VA2C 3QFDA 3UCRA 5J1TC 3ECBA 4DGIL 3EYSL 4PJFA 3WFEL 4M8QA 1ZLUK 3DOSA 1YY9D 4FRWA 4QXGL 5E9DE 3QIUB 1PFCA 3GEWB 32C2B 5KW9H 4MVBD 3MRFB 4WU7B 4QRPB 4RMVA 4ZDHB 4HPYL 4H88H 4L1HA 1OM3L 1EZVX 1B6DA 1TZHA 3T77B 3QUXC 4Z7UA 1T21B 1XGUA 3RDTB 4KJQC 4QHKJ 1F58H 4GRMB 4L3EE 3UTZB 4BUHA 1QFPA 4YHNB 5KSVA 4KKAC 5EIVA 1G0YR 4MB3A 2J6EH 5BMFL 4GG6B 3O9WC 1JF1A 1OWRM 1NCDH 5T3ZD 4ELKB 3IDYC 3PWJA 3GKWH 4M7LT 3MCKA 1JZ7A 1ZT1A 4GRLB 3IXTB 3OHXB 1RZKL 5DJ2A 5ANMB 3MLYH 1NFDF 1ZT4A 3FOLB 4LSQL 5I75C 4WFGD 4X5WA 2OJEA 4N9GB 3RHWK 5I73C 1N7ML 3MUY1 4I0PA 2X89A 5E08H 1NBVL 3D39E 4DGVH 4XMPL 5E8NB 2CDGA 3F65A 2MKWA 1MCOL 1KEML 1A8JH 3EYFB 4MAYB 1CGVA 5M94B 5I1GL 1IC7H 2VXUH 1IM3B 1YEHH 3SCMA 1VGKB 4QCIB 3VWKC 3KPLA 1FYTA 2P7TB 1YDPB 4XHJD 1EIBA 1YEDB 3TT3H 2CRYA 4PJXE 3SGKC 4NO2B 1I1AC 1QA9A 1QG3A 4KMQA 3KPOB 5DWUL 1J0KA 2HLAB 2HH0H 1PQZA 4NKOA 2CUMA 4JZOB 1G0DA 1NMAH 3JVGC 1TFHA 1X5KA 2R23A 1RIHH 4YQXL 1HWGB 1N4XH 2MJWA 3JWNC 2FJFA 5FYKU 3CFKA 4L4JA 4OJFL 3IDIA 2W0FB 4YNYA 3O6KH 1Q38A 5D71L 4X98B 1I1FA 3ZHKA 1RFDH 4HG4J 4JJ5A 3K1DA 1QPPA 1XGTB 2R8SH 3TA3D 3BKYH 4WEUD 2JIXA 5A2IH 4PRPB 2PO6C 2X05A 5AZEH 5F7HA 1I4FA 3ROOB 4GXVL 3TH2T 4F37F 1YEJH 3HPLB 1R6VA 2D7MA 4OF3A 1K4CB 1U3HB 4MWFB 2OR9L 4LAJH 3MRBB 3V6FA 3G5ZB 2C1OB 4HEME 4F37K 3U30C 2BC4B 4FQ1H 3UPAA 2I60L 1NEZG 1U42A 1Y6KR 3DVNA 1T66D 1VENA 1UB5B 1JNHB 4HX1B 1S7QA 4DW2H 2YA0A 3PHSA 3BKML 1UYWH 1MY7A 1FORL 1CU4L 3MRHB 2ZUTA 3D0VA 1I85A 3QO1B 2ZUQC 1G6RH 1XT5A 4NQVA 3RTQD 4YPJA 1VHPA 4L9LC 3MQIA 1XIWB 3LQAH 5H2BA 2V2WA 1WWBX 5FCUL 1QFUL 1TQCB 4U6HB 5K93A 3KYKH 4ELMB 1UZ8B 2EECA 4RAUA 4P3WA 1Y0LA 2AQ3A 2J6EA 3U46A 1FE8L 1YEIL 5FO9B 1T03L 2E7MA 3HZMA 4UZGA 5JNYA 1F42A 5INCA 4XAWH 3VCLA 4KK5D 2WWMD 4W4OA 1XF3A 4OSUL 2GTWA 4WVRA 2BSRA 3SN6N 4U1JB 3HUJA 3TEUA 4MNQD 5E99H 2LE9A 2Q8BL 4YO0A 2OXGA 3SEPA 5HI4C 1OGAA 3MTRA 1CE1L 3VFGH 1RHHB 2D7PA 5E1HB 3QDGB 1AGCA 5IQ7L 1YEKL 1QSEA 3HCVA 4YDLC 1NLDH 1UWEL 1EXUB 3FJTA 2BVEA 1U92B 4P2RA 3QIWD 5F9JB 2VUYA 5I66B 4Z76B 4ELMF 5JR1H 4QRTA 3AC0A 4U1SB 2HKFH 2JB5L 1KJVA 4M5ZL 2Z91B 3ZKMD 3VRIB 2R2EA 1MJ8L 2BNRE 3OF6A 4OF7A 4X80L 5E8EA 3BH9B 4P23B 4F58L 3AS2A 4PG9A 3IGAA 4MA7H 5IVNA 1RULL 2IQAB 4I3RL 4OCLC 2Z8VC 4FQ2H 1A5FL 3DWTA 1XZ0A 4M6OH 2GY5A 4QRUB 4PTUA 2R1XB 4UU9A 4JFYB 1DE4A 2Z31B 4FQXB 1OY3B 2XA8H 2DM7A 4ZO9A 5FHAH 1T0MB 1A3RL 2CO6B 2XOTA 2BRRH 3B9AA 3RVXD 1VADB 4Y5YC 4O51B 5D8JH 5MENE 1X6LA 3PIQA 4KQ3H 1PEWA 4U1IB 1MEXH 5DT1L 3O6FA 1A9EB 5IGXH 3C60C 4ZOBA 3T3ME 4Y4HD 5JDSB 2MPAL 5I2IA 1VFOA 4YGAB 1YPZF 3EBAA 2GUOA 3DMMA 4Z78A 4MZ2A 4HDIA 3OSKA 1AR1D 3SDCC 3MLPA 3AREC 4XCYA 5T3XH 3HMXH 1E27A 1RZKC 1DBJH 4FOMA 1J8HB 4OGYL 5D1QC 5BVPH 3BQUB 5EC2A 4Z7WB 3MJ8B 5DJ8A 4LQFL 3IFOB 1G6RA 2X09A 3QRFM 4ZUTB 1CT8B 5IB5A 1M7DB 1A3LH 1GOGA 3LB6D 1FG2B 3HE7A 3VWJB 1P5UA 3QG6B 4QOKB 1Q72L 1KCLA 4W70A 3MBEB 5L88H 3QFJA 1E4XL 1TJIL 3ARBA 4ZNEE 8FABB 1AD9B 4LAQH 3NIGF 4JO4L 4WFEE 1CLZH 4F7TA 4PJDE 3MUHL 3NTCH 2BSTB 1KIQB 4PS4H 1EHLH 4NO0D 2XZQL 4N1EA 5CSBA 4PB0L 4DTGH 4KJPD 4X7FC 3WD5L 4AT6B 1ZTXL 2V7HB 4WWKA 5C0BB 1YEEL 4RGND 3IJHB 1MFAH 1J1OL 4Z7WF 3HG1A 2LFGA 1GOHA 3W5MA 1BD2A 1ORQA 1W0VA 2D4FA 5E2JA 1R3LB 3G6JA 3UTTE 2G75B 5TQ2H 1QBBA 2FR4B 4I2XA 3RWJB 4IRSD 4L29A 5F8RC 4U0QB 4R4ND 4HV8B 2GSIB 4DK6A 4UIMA 4PJ7B 4OLZL 1DTUA 4ZFOA 1NANI 1IM9A 4Y8AA 2ENSA 1JWUB 5T1LD 2V17H 2AXHA 4S1SL 3BPNB 4X6DE 1NCWH 4PP1C 4WI4A 2YUWA 4LHUB 3VXPA 5C8JA 3C5SA 5JUEH 4OZFG 3JWDH 4DKFL 1YYMH 1VDGA 4J6RL 4K23H 4NO5A 3TN0D 12E8L 5D5MA 3DGGB 4U6YA 5HHOA 1KC5H 5FGSA 5A16B 1F13A 2AERT 4WW1B 1BIHA 2UUDK 1NBYA 1LO2H 3VFMB 5IJKA 4I13B 5BS0D 4QHMA 4EUPB 4PJ7F 1R3JA 4LGPB 1DLHA 1NGYB 1OPGH 4HJGA 4YBHA 2CLVB 1A6TA 1KN4L 1MI5B 1NLBL 3TIDA 4JFFA 1KJ3H 1HIMH 2EC8A 5HYJE 2C3XA 3SGDH 3IXAB 3MROA 1KJ2L 2ORBH 4CL7A 3GSQB 5L7XL 2GAZB 1PLGH 3JV6B 5C0IB 3DYPA 2FYYA 3QWQB 3HMXA 4HW6A 3BOVA 4PGBB 3C8KA 2D7TL 4XPTH 1EPFA 1NKRA 3MLXL 4J3OC 1Z6JT 4NO3B 2ZSWA 1MLBB 5ESAA 1BX2A 2QQLH 4JDTL 5DMGC 4O2EA 5D96B 1ZVSB 4YC2C 3WFHA 4M61B 3KS0H 4AEIH 1FIGL 4NP4H 3B6SB 4KTDL 4ZTPL 1KCSH 2A9ML 3Q0HA 4LP5A 4WWID 1WITA 4M6NH 2J88H 5JXEA 2WQ8A 1F11B 3IJSB 5JHDA 1PVHA 1RJCA 4WTZG 5ID0B 2JB6B 1IEBA 4IDLA 4WV1A 4OFIA 3FRUB 1YMMA 4HQQH 2F54A 5IBTH 4O2CB 4G8GE 2P8PA 1SYVB 3G6DH 5FOJA 1FZKA 3IU4H 5EOCH 3MOAL 1I8IA 1KGCD 4NCC2 2ZCKH 5E6IB 1EFXA 3SE9L 4W6YB 1XF2A 2CH8A 4F57L 1DR9A 3P4OB 4WNQB 4M6AA 2H1PL 2N56A 1Z5LB 5CMAA 5BJTA 2UV3A 3ARFB 2J4WH 3ELAT 3IFPA 3MNVA 4I0PD 2X89D 4PJ5B 2WBJC 5MP6H 4I77H 4OCSL 3TVMA 4F7MB 3TV3L 5EDXA 1IKNC 2FGWH 3P4LA 4HD9A 5DVOA 4EI5B 1CR9L 1XCQB 3SCMD 2EIEA 4MD0A 1S9YA 1FYTD 1UCBL 4B53A 1S7XB 4EVNA 1ZE3C 1SMAA 1JBJA 2C3HA 5IT2L 5DF0A 1LP9A 4PV8A 4JQIH 1VFBA 2FSEB 1J0JA 4MQXC 5IFHL 3G04B 2H45A 1MLCB 1JPTL 3HE6B 5I1HH 3QISA 3LIZL 2X1QA 4UV4L 2XTJB 3MC0A 5LWYL 1NFDE 2E27L 2PW1B 3L5XL 4HC1A 4RFOL 1UKQA 3F7YB 3BWAA 4XVJL 1FIEA 5LXGH 4OLVH 2EKJA 5IB3A 1J1XH 5DI8B 3P73B 3EFFB 1N6VA 3GBLA 3S8WA 2PYFB 2CJUH 5F44A 1I7UB 2K3TA 3L3IA 4HBCH 4G6ML 4C54A 2D3VA 4GQPH 3STZA 4QRQA 5BRZE 5FUZL 2JIXD 2NY6B 3S9DB 3P9LA 4HWZA 4PJAF 4WI5A 1GGTA 1X6NA 3V52L 4X6BB 4XC1L 3SGJA 5JQ6H 5DJ6A 1WZ1L 1PZ5B 2ZUSA 4R8WH 4CDGC 1KG0A 1T83A 3OWEA 3C2AH 4Z95H 4P4KC 3IF1B 3I84A 5AG9A 2O61A 2UYLA 3BZDA 1CTOA 4XWGH 4LVOB 5FYLE 4GW4B 3RWDA 5K9JL 4R2GC 3M1BA 3E6FA 4Y5VC 2DQCH 4KH2A 1QFHA 2C3VA 4PJBB 4UDUA 5EU3B 3E1F1 3MRGB 5GGRB 4K9EL 3BO8B 5EFIB 5GGTL 2E6PA 4QF1B 4Y2OA 4U7SA 4JDVA 4TSCH 2H8PA 4GW1B 4HBQA 4WDIB 4LMQI 3QDME 3AS0A 1BEYH 3MLZL 4P49A 2NY2D 4IMKC 1E6JL 3SKMB 4PBVC 5FGRA 5E2TL 4E5XA 1F3DH 2BHZA 3HZKB 3K2UH 2DQHH 5L9DH 3VDAA 3SDDB 2CKBB 3HR5A 3K4ZA 1I9IH 3FO0H 5DMKB 3VFUA 3LD8C 4KJYB 3RWGA 1KIRB 4MAUL 3VXQA 4WGWB 3WLBA 3TNNB 4POZD 4X99B 3SDAB 3P9WB 3MXVL 1DL7H 3QJHA 4PJBF 5J6GA 1OGAD 2IALB 4OLYH 3VFVA 4Q6IC 1IEHA 4RIRA 3REVB 3TESA 2VLRA 3U0TB 4Q9QL 1NGPL 1QSED 5FOBA 5T1KA 1ETZA 4Y19A 4TNVF 4P2RD 2X9XA 5EUKB 2AP2A 4YIQA 5F9WC 1T1XB 4F9PA 3MLSH 4X7EC 1PX4A 4LCUB 3L3HB 5IVXB 2B0SL 4IMLB 4R3SB 3L3OA 3ULSA 1HEZB 2JJTA 5TE4H 5HHNA 5TE7H 3RIFF 1RVFH 2IBZX 2HJLA 5IMOB 3QXDB 3RPIA 3S5LG 4UT7H 4L5FL 5KANG 3NA9L 3OF6D 4J2XA 2IEPA 2ADFL 3QEQB 4MA8H 5DRNB 1J10A 1XEDA 3D9AH 5IK3B 5F72S 3RIFK 2APVA 2BY0A 4G8IB 4Z8FL 4JFDB 5MERA 4QRRD 1F6LL 2DMKA 3U1SH 1AJ7H 3QIUC 4W4NA 1CLCA 1CDCA 2IBZY 5E5MB 4TUOA 3OR6B 3W39A 2KL6A 2F8OA 5ITBH 2YWYA 4YFDB 5TF0A 3BMVA 1UA6L 2WMPA 4KTYA 4ELME 5IVXF 3BW9B 3T1WA 1N64L 5HI3C 2VIRB 1KB5H 3O6FD 1UJ3B 1WTGT 1NFIA 5CSZB 4M43L 3KLHC 1NUFA 2WW8A 3TF7C 1VFAB 4OZHE 3L3DA 4JRYE 1YNTA 1P84J 3DMMD 4Z7VB 5C08A 1WEJH 1P6AB 2P8MA 2QSQA 2P46B 4K3EL 5C6TH 1ITBB 1FFRA 1G7IA 1IAII 4W6WB 1A6WL 3CX2A 1QRKA 1XR9B 3QDGE 1Q9KA 4GRLC 3WN5B 3CC5A 4G80A 3V4VH 4CADB 3HZYA 2F5AL 2CRZA 2EDDA 3SKJL 2A0LC 3O2WH 2BVOB 2X4TB 1DQDH 3L95A 3VGBA 3JXAA 5IMKB 4LPUA 1CXHA 1T6VN 4LASL 2EDOA 4ZAKA 3THML 4RAVB 3SY0B 4NQCA 1RUQL 1PX3A 4OCXL 3FCTA 4DWHA 3LKNB 4MMZC 1FC2D 1MQ8A 3HE7D 4OD2B 1JE6A 1NC2A 4G8EB 4P5MA 1JPST 2I26N 2UWEB 1YPZE 4XP9H 3QFJD 4Z7VF 2GJZA 3ARBD 1U3YA 3PUCA 5KVFL 5CJXC 3CPLB 1G7JB 1G7LB 3IS1X 5IB4A 3U0WH 3OXSA 3LS4H 4XC3H 2W65B 4ZXBA 2NY4B 4ISVA 4KGLA 9CGTA 1PEZA 4JKPL 3OKOA 4XGZA 4WWKD 2JJVA 5IOPB 3ZTJH 2ARJA 4Y88A 1QEWB 4LRIA 1F97A 2CLZA 5DEGA 1X5YA 1BD2D 2VSDA 1WFNA 5HDOA 2DQGH 4LEOA 5LAXB 1R5IB 2GK2A 4U6XA 1A6ZB 4TSBL 3BDBA 4OZFB 3GSNA 5AYUL 2A6IA 4NUGH 2UWEF 3NCJH 3EO0A 1R3IL 5I8OL 1T5WB 1GVIA 2K9UA 4LSDA 2HFEA 3NIGE 5CJOL 5DJXA 3VFSB 4QXUL 3HC3L 2ERJB 1IM9D 2BFVH 3R06B 2NR6C 4XNQA 4X9FA 3UYOD 1UWGL 3KNBB 4NC1C 2AI0L 4YHML 5J3HC 4RAHA 4PRBB 4LVEA 2OCFD 1L7IL 3OAYK 3T0XA 5DD6A 4Z7WE 3QCUL 5CHNA 2PUQT 3PP4H 3T4YA 4ZFGH 5AAWA 2R0WH 3P9MA 3LV3A 5L2KA 2EXYD 5GJTL 4GRWH 5SWSB 4K9EC 2V2TA 5C0CA 4ZUUB 3K8LA 3WUWA 1H3XA 3LEVL 5HHOD 3BPOB 1I3VA 1B0WA 3WHXA 3HB3C 2YS4A 3DGCR 1GJIA 1KB5A 1A1NB 1RK1A 1FFPA 3BIKA 1Z3GH 3GI9H 2P47B 2UY6A 4JFFD 3BZEA 3P4NA 3ZL4L 1FNLA 4YXHL 1CD1A 4JR9H 4MNQB 3LKRA 4JFOA 4UILL 3ROLB 1GOFA 4I5BA 2AK1L 3FN9A 1QACA 4J8RB 5T3XD 3WFCH 4YHPA 3QR2A 3O81A 5F7YC 5F3BB 4XB7A 3WV0A 2BNQE 1SM3H 1NGZB 1WSST 2B4CL 1AHWC 4YHLL 3W0WB 1TZIB 4OM0L 5F1IB 3V0WL 1J1PL 1S9XA 2ITCA 3H2WA 1B88A 2NPLX 1SJEA 4KXZI 3VFPB 3QQ9C 4BZ2L 5EPMB 3H6JA 2ZUUA 1FLRH 1UVQB 3FT4B 4NKDA 5I17B 5JW3L 5CEYB 5D9SB 3ZTNH 4C4KO 4RMWA 4Y2DA 1C5DA 3LKSB 2EH8H 1CZ8H 3CFBA 1B0RB 1FL3A 3H9ZA 3QG7L 4N0UA 4IM8A 4BH8B 4PJCF 2AXGA 5JHDD 5JXED 4R7DA 5F1KC 4ZFZA 1WISA 5B8CC 4WU5B 4BZ1L 3BIBX 3BH8B 4C57C 2YZ1A 4JZJB 1I8LA 3T2NL 1YMMD 4MXQC 4P23C 2APXA 3RWHB 3QRGH 3DO3A 4FMKA 3RGVC 3QHFH 1ZA3A 3KJ6H 4A2MA 1EFXD 4D9QE 4K71C 3FN0H 1INDH 1EH9A 3A67H 1CFTB 2A6DB 2NYYC 3MJ7A 1TJGH 2DJ4A 4WEBH 5HVWA 3J7HA 3MRRA 3HRZB 5AD0A 3P0GB 4K3JL 4QNPF 4GAYA 2OTUA 5D7IF 4JY5H 2GQHA 3I3BA 3C09C 5HVGB 5GRJH 4XPFL 4R97B 4NJ9H 3SQOH 2BJMH 1ZOXA 1BMGA 4I4WA 3TVMD 4LKCA 1HK6A 1RPQA 5CGYC 2DLGA 2N7AA 1U93A 4YHZL 5CEZL 1MJJB 3F58H 1Q0XH 1YNLH 4HPOL 5AYQA 3Q5OA 5FYJL 4XBPB 2WINB 4HS3A 4XNYH 2Q8AH 3CSYA 5TH2A 3GMOA 5FO8B 1D9KB 1HH6B 1BF8A 2YPLA 3V4UH 2FL5B 2QR0A 2VAJA 5BQ7B 3CLFH 4FZ8L 1PSKH 2XY2A 5EA0H 4X8XA 2W60A 3LRHA 1E6OL 4XPGL 4U6TA 5DXWA 2Y06H 2X6MA 5EZOH 1URLA 1CLOL 1K85A 1LO4L 2BSSA 2NY0B 1OP5K 5EG6C 2Q3AA 1PKOA 2EC9U 2J12B 4LCYB 4OGAD 2ITDB 3GO1H 2VE6B 4XCFH 1A7NH 4JM2B 3GJFA 4PRHB 5JW4Q 5DFVD 3DVGB 2HMID 1HHIB 5DGRA 1C5CL 2EDTA 3QI9A 3EOBB 4LCCB 3TH4T 3UMTA 3R1GL 5IMMA 4UT6H 4NGHH 1OWWA 4S0TD 1VFUA 4Q97A 4DZ8A 5B22A 5FK9B 1CDUA 4DVBB 3VXRA 1OTUC 4M62H 4WENB 4HLJA 1PD6A 4HHAB 5C0AA 5HXMA 3O4LE 2D7NA 4RDQG 3CDCA 2VLJE 4LCWA 5T1LB 5CEZE 3QUYC 3QPXH 2NW2B 4JG0H 3BAEL 2NY1B 2Q76A 4LBEA 4HKZB 4PJAE 4R96A 4H1LG 4UINL 3IDJA 1IAIM 2EH7L 3G5XA 1H3UA 1MCIA 1PKQB 5ICZB 2CKBL 1A14L 1NMCB 1AGFB 1RIVL 2VLKE 3QXAA 4NQXA 5H37G 1T89C 4LEXL 3VDBA 1JV5A 1KPUB 2BX5A 4UUJA 3RWEB 3RBGA 5DQDH 4JVPA 3STBA 1GH7A 4KAQL 3V6OC 4G43B 2DLEA 1XCTA 4N5EC 5EZLB 2P24A 3S5LB 3BEVA 2C3GA 3ARGA 2Q86A 3NBNA 3Q3GA 3GSRA 5LQBH 2X9WA 5SWZA 5IHUH 4GS7C 2VLRD 1A22B 5T1KD 1IAKB 4J4PC 1WBZA 4Y19D 3UTSA 4MXWH 5MI0B 4JHWH 2VDLH 1CGXA 4LRNL 5AUMA 2VZUA 3VI4F 2YPKA 2ZWLT 3VXUA 1QBML 3NFNA 4KRPD 2DQDL 2M2DA 3VH8B 1N8ZA 3DXAB 1QSFB 2X10A 4LP4A 1E28A 4GO6B 4H26A 1NUDA 1AGEB 5CBEB 1ZGLM 2V7NA 1CICC 2BVQA 4OFKA 4DGIH 5EUOF 1REIA 3EYSH 4PJBE 1BZ9B 5EOTA 4MDIA 3WFEH 3KDMB 4XPAL 5SWQB 4QXGH 1CWVA 2ICWJ 4MHHI 3MZGB 4HH8A 3EJYC 4Z7UB 1OTSD 3EYQD 1XGUB 1QLRA 4YBQD 1KNOA 2OL3B 4HPYH 1OM3H 3W9DB 2UZYB 1RURL 3WS6A 1T1ZA 1W8OA 2AEIT 3AY4C 4LLQB 4OLWL 3M07A 3OB8A 3TBYA 1U0QA 4PJFF 4Z0BL 5A1AA 5BMFH 4TVPL 4PRIE 5E6IC 3U4EA 1J0YA 5C08D 3S7GA 1PGRB 1U8MA 3MA7A 1KYOK 3LEXB 5D1XB 1FO0B 4WFHD 2DOCA 2K7QA 3G9VA 2DTML 3CDFA 4W6XB 1RZKH 1HHKA 1RD6A 1OP9A 4JG1L 4LSQH 1NBZA 4Z7UF 5KOVC 1FG9C 2XKNB 3BZ4A 3ARFC 1N7MH 4NQUA 3UBXI 2VISA 3H9SE 5JA8B 5DK0A 1NBVH 4XMPH 1BFOB 3CIQA 5I71C 4BQCA 4ODTL 4ZAKD 5FKPA 1MCOH 1FZOB 1KEMH 4CVZA 5E95B 4NQCD 4LK4A 5JIPA 1JGEA 5I1GH 2QKIA 1NC2D 2LABA 4JKWA 4Q6YA 5E2UL 3BP5A 1WUNT 2WWKO 3D18B 3OKKA 3N1PC 1JWMB 3DUUA 1IC5L 2MHAA 3RVVD 3DUSB 3HE6C 4O9HL 3RY6C 2IH1B 2G2RB 4FG6C 4ZXBD 5DWUH 1U8LB 3H9HB 1KPVA 4M3JA 3BYTA 2C4FU 5HGBB 3RZCB 1GCFA 4EDXA 4YQXH 4LGRB 2H2PD 4LQ1A 3L3GA 3LOWA 4N0YL 3WCYA 4OJFH 1ZT7A 3MGTA 4F8TA 2A2QT 1CS6A 2H32B 5D71H 3ULUL 3WKML 5T3ZE 1I4FB 1DZBA 3PP3H 5DVNA 4ORGA 4UAOC 4NBXB 1S78C 1V3MA 3UTQA 2RHEA 5F1NA 3WL9B 4WFGE 4GXVH 2PXYA 3WIFA 3MV01 3MGAA 3OXRB 3QDHA 4MJIA 3QDJA 2R2BB 2QSCL 4OZGA 2OR9H 3DVNB 4KUZL 3DRQB 1T0NB 2MSPA 3JV0A 4X7DC 5E4EB 1JYWA 1QRNA 2HVJB 3FT2A 4CRPA 4LVOC 5I0DA 1SY6L 4GXUN 3S96A 3O41A 3KPRB 2I60H 4JLRA 3VD5A 5FM5M 4NQVB 3NACL 1D6VL 3GI8L 2EYRA 3BKMH 5L2KD 1FORH 1CU4H 1J05B 2DD8L 3DV4B 4BFEA 5H2BB 5C0CD 4TUKL 3M45A 1DSFL 4WHDA 1MQKL 3ESUF 4M1CC 1MCHA 2VL5A 4RAUB 4Y5YA 6FABL 2VERN 4OAWA 3U82B 3ZT7A 5HYFA 5E94A 1MVUA 2Y7QB 4JFXB 1QFUH 3HZMB 4IRZL 4WI7A 3C60A 2QADC 3OAZH 5INCB 3MXWL 4KWUA 5I1DA 4E41A 4L9DA 4LLUB 1N2RB 1FE8H 1G9ML 5DS8B 4HUMB 3S34H 1YEIH 3UP1A 5IHLB 4WUUA 1I1YA 2BVYA 3T1FA 1T03H 3LQZB 1U8PB 1X5FA 3GSWA 4GUPB 1T22A 1VEOA 4CN1A 4OSUH 3SDAC 5DQ9B 3WDJA 1DBML 1VERA 3D3VB 2ZOKB 1TPXB 2Q8BH 2X4PB 4IIQC 4BZYA 3VGGA 1I7ZA 5E2WL 5IQ7H 2X4SB 1BOYA 4I9WD 2DL9A 4QRTB 1UWEH 1DDHB 3VMPA 2BOCA 4HIJA 2RQ8A 1I3RB 2R2EB 4Y2DD 1KLGA 4U05A 2I9LB 3L5WA 5DFWH 5DQJA 1S7UA 3ZT6A 5KZCD 3BPCB 5C6WH 3HUJF 1RUKL 2JB5H 4LPYA 4M5ZH 4PG9B 2FJHA 1G7PA 1I7RB 4QRRB 3DHMA 5K9QG 1YY9C 1MJ8H 2RB8A 2DMBA 4U1LA 4X80H 4F58H 4MVBC 3KYOB 2R29L 4FXLA 1RULH 1U8QA 4I3RH 3T4AB 1A5FH 1K6QL 3ZKND 1T1YB 5ISZA 4G7VL 1S7SA 3WO4C 5CD3A 5J13B 4D0DA 4WI6A 1UM4H 1FNSL 1ZV5A 3PHOA 3QUMB 4FQQA 5I30L 2DB8A 3B3IA 1MHEB 3PL6A 4HGMA 5EO1A 5ESVB 3C5JA 1A3RH 2AXFA 1CK0L 3FQRA 3MSPA 1F45A 1P7KA 4ZUVB 2VABA 4OFYA 5DA4A 4ODSH 5DT1H 3UYRL 4L8SA 4XTRD 5T33L 1UJ3C 2GJ6B 1UKSA 5FYKL 4PJCE 5DHVH 4P5TA 2EXWD 2MPAH 2R56L 1TQBB 4NHUA 25C8L 2MQ0A 4MB4A 3RL1A 5IR1B 1AXIB 5EH1A 1MFCL 2P42B 1QFWH 5TGBA 1A4JA 4DZBB 4PV9A 4YDVB 4NRXB 3T0EA