4P9HH

Crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv-1 and soluble cd4 d1d2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
231
structure length
215
Chain Sequence
b'QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAVNWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLISAVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTYDKWSGLHHDGVMAFSSWGQGTLISVSAASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPYICNVNHKPSNTKVDKRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Antibody 8ANC195 Reveals a Site of Broad Vulnerability on the HIV-1 Envelope Spike.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 37
structure length 215
sequence length 231
ec nomenclature
pdb deposition date 2014-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hH01
4PREA 4P46B 4U1JA 3BRDA 5HHQA 3ZE1E 2VXVL 3TA3C 3QWQB 4OZHB 5LGKA 5KSAB 1YEGL 1HYRC 3PIQB 4ZUTB 2Q8AH 2YRLA 3IDXH 1CL7L 2VR4A 4HFWB 1WUNT 4K07A 5I8OH 2DQIH 3NZHH 2GSGA 3EJZC 1GIGH 2YC1A 5DR5H 2GW5A 4ONGL 1J10A 1I8KB 4FQQB 1JN6A 3GMQA 1CE1H 1QEWA 2OJZL 3KGRA 5C3TA 1BQUA 1PBYA 4X5WA 3F58L 3DYPA 4XNYL 4LVOC 3WJJC 3U2SB 2VKXA 4R97B 2HFEA 4PRDA 1YC8A 1F4WL 3BIKA 4PGBB 3JWDC 3LSOA 4QXTA 3UTOA 1IEAB 4NQEE 1JGLL 1QA9A 3DPBA 1HSAB 3PWPA 4ZS6C 4LRNH 1IAII 3CFBB 1MFCL 2GCYB 2YSSA 1WSST 3MV7E 1P7HL 2FJGA 2IFGA 1BF2A 2F19L 1G9NH 12E8H 2V2TB 3IFOB 4WHTA 1JZ7A 4YHML 3KPOA 4MA1C 1VSCA 3UP1A 1NC2A 5HI3C 2GUOA 4JN1L 4JANA 3MJ6A 3L7EA 2L0DA 2I24N 5SV3A 4K2UH 4MXWH 1X5AA 1T4KB 2JJUA 4U6VH 1UJTA 2MTPA 2VDLH 4UILH 1DBJL 2XTJB 2W60A 5DJYB 4HULB 3WFEH 2CKBB 5FYKU 2RIKA 4RRPA 5TE6H 3N1MC 2CH8A 4CJ0A 5CEZD 1EBAA 4P2RE 5JORA 3HG1D 1CFVH 3VD7A 3ZKQD 2YPLE 4MQXC 4IS6B 1J5OL 4ACPA 4PJIB 3S4SA 2DYPA 2X6MA 3C5JB 2FJFB 5D6DA 4KI1A 2AJ3B 3N85H 5CZKA 3HPJB 3SEPA 2IEPA 1G84A 5ENWB 3FTGB 2J7LA 5KS9E 4O9HL 4HCRL 4Y4HB 1MREH 5IESL 4ZQKA 4HKZA 1LO4H 3TVMC 3MV9A 1S7SA 4UQ2B 5L2JB 2NY6B 4R7DB 2UWEB 4S0SD 2HT3C 4WUKL 3FRUA 4Z8FH 1A7RH 2Q6WB 4ORGA 3SO3C 1PX4A 5J6GB 5DJ2B 4X6EA 1ZT1B 3UTZA 3VWKC 2JCCF 2ATKB 4FOMA 5AYQA 3WUZA 1N5YL 4XVTL 1N4XL 3D2UB 5E1AA 5E8NB 2ILLA 4Q9QH 1TXKA 1WZKA 4HWBH 1FG2B 1U8OB 4OT1L 5ESQB 5IQ9B 1IGFH 5BXFB 4RAHA 4O2FB 4JQIH 5CFHA 5F88A 1N6QH 5DGQA 4TUOA 4OZGE 1QYGH 2C5DC 4X6BB 5KN5A 3IRPX 1HILA 4JPWL 3O2DH 1U8QB 5E9DA 4J1UA 3EOTH 1JK8A 4JZJC 3BFOA 4Q0XL 5IVXA 4M6OL 1A0QL 4KHXL 4IIQA 2RFXB 3GNMH 1T0NA 2IPKB 4G7VH 4MQSB 2NXZD 3DLQR 5I1KH 3U9PH 1EO7A 3WHE0 3JV0A 1KPRB 1OAKH 1CXLA 2EEBA 3ZDXF 2OSLA 1SMAA 3NFNB 3NPZB 2QHRH 4WO4A 1P7QB 3GI8L 3OKNA 3F7VB 5I8KH 3MCLL 3JTTA 5M94B 2PYED 1GPOH 5GGSB 4G6KH 3VWJB 4OV6F 4V2BA 2BVEA 2WK2A 5JW3L 3G5VA 3ARFA 5D2NE 5EPMB 1HHIA 3CVHB 1D5ZB 3DBXB 4F15B 5KJRH 3JUYA 4JPKH 3ULUL 2NY2C 3RGVA 4OBRA 1BFOB 1O0VA 4JKPL 5CGTA 1JJUA 4M6MH 4TPRH 4R7NA 2A9ML 1CF8L 3BWAA 4LP4A 5IUSA 2DIBA 5AWNL 3VXME 4MGXA 2FYYB 4PG9A 2OR9L 1X5ZA 4RFNC 4G5ZL 4R90L 5INCB 2OCFD 2VN7A 5ALBH 3U30C 1OQXA 2GITA 4WWKC 1P84K 3WKML 4AM0B 4OGXH 4Y5VC 3IXAB 1DQDL 3WFHB 4F7PA 4PS4H 1NFDB 4GAYA 1G7MA 1JNLH 2FLBT 3OKDA 4PJBE 3E8UL 4Y5XB 2CDFA 3RL1A 3TV3H 4Y4FA 1YEKL 1BD2B 2QADD 1I1AD 3OX8A 4FFVC 4XMLH 3GSNH 1VKXA 2MWCA 2G2RA 1MCLA 3ZE2E 4F33B 5IJVA 5T1LD 4EI5C 4ZTOL 2A6IB 3QWOB 3KLDA 4YPJA 4BKLB 4G6JH 1T1ZB 1IM9B 4KDWA 3EYUL 5GIRA 3T08A 4KTEH 1A6AB 1OF2A 5I8EB 4NPYA 5E8PA 3O9WA 4OI8A 1PD6A 3BGAA 1LE9A 4F58H 1FCGA 5IB1A 4D9LH 3VD4A 3OXSA 1UJ3A 4H8WL 3T2NH 1XCQA 5A2KH 4YPGB 5JMOC 1CDIA 1DE4B 1I7RB 1A64A 1IC4L 3FOMA 4LNRA 2C1OA 1RK0A 4HS6B 3K1DA 5L88H 1ZHBB 1HINH 4Z76A 4UV4L 2R0KL 1CDCA 3QUKB 4X6FA 3MJ8B 2R0ZL 3MRKB 1NC2D 2FRGP 4I0PC 5IBTH 2VLKE 5I15H 1S9KC 5IF0B 2HA1A 2QQNH 5IV2B 3DSNA 5EU5B 4AEIH 5LGJA 3DGGB 3QO0A 1YMHB 5LCVH 3SDAA 1Q0XL 3T0DA 4YHOH 1DANT 4XVSL 5FAAA 4ZAKA 4JFZH 3DV6A 4ORZC 1RUPL 2EXYD 2GHWB 4OD3H 1FNEA 1FL6B 1L7TH 1B90A 5GQBA 1ZA6B 1UWXH 2B7DT 3KR3H 5E99H 3V5DA 4I3SH 4UT7L 4Z7VA 3ESUF 4MAUH 4HS8H 3KYOB 1MI5D 5T3XH 4WTZG 1F02I 2RR3A 3O6FC 4X6CF 1RSFA 2FR4A 4KTDH 3OR6A 4NM4H 2C3GA 1T6WA 3RZCC 3H8NA 1P5UA 2GFBB 5IT2L 4O4YH 3VXPA 4K8RL 1T83A 4HWNA 5T5FL 3MV9D 4APQC 5CJBA 2DMCA 1KYOJ 4CU8A 4I77L 1HHHB 3LOWA 5GGTH 3D69A 4OB5H 3DX9B 3OAZK 1A1MA 4YHNA 3IDYB 3DI2B 4IMLA 1FQ9C 3JV5A 5T3XE 3H6JA 1V7NL 3HE6C 1UKTA 5GRVL 3FFCB 4KQ4H 5D9SB 2FJHB 1LEIA 4KZEL 4LARL 3B2VL 1RZJL 4RX4A 4WGVB 2IH1B 4XNQB 4NRXB 4QCIB 3MR9B 4HKJB 4D0DB 3FB7B 1NCTA 3SKUD 5TDOA 2Y06L 2BNUB 5HYJA 1YN7A 5A2FA 3WDJA 5FK9A 3E6FA 1FFOB 1A3LL 5K9OA 2YKLH 1Y0LB 1A22B 2A74A 2XZZA 3RWJA 4M43L 5HD8D 3U48A 5I76A 1UWGH 2EDNA 4OCLC 2VH5L 3QH3B 1X5HA 4OV5B 4P9HL 3MRJA 4NNPH 1RURL 1JUFB 3RVTD 2FD6L 2VZUA 5ANMA 1CGTA 4LLAA 3NH7H 2XN9A 4PJAF 2H3NB 4IJ3B 4U1LA 1SEQL 4MCZB 5I19L 4Z7WA 5LAXB 4RNRA 2FX7L 4J4PC 2EKSA 3MYJB 7CGTA 3GKZA 5CLWA 4UIKH 3RGVD 5GGSY 4PG2C 1VDGA 4NO3B 3EOBB 3U7YL 5H35B 4FZEL 3X14A 1MAMH 2A9NL 4JR9L 1IAIM 5BV7H 3GJEA 3MNWB 4NT6B 1S9WA 1PAMA 5ACMA 1U3HC 3HE7C 1DFBH 3QDMD 5HHOD 5HGGS 3FQUB 5JIKA 1SYSB 3HUJF 4PJ8B 4MD0B 1E4XL 1I4FB 2VOTA 3KPLB 3MUGA 4KI5D 1MIEL 4NRYA 3PL6D 3FB5A 5F7NC 2VDOH 1K4CB 3OZ9H 2JJVA 3SKMB 4DW2L 2X41A 2YOCA 4YBHA 3ULVC 3G6DH 1S5IL 4M1GH 4NC1C 5E2VL 4GKNB 1WBXB 4XC1H 5E95B 4XCFL 2Q3AA 2V5TA 1PEWA 4U6YA 4X8JB 1JGVH 2AGJL 2BOCB 1SEBB 5DJ6A 4Y4FD 1JGUH 4XT1C 5JA8B 2V2XB 4WFHD 4R0LB 2VLMD 1RZKC 4X83A 2VWEC 1ZEAL 1SM3H 3RP1A 4YGVB 1KC5L 1HH6B 4LP5A 5KSBE 3RKPA 4HQQH 2PYFA 4MJ5B 1JYNA 1LNUA 2J8UE 3LQZB 1N0XL 3SBWA 3O9WD 3QNZB 4UDUA 3BDXA 1WFUA 2MKWA 1CQKA 3QUMH 5HDQL 4ZO9A 1BQHA 5D1ZC 1OARL 2V6HA 5J6HA 4XMPH 2VXQL 1JWUB 1QFUL 2NZ9D 3LIZH 4L3EA 1FO0A 4RFEB 1YEHH 1WITA 3RWCB 5I16A 3T3MF 1VACA 1MCPH 3ULSB 3ARUA 3C5ZB 4OGAC 1P4BL 4ZXBD 2VNCA 2BSTA 4XP4H 4QHMB 3P4OA 4LKXA 4LCYB 3S3SA 1KLGA 3H9SB 1CICB 1WICA 2JELH 2NW3A 4HG4K 3HFMH 3GIVA 4X5LA 4OJFH 4KK9D 1N8ZA 5C09B 4DAGL 1NFIA 3VA2C 1FFPA 4WV1A 2XWJA 4U2YA 4MNQB 1S7RB 2VR5A 4LGSB 4ZAKD 4ZUSB 3B9VA 4IMKA 4PP1C 5T3ZD 1QKZH 4NKOB 5EU3A 3S96B 3S3JA 4K3HA 2X1WL 4NJ9H 3LAFA 5D8JL 4KJWC 3TYGH 5J11B 3SDDC 2AJUH 4Z77B 4X7TA 4D3CH 1H3GA 3UPCA 2BY3A 1NCWL 2XA8L 1FNAA 1ONQA 3ELAT 3O41A 1YNKH 5IHBA 4BZYA 2PETA 3I6KA 1INQA 4GLRH 1M1SA 3HAEA 5HVHC 5HVWA 2UZYB 4NN7C 4EIZC 5E6IB 3SE8H 1IEBA 4NIKB 2W0FB 1IGCL 4U1NA 3LMJL 2WAHA 3BQUB 3JV4B 3ZDZF 1FL3B 1DBAH 1RVFL 2DQJH 2HT2C 4IRSB 5DMIL 5IKCA 1S7UB 1UWXK 3BZFB 1WBYB 4DKFH 2B2XH 4TSCL 5DLML 3QDJD 4M5YH 4NOBA 1HKLL 1TPXB 2M26A 4QRRB 4G6MH 4XBPB 3U0WH 3RZWA 3GRWL 4QNPE 2OL3B 4RX4D 1T66D 4J12A 4ODHL 2QADC 1QBBA 4PJ7E 5L0QB 2C1PA 4HMEA 4M7LT 5F6HI 2ZUQC 2PTTB 3ILQC 4OLYL 1MVUA 3L1OH 4LRIA 1TJGL 5HXMA 2EYRA 5HBBA 5JDSB 3O45B 4ALAH 1CD9B 2ADIA 2AK4E 3KPQA 1BVZA 2BCKA 3O3EA 4WUUD 1Q9KA 2ZOKB 1AQKL 1A7OH 1MLCA 5DO2D 1I1FA 4QRQB 3VXTA 2AI0H 2O26U 4ZG1A 3SCMB 2F74A 3MRCB 4U6XB 1IGTB 1XGPB 5ITFB 1LGVA 1ZS8B 5K9KB 2EXWD 5GGRB 4DVBA 1UCBH 5DURB 4G6FD 2IFFH 4WGWB 4WJ5B 2Z8SA 3LPWA 1A3QA 3T4YA 4OLUL 1JNJA 4JZOB 4HWZB 3B8SA 1MHCB 4DCQB 4JRXA 5EULV 4Z7QE 4WU7B 2VZSA 2CLRA 1DLFH 4DZ8B 2CIIB 3OHXB 1PLGL 4FP8L 4ZTPL 1EVTC 1RUQL 5EBWA 1PG7L 1C12B 5CKGA 1YMMA 3WHXB 3DSFL 1IC1A 1KELL 3W39B 4YXLH 2N56A 5B38B 4RA3A 3BKYH 1J0KA 4JB9H 3RGHA 4CJ1A 4PRPA 5T1MA 3VFTA 2YD8A 1KEGL 2DLFL 2OR8A 1I8MB 5E08H 4K9EL 1MJ8L 3ROOB 3VGDA 1AR2A 1R5IA 1YPZF 3G6AA 1YY9D 1VERA 3T77B 5D6DC 2YUZA 1EH9A 2DQUH 4ELMB 5CD5D 2GSIB 4PJHE 3DX8B 5EOTB 5E5RB 3H42L 2HRPH 3FAWA 2BFVH 1LP9F 3SGEI 4F57L 2DLEA 2OTWA 1T7WA 4X98A 1A6TB 4JO4L 3STLA 2R0WH 1UA6H 4QRSA 1IQDB 2IAMA 3FQWB 1KULA 5DJZA 1Z5LA 3LHPH 1YQVL 1NANH 4RGNE 4A2MA 4DQOL 2VLRD 1HCVA 2FX8L 4Y4KA 1UZ8B 1RUMH 4K3DL 4KKBC 1X3DA 1CLCA 2R23A 2X4UB 4X6CE 4JFDE 1U8IB 5ISZE 3RPKA 2MQCA 4Y2DA 5FYLL 1JHTA 4H1LA 4L3ED 4ZOEA 5KTEH 2C7UA 5DI8A 3KHQA 4EJ1C 1RFDL 1UVQA 5D5MA 3SE3C 1FSKC 3MSPA 4NQCE 1CGVA 2WLYA 3UTQA 5GS0H 3UZEA 2YD3A 2BVTA 3O6MH 4I48B 4PJDF 2FGWH 2X4NB 1V8HA 3MOBL 4MAYB 4HKBA 2BNQE 1REIA 4UU9A 4D94A 1JPST 1P6AB 1ZXQA 3MLVL 3PHQB 4IIQC 2LU4A 3O6KL 2N7BA 3AS0A 4K94C 1T0MA 3N0PB 3QXAB 5TJWK 2D0FA 6CGTA 4OLEA 4K8RD 1LVEA 4NUJB 3REVB 5FF6A 4FZ8L 5HGAB 3DV4A 4PRIE 4OGZA 4PJGA 1E4JA 3T0EA 4WO4C 3V52H 2XZAL 4OF8A 5I30H 4YQXH 5ADOL 5F44A 2WNGA 1PY4A 1R3KB 1RZGA 1F6LL 3ARFC 3CX2A 3QUYD 4LLUA 1UEYA 5DUML 1GL4B 5E94B 5FO9B 2CRYA 2XZCH 3ESVF 4KJYB 2UYLA 4NZTH 3PE9A 5DRZB 3V4UL 4GS7B 3RGVC 5MERB 3RVVD 3F7QA 4L8BA 4HT1L 4ZUUA 3WLBA 3WUWB 1DQJA 5C0JA 5J9PA 1DQLH 2X4OB 2NY5C 3FL7A 1UZ6F 4PV9B 5IB2B 1KN2L 3QNYB 2CDEB 1RZFH 4JFFA 2XKNA 4I9WE 2CKBL 1OT2A 3UC0H 3C60A 3ES6A 2WBJA 3C5SA 5DS8B 5FO7B 5I8CB 3LB6D 2JK5A 5D2LF 4OZFH 4JFQA 1U8NB 4QGTA 2PO6C 4F9PA 5JW4R 1SBSH 3Q6FA 1VGEH 2APXA 5FOBB 3JWOC 5EIIA 4I5BB 1NKOA 2X7LA 4Y4FC 3DMMA 2NCMA 1JV5B 1JFQH 1RIUH 3KYMA 4HIJA 1R3IH 4MQ7A 3ZHDA 2IADA 4GG6E 3D87B 2JJWA 5CEYA 1NGZB 3HCVB 1T1XB 2E7CA 4Q6IB 4OM0H 5IVOA 4JDTL 2RAMA 4TYUA 3QHZH 3WIFA 4RMWA 4IBLT 4Y1AB 3ZHKA 1MQKH 3R06A 4PRHB 2ZJSL 5CBAA 4NQDD 5T5NG 5IEHB 2AXFA 2DQGH 4XXDA 2NZ9C 4RZCB 1H3PH 2J88L 4OFDA 4GAGH 5IBLD 5L8JB 1FVCA 5BW7A 2Y4SA 2DIJA 1JGEA 3JBG7 5F1NA 4AL8H 5D7SL 5I8OL 2BP3A 4HGWA 4W6YB 4M6AA 1A02N 3LEVL 2FH8A 1IVLA 4X9GA 5F1IB 4ENED 2DMBA 1M71A 4UZGA 1MRDH 4S1RH 5C2UB 4AG4H 3V0VA 2X40A 3U4BL 1K8DB 3DIFB 5GGRY 3RWHB 5BQ7B 4R2GC 4I1NB 4KK9C 3GUTA 3CX5J 1A4KA 4OD2B 3U4AA 4YHPA 3SDAC 5TQ2H 2HJKB 2R1WA 3JVGA 3UAJD 2PW1A 1EGJH 4LRNL 3IF1A 2FB4H 2Y72A 2GTWB 5I1EH 1AKJA 4PRPD 3T3ME 2WIMA 4TNVF 1XR9A 4N1HB 1RUKL 1KIRB 4YAQB 3BSZH 2VIRA 1KJVB 2WUCH 1MJUL 4PJ9A 3NZ8B 2C3XA 4MDJA 1J0HA 1ITBB 2ENSA 1HI6A 3KJ6H 3CVHL 5F96H 4P46A 3OR7B 5FGRA 3K8MA 3LEYL 3TLRA 1T7ZA 3D1MC 3QULB 3WD5H 2F5BH 2IPUK 5GGVY 3OSKA 4JO1H 1T83C 4DEPC 5KSAA 3PIQA 4ZUTA 1MCOH 3FN0L 3MRNB 5ID0A 3VXOB 4N1CA 3BRFA 3BP7A 1NGXA 2IAMD 5E4EC 1CFVL 5FM4A 5KVGL 4KRPD 1I8LA 4X0KB 1CI5A 5TQ0L 4Y4KD 1Q9OB 1I8KA 1VB9A 4FQQA 2VLJD 4GKSB 3PWJB 1IKFL 3RTQB 1MF2L 3CLEH 3U2SA 1R5WB 3F7YA 1MJ7L 3LD8B 4LAJH 4Y2DD 5HHVL 1UYWH 4PGBA 1U8LA 2QEJA 4PP2A 3UYRH 4QRPB 1R0AL 1HSAA 3CFBA 3BGMB 4C56B 2R4RL 1MFNA 3SPVA 3IFOA 4P9ML 4TRPH 3DVNB 3U46B 1A7RL 4AH2B 4K71C 4I2XE 1YEFH 3ULUC 2Y6SC 5FYKH 2DLHA 5B3JF 5DEGB 5E7FA 5M7QA 4GOSA 3SY0B 4XI5D 4NZRL 2I26N 1IILE 1KTDA 4DUVA 5E03A 3UTPD 1PKOA 4Q9QL 4HWBL 3BN9C 3TT3H 1YZZA 1UT9A 1T4KA 3VI4F 1IGFL 3B4NA 4JQIL 1BVLB 1S9XB 5DJYA 3UPAA 2CKBA 3LQAC 3KPSE 1N6QL 3TCXA 3O2DL 2VXSL 4IS6A 2IALB 3Q6GL 3C09B 5CJQL 5L6YL 3C5JA 3D5OF 1OD9A 5FYKE 4X8XA 4ODTH 5J3HD 4E41B 1D5MA 2AJ3A 4K55A 3HPJA 5E6YA 1G0YR 3LN4B 4KROD 5ENWA 3FTGA 4X4YB 4Y4HA 2QHRL 4QEGA 5DQ9B 4ODUA 1MRCH 1CU4H 1NPUA 1PX3A 4HAGA 5FV2A 3ABZA 5L2JA 4NQXB 1OPGH 3DARA 4XAKD 3RI5F 3MRBA 2VAAB 3KLAB 5FA3B 5EO0B 5J0BA 4HV8B 3GMLB 5J6GA 1ZT1A 2APWA 1EFXB 1EJOL 5FUCC 2ZUWA 4H8WC 4M6ML 5T1DL 4O51A 1D9KD 3ARBB 5GJSH 5KAQG 3DMMD 5E8NA 1BMGA 1A14L 1FG2A 2HT4D 3IDJB 1SJEA 5EOQH 3S35L 4Z0XA 4KHTH 2NY1D 5DYOA 5FGCB 5BXFA 1F6AB 4ODSH 4O2FA 5CMAA 3H7BA 4POZC 5ALBL 5TF1H 2VC2H 1KNOB 3D18A 3SDXE 3PDOA 1DBKH 4ODXB 1U8QA 2NY3B 1JYXA 1JMZA 1HYSC 2BVQB 2H32B 3I9GH 2HTKC 5C9JB 4J8RA 2DLGA 2P8LB 3IDMB 1M05B 1WIUA 4OFKA 3L6FB 1NCBH 2OM5A 4JFXB 2DBLH 2VYRE 3TV3L 3LKQA 1A9BB 5FUZH 5E8EB 3NFNA 2J8HA 3X12B 1P7QA 1BBJB 3F7VA 1DQQA 5C08B 5GGSA 5EUOB 2ZWLT 1EAJA 3OG6B 1LE5B 5D1XD 4D0BA 4WNQB 2FATL 1J86A 3CVHA 4YWGL 2OXHA 1D5ZA 2DQHL 5MEPB 1M6OB 4U1KB 1FBIH 4F58L 4XHJD 2EDHA 4W4NA 4YH6A 5I1IL 3JWDH 3VFOB 4WV1C 4U0RB 2BNRB 3VFNB 1BFOA 3O11A 2ZPKL 4IMKC 1VFUA 1NMAL 5IHLB 4Q9RL 1NBQA 1FYTB 3DURB 3QRGH 4L4TB 4HIEA 3CU1A 3ZKMC 5IB3B 2F5AH 1IC7H 3PJSB 4LOUC 3BOVA 1FVDB 5DMGD 1R3HA 5INCA 4M1CC 4LAQL 1HE7A 1XIWD 4M7ZB 4PJDE 2H45A 3IXAA 4MB5A 4P46D 3WFHA 3DVGB 2D7PA 4PGZA 1OVZA 2IC2A 3RVVC 1CT8A 4PJXF 5FYLD 2DQEL 5D93C 3DROB 2QQLH 3EJYC 5IW6A 1RZJC 2EEDA 4ZUVB 1GOHA 2DDQL 5F7DB 3PGFH 5IFAL 3WXWH 4KK8D 3OB8A 2P48B 3EZ8A 1NCDL 1L9NA 3VGEA 3U1SL 1NEZG 4F33A 2VQTA 4HF5H 3QWOA 3SGDI 2H26B 4BKLA 3ULVF 1T1ZA 1IM9A 3QXTA 1FE8H 4I18B 1A6AA 4U2ZA 5I8EA 1UM4L 4PB0H 4U1GC 2ADGB 1KB9J 1KJ3H 5GZND 1ZT4B 1CZ8H 5E2TL 3O81A 4Y5YB 1IT9H 2E6QA 4F7MB 1EZVY 1UB5B 4YDJB 3S98A 3V95A 1HOCB 1WFNA 5E7BA 5DQDL 5ETUB 1DE4A 4JM2A 4FABH 1I7RA 3MRLB 3CMOL 4YFLI 4H88L 2DD8H 4NQEB 3X13B 4HS6A 1A6PA 1ZHBA 4LRIC 4U7MA 4JHWH 3EYQC 4EKXA 2O5ZH 3DOSA 4ONFH 3QUKA 1I3UA 1N64H 2NXYD 3L5IA 4YFDB 5IF0A 1HZHH 4XZUA 5I1LB 4X7DC 4BSWA 5IV2A 1Q38A 4HBCH 4XRCB 1OAZH 4F8TA 5CZVL 3MYZA 1CFTB 2BDNL 1YMHA 5DHVB 1GGYA 3MXWL 3HRPA 4R4BA 1SY6L 5IBLC 5K93A 4BH7B 1BJMA 4EUPH 5D70H 1OW0A 3TNMB 3D3VE 4P2QD 1FL6A 2RB8A 4HJGB 2CIKA 5BVPH 1H3TA 3WFZA 1ZA6A 4OIAA 1OGTB 2VDPH 5C0AE 5CHNA 3S37X 3LRSB 1ZWIA 4ENEC 3KYOA 1H3WM 2YKLL 4GJTB 2EDFA 4P2RB 4LLDA 2G75B 2YPLB 1H3UA 1OAXH 4XC3H 4OF7A 5EC2B 3QIUB 4PGCA 4NNPL 1UACH 2JIXA 3MV01 4ETQB 1IFHL 5JQ6H 4RSVA 3MZGB 3DXAE 2DIAA 3NH7L 4MA8L 2ARJQ 4PGDB 1KT2B 5KS9B 2ZUXA 3EYVB 1HHHA 3QEQE 2ICEB 2X4QB 4ZFZB 4AENB 3DX9A 2Z91B 1EERB 3GO1L 4H20H 2XQYK 4E42B 5TFSL 1AXSB 4Y8DC 3FFDB 4P5TB 2X1PA 1BM3H 4Q6YA 4HDIB 1AR1D 5DVLA 1MCSA 2DTSA 3FFCA 1MFAL 5D9SA 3JXAA 2FJHA 1DFBL 1NGQH 4HPOH 1A7PL 4LCUA 3QCTH 2IH1A 3WXVH 3RY5A 4RAVA 4WHDA 2DICA 2BOBA 1N7MH 2Y25A 4HKJA 3V4VL 4D0DA 4L5FH 1IKNA 1U6AL 2P5WD 5EZLB 3FB7A 2YEZB 1ZMYA 1P69B 4KRPC 1YY8B 5F3HA 4LKCB 5H8DA 4Y4KC 1KN4H 4K7PY 4PGEB 1OM3L 5BJTB 1FFOA 2D7OA 4XC1L 1P5VA 1Y0LA 3VFGL 4OZGB 3V9FA 4X99B 2R4SL 1JGVL 5A40E 5C0RL 1BLNA 4Y2DC 1D6EB 2MJWA 3MUJA 3QH3A 5D96C 4AEHL 3RWGB 5FDWB 4UIMB 2IPUG 3P0GB 1JUFA 1P7QD 5IOPA 2OL3L 1SM3L 2YN3A 2AW2A 1K9TA 1H3VA 1NBVH 2CMRL 1HXYB 4EN3B 3WN5B 1ZK9A 5TGBB 1BFVL 4QXGL 3HMWH 3CJJA 1YYLL 3V5HB 1JI2A 3MYJA 4IHOB 5DFVC 2DQFB 2XWTA 2PCPB 4NO3A 4NKIL 5D2NB 2WUBH 5H35A 3PF2A 1HDMB 1Q94B 3E1F1 3NFPB 3HN3A 2IAND 1FIGL 4HXAH 1KCRH 4NT6A 3T0EC 3FMGH 1JZ6A 3FQUA 1SYSA 4MD0A 2VDKH 1I4FA 4OF5A 1YC7A 4LVHC 2D4FA 4MD4B 3QUXA 3KG5A 1K4CA 4RAUB 4W81A 3VXMB 5GGQH 3QHFH 3GEWB 2CLVA 3WFCH 2K9UA 3KNBB 5J3HC 4NZJA 1P6FA 5IHUH 1KTKE 1WBXA 2JJTA 4HC1A 3QI9C 1TITA 1BOGB 2AEQL 1C5BH 3P4NA 4YHZL 1AJ7H 4JM4L 3P0VL 2BOCA 1SEBA 2AJSH 3MV8B 4NKDB 3VRLF 4WW2B 1EMTH 3AXLB 1AO7D 4NJ9L 4R0LA 4AIOA 3OKMB 3CSBA 3I2CL 1F00I 4Z7UF 2CK0H 1SJVA 1PEZA 3IDIB 4PJBB 1HH6A 4GO6B 2E8ZA 4UINH 1I9RL 2BJMH 2FZ3B 2Y9RT 3C60C 2WBJC 4M8QB 4MJ5A 5HGDB 1MIMH 1NCAH 2W9EH 3KS0J 3QNZA 3B5HA 1YNKL 25C8H 4UTAL 5JW4M 1D5XA 4F9PC 3X3GH 3VFRB 1RHHA 2W9DH 3HPLB 5EU7C 3INUH 4GW1B 1SY6A 3ECBB 3SKJH 4LSSH 3DMMC 4PLJD 4RFEA 4XP5L 3RUGB 3RWCA 4JM2D 5HYSA 3ULSA 5IB5B 3C5ZA 3OAYH 2M1KA 1GGCL 3BHBB 2E27H 5CIPH 3ILPB 1BBDH 4QHMA 2E6PA 2X89A 4LCYA 4WFFE 1N59B 3IT8D 3H9SA 1SQ2N 1JI1A 2B2XL 1G7IB 4LSPL 2I60L 1UFUA 5L8KB 1HHGB 2BVYA 5C09A 1XGQB 2ZP0T 4MNQA 3BT2L 4OF3A 3KDMA 1H3XA 1S7RA 3WV0A 4ZUSA 3L95B 1A5FH 5LJYH 5BW7C 4NKOA 5I2IB 2BHZA 4XCCH 4LEOB 1MCQA 2RCSH 3S96A 4BFGA 4LDOB 5A16B 4OKDA 1XGRB 4XGZA 4DUXA 1FLRL 2OP4H 2ICWB 2ZUYA 5IVXF 1RULL 2YUWA 3IFNL 4ALAL 3OL2A 1ADQH 1IGMH 3BXNB 5HI5D 4LLYA 3NCCB 4LVNB 1V7ML 5EO9A 5HSFA 1QO3B 1GSMA 4BZ1H 3RVUD 2AI0L 2W0PA 3V6ZB 4OZFG 4N0FB 3NN8B 5I9QC 3OF6A 2JIXD 3PV6B 4L3AA 4ZDHB 1QSED 1RHFA 5E6IA 4CL7A 2W0FA 5F6IC 3D48R 1NUGA 2J4WL 1A3RL 3Q0HA 3JV4A 3P30H 3BQUA 4PJ9C 1PSKH 1FL3A 2OXGA 5DJDB 4BQ6A 3RVXD 3AMKA 1WISA 2P7TB 1S7UA 4P46C 4N1EA 3BZFA 1CQYA 5SWSE 2KZ1B 1BOYA 1WBYA 5J1AB 1DLFL 1NUFA 1BZQK 1QHPA 1PYWA 4XBPA 4BZ2H 5C70A 2NY4D 5A3ID 3I85A 3X3FL 3HR5B 2OL3A 5KSAC 3CSYA 4BQCA 4RMQA 4YXLL 5C0BB 3IJYB 1TJIH 5GGUB 1NDGB 4PRNA 4JB9L 4MNGA 4O2EB 5CEZH 4L8SB 1KJ2H 4MJ2A 2PTTA 2VLKD 3Q5YA 3QQ3B 1LEKB 3T0BA 3X17A 1I8LC 4XBEH 1FCCA 4MD5B 1FC1A 5HJ3B 3X11B 1MFDH 5JDSA 2JCCA 2DQUL 3O45A 3DWTA 3PABB 2ZOKA 4YEFA 4R97C 4NFDA 2FEDC 5DF0A 5E70A 5DT1H 1J0IA 2VXTL 3GSQB 3SCMA 1RZKH 5IJKC 4U6XA 1IGTA 1XGPA 4KJPD 1BF8A 3WEXA 3MACH 1YEIH 1ZS8A 1T5XB 1H0DB 2R0WL 4KPHH 5GGRA 5CEZE 2O5YL 3HG1E 3TJHD 4XPBL 5E4IA 4R8WH 1RUML 2ARJB 4NC1E 4JZOA 5L2KB 3AS3A 1KCUH 4B7LA 1J8HA 5DDHA 4MJ6A 2DM4A 3O8XB 1MHCA 4DCQA 4OLWL 4WU7A 3VFWB 1KPUB 5C6TL 4L8DB 2XNAA 1YYMH 1U58B 1QRNB 1IGIH 2CRZA 4ODWB 3W2DL 2VWEE 3W39A 5B38A 1RZ8B 2XTJC 3QFJE 3ET9F 1OWWA 1P7KB 3O6ML 3QUXD 4IDJH 1AGFB 2DJ4A 5FKAB 1DL7L 1VGKB 1NLDH 2F54D 1K85A 1NMCB 3GIZH 3T77A 4DN3H 1BJ1J 1Y6KR 2W92A 1VPOH 2GSIA 3MGOB 3D9AL 3DX8A 4Y8AA 5EOTA 4IRJB 4Y4HC 2GJ6A 3WNKA 4FNLL 5I30L 1ZHKB 1KJMB 3OWEA 4YQXL 5C2BL 5DJ0A 5KOVC 2AJXL 5F93C 3LS5H 1A6TA 4LFHG 2NY6C 5BV7B 1IQDA 3FQWA 5KZCB 1B0RB 3TF7C 3GDBA 4X4XB 4AY0A 2P43B 4NZTL 1JRHH 2A77L 1UZ8A 1NQBA 4G42B 4F3FB 3LDBB 4OI9A 3TPKA 5KSBB 3K4AA 5MEND 2VXUH 4R9HA 3QPXL 2DRUA 1AR1C 2X4UA 5AAWA 2J8UB 1U8IA 3NA9H 1ZVSA 1F4YH 1AGDB 2X70B 1RJCA 1D5BB 2ZCLH 2LABA 2LE9A 2DQCL 1UWEH 5C6PB 1A6VL 2VDQH 4YDIH 1YNTB 2PYEE 3C5ZD 3QEHA 3MBEA 3FB8B 1T3FB 3S3PA 3ARYA 3C6LB 4I48A 3U7WL 1WT5A 1DBBH 3CC5B 3IVKA 1P53A 2X89D 1TTUA 4MAYA 4G7YH 2C3VB 1I7UB 3MGAA 5F1OB 2XQYG 1ZE3C 1Q9WB 4W4OC 4TSBL 2E7MA 3RI5K 4XCYB 2COQA 3FJTA 4N8VA 1ACYH 1GZQB 1CVSC 1FGVH 3REVA 4NUJA 3HI6H 3LKSA 4OLXH 2QSQA 1JFQL 4R4ND 3QUMB 1INEL 4OTXH 4F9LA 1UQSA 2F53B 1R3JA 4M7KH 1OTUD 1NEZB 1R3KA 3VWJC 3MO1B 5C0GB 3ULUF 1XF3B 4YZFE 5FO9A 3OAYK 1DUZA 4WI6A 4KJYA 2GT9B 4F15C 3BP5B 5MERA 4KJQC 1GGUA 5D7JB 3WUWA 3CFDB 1WAAE 1RMFH 2NNAB 2X4OA 3OF6D 3HZYB 4V1DA 2B1AL 1BIHA 5BOZG 2NY7L 5IB2A 1JZ5A 4Q58C 3TN0A 5E6ID 2CDEA 3BPOC 4QRUB 1TETH 3V4PH 1KV3A 1L9MA 2DWEB 3QIWB 4PY8J 3CPLB 5E8OA 4HEPG 4Z7WF 1OAYL 1T7VA 5ID1B 3WE6A 3WFBH 4HLZH 4L9DA 5DUPL 1J18A 1MRDL 1HNGA 5FO7A 1M7IB 2R2BA 4S1RL 5I8CA 2I9TB 2UZXB 1E6JL 3PWLB 3H3BC 5IEKB 4XB8A 5FA4A 1U8NA 3BAEH 4NWUL 3EBAA 4TOYH 5JDJA 5CBEB 4OCYL 5IVNA 4I5BA 4KQ3L 4Y5XC 4P59H 4EDXB 4E9LA 4S1QL 1UKSA 2Q7YA 3SKOB 3FT2B 4ZS7L 3O6LH 3KPMB 3BSZL 1NGZA 3HCVA 4E0RB 4PJ7B 1BJ8A 3FT4B 1WIOA 1NL0H 1KPVB 4Y1AA 4XNUH 3GSUB 1FAKT 5CKAA 4WTZA 4PRHA 2V17H 4P4RB 1QNZL 4RGMB 3HZKB 5IEHA 2HFFA 5H2BB 1AXTL 3SCMD 3EO9H 4RZCA 1JNNH 3VRLE 1ZHNA 1J9CT 2FNBA 1IAIL 4K7PL 1FFQA 1B6DA 4XHQA 5FHAH 3MREA 5EA0H 2AK1L 5GZOD 2NY0D 1FH5L 4MJIB 2FEEI 3P9MB 5F1IA 5K59E 1MCWM 4Y88A 1MI5E 2DM2A 1DBML 1J8HD 3ARDA 1WWCA 1K8DA 1L6XA 3DIFA 3RWHA 4M03A 3VRIB 5BQ7A 4KKLD 4OD2A 1UYWL 1WQVT 4HZAA 4C4KT 4UDTA 1AFVL 2QBWA 3QZWG 5C3LD 3ROLB 1TZGH 1WF5A 3SDYL 1N26A 1GOFA 1K6QL 4PJAA 3MV9E 3KVQA 1OW0C 3FONB 4NP4L 3T65B 2GTWA 3HI5H 1HH9B 4G43B 3ALWA 3B8YA 2H9GB 1KJVA 1SYVA 1YEJH 2H8PB 1A7NL 3MLWL 2P24B 1MFBH 5FUOH 4BQ8A 4K94H 4OD1L 1EX0A 3OR7A 3TZVB 2EIZB 3H3PH 3NCYS 3QULA 1KBGL 4WCYH 2Z31B 3WFDH 2LTQB 3RVUC 4WI4A 2WQRA 4EQ2A 3OPZH 2GJ6D 1GHFH 2W0KA 3A6CL 3WNNA 4MS8C 4NCDA 4PJEB 2VRAA 3T3PF 3CVIL 3VXOA 4PJHB 5DRNB 4P4KA 1YNLH 3MCKB 1A4JA 4X6DF 4YFEA 4MMXC 3VG0H 1FZMA 3DHJA 5E2JA 4X0KA 2ADFL 3IDYC 1Q9OA 3PWVB 5IVXE 1QLFB 1JPSL 3CMGA 2VXVH 4GKSA 4UQ3B 3PWJA 3QO1B 3RWDB 3RTQA 3VD3A 1S5HB 1AD9B 1YEGH 3FO2B 1AGBA 2C3WA 1CL7H 5A3IC 2R9HD 2DS4A 4QRPA 5CWSB 1J1PL 1W2KT 3QG6B 1CU4L 1J0JA 1HQRA 4RA0C 3MBED 4NFBA 4C56A 1IKNC 5ICZB 1GOGA 2OJZH 4WFGD 2BK8A 2MHAB 1MWAB 4NQCB 3BPCA 4EUPG 3F58H 4MAYD 3S5LG 1TTGA 4AH2A 3RIFK 3RDTA 3R1GL 2V7NB 3I75B 3Q3GB 1F4WH 5DEGA 2VABB 3NIGE 2PXYA 2WSKA 1JGLH 2X9WA 3EHBD 3SY0A 2BNQB 3QIBB 3F7PC 2LFGA 3FRPG 3ZE0E 3BGFB 5HHOE 2YK1H 2I9LA 3VFMB 3BPLB 4G8EB 4ODSL 3VCLB 5ESAB 4KI5E 3WNPA 1MCDA 1BVLA 4YHMH 5IMKB 3B9DA 4IJ3C 3QSKB 4L1HA 1JZ2A 4PJFB 3WIIL 2IALA 2ESVB 1KIPA 5EZIL 2XRAH 4NCC1 3I9GL 2X9XA 3LCYA 4MZ2A 4ZSOA 4E41A 4QLRA 2A6KA 4X4ME 4N90D 1HCFX 1PG7W 1U95B 4TULL 1CLZL 1DBJH 1UG9A 3LN4A 4V1DD 5FUZL 3GBMH 3TN0D 1BZ9B 4I4WB 4X4YA 1U3JA 2MNUA 4WFHE 9CGTA 5DQ9A 4F80A 3MX0A 5CCKL 5KBNC 1J5OH 4GBXB 4N9GB 4JQVA 4OZIF 2DF3A 4QXUH 2C9AA 4NQXA 3FO9B 1MJJB 5CINL 2FSEA 2QSVA 5F7KC 1J11A 1QACA 3MC0A 3BVNB 3BUYB 1T2JA 4JY6B 5DEFA 3TH4T 4Z7OE 2VAAA 3KLAA 5FA3A 5EO0A 4BH8B 4G80B 4HV8A 3GMLA 2BSRB 2JJTC 3NAAL 4P0DA 4O9HH 3RKDC 1JF1A 1EFXA 5IESH 4IOSD 3SGKA 4CADA 4BA8A 4ZFGL 3ARBA 1ZGLP 3E3QE 3IDJA 4R0LC 3NPSB 5ICYB 1FV1B 1EIBA 1KUMA 3ZO0A 1I3GL 5IVZB 2YD5A 1U91B 4G9DA 4GG6B 4Y1AD 2BVQA 2E9IA 4PY7B 4WHYG 1N5YH 3Q1SL 4XVTH 4XNZB 5C9JA 4Y16B 2P8LA 3IDMA 5MHSD 4LU5L 43C9B 3L6FA 4JFXA 5CGMA 2UV3A 1A9BA 4Q97A 1X5LA 5E8EA 3X12A 4ODVL 2DKSA 3PWNB 4POYA 1BBJA 1CBVL 3VGFA 4G9FB 4JPWH 3C5ZC 2UUDH 5EUOA 4R6UA 2D7TL 5IG7B 2PN5A 4Q0XH 2GJZB 3OKEB 5T33L 1LE5A 2C3HA 1A0QH 4KHXH 4Z7VE 4WNQA 1CICC 2CDGB 5ADPH 5HVFB 4QRTA 3ARDD 2EE3A 4QO1A 3SDCD 1FZJA 1M6OA 3NCBB 4OAWB 1IT9L 5IFHH 3KWWB 1N3NB 2BNRA 3VFNA 5JLZB 4DKAA 4Y7MA 3M07A 4HHAA 2JE8A 4R4NC 4KH2A 5JW3H 3DURA 3QEUA 5IB3A 3TNNB 3PJSA 4OSUL 4BK5A 1G7LA 5J11C 5EORL 4MB4A 1FVDA 4GMTL 1CL7I 5KOMC 3MOQA 4ONFL 3ULUH 2YD1A 4YXHL 3D0LB 4ZFOL 5IMOB 1TFHA 4HPYL 1P4IL 3MRRB 2JB6B 3KYNB 3DVGA 4JKPH 5B21A 3KJ4B 1OAZL 4KV5F 3QDJE 1CYGA 2A9MH 4W6WB 4PJGF 1CF8H 2VZ3A 2VDNH 5KVDL 1Y6NR 3I6GB 2C4FU 1ITCA 4PV8B 2VQUA 4G5ZH 3SE4A 5E6IC 4R90H 3LQAH 4P4KD 3GMMB 1OHQA 1TQBB 4YO0A 1B4RA 1ZSDB 4BJLA 3WKMH 4HUWA 2BVPB 2GY7B 3BQUC 1DQDH 2H26A 1YPZA 3MLSL 3ULUE 3ORJA 4IRSC 2ADGA 4HUUB 2CD0A 3MRGB 3E8UH 2X4RB 1TPXC 1YEKH 1QFHA 4F7EB 5EWIH 1LP9A 1UB5A 2OLDA 4G6AD 5JQ6L 4NYLA 2UY6A 4ZTOH 5ANME 1HOCA 5ETUA 5L0QC 3QUZA 3EYUH 4NQEA 5FHBL 4ZYKB 1MY7A 4FQXB 2EC8A 2VKWA 4PJCF 4QHUB 5ACLA 3L3JA 1I1CA 2FL5B 3RDTD 3ZZ1A 1BM3L 3NACL 1CWVA 4BYHA 4NQSB 1EUTA 2PXYD 5I1LA 2EYTB 5HGHB 4H8WH 4XRCA 3L3KB 1BAFL 2APBA 5D1QD 3MRMB 4EI6B 5DHVA 1JTTA 3SCMC 1IC4H 3TPUB 4CVWA 4IOIA 3UPRA 4BH7A 4UV4H 4YE4H 4D9QD 5EC1A 3TNMA 2R0KH 1GXEA 1FZKB 1KFAL 3R0NA 2R0ZH 4KKAC 5GZOC 1OGTA 3LRSA 2APTA 3KPSB 4GKZB 3O3AB 1I7TB 2G75A 3RBGA 4XVSH 5FUCE 4FXGB 4G8FA 3KLHD 5EC2A 1RUPH 5JR1H 1FO0H 2CRMA 3MRIB 32C2B 5FB8B 4CU7A 2CQVA 5JXAL 4ETQA 5HHMB 5JXED 8FABB 1GC1L 1OY3B 3GJFH 4UT7H 2JB5L 4PGDA 1KT2A 3EYVA 2WIIA 4TTDC 3TYFB 2XXCB 4ELKB 4X7CC 1QLEL 4ZFZA 4AENA 2Z91A 2VLRE 1J0YA 2X09A 1YUHB 4CNIB 4E42A 1Y18A 3LPFA 4P5TA 4M1DL 5IT2H 4HDIA 2H1PL 1VA9A 1J1OL 1EFXD 2O61A 4LPXA 1MAKA 5T5FH 1NGPL 4XPGL 4ZO7A 5ECJE 1KCRL 3L3IA 4L3EE 1VFAB 5D4QA 5JZ7D 1G9EA 4RISL 1TVDA 4OBSA 5C0NC 5C07A 3T0XA 5F1KC 5C0DB 2H6PA 5D2LA 1YY8A 5GJTH 3VXRA 4LKCA 4KXZH 1U92B 4GRWH 4PGEA 2V7HB 5IHUL 3O0RH 5A2IH 3VH8G 4GAFB 4X99A 4KZEH 1MFEL 3ARED 3SDXB 4LARH 3B2VH 1KB5L 1RZJH 4OZHF 4U1MB 3GM0A 1D6EA 4B41A 3RWGA 3VXSD 5FDWA 4UIMA 5DHYA 1CCZA 4EXPX 3U4EA 4XPHH 2Y06H 1PKQE 5SX4H 1FDLL 4N0CD 1F5WA 3PV7A 4UINL 5EU6D 2H2PD 3RQ3A 1XF4B 2F8OA 1HXYA 3UZQA 3WN5A 4S2SA 1QSFB 5TGBA 4ZFOA 1MIML 3AY4A 4NN6B 3VWKA 4YHYB 4N0UA 4MAYC 4GRWE 2VH5H 3MODL 1IARB 4IHOA 4P9HH 1LO5B 4JPIB 2DQFA 1CFBA 2R15A 2PCPA 2X42A 3LH2L 3EHBC 4QWWC 1T1WA 2FD6H 3VFSB 1IGJB 1HDMA 1FN4A 3NFPA 3P11H 2VJXA 4XPFH 1NH6A 2EC9T 4F9LC 2F8XC 3B9EA 1I9JH 3FO1B 1SEQH 3GMNA 4JVUA 1ZHLB 2V9TA 1UH2A 4P23D 4WY7L 1BBDL 1JGDA 4NUGL 3BIAX 4QHNA 4JZNB 4MYWB 2UUDK 1JYWA 4HH9A 3MOAH 4MWFB 3TBWB 1DQTA 4FZEH 1PW3A 5DUBA 4KGJA 2HJLA 4GS7C 3KNBA 5IM7B 2A9NH 4JR9H 3S36H 1BOGA 1OSPH 2HWZL 1QBML 2E7LC 4MHHI 4HAFA 1EHXA 5C1MB 4XWOD 1A5FL 3MV8A 4NKDA 4WW2A 4XCCL 3KYAA 3AB0B 2HFTA 3VXUD 4NC0B 3ARRA 3U6RB 1NSNL 3GHBH 3OKMA 3HC4L 3ISWA 2OQJB 2BHYA 3UTSB 2HJFA 5I74B 4ZUWB 3IDIA 1IRAY 4DW2H 4G8GB 1N6VA 4PJIF 3DUSB 5E2VH 1S5IH 2FZ3A 3E0GA 1KGCD 4M8QA 4XCFH 3TIDA 1ADQL 1IGML 4M4PA 2AGJH 3NIDF 3HNSL 3SJVD 4NQDE 3VFRA 3PUCA 2B20A 4Z6AT 1ZEAH 5TH2B 2HKFL 3ECBA 3K8LA 3QZWB 1KC5H 3EAKA 1BFTA 1DEDA 5F9JA 4PB9L 3RUGA 2A83B 3NCMA 3QUZD 2AJYH 2UWEF 3LZFL 2B1HH 3BP6B 5IMMB 5IB5A 1N0XH 4XP6L 4Z95H 4HMCA 1W72L 4Q6IC 3DNKA 5I18L 3T1FB 3ILPA 5JO5B 5EN2B 4JY4B 2W9LA 5HDQH 4ETYA 5I1AA 3P4LA 1N59A 3TA3D 5BZDB 1IC5L 2VXQH 4JRXE 3W9EB 1QFUH 1G7IA 1AXIB 4JCLA 1HHGA 3VXQB 2GQHA 3QNXB 4UBDD 4WI9A 5F9OH 1KTLB 4RWYL 1WZLA 1YMME 4EI5A 1Q72H 3L95A 1U42A 1TJIL 1VEMA 5I2IA 4LEOA 5EUKA 3GSVB 2ED9A 5A16A 1XGRA 4NSKB 4PRPE 5B39A 3ULVL 5GS3A 3ZL4L 3CX5K 3D3VB 5MEQB 3BXNA 3RX7A 5C0AB 1OGAA 1HHKA 5FV1L 3UJIL 4CU6A 1S9VA 1QO3A 4ZS6D 4HLZG 4YUEL 4H1LH 2JLLA 4J6RL 4MA3A 3V6ZA 4N0FA 3FN3A 3PV6A 2ADJB 5D8JH 3SKNA 4FS0A 3RRQA 3AC0A 4ZDHA 5DD3H 4JRYD 4H0IA 1NCWH 2XA8H 4K23L 4EOWL 1S78C 5ILTL 3DXAB 4RRPG 2R56L 3S5LB 1QTYT 4J23A 4P5TD 2P7TA 1XZ0B 1NAML 2VLJE 3EYFB 5EBMA 1KB5A 3RL2A 1VESA 4LQ1A 1FNFA 4DGIL 4JZJB 2JKXA 3G6JE 1YYML 1OQOA 4WTWA 5SWZA 5H37G 1IGCH 1IGIL 5D5ME 3LMJH 5IQ7L 2DJSA 5J06A 3NIFE 4JFEA 3MNVA 1FZOB 1LILA 1V3KA 5C0BA 4OZIB 3FHQA 1MCBA 5BZWB 3IJYA 5GGUA 1NDGA 3F7RA 5HDBE 3WCYA 4O2EA 2RQ8A 1CXEA 5C07D 3PGDA 4L8SA 1Z3GL 4UUJB 4DOHE 1SHMA 4BUHA 5DMIH 2I25N 4FQ2L 4ISVB 3VXRD 3GJFK 4KDTC 1K2DB 1NFDF 2UZIL 4TSCH 3TBTA 3JZ7A 4DN3L 1HKLH 1MVFA 3OKYA 3RTQC 3PABA 2DBJA 5D6CB 4JFPB 3LD8C 4POUB 1ZVYA 1G7QB 3HZVB 3HR6A 3UTPE 4GW4B 1ZGLM 4G6AC 3GSQA 1JPFB 4OLYH 3PQYA 2HT3D 3LS5L 1TJGH 5IIEB 2ERJB 2ZKHL 4DJMA 1H0DA 4LCWA 3VWKD 1E4XI 1JRHL 2ZG2A 3KPRD 1AQKH 4RFNB 4G8IA 5L2KA 2X4TB 2PXYC 3FQTA 5GSVB 5H94B 3NA9L 5GRVK 1A47A 3UTTD 1KPUA 2YN5A 3HI1A 3PWUB 2NMSA 3VI3E 1G6RB 1QRNA 1UWEL 1XR8B 3B5GA 4ODWA 3I3DA 3RJQB 4D0CA 1CR9L 1FNSL 5C0FB 2VDQL 4HUVB 4YDIL 5EZJB 5DSCB 2CUMA 4AIZB 4Z5RB 1WK0A 4OLUH 1ZAGA 3EFDL 1AGFA 4HUKB 2ITDB 4JVPA 2CUHA 4MSWA 5E2UL 4XH2A 4JG1H 4XAKE 4BSVB 1SJHB 1QRKA 3OGCA 3C09C 4P5MA 3ZMRA 2YD7A 4FP8H 4ZTPH 3ETBF 1RUQH 1PG7H 3LKOA 1FGVL 3DSFH 3MLRL 5EU7E 2F15A 3B6SB 1KELH 2P5EA 3MV8D 4JCMA 4IRJA 1ZT7B 3MXVL 3EO0B 1ZHKA 1D6VL 1KJMA 1KEGH 4TVPL 5FCSH 4YBQC 1LHZA 3LEXB 4JQVC 1W72A 4K9EH 1MJ8H 1RI8A 3QDGA 2VL5B 1B0RA 2XY1A 3EKCA 4X4XA 3RJDA 2OZ4L 3KXFB 5KSBA 3H42H 2QL1A 4JO3H 4OF6A 1B2WL 4Y19D 1U3HA 4UT9L 3V7AG 2X5PA 1F45A 1EA9C 3ARBC 2X70A 4X80L 1D5BA 5JZ7C 5K9JH 4JO4H 2Z8RA 1TETL 4RMUA 3RNKB 4WWKD 1YQVH 1YNTA 3RAJH 3T1WA 2FX8H 2IF7A 1EAPB 3DRTB 5DK0A 3NMEA 3FB8A 1HQ4A 2NR6C 2ZSWB 5CJXA 3B9KB 3C6LA 3D6GA 3VGGA 3QQ9D 3MFGB 5J7CC 4LEXH 3P73B 5E56A 1I7UA 1WTGT 3BAEL 4P57A 2E8YA 5FYLH 5MP6L 3CSPA 1Q9WA 2IH3B 2W91A 4PR5B 2CUIA 3I02A 4XCYA 5F89B 1RFDH 1GZQA 3CSGA 3QXDB 3C08L 4S10A 4EI5D 4NNXB 4UAOB 5K33A 1YJDL 2E7BA 2FWOB 4GRLB 2F53A 3MOBH 3O6LL 4NO0B 1NEZA 2H2PC 3MO1A 4PJCB 5C0GA 1DEEB 3MLVH 1XF3A 1TCRB 5AG8A 1OD7A 3RU8L 3WKNA 2Q7NA 1QBLL 3O6KH 1DZBA 1NAMA 3IJSA 3O3DB 2GT9A 2DTML 3BD3A 1OGAD 1MEXL 1LD9A 2NX5A 5FYJL 5FYLE 2XI9A 3BP5A 4FZ8H 1LMKA 5D7JA 3CFDA 4P49A 2NNAA 4U0RC 5D72L 5EU4A 4C59B 2XZAH 1NDMB 5GS1B 3HZYA 5DD6B 2VISB 2P47B 5A1AA 5ADOH 1X4YA 4JN2B 4OI7A 4ZOAA 1U8JB 3KS0H 4GRMA 4FA8A 4LGPB 5DUMH 4OCWL 4I0PD 3CPLA 1FNGB 4M7ZC 3F5WB 4JFYB 1JHLL 1BWWA 4HT1H 2I9TA 3PWLA 3R8QA 1W0YT 3IAGC 5CBEA 1KN2H 4L4VB 4CAGA 3Q2CA 5SWZD 4KMTL 1TZGL 4XWOC 3SDDA 3VMPA 4JFED 5C0BD 2L7JA 3SE4C 2G5BB 2XXMB 1JNHB 2CKBH 2OBGA 3QDHA 1R5VB 3H9HB 3MA9L 5DMYA 3FT2A 5FM5O 3KPMA 4IOFC 1KB9K 4PJ7A 3ZYZA 1CDJA 4I18C 3FT4A 4XWGL 1GVIA 3LV3A 5FUOL 1X5KA 2P49B 2FBJL 3EJJX 3GSUA 3H3PL 1N6UA 4XP9H 4Y5YC 4P4RA 2OX5A 2ZUUA 3REWB 1S3KL 4YDVB 4WI2A 4APQD 3HZKA 1TVHA 5H2BA 2FO1A 3OKKA 4J3VA 3FOLA 3PQYD 2WWMC 3QPQC 2Y7QB 2HMIC 3MRQA 5KW9H 4JDTH 2BVUA 3HC0B 4P2QE 3CFEB 4LCWD 1HHJB 1X5XA 2XPGB 3EGSA 2XG4A 3U0PB 4OCMC 4MJIA 2W1NA 2ZJSH 3HE6D 3UYOD 1I7ZB 2V5RA 1OTTC 2ITCB 5L2KD 4PRAB 3HG1B 2NY5L 2J88H 2D7NA 4JKWA 2G9HB 1TENA 4UBDC 4MXVF 1JHKL 5CZXC 5D7SH 3ROLA 5F8QC 2P8PB 5JHDA 1OAUH 3LEVH 1S7VB 5CP3A 3V7MA 2VLLA 2A6DA 5AZEL 1T22B 1N2RA 3FONA 1RIHL 3T65A 4QXWA 4KY1L 3W0WD 1HH9A 4G43A 4OLZL 1MCHA 2IBZX 3TFKC 2H9GA 3IS1X 5SWSD 3U4BH 4OFIA 2OZ4A 2X4PA 3OJDB 2H8PA 2EEAA 4BELD 3NBNA 2BRRL 1JVKA 3SOBL 1DN2A 3JWOL 3TZVA 4CDHA 1QZ1A 1JTOA 1G9NC 1ZLUH 3S88L 3GGWB 3QIUC 2P5ED 3C8KB 3K80A 3EUUA 1QSVA 1XEDA 1B88A 2YK1L 1ZLWH 5B8CB 3IDGB 4OQTA 1Z2KA 1RUKH 4LASL 4PJEA 5I1GH 4PJHA 4YIQB 1MJUH 5DRNA 3MCKA 2P5WE 3QDGD 4J4PD 3AS2A 1QPXA 1KTRL 3CVHH 4F7TB 5FFLA 3LEYH 4UNTA 4XCNA 2XRAL 2QQQA 1QLFA 4P5TC 4EIGB 4HK3J 4UQ3A 4PYHA 3ZT7A 3QO1A 4YR6B 1EEZB 3HE7D 1U3HD 1RJYA 4MHHG 4R26H 1S5HA 4Z18A 1CDGA 3RWDA 3ZSSA 3OJMB 2A0LD 3BEVB 3FO2A 3A6BL 3FN0H 3GBML 5HHNB 4S0TD 4Z7UA 5CWSA 2D7MA 2NXZB 3QR2A 2Q76B 3D39B 3G08B 1K8IB 5KVGH 2PUQT 4LBEB 4KRLB 4QXUL 5TQ0H 3ULVD 5ICZA 4JJ5B 3C6LD 1URLA 2MHAA 1MWAA 1IKFH 2A1WL 4NC2B 1MF2H 5GRYA 5ESVB 5DXWA 1MJ7H 3I75A 1U2HA 2GK0A 2V7NA 3BIBX 3MLTB 5HHVH 1L0YA 1F8TH 2GKIA 1BWMA 5HYQB 1R0AH 5JNYB 1C7SA 5E6ZA 3QFJD 1ORSB 4XNMB 2IANE 5BO1L 1ORQA 2GJJA 2R4RH 3TP4A 1GAFL 2D0HA 5IROA 1XH3A 1X5GA 5DTFB 3VFMA 4G8EA 2F53D 4P9MH 5ICXB 1BJ1H 2PW2B 3OBAA 4EN3C 1E4WH 3WN5C 5TE7L 3AY4C 1D7FA 4PJFA 5J56B 4OZ4B 5D1ZD 2ESVA 2IJ0C 3MRPB 2GY5A 2YUXA 4XTRC 1B3JA 1J1XL 3F65A 4NZRH 2QSCL 3WS3B 3U36B 2AV1B 2NX5D 1QLRB 3QDAA 5D2NC 3SE3A 2DWDA 4WWID 1U95A 2P8MB 4PREB 4U1JB 4OGAD 4XP1H 1BZ9A 5HHPA 1AO7E 3H9ZA 1AGEB 3BDYL 3DRQA 4N8CL 2VXSH 1XMWA 3Q6GH 1JPGA 5CJQH 3FO9A 1MJJA 5L6YH 2AABL 1I1AB 5CSBA 1AY1L 1OL0A 4ZNEA 1EO5A 3BVNA 5CEXB 3BUYA 4F37F 4JY6A 1AGCB 5ADPL 2BHUA 5T1LB 4JPVL 2GSGB 1DN0A 4BH8A 4J2XA 4LF3A 1OLZA 4GSDL 2BSRA 5IFHL 4PP1D 2WANA 4JQXA 1JN6B 4MJ4A 4KJWD 4X5WB 1YECL 3SDDD 4KVNL 2J5LB 4WW2C 3K1KC 1DVFB 4PRDB 5ICYA 3LSOB 1PZ5B 1IAOA 1QA9B 3VFPB 1T03L 1EO8L 1NUNB 5IVZA 3EDDA 2EICA 1S7XA 4U1HA 1UM6L 4ZOBA 1KG0B 1LO3L 1EJOH 5F8RC 4ELMF 1NCUA 2OTPA 4Z7NE 3Q48A 2IBBA 4PY7A 4CBPA 5T1DH 4WHTB 5EO1B 1CGWA 5C7XL 2DKUA 2VDNL 1A14H 3U7AA 2IBZY 1NC2B 3S35H 4JO2H 43C9A 4LMQE 4CMMB 3ALPA 5JIPA 3TCLB 5IMLB 3LQAL 3L7EB 2HT2D 4BQBA 4G9FA 3KLSA 1MNUL 3QQ9C 2GJZA 2PO6A 4P2YA 4R4FH 3P4MA 3L7FA 2H41A 4O5LL 2CDGA 4U4BA 3L5JA 5FO8B 3S9DB 5HDLA 4OAWA 2EH7L 1MHHA 3K2UL 4OFYA 3BW9B 1N3NA 1RQ5A 3ARSA 4EDWL 1KOAA 1MI5B 1T5WB 5EWIL 3T0VA 2Y5EA 4NNYB 5JLZA 1EEUA 3BJLA 1NAKL 3QQ4A 3ILQD 5JHDD 4TVPD 1GC1C 1TVBA 3AFLA 1QSEE 3CZJA 3U82B 2AEPL 4AEEA 2FATH 2N4IA 3ALXA 3MLXL 5EB9A 4YWGH 2DQHH 1FIEA 2ZG1A 3MGTA 4YNYA 5F6HJ 3MV9B 1S7SB 3JV6B 1T6VN 3D0LA 1UXSB 5I1IH 4M61A 4LVNC 3MRRA 3KYNA 3VJ6B 4DGVL 3FRUB 3PWPD 2ZPKH 1F4XL 4I13B 1NMAH 4NBZB 2E3VA 4ORGB 4S1SL 4Q9RH 3V8OA 3IETB 3I6GA 5BRZA 4K3JL 1MHPL 4YE4L 4CDGC 5I71B 4LAQH 1ZSDA 1BZ7A 1CFSB 1ERNA 4YHKL 2FCBA 1DR9A 2DQEH 4LHUA 5HGBB 4TUOB 5KN5B 4HUUA 2EDOA 2DDQH 3B83A 5A2LH 1CLYL 4JAMB 2X4RA 4J1UB 5JR1L 1JK8B 1FO0L 4QKXB 1UXWB 5IFAH 2WWKT 4F7EA 3O2WL 4IIQB 1NCDH 5LG1A 4KZDH 1ZLUK 3U1SH 4OCNC 1ZTXH 3UROR 4M62L 1A2YA 3FZUD 3DTXA 1OB1B 2DYPD 4PLNC 2OSLB 4L8SC 4WHCA 1ZLWK 1UM4H 4ZYKA 1AI1L 2PR4H 2CO7B 4LSUL 2GAZB 4QHUA 5E2TH 3O2VL 3K7UA 2FL5A 3DX6A 2VB5A 3TT1L 5FYJD 4HC1H 4NQSA 5BMFL 4LCIH 5HGHA 4L3CB 3L3KA 2HVKB 2H2SC 3BZ4B 4U3XA 5DQDH 3MRMA 4EI6A 5IWLC 1U93B 3CMOH 3HB3D 3RGVB 3TPUA 4H88H 3P3YA 4U7KA 1R24B 5F7MC 1WZ1H 4H1LG 4M5ZL 3IJHA 3L3DB 4R7NB 4OCRL 3RWEA 1BEYL 3QDMB 4KKBD 4LMQI 5GJTL 5HHOB 5DRWB 4HJ0D 3MMEB 2ESVD 4HKXB 3DETC 3O0RL 3PL6B 1V3JA 2F54E 5CZVH 2BDNH 4GKZA 2F58L 3O3AA 4LDLB 1I7TA 3GSOB 3N1PC 3O8XC 4HS3A 4OIIH 2YD2A 3MXWH 4QOKA 4FXGA 1SY6H 3MRIA 1II4E 3DUHA 4GKOA 3GSWB 3THML 4GAYB 5FB8A 1G7MB 1YEEL 4XPHL 4Y2OA 2VZVA 1L0QA 1ZGLB 8FABA 4XX1E 4TSAL 5E9DD 4D2NA 1RU9L 5TDPB 5LKNA 3TYFA 4ELKA 1XCTB 2DKMA 5E24E 1VKXB 3ZTNL 4PLOB 1YUHA 5FDYA 4CNIA 2IGFL 1NMCC 3MRFB 3B9AA 2D3VA 5MENE 1H8NA 4WO4D 4NPYB 2VSDA 3O9WB 1IFHH 3EDJA 2HYMA 2DL9A 3DVIA 3T09A 3P11L 4IRJC 4MA8H 4XPFL 2B5IB 4JRWA 5IB1B 1I9JL 3ARFD 1F90L 1UENA 3OXSB 1UJ3B 4Z9KB 3O3BA 3GO1H 1R3LB 1U3ZA 1RPQA 5BV7C 1I3VA 5IW1B 4JJHA 5TFSH 4NHCL 2E7HA 5C0DA 5J1SC 2EH8L 3MOAL 3FOMB 1RK0B 1U92A 4ZXBB 3LDBC 1MFAH 3S36L 2AAVA 4P5KA 1WCQA 4Z76B 5C09E 1OSPL 4TTGA 5ABDE 1A7PH 1RUAL 2A0LC 4X7EC 4U1MA 4DN4L 3HRZB 3VW3H 4X7SH 1ES0A 4LLQA 5I73B 3V4VH 3GHEH 1U6AH 3GHBL 2ICWI 1X4XA 4HUMB 3TBVA 3UJJL 1DUYA 4U1SA 4ZAKB 3DV6B 1OM3H 4AIXA 2RBLA 5CJXC 2EDXA 3C6LC 5I0DA 3RNQB 2RGSA 2Q20A 2PO6D 1QSFA 3ZDYF 1I1RA 4YBLB 3OJ2C 3VFGH 1FNEB 2R4SH 1W0VA 4YX2L 1T2QH 5C0RH 2Y5TA 5IK3A 5GSRB 4ZODA 4JLRA 4AEHH 3V5DB 1LO5A 4OFYD 3BI9X 1K3ZA 4Z7VB 1V5JA 1LK3L 5GRUL 4I8DA 2XWBB 2OL3H 3VFSA 3BKML 3UXFA 3PHOB 1LWRA 5E0QA 2CMRH 3MLZH 4EVNA 2AJYL 1MRFH 2B1HL 4XNXH 3MUZ1 2VQ1B 1BFVH 3FO1A 1M4KA 2D31B 4QXGH 5GHWL 2AXGB 3VXPB 4Z95L 2A73B 43CAB 2ZSVA 3EFFA 1YYLH 4QHLB 2Y07L 5CGYC 5E00A 3UBXI 4MWFA 4NKIH 3DECA 2QQKH 1WZMA 3MRHA 1NC4B 3CIQA 1A1MB 3EO1A 5D7JC 2EIDA 4YHNB 1FIGH 1VFMA 4IMLB 1NBYA 3H0TB 5F9OL 2L4OA 4JKLA 2FIKB 1Q72L 2VR9A 3WMSA 5BRZD 1F58L 3QDJB 3DUUA 2WINB 3U6RA 4MNGE 1FP5A 2OQJA 3UTSA 2I07B 4OM1L 4G8GA 5DRXB 1QVOA 3CCHA 1T04A 4R2GD 4LHUD 3GBLA 2AEQH 2JCCE 4YHZH 3SDAD 1GRWA 5TDOB 1JWMB 3ARPA 4JM4H 3P0VH 1YN7B 2WP3O 3E6FB 4FQJL 2HKHH 1A1OB 3I2CH 5TH2A 4WUUB 3QZWA 4M3JA 4U0QB 5DD3L 1KLUB 1I9RH 4X6DA 3MRJB 4B53A 1J0ZA 2XFXB 3BP6A 5IMMA 1L7IL 5I6XB 3TESA 4HMDA 4L1DA 5ANMB 3T1FA 4UTAH 5BS0B 5JO5A 3CNKA 5C0CB 3N9GL 1J8HE 4XAWH 4U1LB 5BZDA 3FAXA 3W9EA 1QPPA 3VXQA 3Q5TA 4XP5H 3ZDXE 4RGMC 3QNXA 1JL8A 4GH7B 5F7YC 1KLFA 4X5XB 1KTLA 5JPMB 3V6FB 1UB6B 3TBYB 1GGCH 1L0XA 3W11D 3GSVA 2NTSP 4NDMA 4PPTA 4NSKA 1S9WB 2KUTA 3QWRA 2EE9A 4FFWC 1DSFL 2OK0L 4LSPH 3T4AA 2I60H 4NRYB 3FB5B 5MEQA 1Q0YL 3B3IB 5TF0A 4DGYL 4YDLB 3BT2H 2XG5A 4QOKD 3VDBA 2GJ6E 4RFOL 1QFWL 2ADJA 2VZOA 5HHXL 1FLRH 5HHMD 5HYJD 4F7CB 5EUOF 1HXMA 5DJ6B 3ULUD 1RULH 2Y6SD 4CVZB 3D0VB 2Z8VC 3IFNH 1S7TB 3DX7B 2DAVA 3SGJA 1V7MH 3DXAA 3AUVA 1XF5B 3S5LA 1G1CA 1XZ0A 3BN9D 3CK0L 3TZVC 3T2OA 4M3KB 3LKPB 2VLRB 1HEZB 3MRDB 2Z31C 4UDUB 5J1TC 2R8SL 3QT2A 3BRGC 2YZ1A 2XN9D 3LN5A 1T20A 1C5DB 2YBRB 2APVA 1MAJA 2J4WH 4LLMB 1A3RH 4C83A 4WU5B 4KFZC 4OZIA 5BZWA 1NCCL 1AQDA 4L3EB 4Q9BA 4JG1L 2CGRH 1UGNA 4WFGE 2R29L 5DMJB 4ISVA 3QHTC 5F97E 1GCFA 1K2DA 3GJFB 1C1EH 3EOYG 4LPVA 2BSTB 2WW8A 2A38A 4M93B 4R96B 4LKXB 2FDBP 3X3FH 1IQWL 2MFNA 3GMRB 1I9IL 1WC7B 4HK0B 4JFPA 5D6CA 1BP3B 2VZ1A 1C5CH 1G7QA 3HZVA 1BECA 1YJDC 1MLBB 3GIVB 4GW4A 4WDIA 3ZE1F 4JDZA 1FG9C 4FG6D 2Z93A 5FGSA 1P4LA 3FZUC 5IIEA 3D25A 1CXKA 4P3WA 3HA0A 1RJLB 5DJXA 3K46A 1QSFD 3IGAB 1XF2A 1PKQB 3CFKA 2AXHA 2OI9B 3PNWA 3G04B 1NKRA 1P2CB 3C2SA 2X4TA 3NGBB 4JO3L 2XT1B 3QUYB 2VXTH 5GSVA 4N90E 3QIBC 4J3SA 2NLJB 1CFQA 4V1DE 4GRWB 2E9WA 4LLVB 5C0IB 5K9JL 3RFZC 3HB3C 1G6RA 3BGFC 4POZD 1Q8MA 5IROC 2O5YH 1AIFB 1BGXH 3BPLC 4XPBH 5C0FA 4HUVA 3IXTA 1H5BB 3RAJL 1EHAA 5DSCA 3O4LA 4HJJH 1LEGA 4Z5RA 4AIZA 1HYSD 2WM0A 2ITDA 4GQ9H 2HTKD 5ACZB 1IEBB 4HJ0C 4FFZL 3VG9C 4BSVA 4LEXL 4U1NB 1V3LA 4OLWH 1E6OL 5JW5A 5C6TH 2Q87A 3W2DH 2DI9A 4LLWB 3H9YA 3DVFA 3B6SA 5CILL 3MA7A 3STZB 2B0SL 1Z6JT 1ZT7A 4GLRI 4ERSH 3EO0A 1DL7H 4GBXC 2W0LA 3AROA 3R8BB 3LEXA 15C8L 1KXQE 4G8GD 5F71A 2VL5A 3MFFB 1GJIA 5LBSL 2R1YB 3MJ9L 1DP0A 1XFPA 1HNFA 4Y1AE 4PRHE 3EOAA 4NZUL 3KXFA 3D9AH 3HKFA 3MUHL 2EYRB 5D71L 5MHSE 1X6NA 2BMKA 3UYPA 3VFUA 3C9NB 4JQXC 5D7KD 4W70A 4FNLH 3ZKMD 5B4MC 5F9WB 2BCKB 2HLFC 3EDFA 4G3YL 5C2BH 3OAUL 3QA3B 4JGJA 4LOUD 1AC0A 1MHEA 2AJXH 1MLCB 4JHAL 1I1FB 3NPSC 4NQDB 1B0GB 1E27B 3L3HA 4M1CD 3RNKA 5KS9F 3VXTB 4FTVA 4KKCC 5DJCA 2XICA 2A77H 2D03L 2ZSWA 4YEEA 2F9BT 1UADC 3QI9A 1ZA3A 3QPXH 4DVBB 4TNWF 3EJYD 3OB0H 3P73A 5D7LB 1OP5H 4XNZC 2IH3A 4PR5A 5JOEA 1NJ9A 3T4YB 3A0OA 3MNZA 2DQCH 1X7QB 4BQ9A 1A6VH 3QXDA 3HS0B 3HC3L 4KTYA 2CLRB 4PJAE 3U7WH 2ATPB 4GRLA 5DJ8A 5EBWB 3UCRA 2E9BA 4NO0A 4FXKB 3QWRD 4PJCA 4P2OA 1TCRA 1IM3B 4HX1A 3ARTA 5FM8A 2FEEL 4TSBH 3TO4B 4CVXA 5J13B 3OKOA 4OZGF 4PRPB 5T1MB 3O3DA 3TO2A 3VFTB 4XP9L 2CLZB 1A21A 1OTSC 1R5IB 4XPTH 3FT3A 1W0WB 1INEH 4XXCA 1NDMA 1M7DB 1FRGH 2QJDA 1JMXA 5GS1A 3NABL 5DD6A 3HUJE 4OCXH 2VISA 3PXJA 4JN2A 1U8JA 3EYQD 4NM8H 5KW9L 1NMBH 4IEFB 2IQAB 4FFYH 2Q86A 4ONHA 3SQOL 1FNGA 4X98B 2VTFA 5CP7A 4PD4J 4QRSB 2IAMB 4WW1A 2ZZUT 3GBNL 1G7JB 2MSPA 3KJ4C 2B1AH 1KXTB 2P46B 2NY7H 4Y4KB 3V0WL 4L4VA 5A43C 4OKVB 3BPNB 2VLJB 3AVEA 4QRPE 5IB4B 1OAUL 2HTLD 2R23B 2MPAL 3D85A 4X9BA 1OAYH 2G5BA 1JNHA 4TUJB 1JHTB 4KK5C 5D96B 1S7WA 1R5VA 1TQBC 3G6JB 3WIHA 5DUPH 2X10A 2C7UB 4PRBB 1UVQB 1E6JH 4JRXD 4NWUH 5TPWL 4Z0BH 4K7FB 2EZ0D 4DOHB 4PJ5B 1NANI 4OCYH 4WEBL 4LSTL 2HRLA 4KQ3H 5T5NF 4U1IA 5BVJA 1YMMD 4YK4B 4S1QH 5CSGA 5D7IB 3REWA 4YDVA 4WW2F 3PP4H 2AEIT 4JGMA 3GB7B 1T0MB 4B5EA 4ZS7H 2CJUL 2HLAB 5I1GL 1KENH 3L5XL 4PJBF 5FF6B 3G5XB 2R2HA 4D9QE 3OQ3B 2VN4A 2CXGA 4FQXC 3ZE2F 1ULVA 5FOJA 5DVMA 1QNZH 2ITCA 3RWFB 4PRAA 4ZSOE 4E41E 4OZHA 4R26L 4AT6B 3SO5A 1AXTH 2G9HA 4IRZL 3GK8L 3RUGF 4HFWA 3E6HB 5GS2H 1IAIH 4K7PH 1INDL 3WLBB 1DQJB 3VGAB 3NCJL 2XKUA 3K8KA 3I50L 2AK1H 1S7VA 1FH5H 3W11C 3O4LD 1T22A 3RX5A 3BH8B 3BH9B 4KROB 3MJ9A 1C16B 2E5EA 3EZJB 1DBMH 2XKNB 3OJDA 2AS5M 5FKPB 1A6WL 5DVNA 1F8TL 1IEAA 3C5SB 5EZOH 1AFVH 5IJKA 1EEYB 3SDYH 3GGWA 5SX5H 1K6QH 3V6OA 4MQTB 2EDJA 4CW1B 4U7SA 2BC4B 2GCYA 3K0WA 4NP4H 4OUOA 5DJAB 5B8CA 1NCNA 5EIIB 2LAGB 2V2TA 5FGCE 5F21B 3CFIC 5C8JB 1D9KB 4HUXB 4YIQA 3ZDZE 1E4WL 1IAKB 2KDGA 1A7NH 3MLWH 5DFVD 3KYMB 3UBXG 4HIJB 4MQ7B 2NY1B 4OD1H 4F7TA 1G0XA 3PXHA 2FH6A 2SEBB 3P9WB 1KBGH 4LNVA 4RMRA 1N5AB 1G0DA 4OUUB 2ZCHL 4XPAL 2XQBH 2IPTL 5MI0B 3T0ED 1EEZA 2XYCA 4LSVL 3P40A 3A6CH 3BEVA 4PBVC 4XP1L 3CVIH 4Y89A 3VXSE 1MCJA 5CBAB 5E5UB 2Q76A 3D39A 1CXFA 1WJ3A 3G08A 1X5YA 4FTVD 4PJIA 4YC2B 2ADFH 5EU6E 2RHEA 3VE0B 1FVCB 1JPSH 2FJFA 1GGBL 4XX1G 3QI9D 3BO8B 3GKWL 4YHLL 3MLTA 5HY9B 3CFJB 3QXWA 4OGYL 5D1XB 4JFFD 1RAMA 5JNYA 1J1PH 4FN0A 1X9QA 1ORSA 4NQUA 4XNMA 4UQ2A 3GUTB 1A4KB 4R7DA 2UWEA 4YHPB 3C60D 2WBJD 5DTFA 3F62A 4FG6C 4BSJA 4UT6L 5ICXA 4A6YB 4DTGL 5C71A 2PW2A 5EBGA 2PW1B 2Q6WA 2I5YL 1MUJB 4MA7L 3R1GH 4P2OD 5HYSG 5DJ2A 1HWGB 4NN6C 4OCSL 4OZ4A 3FHAA 2ATKA 3MRPA 3ARQA 1T0PB 3FO0L 3WS3A 3U36A 2AV1A 2VIRB 3D2UA 3BKCL 1QLRA 1XIWB 3QEGL 5FECB 2VDRL 1U8OA 4JO2L 4X9FA 3OB0K 1HI6B 2C4FT 2Z92B 5ESQA 4TUKL 5IQ9A 1OP5K 2P8MA 5F1SA 4XVUD 5DD1H 3ZKSD 4QTIL 1PG7X 3VXUE 5CJ5A 1WAAA 1AGEA 4X6BA 3WIIH 3GMOB 3WLWC 5EZIH 5ID0B 1YPZE 1I1AA 1KGCE 3CLFH 4NGHL 4R4FL 2RFXA 4W4OA 3VA6A 2IPKA 4I3RL 3BP7B 5CEXA 4MDIB 1F11B 1NGXB 2NTFB 1AGCA 5DD0L 5T1LA 2LQRA 1KPRA 4TULH 1CLZH 5DVKA 3SJVE 3NOIA 1TCMA 4B0MM 4A2LA 5DHVH 4L4VD 5LXGL 5KAQF 1LP9E 5CCKH 1U2CA 1T89A 4RIRB 3VWJA 2ZUSA 3D85D 3F7YB 1DVFA 3AB0C 3EW3B 2V2WB 5CINH 2GYSA 1FNLA 3KPPB 3GSRB 1U8LB 4PP2B 5EPMA 5I74C 1PZ5A 3KPNB 3VFPA 4DK6A 3DBXA 1TTFA 3H7LA 3NAAH 4P99A 3FQXB 4ZPTB 2YHGA 1KG0A 3BX7C 4P3CL 1RJZB 3TJEL 3SPVB 5BCAA 3MQIA 4MZ3A 5I1CL 5EO1A 4ZFGH 5I75C 4NQVB 1FPTH 2EDKA 2NXYB 1AKJD 3OTTA 2FYYA 1JWSB 4CMMA 3TCLA 1I3GH 4PJ9D 2OMBA 1WVZA 5IMLA 1KTDB 5DVOA 4PLKC 2FGZA 4RMSA 4GXVL 1P1ZB 2IWGA 4AM0A 2Q3ZA 1NFDA 3KYKL 3Q1SH 5KSBF 3OAZH 4P2QB 4LU5H 3ZHLA 2J8UF 5FO8A 2P42B 3L9RB 5LGHH 4LPTA 4Y5XA 5KSAD 5JQHC 2EDQA 1WLHA 4N5EC 1BD2A 1YDPB 3BW9A 4BFIB 1MI5A 1T5WA 4ODVH 4KZDL 1CBVH 4NNYA 1D5MB 1ZTXL 3VGHA 2A6IA 1B6UA 2D7TH 2HH0L 1WFTA 4JRYE 5T33H 3M45A 2ICES 5J57B 4GXUN 2PR4L 1UH3A 4ODUB 3W5NA 3CDFA 3DJ9A 4J3OC 3QCUL 2CRIA 5T3ZL 3JV6A 2FEDD 4HC1L 4PTUB 1UXSA 4EZMA 4OQ1A 1G6VK 3AU1B 2JTDA 2VDML 4LCIL 3UEZA 3HMXA 3VJ6A 3B43A 1TJHL 3MRBB 4YPGA 4Z78B 1UZ6E 3IETA 4OSUH 5LWYL 5EORH 1WZ1L 3HNVL 4GMTH 3HLAB 4O51B 2R0LL 4MCYB 3MV7B 5C07E 2AP2A 3MJ8A 3MRKA 3CGTA 3ZTJH 4YXHH 1SJEB 3AGVA 4Z0XB 3SGJC 4HPYH 5D2LE 1P4IH 3VXRE 5B38G 2G5RA 5DYOB 1JBJA 1CFSA 4JVWA 5EU5A 3DGGA 5CMAB 5HGBA 3H7BB 2P5WB 3D18B 4OIIL 5KVDH 1CGXA 3PDOB 4WFED 4JAMA 3G9AB 5EOCL 2XTJD 1UXWA 4DFIA 4J8RB 1OOAA 1I85A 1XGYH 2HTLC 4GMSL 3K4ZA 5SX5K 3D39D 2IG2L 3LKQB 1OB1A 3MLSH 4Q2ZB 4FMKA 5TE4L 3BYTA 4JREB 4N0UE 2GAZA 1Z0MA 1VFBB 3QG7H 3U9UB 1DQQB 4PBWD 3KPRE 2EZ0C 5ELIA 2GFBA 3RVWD 2Y36L 4CGTA 4Y4HD 4D0BB 2AJVL 3UTTE 4P3DB 1RIVL 4L3CA 3CXHK 2HVKA 5HTSA 3BZ4A 1CGSH 5I1HL 2C26A 1U93A 3U0TB 2MOVA 2NY6D 5J4MA 1OAQL 5FHBH 1R24A 4QNPF 3CU7A 3O11B 1S9YB 2ERJC 1C8PA 5HI4C 2IANB 3L3DA 5KANG 4PJ7F 3T0WA 3OG4B 3G5YB 1HIMH 3NACH 1HKFA 3QDMA 5HHOA 4HIEB 3BPOB 5DRWA 3MMEA 4HKXA 1F2XK 3RWIB 3WO3B 1BAFH 3PL6A 2HP4A 1IGYB 1R3HB 2Y1VA 3D2UD 5K9QI 3QB7C 4FQPA 3S97C 2ZOLB 3UO1H 3GSOA 5IBUG 2BZDA 4XNQA 1J87A 2MQ0A 4NRXA 4KAQL 4QCIA 4X7SL 3VW3L 3MR9A 3M8OL 2XY2A 3MV8E 2IMNA 3VXNB 1CT8B 3GHEL 3GSWA 1KFAH 4N8VG 1EBPA 5IW6B 2BNUA 4X4MA 1ZGLA 3BKJH 4HIHB 1C08B 5SWQB 7FABL 3QJFB 4HK3N 4LCCB 5TDPA 3VMNA 1D3CA 1AO7B 1XCTA 4MVBC 1T2QL 5IW3A 4OV5A 3MRFA 1WIPA 2J6EL 3IRZA 4Y19E 4ZPVB 5DD5H 5JXAH 2FECI 2B4CL 2JJSA 4Z7QF 1GC1H 3WUWG 2VE6B 3VWJD 1C7TA 2JB5H 1T21B 3MLZL 3RUGE 4UNVA 1DVFD 1MRFL 2H3NA 1EXUB 4HZLB 4XNXL 1DQML 4MCZA 1QLEH 3MLUH 1R3LA 5LAXA 4O2CB 5IHZB 5IW1A 2D4DA 2EO9A 4JM2B 1UKQA 2J1KA 4M1DH 4KJQD 3WHE1 2H1PH 3EOBA 1J1OH 4UNUA 2QQKL 4AMKH 4ZXBA 1NGPH 4XPGH 3FQNB 3MNWA 2AKRB 4JY5H 4RISH 1YQ2A 1FYHB 4QHKI 5C92A 4PJ8A 3HRZA 1XAUA 3KPLA 4XZUB 4PJEF 4BSWB 4PJHF 1ROWA 2VMFA 1A7QL 4HCRA 3SKMA 2VAJA 4R4BB 3B9KC 3IB4A 4GKNA 4FQCH 3RNQA 1QHOA 5DK3A 5B3JE 1Z9MA 5F7LB 4KUCF 2FO4B 1MFEH 2CIKB 4X8JA 1KB5H 5E5MB 3S6CA 1OGAE 4LHJB 6FABL 5GSRA 5CHNB 5CUSL 1ZWIB 3I3BA 3K2MC 4HGKC 1LO0L 1BD2D 2HKHL 1RZ7H 2V2XA 3CDCA 2XWBA 4S1DC 5E8DL 3VI4E 4LLDB 4N8PA 4YGVA 1FDLH 2LU3A 4UAOC 1WEJL 3PHOA 4QF1B 3DI3B 1J88A 2EDDA 4PGCB 1IM9D 4GRLC 3MJGX 2VQ1A 3LQZA 2G60H 2XZQL 2D31A 2JIXB 2AXGA 4FQIL 1PGRB 1D5IL 2A73A 5GGVL 43CAA 4P2OC 3MODH 1QSEB 4QHLA 2E6JA 3LH2H 4XAWL 1FLTX 2A6JB 4HXBH 1JWUA 1NC4A 2B39A 3A67L 4NO2B 2R39A 3ZKNC 3H0TA 4TNWK 5SWZE 4XXCC 1F3JB 4DKEL 5GS1C 2O5XH 3W81A 4W68A 2FIKA 2BXZA 4XVUC 1CXIA 4JFEE 5C0BE 1K5NB 4X9HA 2AVGA 3QDJA 1Y6MR 4GG8B 4WY7H 5EFIB 5I1JL 2WINA 4NUGH 2BY2A 2NY4B 3GSNB 4PJFF 2I07A 1CICA 2YA0A 4LCUB 5DRXA 4RAVB 2BOBB 2HFGL 2HWZH 2O93L 1QBMH 2D9QB 2VLKB 4NO5B 5EG6C 1JWMA 5F3HB 4D9RD 4PUBL 1OCWL 3QYCA 2FX9L 3TH3T 1X44A 1NSNH 1A1OA 4H25B 3HC4H 2YMXL 4WUUA 3IDNB 5DA4A 1J7VR 1IL1B 2EE2A 3PQYE 4DUWA 1BLNB