4P9HH

Crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv-1 and soluble cd4 d1d2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
231
structure length
215
Chain Sequence
QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAVNWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLISAVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTYDKWSGLHHDGVMAFSSWGQGTLISVSAASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords T-cell surface glycoprotein CD4
publication title Antibody 8ANC195 Reveals a Site of Broad Vulnerability on the HIV-1 Envelope Spike.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 215
sequence length 231
ec nomenclature
pdb deposition date 2014-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p9hH01
4WHYH 1OSZB 5HGHA 5CZXD 4MXQD 2A0LD 3DNKA 5IROC 3ZTNL 3VD9A 3MUHL 2FH8A 2R9HD 5DMGD 2JELL 4HX1A 1EA9C 3MCKB 1KENH 2H26A 1SYSA 4PJBF 3GDBA 2YRZA 3QNXB 4WFHD 5D6DA 5GZNC 5JIIA 4XNYH 5DUBA 3SDDA 5I15L 5JPNB 3QQ9C 4JN2B 3VFVB 5HHNB 1JMXA 1QLFB 1H15B 2IANB 12E8H 1NFDA 2WW8A 3O9WD 1YYMH 4OZGE 4YXLH 2P24B 3UJJH 3MNWA 1RIHH 5FO9A 2KKQA 4FZ8L 4N8PA 5D6CA 4NUGH 1E28B 4BKLB 4XC1H 1BZ9A 1XCQA 1Y6NR 3ULUF 1JPTL 3WFEL 1QFOA 3O9WA 4GBXB 1MHEA 1VESA 2WV3A 3MYJA 1CE1H 4LLMA 3ULVH 4QRUA 3PXJA 2FX7H 1BBDL 4H88H 1OARL 2IPTL 3ROOA 3LZFH 5BO1H 2BNUA 4P59H 1F8TH 3WNMA 4K3DH 1NSNH 2GJJA 3MCLH 4A6YB 1OW0C 1A6PA 1XGTB 3IETB 3QUYC 5CD3B 5HYEA 3MR9A 1BVKA 5DUPH 2CKBH 3MRMA 2X1OA 3ZYZA 1YMMD 5DT1H 5JIHA 4ERSL 1O5DT 4M48L 5GGQH 4HJJH 1IJ9A 1OAXL 4PR5A 1EBPA 3IYLW 3MUJA 1ZVSB 2DLEA 2ICWA 1SVZA 4PGZA 4DCQA 4HUWB 5GSRB 3BGAA 3NGBB 5CJQH 1A6ZA 5ICYA 3DIFA 2LU3A 3OR6A 5L7XL 3DX9A 4WWKC 4YBLB 1XGQB 2N7BA 3FAWA 3WE6B 5LVEA 4RSVA 4EOWL 3QZWA 2E7CA 2I60L 3MMEB 4U1IB 4Y7MA 3DUHA 3LKQB 1TZGH 4GW4B 5CLTA 1S5IL 3MGAA 4ELMF 4S10A 1HILA 3ARGB 1D6EB 3I6LE 5D5ME 5J13B 3HE7D 3VGAB 3EYVA 3A6BL 2F19L 4ODVH 5MENA 5FO8B 1VEOA 4GG8B 1MCOH 2ZCLH 3HAEG 5H2BB 3TN0B 2ORBH 3RL1A 5C0JB 4K3JL 3HE7A 5IQ9A 1H5BA 3OKEA 1PQZB 2X1QA 3RGVC 1EO8L 3KG5A 1UJ3A 2V17L 4JAMB 2CRYA 5DURD 2EE9A 3H9ZA 4OZIB 1X5JA 4N0YH 1W72B 1ZKAA 4OLVH 1R3IL 1FVDB 1FL5A 4WI6A 4G6ML 2VLRB 4M6AA 4XXDB 1ZLUK 5EBGA 1I9JL 3GMPB 4GQPH 3SO5A 1DJSA 4AT6B 1MCIA 2FSEA 3SDXE 2DICA 2BSRA 2VZUA 4YHIA 4MJIE 4HULB 2OI9B 4AG4L 3QXAB 2YD8A 1H3XA 5DK2B 1CN4A 4I3RH 3TO2B 3PHSA 4MCYA 4HKZA 4OGYH 3UP1A 4HS3A 3VG0L 1T7ZA 2R29L 1H8SA 4DVRL 5I71B 3Q6GL 1A3RL 2EDRA 2HKFL 4PYHA 4HV8A 3VXMB 2GK2A 4KMLB 1NFKA 2DQTH 3GSOB 1CFNB 3DVFA 4YX2L 2NY6B 5IVXB 1DSFL 4AEFA 1LILA 1QOKA 1EMTL 4LVHB 1NJ9B 3OKLA 3PNWA 4HJ0C 1K3ZA 1AFVL 1OHQA 1BBJB 4PREB 1RZJL 1RUPL 2SEBA 2FGWL 5DJYB 1PLGH 3RY5A 1RUQL 4F33A 4L4VE 3M07A 1UM5L 3UTSE 2DF3A 3SBWC 2Q8AL 1I8LA 2JIXD 4YBQC 4IOIA 1FJ1B 1W8NA 3H9SD 1E4KA 4KK9D 2X09A 5H35B 4IDLA 4IDJL 4Z76B 2AV7A 3V52L 1MCPH 3TA3C 1HWGB 2FIRT 3BXNA 3C6LA 1DQDH 1OPGL 1S8DA 4U6YA 1RZJC 2Y36H 2XN9D 3FMGH 4G80B 2IQAA 3WS3B 3WUWA 2X4QA 3BH9A 1BJ1J 3QUXB 1DUYB 1IAIH 4FQJL 4AH2B 4U1MB 1J5OH 1NGZB 1BQHG 4XMLH 3IAGC 4MXVF 1G6RL 5T33H 4UU9A 5DJXA 3MLXH 1GGIL 1SYSB 1QSZA 3WEXB 1QFUH 3HMWH 4UILH 2P8MB 2EH7L 3GBMH 1CFVH 1FORH 5AEAA 1Q9KA 4CJ1A 5DGRA 5A2KH 1MFBL 5ISZE 4MJ6A 5EWIH 5GGSA 3ZHDA 2FLBT 15C8H 3KAAA 4HLZG 4LVOB 1R3KA 3RU8L 5EDXA 5CILH 4PLJC 2XQBH 3JVGA 4JCLA 3L5HA 5HDBE 4P5TD 4JG0H 4TSBH 1BZ9B 1XCQB 4LSTL 2FB4L 4ESKA 2WUBH 1N7MH 1PW3A 3V5DA 3D87B 3NVQA 4G8GB 4N8VB 1QRNA 4NRZA 1EHAA 3GBNL 3D6GA 4OZHE 1YDPA 4PRIE 4LLMB 3D25B 4U1NA 3SCMA 3VXUA 3VWKB 4M7ZB 4X9FA 4DZ8A 5DQDH 1ZE3C 1UKQA 3JV5A 3FQUB 1C1EH 3ZDXF 1INQA 4DGYL 4EBQL 2OZ4H 1XGUB 3MRCA 4TUKL 3MOBL 2BY0A 3V4VL 1UKTA 4CN4A 2UUDK 4LMQE 4C57C 4X6DF 3KLAB 4JFFD 2W60A 2VDLH 1NL0L 4HFUH 2VLLA 2BY1A 3UEZA 4MCZB 1GPOL 5AZEH 2VRAA 4X5XB 3RDTC 1EFXB 3PIQA 2ICWB 2VL5B 3W0WD 5ENWA 5JIKA 4F3FB 4OIIH 3MFFA 4XCEA 3PQYE 1MLBA 3QUKA 3TPUA 5IMMB 3OTTA 1Z0NA 1MFNA 1F4HA 1A6ZB 4N68A 5ICYB 5L8LB 4U1HB 4HK0A 3OR6B 1I1FA 2AXJA 3EO1B 4NBYB 4F15B 3DX9B 5KJRL 3GSNL 3F5WA 4JFXB 4O5LL 4QRRE 3RFZC 1CICD 2RBLA 4OI9A 2FX8H 4RAVB 1ONQA 1KJMA 3QCTH 3KR3L 5K59E 4JVPA 1WT5A 3EYVB 1FZOB 1CICA 3GHBL 4QXTA 4OKVA 4LIQL 3ARPA 3P9MA 2FO1A 1K6QH 4BA8A 3EDFA 3GMLA 1DVFC 1X5KA 4G7VL 3RL1B 4K3GA 4RFOL 1RZ8A 3PGDB 2DQEH 5FECB 3FHAA 5JNYB 1T6WA 2QQKL 3Q0HA 3QT2A 1UJ3B 1CZ8L 4K71B 5ACMA 1BFVL 3RX7A 1J1PL 4AQOA 1U8IA 2J8UF 3J8F7 4G6JL 1FL5B 3O3EB 3P30H 4NYLB 4ZNCD 4FQXB 4NQDA 4BFBD 3IDJB 3TBYA 5IMLA 2FNBA 5C0EB 4G6FD 2QADC 1CDHA 4C56E 2XYCA 3RVXD 1HH6B 5CGYD 1JP5A 1F4WL 1F4YH 1IEBA 4CU6A 4HXBH 3BSZH 4JO1H 5DYOB 5ANMA 4M9PA 1J11A 4WFED 2LTQC 1ZWIB 1RD6A 3A6CH 4JM2F 1U36A 2DMCA 4HS3B 4ZD3H 1DL7L 3S35X 1ZHLA 4JO4L 4ZMAT 4LVNB 2Q6WA 1UGNA 1EUUA 4HV8B 4NWTH 1SM3L 1LVEA 1P69B 4GAYB 2IPUK 4PJBA 1M7DB 1V3MA 1JUFB 1TZIB 3MGTA 2C7UA 5EA0H 2K3TA 3OKLB 2HYMA 1A7BA 2Y25A 4D9QD 4EKXA 1FGVH 2SEBB 2ZG3A 5FOBA 2NYYC 2AI0H 3JWOH 3UTQB 4R7DA 5DHVA 5BVJB 2ESVD 3SDCA 1TVBA 3AS3A 3RKDD 3QDJE 1BECA 4LSRH 4KDTA 1JRHH 2AGJL 5INCA 1NAKH 4R8WH 3HUJB 1EH9A 1TCRA 2WBKA 4N90E 3EOBB 1MJJA 4S1SL 2IPUG 3C6LB 2QQNL 3G6AA 4AK1A 4XB7A 3V6FA 1LDPH 2IQAB 4PLKC 5FB8A 5JUEH 5H94B 5IVNA 3UO1H 3MRRB 3T65A 5E8NA 2XTJD 1UH3A 1B90A 4HUXB 4D0DA 3TJEL 1B0WA 1MOEA 2VXTH 2XZAH 1X3DA 5ITFB 1SJHB 3K4ZA 4NC0B 4ZS7L 2OTPA 4U1KA 4YC2C 4UTAL 3DX6B 5GGSB 4AM0A 5AAWA 5AYUH 4J23A 2GSGB 2P5WE 2FD6L 3D39A 3QDGB 3BKCL 2VDRH 2XWJA 4HS8L 4KVCH 3WL9A 4F8TA 4MB4A 3X3GH 3I6KA 3I9GL 5HYQA 4M9OA 1EJ6A 5DS8A 1NAMB 1QRNB 4J7RA 4M5YL 2C3VA 4HUNB 2BNQD 4CDGC 3BPOC 1EEZA 4DZ8B 2CDEA 4NZDA 4MA3A 4J6RL 4XHJD 1INQB 4ELMA 5I1KH 3T4AA 4GSDL 4FQCL 2H2PC 2BNQA 1OAQH 1DANT 4R97B 3HR5B 2XI9A 3CMOL 1IM9B 1KLFA 3BYTA 1A9BB 2W60B 3IJYA 5CS7A 3GO1L 1ZGLM 2VLLB 4G8EA 2OR9H 2OR8A 4UV7H 4W6XB 1QTYT 2OQJA 1FRGL 1K8DB 3OB8A 4HKJA 1U3HC 4V1DB 5ENWB 5IOPA 2BXYA 4WFGE 3ZKNC 2PXYA 4MDIA 3BRFA 1NGPH 4XCEB 5DJ2A 1MLBB 5J12B 2VLMD 1U8NB 1FYTA 3WDJA 2NW2A 4NZTH 5KSBF 5EULV 3LV3B 4HK3N 1I1FB 2CRIA 3KNBB 4OFPA 4I48B 1CI5A 1BIHA 4MAYD 3F5WB 2FRGP 5D70L 2VJXA 3CZFA 1NMBH 5CZKA 1ZHNA 2PW2B 1OAYH 5FGSA 3GSRA 3WS6C 2I5YH 1UWXK 3DYOA 1INDH 2YA1A 2X6MA 1RZIA 3DXAE 3MOAH 4W68A 5J6GA 4X99B 3WNLA 2XZCL 4JPKL 2W0FA 4NQTA 2J6EH 1FFOA 3RWIA 4ETQB 2BMKA 4QXTB 2UZIH 5FUZH 1KELL 1FN4B 1I1CA 4KJYB 4P2RE 3P9MB 4YHLH 1YY8A 1X9QA 1MIMH 5EBMA 3GMRA 1RZ8B 3QIBD 3OKOB 3F7YB 2B1AL 2GHWB 1CT8A 1A8JH 1SJEA 4PJGE 1AQDB 4LHQB 3MXVH 4XB8A 1YPZF 3C08L 1NCCL 3FFCD 1U8IB 2FATH 1LO3L 2GJZB 4LEXL 4NQDB 1ZSDB 5E99L 3TBYB 1CF8H 1P5VA 1EV2E 3EDEA 2FGZA 3VI3F 2W65B 2MHAA 3LOWA 5AAMA 1U95A 5KSAA 4XPHH 4MSWA 1UXWB 4FRWA 1ACYH 3FFCA 5D7JC 2B4CL 4DKFL 4WO4B 1N5AA 2BSSA 1MUJB 1IEBB 2HT4D 4M7LH 3T0ED 3GJEA 3FCTA 5ANMB 3GHEL 4AZ8A 1JYNA 3ARSA 5F88A 2X4PA 1I8IB 1CBVH 4I0PD 1OD7A 3L5XH 4KRMB 1QLEL 4ZS6D 4YDIH 2Q6WB 1UKSA 5EPMA 2EDDA 3EYUH 2QR0A 1ZLVK 4M1GL 4FQIH 1RIUL 4OLUH 2DQJH 3PDOA 1E27A 1CGSL 3HMXA 1R0AL 5SWSE 4P2OD 3ILQD 3T0WA 1C12A 1DBJH 3U46A 5HHQB 2NY4C 3HNTL 3N85L 3IKCB 1C5DA 4PJDB 1H3WM 1K9TA 5DHVB 3O4LB 2AEQH 5JHDE 2KQNA 1QACA 5DEGB 6FABL 1T1YB 4NIKB 1LK3L 1QFWM 4I2XA 4NO2A 1A7PL 2QL1A 1BLNB 4YQXL 3RWDB 2W59A 4S0TD 3S37X 1TQCC 1KCUL 3MBEC 5TDPA 5A16B 3I2CL 3VXOA 3LMJH 3BDXA 4UT6L 1FIGH 4G3YH 5GGSY 1TENA 4HIHA 3F65A 5IQ7H 5C2BH 4ODXA 3GSVA 4D0DB 2L7UA 4QHUB 1Q9WB 3NCJH 1N2RB 4NNPL 4QGTA 1Q0YL 4JPWL 1N5YL 5DQ9A 4WUUD 3VGEA 1FNGB 4XVSH 2B2XH 3AGVA 1H3PL 4Y16B 4GRLA 5F9DC 1S9KC 4JREC 5EOCJ 1LEIB 1KCSL 4U1KB 1YN6A 2GTWB 5HD8D 1S7QB 5T3XH 3D39B 4R3SA 4D2NA 1JF6A 1A6UL 1UCBL 2NXZB 5C71A 1VB9A 3EKCA 1YMME 3VFGL 4O2CA 5AWNH 2QHRL 3ZYOA 4BZ1H 5C0CD 3LD8C 2OL3L 3ARWA 4HKXA 5DS8B 1ZHKB 3VMPA 3VD5A 5I8EA 2C3VB 3C8KA 1FC2D 4OI7A 2X4RA 1HI6A 3QCUH 4PJCF 4P49A 2CDEB 5CEZL 3BGMB 4JFHE 2EDJA 4L8SA 1FLRL 3T4AB 2W07A 4LDOB 3TBTA 3W9DA 2DIAA 2H1PH 4WI2A 4X7TA 4JG1H 3WIIH 4DVBA 5F9WB 1UWEH 4JDVB 3O8XC 4J4PC 4MJ2A 3CX5K 3OGOE 1YMHA 3IJYB 1P5UA 5L9DH 1WIOA 5ECJE 3RX5A 2F74A 4MX7B 2GI7A 2VYRE 3Q1SL 1FZMA 4H26A 2VR5A 2CXGA 4U33A 4HKJB 4MNQD 2BK8A 3D2UD 5IOPB 3Q5OA 5CGMA 4HZLA 2ZKHH 3C6SA 4KTYA 3OBAA 2DOCA 2PXYB 4JDTL 3PHOA 5TDOA 2RCSH 3UPRA 1OGTB 1TTUA 1GGBL 1GYAA 1FYTB 4GLRI 4IMLA 3RI5F 4RIRA 3GEWB 1PAMA 3NIGF 1Y6MR 4LSUL 4PB0L 3D2UA 1G1YA 4LHUG 2CSPA 1LQSR 2VZVA 2Z8VC 3T2NH 1MFDH 4HFWB 4HQQL 2EDNA 3DX8A 5DD1H 1R3HB 3UPCA 4I0CC 4ZNEA 1TETH 1RZIB 2CMRH 4YDJB 1NUDA 2DQIH 4JM2A 3PWUB 4S1QH 5DJZA 2W0FB 4H1LG 5DRXB 3ARRA 5GGTL 5JW3L 1P84J 2BMKB 3NIFE 2I27N 1P4IL 2VR4A 1YY8B 3OJVC 5EBMB 4IJ3C 1FVCA 4KMQA 3RAJH 5EU5B 3HC4L 3DX7A 4RMUA 4AMKH 1QEWA 4IRJC 2VLKA 4YEFA 2CGRH 1FVEA 4PJ9C 5C0BA 1CR9L 4RMQA 4QHLA 1FZKB 3WD5H 3ULVD 3RZWA 3CMGA 3OG6B 4GBXD 4HPOH 3EJYD 2PETA 5JTWA 2FWOA 2BVPA 2EXWC 3MSPA 3RNKA 3QWQB 1GAFL 3BEVA 4MJ4A 4UBDC 5A3ID 5D2LE 4MD5A 3VXPA 5DMKB 4DGVH 4JY5H 5I9QB 4YEEA 5A43C 3CVIH 2BSSB 3RPKA 4HHAA 4YHYB 5CJBA 5GS0L 5KG9A 1V3JA 2QQLH 3DYMA 3FCTB 1T1ZA 4OTXL 5CMAB 1T1WA 7FABH 1CU4H 3BPNB 3KDMA 1JGUL 2VIRB 3WIFA 5ACZB 1IQDB 5HYSA 4F58H 2VXUH 2X4NB 4LFHD 2Q3ZA 2VDNH 1RUMH 1GVIA 3OJ2C 4LLYA 3VFMB 2W9DL 1YYLL 2QR0B 3BZDA 2Z31D 2C26A 3C09B 4R0LC 4WVRA 1MVUA 5HI4C 1C5BH 4YHNA 1CVRA 3FJTA 4I0KA 1QBAA 3FB6A 4GW1A 4NO5A 4XP4H 3TBSA 1K8IB 2XN9E 1EAPA 4TRPL 4WTZA 4N0CC 3KPOA 2Z31A 3WIHL 4U6VH 1C5DB 3DETD 3T3PF 5I1JH 1CDJA 5GS1A 3VXRD 1SHMA 4O58H 1OAUH 1GIGH 1RULL 1ZVYA 3HZYA 2AK1H 2YBRA 1TZHB 1AP2B 4I2XB 1FL6B 4NO2B 3V95A 5T1KA 4L3ED 2IALA 1QFHA 4RWHA 3QIWA 1FFRA 2DD8H 3ARGD 2IAMC 5IK3A 1BVLA 4FOMA 1QG3A 1EGJA 3E2HB 3I75A 4F7TB 3U83A 4JFEB 3DURA 4L3EA 2IQ9H 1ZEAH 1MREL 1EJOL 3LKRA 4WENB 1A0QH 3EFFA 1NKOA 3HZVA 1U8JA 5BRZB 4OLZL 1M6OB 4ODXB 1RUAL 4MGXA 3UDWC 3LH2H 4X6DB 3BUTA 3PG2A 5FV2A 3DV4A 5C92A 5CCKL 1MCHA 4WU5A 1F6LL 4XNMA 4PRAA 3KPSA 5DLMH 3C2AL 2JJSC 5L88L 4GRLB 1IEHA 2DJ4A 3RWGA 5F7YC 4KWUA 4PV9A 1ZLSH 2R2EA 1I1AB 1YN6B 3ABZA 4BSWA 1MWAL 3DLQR 2APWA 2HRPL 5IHZA 4FQQA 4P9HL 3IDIA 3MJ9H 4QHNB 1SY6H 4H25A 5C2UB 1TXKA 1LP9F 2X89A 3MLSH 5KSBA 2CO6B 4U0RC 5MI0C 4OGXL 3EOTH 5HGDB 5C07A 3R1GL 3C8KB 4E5XB 3P4OB 3K4DA 2X4RB 5IJVA 4FTVD 1HI6B 1LE5A 3VI4E 2AW2A 3W0WE 1IQWL 3GMNB 3CFCL 2HT3D 4OF5A 3TT1L 1KFAL 1WEJL 2IEPA 5BS0D 4Y4FD 2NY6D 4ZTPH 4XAWL 3U30B 2HJFA 2VERN 1YEJH 3IDNA 4TQEH 2EDLA 5DSCB 5JORA 2NY0C 5BS0A 2B5IC 1FZMB 4K55A 3TLRA 1YEEH 5FIEA 1YPZA 3EGSB 4NQCD 2J8UB 5FHBH 4LLQA 4KXZH 1HQ4A 2G75B 4GMTH 2GKIA 2VDQH 4Y19B 5DD5H 2BHUA 4PD4J 1X5AA 5DC4B 4NQCA 5CBAB 4JCMA 4EQ2A 5IIEA 1KSRA 1HEZA 1YNLH 3CNKA 3DX8B 4ONFH 3NFSL 1MHPH 3MV8B 4JFPA 2DM3A 3LQAH 1KCVL 3C5JB 2EE6A 5FHAH 5LWYH 3MA9L 2W0PA 1G7HA 4NKDB 4HF5L 1D5XA 2OTWA 2Q76A 1BQUA 3ALPA 2YPVH 1YUHB 1AGFB 1IGYA 3LKPA 2BVOA 1O0VA 5I19H 3QIUC 4NCDA 1WAAE 5F7FA 2BXZA 5MEQA 4MWFA 3MRKB 3MV9B 3HS0B 2A6JA 2QQQA 3BKMH 5SV3A 1I7ZA 2X42A 5C0BB 2ADIA 2OTUA 1CYGA 1OCWL 3WN5C 2P7TB 5EIIB 1FFPB 5B38B 4OZFB 2IG2H 3QEQB 2FWOB 5F1NA 5BW7C 3RNKB 1FG2B 2K1MA 2Y72A 4UNVA 4DFHA 3ETBF 1SBSL 4HHAB 5FUOH 4RX4A 4XNXH 3B9EA 4PUBL 4ZXBD 1U8QA 5HHPA 5E7BA 2O61A 3ARDC 2ITCB 4QOKD 1T1WB 2YD6A 2G2RA 1J0KA 3KDMB 5IGXL 2ESVE 5LBSH 5HYSB 1QR4A 1EHNA 3T0VA 1MEXL 5INDA 1KXVC 4QOKA 4Y2OA 5FYKL 4XCFL 3TNMA 2FX9H 1JHLH 2Q20A 5E2TH 1MVUB 5F9JA 4NNXA 1YEGH 4ZYKA 1EFXD 5EU6B 3TBSB 4R2GC 4JJHA 1K85A 4IOSD 4HW6A 5IBTL 3V5HA 5FXCH 1WWAX 3KPOB 5EUOF 4OQ1A 5GGVH 3CDGB 2EYTA 3CXDH 3U9UB 2R1YA 4LPTA 3MLUL 2IWGA 5GS1B 4KKAD 1R3JB 5IR1B 3HZYB 2APFA 5EZIL 1ZLWH 2YBRB 4Q9QL 4FFYL 5ICZB 1KJVA 5T1KB 5A2FA 3QIWB 2VDOH 4S1DC 4RAHA 2JJUA 2BVQB 4OCSH 4PJCA 1SEBB 4GOSA 4PJ7A 4X6CE 4AEIL 3I75B 2EDYA 4NZRH 4EI6B 2O5XL 4Y5XA 4GKZA 4FFZL 4XI5C 3DURB 1R5VB 1N4XL 1I8KA 1WBZA 3C5ZC 1L7TL 4FXKA 3GI8L 2C4XA 4DW2L 4X9BA 3TO4A 2C3WA 3VD7A 3HZVB 1T03H 4E41A 2XKSA 3SE4C 1QSFE 4E42A 5JMRA 2NPLX 2R1XA 1NANH 1OAZH 4PJFE 5I1EL 3DOSA 2X1PA 1T1XA 4PRAB 5DFWH 5GRUH 4ODUB 4RNRB 4PPTA 1CGWA 4LPUA 3RWGB 1H3VA 4P4KC 4FNLL 3T77A 2Z93B 3X14A 4U3XA 4RMVA 4XP6L 2X4SB 2D03H 4Y1AB 1U2HA 4FQQB 4JFDD 3FN0H 5HYIA 3QUYB 1CGTA 1ORQB 4MS8D 2FJFA 5I1HH 4TNVK 1L7IL 3PABA 3U4AA 1I1YB 1FFNA 3BQUA 4JRXA 1SMAA 4YDVB 3DHMA 4JFDA 1MRFH 3Q3GA 2R39A 1PJ9A 2P48B 3L3OA 2HJKB 3HLAA 4YE4L 2FDBP 3V8CA 4X80L 2Y6SC 2IH1B 2VMFA 4X9HA 4P3CL 1RY7B 1MNUH 2P47B 4QHKI 2HJFB 1EHLL 1T89C 1UA6H 2FYYA 5JXED 4WWKB 5DK0A 2CDGA 1S9YA 5A2LH 2Y07H 3TYGH 1P84K 4Y88A 3O6KL 4KV5E 2W9LA 5IBUG 3OXSB 4NQXA 1K4CA 4JQIH 5JXEA 3BI9X 1MHHA 4YWGL 1LEKA 1WK0A 3HE6A 1QFWL 4PV8B 4LLQB 1NQBA 5K9KB 3KPMB 2DAVA 1JFQH 4Z7VE 4WCYL 3KVQA 2OBGA 2YPLA 5CUSH 1FO0A 4M61B 3GSNA 5J6HB 1AXSA 3BKYH 1NMAL 4OB5L 5F7WC 5IIEB 4PP2A 1HEZB 4O4YH 1C08A 3WLBB 4EOWH 4U1LA 3QUML 2NQCA 1QHOA 3AM8A 2V2XB 3LRSB 4LPYA 1S5IH 3KPNA 3F58H 5I17A 3S88L 1D5XB 1B4RA 1I3GL 3BE1H 3QQ4A 4IOFD 4MQXC 2AK4B 1AD9A 1RJCA 4ZSOB 4MD4B 5J56B 3LKPB 4UQ2A 4HCRL 5T5FL 5IFHL 2I07B 4CN6A 2DQGL 1DBMH 3OKMB 4S1RH 4OD2A 3T0EE 5MHSD 5JMOC 5CWSB 4Y2DD 4ORGB 3U0PB 4K3JH 5E0QA 4U6XA 2AJSL 1J9CT 4NQEE 1A7QH 3QDGD 3D69B 4RGOH 2VXQH 2Q8BH 4M6OH 2OMNA 2D7QA 2ADIB 5ALBL 4JO3H 4JB9H 1V3LA 5K9JL 3KJ6H 4L9LC 5CP7A 3E8UH 3X3FL 4KRPD 4Y5YA 3EO9H 4P46C 2CXKA 5IM7B 5E2VH 4HMDA 3HPJB 3SE8L 4ZOCA 4HIEA 4IMKA 3IDXH 4NOFA 5DJ8A 2CDFA 1VFOA 3GI9L 2GSIA 1EAJA 1P7QA 5HHPB 3U7WL 4D8PA 4OQTL 3TT3H 2G2RB 3GRWH 4JHBA 2P45B 1P2CB 5F6IC 1IM9D 4E0RA 1BGXL 3RHWK 3EOAA 5I1GL 5IFAL 3CDYA 3T3MF 4DVRH 1QP1A 2DQDL 4PJHF 5INDB 3RVWC 1T66D 3O3BB 1PEZA 3HRPA 9CGTA 5FGRA 4OCYL 3IJHB 4PY8I 3B3IA 3MV7E 4NQSA 4YUEL 3UJIL 5F9JB 4KK6D 4Z9KB 5C09B 3TA3B 4J3OC 2C5DC 3X11B 2MTPA 4NO0B 1PDKA 5DF0A 4YHZH 2Z91A 3KHOA 4MNGE 1DN0A 1T6VN 1CXLA 3E6FB 5FV1L 1KC5L 1RUKL 3LIZH 4CBPA 3B9AA 2DM4A 3V4UL 2AJYL 3UPAA 4KTDH 3V0WH 5C0AD 5TE7L 2XFXA 1RUQH 2X4UB 5KANG 1UM5H 2YD7A 5GRJL 1TVHA 1LP9A 2FJHA 3WKNA 1S5HA 3HAEA 4WUUE 1KJVB 1OT2A 5CKGA 1BZQK 4MHHI 5IT2L 4HDIA 4OM0L 4YPJA 1BFOA 5TF1L 4D0BA 3MBXL 2MOVA 5EB9A 2FO4B 3LPWA 4NZUH 3BEWB 1MRDL 3EFDL 3AREA 2YWZA 5JR1H 1OPGH 1VFMA 1ND0B 2A6IA 2B1HH 1JPFB 1N3NB 1I8KB 3C60D 2NNAB 3UJTL 3TO4B 1JYVA 1RVFL 1IC4L 4FQJH 1G6VK 4JFYA 2NZ9C 3DECA 2F5BL 1G6RB 4JVWA 4PRDB 3UROR 1OD9A 2K7PA 5C0CE 5EZOH 3ARBC 3F7VA 4IS6A 1WJ3A 2R1XB 4V2BA 5KVDL 1CFBA 4KI5C 4KZEL 5SWZA 1T1XB 3T4YB 1G9MC 5J1AB 2P5EA 4FQ2L 5J89A 2VDKL 4Y4HC 4WTXA 1NGXA 1CGXA 4OLWL 2ATPB 4NKMB 2XTLA 4I9WD 5FGCB 1K4DA 2NW3A 4Z7WF 2FJFB 4KU1A 2YN5A 4WV1C 3PABB 3DUSB 3U4EA 1U91A 2A83A 1FFNB 4HMCA 4JRXB 3QUZC 2D7PA 2FJGA 2FEDC 3BH8B 4Z7OE 3V6OE 4PJ5D 4PD4K 5D1XC 4EN3A 4Q9RH 1PGRB 4GG6E 1RHFA 3KLHC 1IAII 3KYKL 3KXFE 1B4JL 1QA9A 1JIBA 4R7NB 4TUJA 3U7YH 3VH8A 2R23A 2ZOLA 2DYPA 1U8KB 2CJUH 5TFSL 3WFHA 4BJLA 3WDHA 4HJGB 4PJ5A 1KN2H 4KMTL 3KJ4B 1B6UA 2CDGB 5FYJE 1AXIB 1BZ7A 3GKWL 1NL0H 1V3KA 2ERJC 3OKDA 4NHCL 5TGBB 1JNHA 1V5JA 1S7RA 3O3UN 1QBLH 1ETZA 4MVBC 4BUGA 1LEKB 5JW4M 1BQHA 3BPCB 1MPAL 2YR3A 2IANE 4HWEL 1IM3A 4HC1L 5F1IA 1FH5H 3CXHJ 1DVFB 3GSNB 5HI3C 5LG1A 1JI1A 1AXSB 2YD1A 4CNIA 1IBGL 3MRPA 3L95B 4TTDC 4WFFD 3S34H 3LQMA 1T20A 1CGUA 2YK1H 2IFFL 5J3HC 1C08B 1KIPB 1UVQB 2C1OA 2W9EL 4WW2C 3TZVD 4CRPA 5IB3A 3ULVE 4TULL 4OBSA 3FO9A 4Z77B 1HIMH 4X8XA 1F3RB 4AIOA 5I17B 2XRAH 2R56L 3V6OC 4KY1H 2HTKC 3DRQB 2QADB 1NCAH 3LRHA 3QQ4B 2HMIC 1AD9B 4TVPE 1ZTXL 1UENA 4ONHA 3TZVA 5T3XD 5D7JA 3AVEA 1E4XH 4HZAA 4AY0A 3V5KB 5JW5B 1GGCL 5E56A 2HH0L 4QYOA 5AG8A 4PJXF 4NJ9L 3DV6B 3QDMA 4G9FA 5CSZA 2CUMA 5SV4A 2F54B 5EUOA 2NXZD 4JQVC 2LQRA 4ORZC 3FO2A 4P2QB 2F8VA 5L8KB 4LSVL 1KPUA 1B0GB 1MCLA 3EYSL 3BZEA 1WWWX 2VTFA 5B8CC 3TP4A 5IB5A 4QRPA 1Y18A 2JJWA 4ZFOL 3GSUB 2DQCL 4X4YA 3VFRB 4I13B 5TDNA 3ZDYF 5DJ0B 1N8ZA 5BQ7B 1P7QB 4I3GA 4KK5C 1PBYA 3MLRL 3RWCA 4EUPG 4F7MA 5D7LB 3CCHA 4R90H 1DN2A 2R69L 4R4FL 4U7SA 5CHNA 3LHPL 1WVZA 1LO4L 3EOAB 4N0UB 1KNOA 2ICCA 5TE4H 1HOCA 5E2WH 5FYJU 2PW1B 1T5WA 5DVLA 3Q6FA 2QSCL 5IG7B 3O6ML 1PYWA 1OY3B 4NQSB 1F90L 3EZ8A 5C08A 5DI8A 2HFEA 3P0VL 2WQRA 2FH6A 3TESA 3RY6A 2Z91B 2X1WL 1JJUA 3VXSD 4XH2A 4HMEA 1G0YR 5KVEL 3HTLX 2EO1A 1WTGT 2A6KB 2EECA 1DLFH 2BRRL 1W0YT 4GXVH 4XVUD 1CQYA 3AXLA 1TVHB 1LP9B 1TPXC 4FXGB 4BQCA 2Z92B 3H3PL 3CAFA 5T1LA 1A6WH 3VXSA 3GMQA 4H8WH 1XF1A 3HAEB 3D3VD 4ELKB 2VXVL 5F96L 4OZIE 4OD1H 1YEFH 4D0BB 1JWUB 1BWMA 4NP4H 1AY1H 3G6JF 3ZKXB 2VLRE 4LARL 3AREB 1OTSC 2QQNH 5FKPB 3D3VA 4HUVA 2I26N 1E6JH 3B9KA 3TVMC 1LO0H 1IGIL 5C0RH 3IFPB 4O02L 3I02A 3NGBC 1FC1A 1T2JA 3W39A 3NZHL 2AV1A 3PP3K 2V5YA 4UIKH 3F7VB 3IFNH 3M17B 4IS6B 4ONGH 4OZGF 2E7LA 5E24E 2R8SL 2AXFA 5SWZB 1G7PA 3BPOB 4OV6F 1KIRA 2P5EB 1KB5H 3T0BA 3QXVA 1UM4H 4C83B 3VXME 4GMSL 2AEIT 2AEPH 1G7LB 2RQ8A 1LE9A 2R15A 5ALCL 4K23H 1WSST 3S98A 1K4DB 3D0LA 5LCVH 2ZSWA 1JRHI 2XQYK 4TPRH 5F71A 3TN0C 3U4EB 1U91B 1XF3B 5I76A 2VDMH 5H8DA 5B3JE 5E2JA 4B53A 2J7LA 1NGQH 1U3HB 2FBJL 4J1UA 4EN3B 1GHFH 4QRQB 2NTSP 1EBAA 4JRYB 5DMIH 3VU2A 4DUVA 2D31A 4YHKH 2IBZY 4FQCH 2BVTA 3VMOA 3NABL 3BN9C 2ZOLB 3ZL4H 2MQ3A 4LASH 3FTGB 1LHZA 4RBPK 3TYFA 1JGEB 1A1NA 3SKJH 25C8L 5GRWA 1BZ7B 3O2DL 4NNYA 3SGEH 4DGIH 1FAIH 2Y5TA 3B2UC 4QRSB 1RAMA 1JNHB 4PY7A 4ALAH 4HBCH 1UB6A 1H3TA 3REWA 2H32H 1GC1C 4JANB 4DUWA 3W11D 1BOYA 1G9NC 4JJ5B 5SX5H 3SGJA 3FQRA 4LSSL 3S5LB 3U0WL 5F1IB 5T3ZL 1FGNH 4HIXH 5GS2H 3BDBA 3MRPB 1WQVT 3FKUS 5D5MF 5ABDE 2ADGA 4ZO6A 4JFED 3GJFA 1R3LA 1T20B 5C0DA 5HHXH 1V7NH 4ACPA 5I0ZA 2ZPKH 2XV6B 5BRZD 2RB8A 1ZAGA 4G8GE 5HDLA 4CVZA 4GFTB 4DTGL 4JGUA 1R5WB 4NDMB 1II4E 1RZ7H 2BNRD 2F53B 3RWHA 3STZB 4EI5A 3RX8A 2EXYC 3LS5H 4PJHA 2NZIA 4X8JB 2HRLA 3HI1B 5DRZB 1T0MA 5D7JB 1QSEA 1ADQH 2A1WL 4BZYA 4F9PA 3V6ZB 3OKNB 5EORH 4YAQB 3OAZK 2BNRA 2KBGA 2EH8H 2B1AH 3INUL 1KF9B 4WWID 3QDMB 4G9FB 3IKKA 2DMKA 5HHOB 1VFAA 3L5WA 2PCPA 5DFVC 4NSKA 4DN3L 1HHGB 5D1QC 2PO6A 5D7IF 2CUHA 1AR2A 1HKLL 3LCYA 1UWGH 2ZP0T 4LKCB 2V9TA 5IB5B 5C86A 3MACH 4QHKJ 1Y18B 4KKBC 2NY2D 1J86A 1YEKL 4U4BA 5D6DC 5TDNB 1W0VA 5D7SH 3IF1A 3SDDC 5CKAA 1N8ZB 3HG1A 3P4MA 4KZDH 4LRNL 2A0LC 4QF1B 3DRTA 2ICES 2ZUWA 3RWCB 2NY4B 4UIMA 3OPZL 2NY7H 2VABA 1LO5A 1DQLH 3FAXA 1WZ1H 3OB0H 5CHNB 5E6IA 3T0XA 1HOCB 3MNZA 2R2HB 2KH2B 1P53A 4TUOA 5I1CL 3O9WC 4NKIL 2GJ6B 1PYWB 4XNUH 5FYLE 5DJDB 5IFJA 5CEYB 1KTLA 4NWUL 5C08B 5IW3A 1MIEL 1Q9LB 1MFCH 3SGDI 1NFIA 2FR4B 5TH2A 2NR6D 1TQCB 3WIHA 2QSQA 3MBEB 3P73B 1FE8L 1JPSH 3TIDA 1CLOL 4XH2B 2G5BB 1MF2H 3G04A 2DB8A 4LVEA 5SWQB 2J12B 4GAJL 1UCTA 4P4RA 4X5WB 3VW3L 5TPWL 4Z7WA 4B7IA 3X13B 5T1LB 1LK3H 4MZ2A 1XGYH 4NRXB 3VE0A 3G5YA 1BEYH 2WLYA 1RIVL 3DVNA 3L5IA 4IM8A 1H3GA 4NFBA 3QJFA 1KB9K 3WNOA 1U6AL 4GAFB 3O6FA 2WP3T 2OCFD 1MH5B 3QHFL 4M6NL 1CGVA 2V2WA 2C1PA 3TNNB 3I2CH 2PR4H 5F89A 1W0WA 3QISA 1E6OL 1MQKL 4TSCL 4I18A 4L4JA 3I02B 3UYRL 4NUJA 3W39B 3RIAF 1IZJA 2VSCA 3BVNA 3LD8B 5GHWH 3RQ3A 3MA7A 4F15C 5MERA 1OSPH 2DQHH 1U41A 3K8MA 4OJFH 1YNTA 2AXFB 2CLZB 3ZKMC 1GXEA 2FL5A 5KS9A 4U31A 5JOPD 1QD0A 3O11A 1H3PH 1MLCB 4PGBB 2VH5L 1CFTA 4Q7DA 1NC2B 5BVPL 4QXGL 4MJ5A 3D85A 2BCKB 1LE9B 2ARJB 2J88H 3L3JB 1EEYA 2PYEA 4HUUB 2IH3B 1RJLB 4UQ3B 3O8XB 5GJTL 1UCBH 2ZSWB 4OD3L 4GRWB 1FQ9C 1MRCH 5D1ZD 2OL3B 3MJ6A 1QYGL 1ZANL 3HE7C 2EO9A 4PY8J 4JFQA 1H5BC 2ZCKH 2CPCA 4M7LT 4NKQB 2M2DA 2XA8H 3W81A 1FL3A 4DQOL 3QAZC 1QR1A 1UJ3C 3SJVD 4K71C 3CXHK 1RZGB 4PB9L 1MFEL 4J1UB 3HUJE 3D9AH 3VJ6A 3OZ9H 1D9KD 1P7KA 4KROC 1MHCB 2D31B 4O51B 3H0TA 5BZDB 5BXFB 3MLYH 2Y06H 3F6LA 1HKFA 3SJVA 4LGPB 4PRHB 3C5SA 1CLZH 1IGJA 2X4OA 1AGBA 1A1NB 4RISH 4LCWD 3G6DL 1NCBH 1HH9A 1D9KA 4NNYB 2IGFL 4OZ4A 2Y5TB 3UBXG 2VO5A 5DDHA 2JB6B 4W4OA 5GJSH 2VKWA 3WXWL 4PY7B 3QG7L 3IU4L 3MRLB 3BWAA 3IFLL 3VGFA 3L1OH 1CVSC 1RJZB 3MNVB 4JM4H 4D3CH 5GZND 3B2VL 4LVNC 3QQ9D 1Z2KA 4JDTH 4ZUSA 3FQRB 3QFJD 4RCAA 1T22A 2OJZH 5D2NA 4IJ3B 4UAOB 3VFSA 1F6AA 3O41B 1I9EA 1RURH 4FFVD 3AS2A 5DUMH 4PB0H 1R3LB 3QDGE 4IRJB 4FN0A 5DD0H 3IDYC 3MRHA 4L3CB 4LPVA 4PJ9B 4XCCL 1F4AA 3QFJA 2NY5C 1C16B 4JKPH 1KEGL 1QRNE 4NHUA 4XVTL 5FCUL 3PWLA 1XMWA 3B8SA 4FHBD 3JV4B 3RWHB 3S96B 2ZG1A 1I8LC 3KGRA 3W9EA 4P3DB 3HC3H 5I66A 1CDIA 1FBIL 1HNFA 4Q2ZB 3BW9B 1MFAL 3CX2A 1E4KC 1QSEB 4KAQH 1I9IL 1BREA 3IDGA 4X6FB 5J0BA 2VAAA 2EDHA 5TF0A 1IC5H 3QPQD 1R5IA 1T0NA 4WW2F 4EXPX 2KDGA 3ECBB 2YKLL 3QUYD 2HG5B 3WKMH 4RGNC 4POZC 2AJUL 2PCPB 3RA7L 4Y0GA 5CEXA 1YQVL 1R24A 2KZ1B 1RJYA 1HSAA 4FQLL 1NUFA 4R0LB 4MZ3A 3ZDZF 1BF8A 1ZHBA 4L4TA 4V1DE 2GIYA 4LGSB 1J0IA 3HG1B 3P4MB 5B39G 3G6JA 4U1GC 1P1ZB 1HHHA 4OCMC 3DHJA 4UIMB 3PWNB 3K8LA 4WDIA 5JXAH 1WTLA 2VABB 1LO5B 1CG9B 3JVGC 5E6IB 3JXAA 2VXSL 4WWKD 4HIIA 3AAZB 1ZGLA 2DM2A 1LD9B 2MQCA 3FB5B 5J8OA 4Z95L 4TUOB 3U4BL 1XGPA 3TH3T 3PWPA 4EDWH 4M3KB 4OZGA 2EIZA 4LCCA 5IFJB 2YA0A 1KTLB 5DWUL 4OV5A 4LHUA 4NT6A 1UZ6E 2IAMB 3SCMC 1QUNA 4OLXL 4AL8L 5H37H 4QY8A 5IHUL 1NFIB 1PKQB 2HJLB 2BJML 4TRPH 2DLHA 3V4PH 4K7PH 4KKCD 1IKFH 5MP6L 3HNVL 4H1LA 4CVXA 4P4RB 2G9HB 3WYRA 3OF6A 3RGVD 1UQSA 4CL7A 3G5YB 1IFHL 4KPHL 4ODHH 3MLWH 1JZ6A 3DVNB 4UINH 5SX4H 4XWGL 3BAEL 3PHQA 4TNVF 3GIZL 1RMFL 1PKOA 3RNQA 1FDLH 1N0XL 4F57H 3DSFH 2V2WB 5ICXA 3CU7A 2C1PB 2CK0H 2DQUL 1KCLA 3KPPA 5EC2A 5F97E 2R0LL 4DKAA 1ZMYA 5J12C 1KIQA 4GAGH 5IBLC 3CLFL 5ANME 4U0RB 5MEPB 2NY1B 2OLDA 4QXWA 4YDLC 2BP3A 5EOQH 4JFZH 2FL5B 4H0GA 2EIBA 3CH1A 1MWAB 1CFTB 3N0PB 1XZ0B 2J1KA 3V0VA 4MJ5B 3D85B 1WT5C 3QXWA 5I8KL 5T1MA 35C8H 3I6LD 1P6FA 3CSGA 1CICC 1BD2B 4EIGB 3NFNB 3N1GC 3ZKQD 1T2QH 4L29A 4APQD 3U82B 3H2WA 4DK6A 3A67L 1CE6A 5CP3H 4PJDE 2NY0B 3CD4A 3PUCA 5D5MA 4OGXH 3ISWA 2B5IB 3I3BA 3O4LE 4NOBA 4OF7A 4DAGH 4ZFZA 4J3XA 4UT9H 2YWYA 2MPAH 2QSTA 3S3SA 4YBQD 4APQA 4URTB 2VC2L 1JF5A 3VJ6B 3O2VH 2D7TL 3SEPA 3GKZA 5C09D 3TA3D 3MGOB 1T4KA 4I5BB 4KQ3H 2K9UA 2X05A 3BKJL 4NO0D 2ZZUT 5J11C 4LLWA 3C5SB 4Z7QF 2X4OB 4O00A 1AGBB 3QPXL 3OWEA 1HH9B 1LEGB 3CDCA 1TNMA 1PZUB 3C8DA 4OBRA 4A2LA 4PJXB 5F3HA 4XPBH 5DDHB 1XR8A 2HFGL 1A3QA 3V7AE 4YNYA 2EYRA 4HWBL 3IAQA 3BWAB 3OKYA 1BJ1H 4GQ9L 4KK8C 2DBLH 5CGYC 4MQ7A 4MB5A 5D7IA 3FOMA 1DBAL 1A6VL 4MJIA 5DHYB 2JCCF 3ULUL 2JF1A 4OCWH 5EU4A 3KYOA 4LDLB 1P4BH 1T22B 5I1AA 3S36H 2APTA 3QIUB 3VFSB 1F6AB 1HXYA 2ADJB 3D39E 4PLJD 2ATKB 3OJDB 2EICA 4HXAH 3UC0H 2AJ3B 1CK0H 1MI5B 2VQ1A 1VADA 2V7HA 4DZBA 3FO1B 2DLGA 1AJ7L 5ESQA 4UDUB 3WN5B 4NHUB 3OHXB 4L4VD 3W2DL 1D5IL 4J12A 8FABA 3SDCC 3PWLB 3UTSD 2UVEA 3P11H 4P46A 3ULUC 5IW6B 5I66B 4FZEL 4KDTC 1A3LH 1IAIM 3RHWF 3HCVB 1HYSC 4X9GA 1S7XA 1ZT7A 1ED3A 5ID1A 3I3DA 5DQJB 3KPRA 2VAAB 3AROA 4L4VA 3BJLA 2IPKB 5C6TL 3VRIA 2P1YA 4L5FL 3ARDB 3JWDL 1R5IB 1T0NB 3HFML 2XZZA 4CDHA 1CXEA 4P23A 4UUJA 3OX8A 1F3JB 3DMMA 2X41A 1JF1B 4WHYG 2WBJA 5JDJA 1AO7A 1R24B 4LLUA 4ZAKA 1HSAB 4WEBH 1UZ8B 4ODWA 8CGTA 2GAZA 1VACB 1DBBL 1ZHBB 4OLYL 3OAUH 3RDTD 3OKKA 1OVZA 2CD0A 4R2GB 1PX3A 3JWDC 1SBSH 3G6JB 4OQTA 3TV3L 4PUBH 1FYTE 3L3KA 4UTBL 2ZUXA 4LRIA 1WBYA 4HIIB 1ZGLB 1I7UB 4G6AD 1CXFA 3QQ3B 4KGLA 4FABH 3EW3B 3PWPB 5ISZA 3GUTB 3SQOH 5F70A 1FPTH 3BESR 4LCCB 5J9PB 2EC9U 4S2SB 5CBEB 4LHUB 1OQOA 1BAFH 4NT6B 4PRID 5HGAA 4WNQA 1DFBL 2F58L 1AE6L 1FG9C 1LDSA 3LRGA 1KJ2L 4X4XA 4JGMA 1CFSA 1BQLH 2X9WA 3C5ZB 1QKZH 2F9BT 3SOBH 1DVFD 1UACH 2H6PA 1PD6A 2GCYB 4H1LB 1NKRA 4XTRC 3MLUH 1K5NA 3WXVL 3LEYH 2MCG1 3O6LL 1Q38A 1YN7A 1UQSB 5KZCD 3W5MA 1P4LA 5EZIH 1VFUA 4G9DA 4M1DL 4K9EL 4LFHG 4PJ8A 1AXTL 1OM3H 2ZG2A 3TWCH 5EIVA 5LQBL 3U9PL 2X70B 3K2UL 5ICXB 5DEFB 2O5XH 2PXYC 3CFEA 1L7TH 3GI8H 4DW2H 3U6RA 5I18H 5IKCA 1I9RL 5FK9B 3BP5B 4H5SB 4XC3H 4U1JA 3SY0A 1S3KL 5L2KB 2F54D 2AJXL 4K9EC 3MRQA 3DWTA 4QRRD 4P2QD 4ENEC 1ZA6A 3PQYA 4QHMB 4PJIF 1VKXA 2GUOB 4RRPG 4M4PA 2ZSVB 4XAKD 3CPLB 4NC1C 4MXVE 3LSOA 1IT9H 2FECL 1TJGH 2EEBA 3VA6A 4KI1A 1IC7L 2ZCHH 3BJ91 1UYWH 4M4RA 2DLFL 1ERNA 3R8QA 5ADOH 3CGTA 1GGYA 4L29B 1Q72L 1U3YA 3NZ8A 5D7LD 3K7UA 4QTHA 1CE6B 1MCSA 2NYYD 5DR5L 1HZHL 3IDMA 1U8LB 3HA0A 1T21A 3ZKSD 3P4NB 2GTZA 4I2XE 5EO9A 3TIEA 1AC6A 5LGJA 3LKOA 5JOFA 3MV11 3H6JA 2ADFL 1A7RL 5KSAC 1T4KB 4QTIL 3ZDXE 4C56D 4NCC1 4JFEE 3EJZD 1T0PB 5KW9L 4ZPVB 3LKNB 4P5KA 5F3HB 5K9OA 1UFUA 5E8OB 4FS0A 3VGDA 5BRZE 4RWYL 2OXHA 3O6KH 5FUCC 4X6DE 1J12A 3G9AB 5EU7E 2IMMA 4Z0XB 3RWJB 1CLCA 4GW5A 5D7IB 3FOMB 2HT4C 3E6HB 4TYUA 1YEDA 4HC1A 3HNSH 2BSTB 5F72S 1WGOA 4OM1L 1G7JB 4Z7UF 1HXYB 4BFIA 4F37K 3FB8A 3P9LA 4HG4J 4JN1H 5KSVB 3QHZH 1VADB 4R26L 3QUMB 1X5HA 4KJQC 4QXUL 4DZBB 5I75C 3R06B 4Y4KA 5ESQB 1IGFL 4BQ6A 1M4KA 4N9GA 1MY5A 8FABB 4JKKA 4TTGA 1F2XK 4P46B 1ODAA 1A14L 3PGCB 1L9MA 3ILQC 3WJJA 1VSCA 2O26U 1ZT7B 2I9LB 1YEHL 3G08A 4LCYB 3KPRB 4N90D 1RHHA 4NN7C 1JK8B 2H2PD 3VRIB 1KB5A 1QQDA 2L7JA 3QDJA 3EYOB 4UUJB 5C8JA 1IGTA 2R4RH 5F6IB 3ARFA 1NEZA 1J8HA 1Q0XL 4F7PB 4Y5VA 2WBJB 3QEUA 4ZPTA 4R96A 1AO7B 1KACB 4YDKL 1VPOH 5ERWA 5K9JH 3KHQA 5GISL 5I30H 4ZFOA 3X3FH 2GAZB 4PS4L 1NBYA 4PG9B 3P2TA 4PTTB 4HWUA 1KXTB 5GGUA 3SE8H 3QQNA 4JPIA 1T3FA 2J8UE 4UB0H 4K8RL 4UT7L 4GRLC 5HSFA 3SKNA 4MD0A 1PZ5B 2D7MA 3FT3B 4D94A 4Y19E 2Y5EA 1NCWH 2P5WD 3NAAH 4HGMA 4PRPB 4Z5RA 4F7CB 5I1GH 1G7MA 3QFDA 4LCIL 3STLA 1AI1L 1EVTC 3MV8E 2X9XA 4NQVA 1BM3H 4Z18A 3KYAA 3RGHA 2OSLA 2XNAB 4BK5A 1H3UA 1GOHA 2J2ZA 5A2IH 5IV2A 3UX9B 3P0YL 1DLHA 4K8RC 4N8VG 4MXWL 4XBEL 4YUEH 5E08L 4CVUA 4ODBD 5FDWA 5IB2A 5LXGH 3IGAA 1IAOA 4WY7L 4X4XB 5E5MA 5GS2D 3BWUC 3ZT5A 5EFIA 4L8SC 4Z0BL 3B5HA 4RGMC 3M8OH 1KC5H 1ES0B 2XT1B 5TQ2H 2DKSA 1J1OH 3MYZA 3UYPA 2AJYH 4ZUWB 1K5NB 3MV9E 4N8CL 1N59A 3ARBB 3OJMB 1P4LB 5I8OL 5IESH 5C0BE 4ZTOH 3OL2A 4Q6IA 4JE4B 4MNHA 4KUZL 3FO0L 5E1AB 5E2UH 1XIWA 2X10A 1INEL 3GNML 2F53D 3QEQE 3JTSA 4Y4HB 1G9MH 2YC1A 4ODTH 4D9RE 1JNNL 3AU1B 4HBQA 5D8JL 3TBVA 2N56A 3SDYH 2AKRA 2AXGA 4WFGD 3QJHB 4YXKH 1AD0A 1HQRA 4NBZB 3UJTH 2MJWA 2ZJSH 1OWRM 1TJIL 3RJDA 5I1DB 1KENL 2GITA 1OB1A 3AB0C 3QUZB 5HHOD 2CKNA 2NTFB 4RAUA 3MJ7A 4XNYL 2O5YH 4LP4A 4KRNA 1YJDH 3EDJA 12E8L 3C8HA 4JHZA 3DBXB 4HK3J 5D1XB 3LSOB 2NXYB 4YXLL 3UJJL 1RIHL 3RI5K 4JM2C 4HAFA 2IADA 2PTTA 4NUGL 1JL8A 4XC1L 5EU6E 3B6SA 3VDCA 4LBEB 4X7CC 2JCCA 1CDUA 2GY7B 4LGRB 4RMWA 4U1SB 3VI4F 2MCPH 4P5MB 1Z5LA 4P2RD 4YXHH 3RWFB 3AMKA 2VITB 2DWEB 1WBXB 5DD3L 3DXAA 2NY4D 3QI9A 5TQ0H 1CE1L 2ERJB 3ULVL 2KQMA 4HGWA 3IDMB 2FX7L 4CJ0A 4H88L 3PWJA 4DKDC 3LZFL 4P2RA 5BO1L 3IS0X 5IB4A 5EO9B 1YC7A 3IXAA 3VXQB 4P59L 1L0XA 2GJ6D 4K3DL 1NSNL 1M7IB 3L9RB 1XF5B 3MCLL 3MODL 1MJ8H 3ZT7A 2EEAA 2XWTB 3KYKH 3FZUD 2HWZH 4PJGA 4JZJA 2CKBL 5DUPL 1VFBA 3LQZA 4U49A 4BUHA 5I16B 3O3DA 5DT1L 3O2DA 4IRSD 3MBED 1VENA 2CIKB 4HJJL 5GGQL 2Z8WC 3QWOA 5HHMB 4OAWA 4DKEH 3EJYC 4P5KB 4WW2B 4OCRH 4LF3A 5GGRA 1IGMH 1CD1A 3G5VA 3U1SH 2J8HA 3CFKB 1JYWA 3GSWB 4WJ5A 2NMSA 3LB6C 4GW5B 1S7TB 5E94A 4JKMA 1RU9H 3MV01 3QXDB 4XZUA 5CJQL 3DROA 3BO8A 4P9ML 2GK0A 4BFIB 1KLUA 4NPYB 5F9OH 3MRNA 4Y1AE 1URLA 1RK0B 1FNEA 1NDGA 3ILPA 5EOCH 1HHKA 5SWSD 4OFIA 5HYJB 1TZGL 3UXFA 2Z31C 5JO5A 4Y4KB 2LE9A 3EYFA 1M71A 4N9GB 5FYJH 3QULA 5GS1C 5JHDD 5B8CB 4K7FB 1Z0MA 4ODVL 2R56H 2D7NA 5SWSA 1MCOL 5C0NC 1XT5A 2ZCLL 3RVUD 2ORBL 1FLTX 1ZTXH 1NC2D 3QIWC 4GUPA 3CZJA 2A77L 1NDMA 1GZPA 1KIUA 5C7XH 2MFNA 5DO2D 4JLRB 2M1KA 5C8JB 4N0YL 3O8XD 1IGTB 4J4PD 3ARFB 3LS4H 1CFQA 1J8HB 4OLVL 4ZDHA 3HB3C 4Y5VB 4K3HA 3QEUB 2APVA 4R96B 4V2CB 5E8EA 4JR9H 2FEEL 1RK1A 3RUGB 5GGUB 4X98B 1S7UA 4NM4H 4RA0C 4X7FC 1NGYA 4KC3B 3PGFH 3L7EB 3MJ8A 4I4WA 4MD0B 4YZFF 3VI3E 4UDTA 4I3RL 5IBUB 4OLEA 4JO2H 2Q7NA 4TVPH 4LMQI 4TVSa 4HPYH 4OGYL 4PRHD 4LQFH 4Z5RB 3ZO0A 3VGGA 4A6YH 1TPXB 4EVNB 2I9TA 4NQVB 1L6XA 2DQTL 5IV2B 2CK2A 1V05A 3JBG7 1E4XI 3O6MH 5KVFH 1I3RB 5E9DB 3O0RH 1F90H 3MLZH 1Y0LB 3PP4L 1LO2L 3EOYG 5FDWB 1OGAB 3WSQH 3IGAB 4PJIA 1N6QH 3FQTA 2AK4E 5E5MB 4D0CB 4ZSOE 1YMMA 4JFHD 5EFIB 4N0FB 1PLGL 3TVMB 2GFBB 1U8OA 4N1HB 2RAMA 2E9WA 5L0QB 3T8XB 5ITBH 3TF7C 4PBVC 1G7QA 5LAXB 1JE6A 3VDAA 3V2AR 4IRJD 4X6CF 5B4MC 2YD9A 3QNZB 5JIPA 1AIFA 3H8NA 3ZE1E 1AKJD 3FQWB 1DQDL 4PYGA 5D9SA 3B5TA 4XRCA 3CVHA 1QPPA 5EU3A 2Y36L 1I3UA 3FMGL 1A2YA 4UBDD 3CFBB 2DLIA 4J2XA 1IAIL 2AXGB 3VMNA 2Z35B 2D9CA 1J5OL 4XMLL 5BJTA 1C5CH 2OM5A 2OXGA 1KULA 1P6AB 2E7MA 3OGCB 4JFOA 2A9MH 5F7HA 1LMKA 5T33L 3NZHH 3MLXL 1QLRA 1QFUL 3HMWL 4RAUB 1FORL 2R8SH 4JY6A 2NLJA 3DGGB 1JWMA 4EUPA 5EWIL 3CSYA 4QWWD 2YD2A 15C8L 4BZ2H 1YC8A 1MCCA 5CILL 1MJ7H 2XQBL 4G7YH 4JG0L 4TSBL 1W72H 5C09E 5ALCH 2UYLA 3OAYH 3FFDA 5J1TC 1DEEA 2JCCB 2WUBL 1N7ML 43CAA 3FQNA 4EJ1C 1U8PA 4YO0B 4N0CD 32C2B 4Z7UA 2A38A 2VL4A 4HGWB 1IAKA 5DQDL 2F15A 1X4XA 5ILTH 1X5IA 1ZK9A 3PWJB 4F2MA 5DC9B 1QZ1A 4RFNC 3U0TB 5A40E 3IS1X 1A9EA 3IXAB 2VLJB 2OZ4L 4HG4K 5JDSA 1YEIH 4LL9A 1GC1H 3QHTC 5HVHB 2R0WH 1G9NH 1MCWM 1CL7H 3NH7L 3LQZB 4LQ1A 5DJCB 2VDLL 4HFUL 2LFGA 4OAWB 1NC4B 1NBZA 2I25N 3ROLB 1CS6A 3QCVH 3VRJA 5IWLA 2EDXA 3VGHA 1QBMH 5AZEL 3S35H 3DO7A 4CW1A 2BVUA 1KPRA 1CD1B 5IEKB 2WQ8A 3OR7A 1CXHA 4ISVB 3L6FA 5D2LA 3VFUB 4PFEA 1GCFA 3VH8G 4XPAH 3MUGB 3I6GB 2VISB 4XZUB 4ZO8A 3TCLA 1Q1JH 4W70A 5DMYA 3U0WH 1FCGA 1WLHA 3BO8B 2GK0B 1KLUB 2E3VA 3HC0B 3S7GA 1NCDH 4G8FB 2JIXA 2NX5B 3F7QA 4X6BA 5FGCE 2FX8L 3H9SA 3R0NA 3QCTL 4OF8A 5D1QB 5HGHB 2DDQH 3QULB 4N9OB 5I8CA 1J0YA 4HX1B 2XN9A 4K94H 2H26B 1K6QL 3MLTA 5DUBB 4N1EA 2AABH 3SDDB 2DQEL 3HI6H 3EYQC 1GZPB 1NFDB 1WFOA 3MNWB 5FO9B 4Y5XC 4R9HA 2B20A 5D6CB 3GK8H 4EEEA 3P30L 4W4NA 3JV0A 3TO4C 1XH3A 5E8EB 3O9WB 1F4XH 1F58H 1JZ4A 3TJHD 3V7AG 5C0FA 3SDAD 1MHEB 3MYJB 1CTNA 2WIIA 1S7UB 4QRUB 4P5TA 3RTQD 1F4YL 2NY3C 3MTRA 4HXBL 3MJ8B 3BSZL 1B6DA 4JO1L 3ROOB 2AQ2A 3SDAA 4JPVH 2BNUB 2H2SD 3A6CL 4ZD3L 3PWVA 3RTQA 4M5ZH 3MR9B 5F7DA 1BVKB 2I24N 4NWTL 1OLLA 3MRMB 2AAVA 2I9TB 2DRUA 1GH7A 2HLFD 1XF4A 4MMXC 4YHOH 3BQUC 1I7TA 2DS4A 3GB7A 4NWUH 5KVGH 4XX1G 4PR5B 3RZCD 4LIQE 3H9YA 4PJIB 3FQTB 4F8QA 4JFFA 1FSKC 1FGVL 3IXTA 1BQSA 3JWOL 1U8OB 4DCQB 5DXWA 3U48A 4JY4A 1JGVH 4GKOA 3RZCA 4LSRL 3DIFB 4I1NB 1JRHL 1MI5D 3W0WA 1NAKL 1FO0L 2F54E 1NGWA 1PSKH 3PDDA 4R8WL 1N64H 3KJ4C 4NGHL 3RRQA 1K2DA 1SBBA 1AIFB 4ZFFA 4P2QE 4FMFA 5MEOA 3QZWB 2P44B 4QNPF 4XAKE 2OS7A 4XRCB 1U6AH 3CX5J 1HILB 1LDPL 3B5GA 4HKBA 5JXEC 3WFDH 5JUEL 4PIRF 3ARZA 4Y8DC 4D9LH 4Z78A 5FYLH 3HE6C 4M6NH 3IU3A 4AEHH 2YZ1A 3UO1L 5MENB 3FRUA 4QKXB 5I6XC 5KANI 3MREA 3MRDA 3ARDD 4JFOB 5CIPA 5D7LE 5IB1A 5F9AC 3VFTA 2VXTL 1X44A 3HE7B 1I85A 2AEWA 4KVNH 2XZAL 1H5BB 5IQ9B 4N0UE 3OKEB 3T1FA 3QAZB 4JY6B 5IMKA 4GS7C 1J05A 1F11A 5C0IA 1A6AA 3UTTD 3AM8C 5AYUL 3UYOD 5BVPH 1RZFH 4KROB 2H45A 2VDRL 4XP5L 4ZFGH 4YLQT 1DEEB 5ADPH 2P46B 2X4TA 1NCUA 43CAB 3X3GL 3LEVH 5GJTH 2AP2A 2FSEB 3H42H 5FOJA 4LOUC 2BSRB 4Z7UB 4YHIB 3DARA 3BZ4A 1EVUA 4GKNA 5EN2A 3ZHLA 1YQ2A 4IOFC 4I3SH 1LP9E 4MCYB 4F2MB 4HKZB 4PB9H 3QEHA 1A9EB 5I1KL 1A02N 5GGRY 4KFZC 3MRBA 4HH8A 1YECH 4S1DD 2CR6A 1OAQL 4Y5YC 2VUOA 2YXMA 4IMKC 3I50L 4M1CC 3FRPG 3P77A 2OR9L 3PNWB 3IDYB 4HWBA 4KRPC 3RJQB 2Y9RT 4CW1B 1A1MA 1JPST 5IEHA 1EEQA 1OQXA 3VXNA 3WXWH 4F33B 4YFEA 3KWWA 2NY5H 1YZZA 5SWZE 4YHPA 2RFXA 1NGPL 4CU7A 4IOIB 3GJFK 2P5EE 4P4KD 4NZTL 1IGCH 3IAPA 3ULVF 4M7JH 2YA2A 4F80A 3H7BA 2ESVA 2AV7B 5CLWA 1NMBL 3BXNB 4X6BB 2JIXB 4XPFH 1S8DB 4U6YB 2JB5H 4RGNB 1OAYL 2ZUUA 3H9SB 2I5YL 1JI2A 3WUWB 2X4QB 1INDL 3BH9B 3MOAL 4FQPA 3BT2H 4CAGA 2DTMH 5EG6C 1H9VA 2J6EL 4KK6C 5I8CB 4XVTH 1FCCA 2UZIL 2FZ3A 4UU9B 5DJXB 4YHLL 3OSKA 1MIML 2F5AH 1MFAH 3S37H 2GEEA 3MUZ1 1Q9KB 4JRYE 3R0MA 1JHTA 2YEZA 3FT4A 2Y6SD 4U1GB 1NCNA 4HT1H 3ZKXC 4MJ6B 3C2SA 3GSQA 4ODSH 1DQQA 3MXVL 3AREC 1R3KB 4R4BA 2CRMA 4BH7A 2FATL 4PJEF 4M93C 3GMOA 1QNZH 2B0SH 4E9LA 1CF8L 4WI5A 2ENSA 3V5DB 1HCVA 3MJGX 1QSFD 4XPHL 2ED9A 4X6CA 3REVA 3DUUA 1B0RA 4DJMA 5I1LA 1ACYL 3ZTJH 1WICA 4NRZB 3BD3A 1YDPB 4C54A 3D0VA 4U1NB 4YR6A 3SCMB 4P5TB 3VXUB 4L8BA 4YHMH 1NAMH 4M7LL 1X4ZA 3UBXA 1RFDH 4DWHA 1XCTA 4BH8A 4R4NC 4Z6AT 5EZJA 1CBVL 1OTUD 2E27H 3MRCB 4KKLC 1D5BA 3L5XL 1I7RA 5CINH 4GKSA 3VGBA 4Q9BA 3DPBA 4IRZH 2BC4A 1U2CA 4UOW0 4FQIL 3EO0A 4M8QA 2DQJL 2C4FT 4K07A 1KJ2A 2F53E 3O81A 3PIQB 3R4DA 1DBJL 4JFFB 1VGEH 4RBPH 4EN3C 4WI9A 2BDNH 5CFHA 5KTEH 3HRZA 5K9QG 3MFFB 1ZVHA 2A6DA 1S7SA 2AEQL 3QUKB 3TPUB 4PJAF 1MJUH 3QDME 4G9FE 4C58B 4HK0B 4YDLB 5HHOE 1NGWB 3EHBC 4M02A 5JQ6H 3RVVC 4ZFFB 2YD3A 5MEOB 2C3HA 3NOIA 5I2IA 1ONQB 3QYCA 2YPKA 1KJMB 3K1DA 5JZ7D 4MAYA 3LMJL 2LV4A 3IU3B 1FIGL 1CICB 4G3YL 3VFOA 2DQUH 4OKVB 3BISA 5IQ7L 5C2BL 3MREB 5CIPB 3GMLB 3NCJL 4DEPC 3WO3B 4G42A 4HEPG 3CC5A 4XVSL 3T1FB 2WUCL 3KYNA 1JZ2A 5B39A 5IMKB 1SYVA 4NN6C 4Z7VA 5BZWA 1A6AB 1AGDA 1NBVH 2GJ6E 3NMEA 5T3XL 3QIBA 3LN4A 5C08E 3BP7A 4CU8A 2VQTA 5IMLB 2C9AA 1HXMA 4G5ZL 5B3JF 2VN7A 4NM8L 5J11B 2X4TB 3NTCL 4Z7NF 1D5ZA 3TZVC 1AHWA 5AWNL 1EO7A 5E8PA 4WTWA 4BZ1L 4U0QB 3TBWA 1WC7A 3A67H 3BZ4B 1U93A 5EN2B 1IE5A 3EJJX 3QCUL 4G6FB 4NQED 4PRPD 4CKVX 2WANA 5JHLH 1A5FH 4JZOA 4F37F 3S6CA 2FLRT 3HHRB 1A21A 3N9GH 1ZHLB 3T0EA 2H1PL 3IFOA 5HY9A 3HR6A 3WIIL 5B38G 2PUQT 3AY4A 4OZFG 3O2WH 4NQEA 3DJ9A 4QEGA 1T83A 3Q2CA 2B4CC 4PJBB 1XR9A 5IVOA 5FO7A 3UTZA 4I0PA 3CFJA 5L9DL 3UZEA 4M43H 1QPXA 1SEQL 3QRFM 1SMOA 2C7UB 3MGTB 1MAMH 2WWMC 1TJHH 5B21A 43C9A 5IF0A 1A1MB 5FOBB 2NZ9D 2OP4H 3U2SA 4G43A 5KSUA 1ZLWK 3VXNB 1CDGA 4R7DB 3EDDA 3KWWB 1EO5A 1TVBB 3SDCB 4KI5D 1E0OB 2RFXB 3ZE2E 2RCSL 5DHVH 4JQXA 4P2OA 4RZCA 3QNYA 5INCB 1A6VH 3WLWD 1S9XA 1TCRB 3ULUH 1OP5H 3WFZA 3DYPA 3MV7D 4OSUH 4FXLA 3T2NL 2ICEA 4BELD 1MFDL 1MJJB 5FM5M 3G6AB 5DD1L 5FM5O 2XZQH 3PL6D 3RY6C 3V6FB 6CGTA 1XGRA 5FB8B 4GRWE 3OG4B 1TETL 2CMRL 2PYFA 1JNJA 3VWJD 2DQIL 2HVKA 1GGTA 1J8KA 3T65B 2YMXH 4JHWH 4S1QL 5E8NB 3QUZD 1V8HA 5T1DH 5KBNC 2FZ3B 4MNGA 3A0OA 2FHBA 4RA3A 4HS6A 2HKHH 5L6YH 4J3WA 4PRBA 2RR3A 3MRJA 3VWJA 5D1XD 3RAJL 5EO1A 3FT4B 3KLHD 4AMKL 2XTJB 1KYOK 4N5ED 4AM0B 2CGRL 3JWDH 5HPMA 4PRHE 3QO1A 2D2OA 2ILLA 4WUUA 4BH7B 3B9KC 5FKAA 3ZE0F 2AQ1A 2EDFA 3BP4A 2XWJB 3HKFA 3WL9B 2UWEF 2ARJQ 4LCUA 3I6KB 4AYFA 1VGKA 1JVKA 1B0RB 2R0KH 5HYQB 5I1LB 4X4ME 2E7LC 4DGVL 4MVBD 4JY5L 4G6KH 1EEZB 4LSDA 5I1IL 4MA3B 4PJ7F 2QQLL 2MNUA 4IBLT 4L8DA 4ELMB 4YFDB 7FABL 1CU4L 5EOTA 3E0GA 5C0CA 5AZ2H 4LEOA 1D5BB 4F58L 1JGLH 2VXUL 2BNQB 1A7OL 4TTDD 4GKSB 5HVGB 4UOW1 2VDNL 1RUML 4YIQA 4MQSB 2LVEA 4G8EB 1C5BL 4M8QB 4XP4L 1A7NH 4QRTA 3MQIA 2HTKD 2OQJB 1V7ML 4QGYA 3N1PC 4WUKH 4BSJA 2Z8SA 4U6VL 5BMFH 5FDYA 5FA4A 4NFDA 5I1JL 4MDIB 2A6DB 5DJ2B 3KXFD 1E4WH 4O58L 1OAUL 3NFPA 1GIGL 4NKOA 4PLOB 1KEMH 4XPTH 1FZJA 2NW2B 2AK1L 3HZKA 4XWOC 4MNQA 4UV4H 1S7VA 5FYJD 3CZFB 2DD8L 2BOCA 3IRZA 4K9EH 1ZHNB 3GSRB 3TM6A 4IIQA 5HGBA 4YJZL 1FFQA 5J6GB 4NJAH 5HHVH 3IDUA 3THMH 2IQ9L 5D4QA 1FFOB 1ZEAL 4LAQH 3RWIB 3ZYJA 2EIEA 1A0QL 4KQ4H 3HG1E 3T04D 3SGJC 1OSZA 4PG2A 2IAND 4Q97A 3LH2L 3GMRB 1CDYA 5A2JH 5FFLA 4UAOC 4YFLI 3MCKA 2QTEA 4NRYA 5DLML 1CT8B 1SJEB 3KPTA 3QNXA 5E8DH 5B39B 1SYVB 1GRWA 1JHKH 4JN2A 5HHNA 1ZLSL 3S4SG 3VFVA 2LVCA 1UB5A 1H15A 2IANA 1HYRC 5BZWB 1AGDB 4NN5C 2P24A 2RHEA 3MJ9L 1E28A 4EI5C 1SY6L 2MHAB 4BKLA 1U95B 5KSAB 5B3NA 4MSWB 3CK0H 2BFVH 1PKQE 3MLSL 2DLFH 1KT2A 4TVPD 3FFCB 4F9PC 3HUJF 3EOTL 1N5AB 3TBWB 4GBXA 1WC7B 3TEUA 3GJEB 1U93B 4PP1C 4DN4H 5F88B 2IBGA 2X4PB 3QRGH 4FQ1H 2LU4A 3UMTA 3RBSA 1OTTC 2PO6C 2X1XR 1MCRA 5EPMB 4ZTPL 2CKBA 5E9DD 1OOAA 1XGTA 5CD3A 1YEJL 4TQEL 3FOLA 4I0PB 3PDOB 1OTSD 3CFJB 1E27B 5C70A 4OFKA 5GS0C 1BFSA 3M45A 5KW9H 1DBKH 5TJWK 1C12B 5I75B 1B9ZA 43C9B 3HMXH 3U46B 1YEEL 2EDWA 3V6BR 4G43B 4X7SH 5D7KE 3Q48A 2NY2C 1SJXA 1ZVSA 4PJEA 5E6IC 5FHBL 2V5TA 2DLTA 4OFYD 5F7NC 1KTDA 4XP1L 4GMTL 3QNYB 4HUWA 2VDQL 1S9XB 1GOGA 3DGCR 4P2YA 5DD5L 1EUTA 5D96C 4NN7B 2OK0H 3VXRA 3TFKC 1XGQA 2IJ0C 1BD2E 3WE6A 1YNLL 4OFYA 4ONFL 3UBXI 1MHPL 4XPGH 4XVJH 3MMEA 1XGRB 4RRPA 5TDPB 4R26H 4U1IA 3LKQA 3LQAL 3VXOB 2PF6A 3H7LA 3ZHKA 4QXUH 4GW4A 3TN0D 5LWYL 4K2UH 3ARGA 4WHTA 3FHQA 1D6EA 1IGFH 4HIHB 4OT1H 1X5ZA 1T5XA 3GSVB 4HH9A 2JKXA 2YPVL 3NA9H 4GXUM 4GG8A 3SE3A 5DQ9B 5I19L 4PRBB 2EDKA 3MRJB 5H2BA 3RY4A 4XMKL 3BKML 3O6FC 2VLRD 1PQZA 3BN9D 3QXUA 4Q0XH 3LQAC 1A47A 5IP4A 4JAMA 4R3SB 3SO3C 5FKAB 4ZOBA 1FVDA 1J0ZA 2IG2L 4LCUB 4I18C 4PJXE 4PJAA 1A1OA 4O2CB 3B2UD 4YDKH 1B2WH 2NY1C 3BD4A 4XXDA 3GMPA 4HKXB 3ORJA 5D71H 4MA8H 1OAKH 5I8EB 1WUNT 1WISA 5FUOL 4XNXL 2VLJD 4K8RH 4KHXH 5BOZG 2CQVA 2V9RA 4X7DC 4L8SB 4RGMB 3TC9A 3VXMD 2R0ZH 1H8NA 2WINA 2WIMA 1JNLH 3BHBA 4P9HC 3RIAK 3TBTB 3B43A 5LBSL 3TO2A 3ARXA 3W9DB 1JZ3A 4X7TB 1UZ6F 4FTVA 4DVBB 1MI5E 3UTPE 4EIZC 1FAKT 3R8BB 1YMHB 3WJLA 3OV6A 2FX9L 3VXMA 1JHLL 5E2TL 2F74B 1YEGL 3GSOA 4NZJA 4Y4FA 4H26B 4XBEH 5FEBA 1G1CA 2FECI 4LPXA 1BBJA 5GGVL 4TNWK 3CXDL 3PDGA 4HZLB 3C6SB 1HINH 3PHOB 2A2QT 5TDOB 3GBLA 3PXHA 3UPRB 5JA9A 4M62H 2D3VA 1N26A 3V9FA 1FZJB 4IMLB 3WFCH 4RIRB 2NX5D 4MNQB 3AB0B 1FJ1A 3D2UB 2WAHA 1D9KC 5DFVD 2VDOL 3QUXD 5H35A 2EKSA 3VXTA 2BOCB 4FP8H 3NACH 4W4OC 1J1XH 5HGBB 3UTTE 4XMPH 4NZRL 4Z8FL 4JM2B 3P9WB 4KKBD 1KCRH 1S9WA 4G80A 5DJZB 5FF6A 1JNNH 2R1WA 2UZXB 3QUXA 1DUYA 4H0IA 3SDDD 4AH2A 1RQ5A 4U1MA 1T03L 1IMHC 1NGZA 2D4DA 3G6JE 2Q86A 5D2NC 1TJIH 4X0KA 1FVCB 1OAZL 4M03A 4NRYB 3DX7B 5GRUL 3WEXA 1QEWB 1TMCB 1VEPA 2P8MA 2VLKB 1FVEB 1UB5B 2J4WH 2LAGB 5FYKE 3ARUA 3ZSTA 3PWPE 4QHLB 4G8GD 2D03L 1EZVY 2EDEA 4PJDF 4FFVC 2BOBA 3FN0L 2BVPB 3VWKD 1EZVX 3BEVB 5I1HL 4OZFH 3VXPB 4MD5B 1NMCC 1KT2B 2Y23A 4LSQH 1D6VH 4KJPC 4G8GA 1WFTA 4N8VA 5DD3H 1MRFL 5KG9B 2DL9A 1T1ZB 5D72L 3D25A 3VWKA 4OUUA 5HDOA 2EE3A 3WIFB 3FQUA 2OZ4A 3U7AA 1UM6L 1TTFA 1KBGH 4QCIA 4AQ1B 4ZXBA 4DFIA 3QPQC 1MNUL 1XGUA 2W91A 2CKBB 3MODH 4LLYB 1UA6L 3VRLF 1JYXA 3FOLB 4YHNB 3KLAA 2AJVH 1QVOA 4O9HH 3FB6B 4GW1B 4NO5B 2YSSA 3MXWH 2Y07L 4ZODA 3TYGL 3CLEL 1EAPB 4JZNA 4MCZA 2P4AB 4FFWC 3SE9H 5KOMC 2Z31B 4JQIL 4X5XA 1EFXA 5L2KE 4PJEB 2VL5A 3IVKA 1Z3GL 4F3FA 4XP9H 4YH6A 3ZKMD 1JFQL 5DA4A 2UWEA 2GW5A 1KTDB 5CUSL 5IMMA 4GO6B 4HWNA 2AXHA 1CD0A 2IALB 4LCCC 3BKYL 5FYLD 2APBA 4U1HA 5FM4A 3EO1A 5IK3B 3HI5H 1BVLB 3I85A 4NO3A 4P9MH 3VXRB 4JFXA 1KJ3H 4O4YL 5MEND 3WBDA 4RAVA 4CGTA 1EGJH 2MMXA 4L3EB 4LPCA 3F58L 3LKRB 2CO7B 3EFFB 4J3VA 4WHTB 1U8JB 2YD4A 3BE1L 5F7LB 1T5XB 2WSKA 1FZOA 4HH9B 2YD5A 1IEAA 1EERB 5DVMA 3ZTNH 3DV4B 2JELH 4RMTA 3F7RA 4WU5B 3WHE0 4XNMB 4KKCC 2F8XC 1HCFX 1DBML 3KPSB 4S1RL 5FYKU 4B5EA 3GGWA 1LNUA 1NH6A 3PGDA 5I15H 4KROD 4PV9B 4FQXD 2A77H 2R2EB 5LGKA 1A7QL 5FECA 4U7MA 5JNYA 4BSWB 1IRAY 4RGOL 2VXQL 2Q8BL 4M6OL 5IHZB 5DFTA 4FQHA 3IDIB 4JO3L 4FZ8H 4JB9L 3KJ6L 4H25B 3Q5YA 3O3EA 4NYLA 3E8UL 4FQXA 3IDJA 4PJAB 3EO9L 1A1OB 1EXUA 5FA3A 5KSBB 1JPTH 5E2VL 5C0EA 3MRGA 3WFEH 3IDXL 5C07B 1KUMA 1HH6A 5IJVB 1RV6X 2VB5A 5D7IE 5HVWA 1LE5B 1KLGA 3WCYA 5J57B 5EC1A 3TT3L 5DYOA 1BBDH 1NEZG 1OARH 2IPTH 4C4KT 3GRWL 2WINB 3BHBB 4A2MA 4EDXA 1ZWIA 3SQBA 4FTVB 1HSBA 5KN5A 1GGUA 2P43B 3IDNB 1DEDA 1HK6A 5JORB 4GAYA 4ERSH 4Y4FB 2DI7A 2HLAA 4M48H 5BS0B 1M7DA 1JUFA 1OAXH 4YK4C 3PP4H 4YHZL 1LO2H 1TZIA 1YPZB 5SX5K 3LIZL 4APQC 4KUCD 3WO4C 5JA8B 1IKNA 4KTDL 3V0WL 4XCYA 1HQ4B 3KPRE 3UTQA 5BVJA 4CUCA 3K80A 3C6LD 5BV7L 4NQCB 4RGND 5L7XH 3HUJA 4POZD 4MA7L 2EKSB 1F13A 1U8HA 3VXTB 2H8PA 1AO7E 4JFPB 2I60H 4NZUL 3EOBA 4WI7A 3DO3A 5JR1L 1B3JA 2B1HL 1S9WB 1G7HB 5FF6B 2OTWB 2R1WB 2Q76B 3A6BH 2F19H 5H94A 2JJTA 3MRRA 4GJTB 1IGYB 2BVOB 2DTSA 4JHAL 1WWCA 1BOGA 5EZOL 2Q86B 3S5LG 5BV7C 4HUXA 4X0KB 3D18A 5MEQB 4MWFB 5EIQA 2A6JB 4PRPE 2YRPA 5ITFA 1I7ZB 4OFVA 1SJHA 1EO8H 2V17H 1P7HL 4RFNB 2OTUB 3DX6A 2BHYA 1C7TA 3P40A 2QBWA 4IEFB 1R3IH 4Y2DA 5D93C 1QRND 3NA4A 2GSGA 3MCG1 2BOBB 3SCMD 3VXUD 4G6MH 5F1NB 1Q94A 3QDGA 1I9JH 5F7KC 3RWEA 3S3JA 3W5NA 2HN7A 3OB0K 1NAMA 4EQ3A 1U8QB 4KGJA 2O61B 4AG4H 4OUUB 4P23C 5ETUA 3DMMC 1WIUA 3PV6A 4Q9RL 4KI5E 4P0DA 2WBJC 2W0KA 4QCIB 3VG0H 2R29H 1XF2A 3LDBC 4ZXBB 3U7YL 3Q6GH 1A3RH 4ZAKC 2HKFH 4QOKB 5F1OB 5GRYA 3TNMB 2CJUL 3HR5A 1KN2L 3NH7H 4NNXB 1IM9A 4ZYKB 3ZLQC 4YX2H 1QVOB 1A9BA 4V1DD 1DSFH 2YSSB 4X4ZA 5JPMA 2EC8A 5E4IA 1EMTH 4JZNB 3V5HB 3GZKA 5C3TA 1AFVH 2B8OT 5IBLD 1QBLL 1RZJH 1RUPH 1RZKL 2EYTB 4J8RA 3WNNA 2FGWH 1FIEA 1K8DA 2R1YB 3F8UB 3N1MC 4LRIC 5HJ3A 4OGAD 3IVKB 5AD0A 4V1DA 1DQTA 4YPGA 2UWEB 4X5LA 2Q8AH 3B9DA 2FBOJ 2FEEI 3QP3A 1FH5L 1U8NA 4OGZA 1A22B 1FNHA 3QG6A 2XPGA 3CDFA 4Q9CA 3LV3A 5C0AA 3KNBA 2QSVA 4I48A 4IDJH 3S34L 4NO3B 5I74C 2OJEA 4PJCB 3CH8A 3V52H 2YK1L 4PJ7B 5HVFB 4GXUN 4LLAA 4G6AC 3V7MA 3WDIA 3L3HA 4Y5XB 4GKZB 1RZKC 2PW2A 1WBZB 4FXKB 2HT2D 2J6EA 5GRXG 1HIML 5IVZA 4X99A 2XRAL 4KY1L 4E41B 3WHE1 1NCAL 3L7FA 4E42B 1IEAB 4ETQA 1KPVA 1CL7I 1Z9OA 1FN4A 4KJYA 2COQA 1G6RH 1E4XL 1GGIH 3C60A 2PN5A 4LSPL 4PJ8C 2NY3B 2WM0A 4KTEL 2EH7H 3GGWB 5EO0A 1NBQA 1LNUB 2WNGA 1UEMA 5CJXA 3JSSA 3OKOA 3F7YA 4NQDD 3T77B 4KH2A 3X14B 1MFBH 5E6ZA 3K1KC 3BIBX 2JK5A 1AQDA 4FQHB 3RU8H 3LPGA 1KB9J 4WO4D 4LSTH 2GJZA 5AYQA 4KJWC 5HHME 2FB4H 1ZSDA 1EXUB 5FA3B 5HI5D 4O2EA 3L3GA 1S78C 2DJUA 2W65A 2J3SA 3MRGB 1CD9B 3BRGC 3BQUB 1UXWA 4RDQG 4JFDB 1Z9SA 3GBNH 3Q3GB 4F9LC 4KK8D 2XY2A 3L3OB 5E5RB 4WO4A 1JZ7A 2YS4A 1KLGB 1MUJA 4PGEA 3HLAB 5IHBA 1MY7A 5EC1B 1J87A 1FSKB 4R90L 3ZDZE 2NXYC 3A6OA 1I8IA 4DGYH 4EBQH 4WW1A 1KTKE 5CGTA 5TE4L 4EDXB 4TUKH 5E2WL 3MOBH 1BPVA 1HSBB 3V4VH 5KN5B 4MLSA 2FYYB 5HYJE 5DK0B 4XCNA 1S9YB 3MPCA 1FP5A 4DUXA 2HLAB 5KS9F 3O4LD 3SDCD 1GPOH 4NQXB 1K4CB 3ULUD 1MHHB 4WGVB 1HYSD 1IAMA 3HE6B 5HHQA 1DLFL 4XCYB 3IKCA 4PJDA 4GXVL 5HGGS 5I6XB 4OCLC 2YPLB 3O4LA 5DEGA 1FO0B 3N06B 1T1YA 2FCBA 1A6WL 4H8WL 4J3SA 5J06A 1FO0H 4HGKC 4OD1L 1J8HE 3GSNH 5KJRH 1YEFL 4NGHH 4BQBA 2HVJA 1BLNA 2X2YA 4O5LH 4PP2B 1U8HB 3RWDA 2ZUQC 2H8PB 4NP4L 4GS7B 1AY1L 2H9GA 1VA9A 4U1LB 2DN7A 3H9HA 1FYHB 3I84A 3KPNB 3RUGE 3KR3H 2HTLC 3MZGB 3VG9C 3EJZC 1E6JL 1LO0L 5A16A 3QEGL 3GHBH 5C0RL 4Y16D 3UTOA 3T2OA 4UQ2B 4LIQH 4UIKL 4H8WC 1BOGB 4L3AA 4ONGL 3IFNL 1P9MA 4OD2B 4QHUA 1Q9WA 3D18B 2XXMB 4G7VH 1N2RA 1S9VA 4RFOH 1I8MA 1F2QA 2CH8A 4U6XB 3D39D 1PG7W