4P9NA

Crystal structure of sshesti pe mutant
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
PLDPRIKKLLESGFVVPIGKASVDEVRKIFRQLASAAPKAEVRKVEDIKIPGSETSINARVYFPKAKGPYGVLVYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFDGEMGIAIAGDSAGGNLAAVVALLSKGKLDLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPIIAQDLSGLPPALIITAEYDPLRDPEEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIDQGKDAIGLIGSVLRRTFYDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Low pH Adaptation of a Unique Carboxylesterase from Ferroplasma: ALTERING THE pH OPTIMA OF TWO CARBOXYLESTERASES.
pubmed doi rcsb
source organism Sulfolobus shibatae
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p9nA00
3K2IA 1QIIA 1DINA 3FLAA 3D2AA 4OYYA 1CUZA 3ANTA 5ESRA 5ALFA 3I1IA 1XQYA 1TIBA 4Y2VA 3MUNA 5SYNA 4MQLA 5LIPA 3D5EA 4E15A 4DSZA 3OC0A 5HZGA 1CPYA 4CIAA 3AINA 2WUFA 4FHZA 2OCKA 1YB7A 4LYDA 4BE9A 4CG3A 2HU8A 3GZJA 4NZZA 5ALHA 1GPLA 4IQ4A 1NU8A 1LLFA 3FYUC 5IKXA 2GBFA 2WTNA 1R3DA 3A70A 1XFDA 1HQDA 1DWPA 3H2IA 3WKBA 2XE4A 4WY8A 4WFKA 5K5EA 4TPKA 3IBTA 2PVSA 1H22A 4DSAA 4P08A 1SCQA 1CRLA 4FLMA 4XVCA 4K2AA 1JT2A 3H2GA 2DQYA 3MVEA 1Y7IA 1XRRA 4FBMA 5AI6A 1E8NA 2XUHA 4WDQA 2HIHA 1UOPA 2WM2A 5AKKA 4AN1A 5FV4A 1HPLA 5A7HA 1D07A 1EH5A 3W2TA 4UHCA 4WCVA 3JWEA 2ZYRA 4OB6A 3AJAA 3I2HA 2WU4A 2ZYHA 4X6XA 5AK3A 3BJRA 2WIGA 3WYNA 3IUQA 2V96A 1MX1A 2Z3WA 1GKKA 3O4GA 5T4BA 1P0IA 1H2XA 3FLEA 1ZOIA 5AK6A 4G8CA 3YASA 4DMHA 5D7BA 2XMSA 2FJPA 4BCDA 1NX9A 4OB7A 4EY7A 4QZVA 3O4IA 4UHDA 4AO7A 3C8HA 1QO9A 5LYYA 5AOBA 3GUUA 1Q0RA 4J0JA 1LPPA 3VKFA 5T4HA 5JAPA 4UBIA 3WWPA 2PSHA 4ZXFA 4CFSA 3AZPA 4I4CA 3WJ2A 1CEXA 1YS2X 2VEOA 1ORWA 2BUAA 5AM1A 2G5TA 3STXA 1KU6A 3DOHA 1TQHA 3H2JA 5E4JA 4H7HA 2VJCA 1FSSA 3FSGA 1W4LA 4V2IA 4UFNA 4QWMA 1XZKA 3M82A 4J0CA 2FX5A 4AO6A 2GBGA 3TRDA 3FCXA 3Q0TA 2EEPA 3ILSA 2QXUA 5KBYA 1BN6A 1WB4A 3F8SA 3QZUA 4Y9SA 4EY5A 3QPDA 4PSDA 4PO3X 2HRQA 1G4HA 1R50A 3QYJA 5FPQA 2QJRA 2PBLA 5AKHA 1R9NA 4HXEB 2XLBA 2H9YA 4AXBA 1TCCA 5ALQA 1QIHA 1Z68A 3ZPXA 4YPVA 5HQ3B 5HKBA 5A71A 1B41A 1TCAA 4OSEA 2I3DA 1THTA 1FFAA 1DT3A 2VT6A 1E8MA 2I78A 3LCRA 2XMGA 2WUDA 2ORYA 2Z5GA 2J4CA 3AIOA 2JF0A 1IZ8A 1XZJA 1NU6A 5ALIA 1A8QA 4X6YA 1USWA 1WOMA 4ZWNA 4HTAA 1XZBA 5ALWA 1MAAA 3L1HA 3QITA 3KSRA 5ALEA 3C6YA 4CCYA 4P9NA 1AMNA 1XLWA 2AJDA 3H2KA 1FFDA 2VSQA 1AZWA 4AO8A 2PX6A 4YASA 4NS4A 4AB1A 5K3BA 2Y6VA 1ZIYA 4CI9A 4K6GA 5ALXA 2XQKA 5AM5A 3G8YA 5JALA 4BCCA 4QDOA 1CVLA 2GYUA 1WB5A 1J2EA 3A2LA 3VXKA 3DL4A 4MXDA 4X3CA 5AIAA 5AIBA 3PICA 5T4EA 1MU0A 5HQ3A 4LYEA 3RM3A 3H17A 1BEZA 1K4YA 5LKAA 4KACA 5CH5A 3DCNA 4E46A 1H2YA 1WPRA 3ZV7A 4HAIA 3G0BA 4DYHA 4GXNA 2RGUA 3FAKA 3FCYA 3IUNA 4X7BA 4YK7A 5ALMA 4ZRDA 4CCWA 3WL6A 1YAJA 1QIDA 2WHPA 2HA3A 4X90A 3BE8A 4J7AA 2OGSA 4RE6A 3FSGD 1F0NA 3FLBA 3GFFA 4G4JA 4Q3LA 3SC2A 5AOAA 4DGQA 4H7JA 4QLOA 2OPHA 2C5GA 2JGJA 2WFLA 2PUJA 3STTA 3AIKA 3OG9A 1FFCA 2DHCA 4C89A 1DX4A 3C5VA 4N8DA 2HA5A 2J4FA 3WK7A 5HF5A 3RKSA 1H23A 4ZI5A 5EHXA 3I1YA 1GQSA 4U2GA 2J3QA 1DT5A 2CUTA 3E1GA 2WKWA 1BCSA 2WHRA 1XRMA 1EDEA 4AMYA 1EDBA 5EHZA 1ZJ4A 2ZSIA 1CUGA 3C70A 4OUKX 2JGFA 1ORVA 4CG1A 5A6VA 4K5QA 4DNPA 3WA7A 4BTVA 3UUEA 2WUEA 7YASA 1FJ2A 5CT6A 1G42A 3ESBA 5JZBA 1WHTA 4QEKA 5AKJA 1E66A 4ITVA 2QVBA 1F8UA 3DJYA 5D6OA 5F4ZA 3H18A 5CXUA 2ES4A 3DLTA 1XZHA 2DSNA 3C8DA 3D59A 2R8BA 5K3CA 1LPMA 4UHHA 3DNMA 1XZCA 3FYTA 3WKDA 5K3EA 4BTLA 4L0CA 3UMJA 4INZA 3WKCA 1SCKA 1MJ5A 2WFMA 2C0QA 5A7FA 3U0VA 2QT9A 4BAUA 3D7RA 4KR0A 1QLWA 4Q82A 1IUOA 1WHSA 5HFNA 2XB6A 2XMQA 3EBLA 3F9CA 3M81A 3WJ1A 3OTQA 2B9VA 4DLNA 4BVKA 2JGMA 5AKEA 3QMWA 1PFQA 5ALVA 2CBGA 2VF2A 1MN6A 1C4XA 2PL5A 5CURA 1YA4A 1A8UA 2HA0A 4AX4A 3QM1A 2OGZA 1BEEA 1R1DA 1AGYA 2IX9A 3E4DA 5JAHA 4FBLA 4NMWA 2HL6A 3BF7A 3I28A 5JYCA 3H2HA 1X2EA 4Z49A 4F5ZA 1Q83A 2ONCA 3C5WP 2QKYA 4Y2YA 4J0KA 4GLBA 3IURA 3DKKA 1HL7A 3V1NA 4X00A 2Y1KA 1O6GA 1AX9A 1VZ3A 4G8BA 5JADA 4MEBA 1GZ7A 3GA7A 1CLEA 2HFJA 1XRPA 1DWOA 5K3FB 1IUPA 4H0CA 1MAHA 4GDMA 4X6UA 4QA9A 5HF8A 3HSSA 1CUUA 5JANA 2PSJA 4JH0A 1A8SA 1DQYA 2OGTA 4G1FA 2WHPB 3I6MA 2Z8XA 4LXGA 5DLPA 2E3JA 1T2NA 1MX9A 2QMQA 1VXOA 3EIOA 3JYHA 1X70A 4KE6A 4Q1VA 2V98A 1DX6A 1DWQA 3AUKA 4BAGA 3QH4A 3O9VA 1F0PA 3X3HA 2VJBA 4XWGA 1YS1X 2I03A 1THGA 5HCUA 2BFNA 3WZLA 4B9AA 1F6WA 4J0IA 4PW0A 3EQ9A 3STWA 4B0PA 2WJ4A 1MX5A 2GYWA 1LPAB 2XMDA 1QZ3A 4MWSA 4S0XA 3IUJA 3HRHA 1JJFA 1RYYA 4G9EA 1BROA 3A2MA 2YH2A 3DOIA 3O4JA 2XUIA 3HXKA 1XRNA 1XZEA 3V1KA 5EIEA 1EXWA 1HKHA 2RHWA 4RPCA 4C87A 2CZQA 3LS2A 4F21A 3S8YA 2Y2VA 4AZ0A 3HC7A 4MYSA 1LPSA 4HZGA 4A5SA 1CIJA 1IVYA 3V9AA 5AKXA 3R3YA 2W22A 1XROA 5JARA 2G4LA 1BU8A 1T4MA 5EHQA 2ECFA 3Q8WA 2I3ZA 3TGLA 4DTCA 2O2GA 1UXOA 4W9RA 4UFOA 1QE3A 1OILA 1ZJ5A 4C4YA 1QIEA 3V1LA 1UKCA 1KU0A 5LP1A 4H7EA 4LXIA 1ISPA 5CT4A 4C4XA 5CRIA 3B12A 2QTBA 1UK9A 1E3QA 2BUBA 3W06A 1E89A 4C6HA 4H7DA 4KE7A 6YASA 3LIPA 4B9EA 3PF8A 2XQJA 2CEKA 4RGYA 5LLSA 4U2CA 2WG1A 4EA6A 4AQDA 5ALNA 4QDTA 3R0VA 3TJMA 2WLSA 2ZYSA 5ALJA 1UOQA 2X76A 2VATA 3WWDA 3BDIA 2YXPX 3EQ7A 3FVRA 5AM0A 4X97A 1VLQA 3FVTA 2RONA 2XDWA 4H35A 4N5IX 3R3ZA 3NGMA 3T4UA 1DTEA 1RP1A 3BXPA 2QUBA 5SYMA 2VA9A 2WFZA 1I6WA 5EHNA 2C58A 2OXEA 3QMMA 4IH4A 3K9BA 4XIIA 3I2IA 2QUAA 1Q84A 2P8SA 1GXSA 1P0MA 1CUIA 1EB8A 4KAAA 2PSDA 1SOMA 1BE0A 3LP5A 4BATA 4GBGA 4U2DA 4BC0A 1VA5A 3R3VA 1CQWA 4FKBA 1BRTA 4HRXA 2R11A 4G4IA 4C88A 4XX1A 3FWHA 1ZD2P 3WK4A 2XQGA 5AKYA 2XUQA 2DHDA 2HA7A 4CIBA 3WWCA 1S8OA 2HFKA 2OQIA 3G02A 5AKZA 1XLUA 3KWFA 4UBKA 3DYIA 3KOOA 4OU4A 4B7ZA 3WKEA 1ACJA 2Y2UA 5ALTA 3WL5A 3ICVA 5C81A 4X71A 2VAXA 1QTIA 5HF6A 3G9UA 4B85A 3ED1A 2PU5A 3W04A 5AI0A 3P2MA 4JNCA 3F67A 3V1MA 4HVTA 1W1IA 4QNNA 4B84A 3IA2A 4W63A 1G5FA 1UK8A 1MTZA 2PPLA 2C4HA 4BB0A 5JATA 3UUFA 1GQRA 5ALLA 4EZIA 5T4FA 4KJXA 1AURA 1O6FA 4G4GA 4H7KA 4FTWA 4F60A 3OOSA 4Y2JA 4QLAA 2QJWA 4HXGA 4Y2SA 4FNGA 2X8BA 3QBJA 4Y7DA 1HLGA 3ESAA 2C7BA 3WI7A 4I3FA 4BP9A 3EF3A 1ODSA 2BCEA 4Y2PA 4IH1A 4DIUA 1K8QA 2GYVA 5HK8A 1IZ7A 4KRYA 2ZSHA 3BJMA 2BUCA 3WK5A 5BWBA 1MNQA 3HI4A 4YX9A 3G0CA 5AP9A 4BRSA 2XUDA 1ZD4A 1QGED 1J07A 1TKRA 4JYPA 2HM7A 4UBMA 5IVIA 4KEAA 2WIKA 3T52A 5EIHA 2H7YA 3GELA 1W6RA 1M33A 5EI5A 1K6EA 1R9MA 1LPBB 2WHQA 4BP8A 5I7UA 1QO7A 1XZDA 4M0EA 1U8EA 2AJBA 3HJUA 3R41A 4KAJA 4G9GA 1JJBA 3ICWA 1L7QA 5CBKA 4UBOA 3HZOA 1GKLA 5DTJA 5K3FA 3B3QA 1EVQA 2HA6A 3FYUA 4UUQA 1OCEA 1VJ5A 3C45A 4F0JA 3N0TA 1QFSA 1YASA 3BIWA 4OYLA 3W05A 1EHYA 3WIOA 1CUXA 1N5RA 3C6XA 4MQMA 5DNWA 2V97A 5K3AA 4W1SA 4QWWA 1JI3A 4BC1A 1CUAA 4ZV7A 3V48A 3ESDA 2HA2A 3FYUB 4UBJA 5E4YA 1XZMA 4A16A 1XZAA 2PKYX 4DMFA 1J06A 5JZ9A 3R40A 5JD4A 1ZIXA 5J3JA 2PUHA 5DYTA 5EGNA 3I2FA 5JZSA 2QZPA 4UPDA 1W75A 3WL8A 1ZI9A 2XMZA 3R3XA 5AKLA 2ZYIA 4GWLA 4JYMA 5ALOA 2C5FA 4X94A 4H18A 1B6GA 1UK6A 4Y2RA 4UHFA 2H7CA 1YAHA 2XQIA 2XLCA 4ROTA 3W9UA 4MYDA 2G5PA 1LBSA 5FRDA 1CUSA 1VZ2A 1ODTC 5AOCA 5DWDA 4DMCA 1MNAA 2HU7A 4BVJA 1QIJA 4LIPD 1HDEA 1AUOA 1WB6A 1YR2A 4AMZA 2XUKA 4J0HA 4X95A 2XUOA 4GECA 2B4KA 5AICA 2ACKA 2HRRA 2WJ3A 5FOQA 1AC5A 1K5PA 3KDAA 5C8VA 5BOVA 5LZ2A 3PE6A 4H7FA 2GZRA 4I19A 3BL8A 4PNZA 1GPKA 2HU5A 3IUMA 1EDDA 3C6ZA 5BWCA 4BVLA 1ZGCA 3C87A 3WK9A 3PDCA 1X2BA 1ACLA 5DYYA 2Z8ZA 2WILA 1CUBA 3PFBA 3SX4A 2XUFA 1OXMA 4EBBA 5ALZA 5AI9A 1JU4A 2PSFA 5H3HA 1ZICA 4HRYA 2GZSA 2OCLA 3WA6A 1ZD3A 5EFZA 4WFJA 2AJLI 5AM3A 3DDUA 1EA5A 4G8DA 2JBWA 2YYSA 1PV1A 5BV7A 4DM7A 3DYVA 1E8DA 5DJ5A 5ALDA 4X93A 4DNOA 1W52X 4FFVA 3N2ZB 3I2GA 2IITA 1WPXA 4TGLA 1C7JA 4BBZA 2H1IA 4WJLA 3FOBA 1Y37A 5IVDA 5ALYA 4N8EA 1YB6A 5LZ8A 2WFLB 1XZIA 2D0DA 1FFBA 2ZJ6A 3W9BA 5ALUA 1MO2A 2EDCA 4LHEA 2WIFA 4W1QA 3F96A 1YSCA 1UOOA 1DQZA 5LZ4A 3O0DA 2DR0A 5JIBA 3DEAA 4PV7A 2HDWA 4JEIA 3IIIA 1JU3A 2OLEA 1YA8A 1C7IA 4Y2UA 1QTRA 4B83A 2IIVA 2O7VA 3AFIA 5FPPA 4EUSA 4HS9A 3ZI7A 1LZLA 1QIGA 3G9XA 1CQZA 1MPXA 3HACA 4K6HA 4BAZA 1GT6A 5JAOA 1A88A 3VISA 2XMBA 1QONA 2H7XA 3OM8A 4JUIA 1P0QA 3H04A 4X85A 3LLCA 1ZI6A 2QR5A 2WIJA 2CJPA 5ALRA 5I9IA 2C0PA 3R3WA 4P93A 4ARAA 3KXPA 3WWOA 1XQXA 4OCZA 3D3NA 3L1JA 3VJLA 1R88A 2BGRA 2BKLA 4BCBA 4CCYB 1SCIA 5EIAA 3E0XA 2D5LA 3H0CA 3NWOA 1ZGBA 1UWCA 1CUHA 1QIKA 2RI6A 3PUHA 1MT3A 4O08A 2WSLA 2XUPA 5K3DA 1BCRA 1UK7A 1UKBA 4FDMA 2WQZA 3IB3A 4FFWA 1EK1A 5HK9A 4BDTA 4P92A 1UKAA 4BE4A 4MWTA 3VVMA 3MGAA 1U65A 1UZAA 4J0GA 4EY4A 5IVHA 4L72A 1FFEA 2XUAA 5AJHA 1IUNA 5I8PA 3ZLTA 5AI5A 4Q34A 3WWEA 1BN7A 2CB9A 1P0PA 5A62A 3R3UA 1XZFA 3IDAA 3FBWA 5AO9A 1QIMA 1U2EA 1QIFA 3STUA 5CH3A 4N5HX 2DQZA 3M83A 1KEZA 1R4ZA 4L9AA 1CUFA 2J3DA 3I2JA 4GHWA 4UBNA 4B6GA 1CUDA 5KWIA 3WKAA 4RNCA 3DKRA 2QRUA 5FLKA 3DL7A 2JGKA 5A2GA 1EVEA 2VT7A 2QOEA 2PSEA 4QDUA 4QE3A 5HKAA 2FJ0A 5HFAA 3LIIA 1JJIA 5E4TA 1VKHA 5ALSA 3QPAA 4PQEA 2RHTA 1LZKA 3PFCA 3F97A 4FNMA 4DMKA 1L7RA 1SC9A 2O2HA 4C01A 5ALKA 4WFIA 1J1IA 2QXTA 4EY6A 3HEAA 1XQWA 2WJ6A 2BGNA 4MEAA 5AI4A 3PI6A 5IH7A 1TCBA 3C43A 5DTIA 3FNBA 3I6YA 4BDSA 3ZLVA 1EI9A 3GROA 2WUGA 4H77A 2WG0A 4E14A 5AM2A 5DYWA 5KWJA 4GW3A 5AKIA 5CT5A 3A2NA 2ROQA 4UBLA 1LBTA 4QDZA 4ZGBA 4E11A 5JD6A 4EHBA 2GBCA 4NVRA 5AK5A 5FP0A 3G0GA 5FXMA 3WQHA 4K6KA 1CUVA 3GBSA 2ZJ7A 3BF8A 5LKRA 4KYVA 2BAGA 3EQ8A 3S2ZA 1CFJA 5IVKA 4Q05A 1TK3A 1VA4A 2K2QB 3RK4A 4PSUA 1TAHA 4PSCA 3HYSA 1EB9A 2OAEA 3G0DA 5C8XA 2BJHA 3M3DA 3OURA 5FDFA 3ZWQA 4X91A 5AM4A 1W76A 1SFRA 1VE6A 3I2KA 3AZOA 3CCCA 5D3KA 4M0MA 4UHBA 1JFRA 1XQVA 5AHXA 3AIMA 4FOLA 2OAGA 4J0DA 2WTMA 4A23A 3WZMA 4BYMA 3D2BA 5ISMA 5DNUA 2XI4A 4CG2A 4Q3OA 2DHEA 3MUOA 5CW2A 3PF9A 1CUYA 3AZQA 2AJCA 2PM8A 4BZWA 2EDAA 4Y2XA 2HA4A 4WY5A 1K63A 4N8SA 2JGEA 4EB0A 4AN0A 1N1MA 2AJ8A 2LIPA 2ACEA 1ETHA 2XUGA 1LGYA 2RIPA 5A7GA 1IMJA 2X5XA 2FUKA 3K6KA 1EK2A 5CMLA 3I6ZA 2NW6A 1N8SA 1UT6A 4MJ3A 3AILA 4Q3KA 4WDRA 2UZ0A 1CUJA 5D3ZA 1N5MA 1CUCA 3STVA 2Q0XA 3KD2A 2CMFA 1ODCA 3U1TA 5JASA 2O7RA 4XJVA 4EY8A 3DD5A 5C7YA 4OB8A 4ZREA 3D0KA 4TVKA 1LPNA 2B61A 3IULA 2Z3ZA 5CXXA 1QOZA 2VJDA 5JD5A 4B80A 1EX9A 4L3WA 1PJAA 1QFMA 3DQZA 3BDVA 4BZZA 2PU7A 3CN9A 4IHAA 1XZGA 4OPMA 4Y2QA 1LNSA 1DU4A 2O2IA 3O4HA 1XKLA 4Y2TA 5LZ7A 2QM0A 5AKGA 3TEJA 4LKOA 4AZ3A 3ESCA 2WIDA 3G9TA 1WCYA 2VQ6A 1RWQA 1XKTA 3VVLA 2DFPA 4UFPA 3C6BA 1JMKC 2YASA 3SWWA 5E2IA 3NOXA 2XT0A 4H7IA 3VDXA 3HLKA 5AH0A 4OU5A 1UFOA 3BIXA 2RAUA 3VJKA 4PF1A 4FWBA 1JKMA 2WG2A 4QDXA 2G63A 3PUIA 2QS9A 2B20A 2CKMA 1Q0ZA 3E3AA 5LZ5A 4ETWA 4HXFB 2ZJFA 1EINA 2HHAA 4KAFA 3G9ZA 1GPNA 4ZV9A 4KE8A 1G66A 3ZLUA 3HABA 2VTVA 2JGIA 2JEYA 4ARBA 1CR6A 1LPOA 4DNFA 2XMRA 5C8ZA 5CT8A 4J03A 3RLIA 1XRLA 4GEGA 4KE9A 3WK6A 1CUEA 1VXRA 3H1BA 2VJAA 3QMVA 3G0IA 3WLAA 4J3JA 3D4LA 3D2CA 3STYA 4B0OA 4M0FA 3DS8A 3QVMA 3WYDA 2OG1A 2GBIA 2DCMA 4LXHA 5KREA 4OD0A 3ANSA 1XLVA 4IH9A 2XQFA 3CN7A 5JAUA 2JIDA 5AI8A 1XZLA 4BRZA 1Y7HA 4B82A 3A6ZA 4B81A 3WL7A 3F98A 4RE5A 3IVMA 3SK0A 2OQVA 1H2ZA 1E5TA 4IO0A 4GI1A 2JEZA 5FUMA 3CXUA 2ZVDA 4U2FA 4U2EA 5LZ9A 4U2BA 3VJMA 4FMPA 5CT9A 1TRHA 1VOTA 2XUJA 3O9MA 3H1AA 1CV2A 3H19A 1U4NA 2OCGA 1JMYA 5YASA 1VE7A 1GGVA 2HADA 3WK8A 3QPCA 3JW8A 4C4ZA 2XMCA 3B5EA 3RARA 1XRQA 1ZI8A 4X92A 4FLFA 3NUZA 1WM1A 3O95A 1QJ4A 2WU3A 5ALPA 5DNVA 1HBJA 1YCDA 3WMRA 2VAVA 5ALGA 2W6CX 1AKNA 1AQLA 4W1PA 4D9JA 2AXEA 4DNQA 1CUWA 3BWXA 3CCBA 4UHEA 3OPMA 2Y6UA 5AK4A 1ZD5A 1H2WA 1L7AA 5HF9A 4FLEA 4G5XA 2OCIA 5CTAA 5FKJA 4KRXA 5CH8A 3KWJA 1A7UA 1BS9A 4W1RA 3G7NA 2JGLA 3WIBA 2V9ZA 3L1IA
chains in the Genus database with same CATH superfamily
1NXQA 1DINA 4BN0A 2DLCX 3KVVA 2A9RA 4YI5A 4D2IA 3ZY3A 3NDIA 4LBWA 1XQYA 3DZIA 4JBNA 1KI6B 4Y2VA 5JDCC 4K87A 4I3HA 5MFPA 4Q7MB 5IM5A 1C29B 5LWHA 3GEDA 3FZQA 4DCJA 4EW6A 2FUG6 3GO4A 1GGHA 1T0HB 5FBLB 5BSRA 3GG2A 3AONB 3AINA 1TC1A 4I1RA 4QYMA 4AURA 1J24A 2VP9A 5CX1A 3I9MA 5ETJA 3FF4A 3CH5A 4ERXA 2PUCA 3DTVB 4I4IA 1E9RA 1B15A 2VLBA 2XADA 1MFPA 3GGGA 3K09A 1ELOA 5DSTA 2IV2X 1K08A 2FFJA 1XD2B 3GEGA 3WIVA 1GPLA 4M99A 1P3Y1 4PEVA 4GPTA 1LLFA 4X62B 1PX0A 1NC3A 2IYPA 3MJRA 1DFHA 4IIVA 4BMNA 1K5DA 3FUWA 3SG0A 2WI8A 2WTNA 3N75A 3PUKA 4HB2A 3A70A 1VYHA 4YO7A 5HIIA 1KFEB 3WFJA 3WDLA 2EX4A 3VZSA 3F78A 3DAOA 3CKMA 3R5HA 1IYZA 4YHBA 2AF4C 1SVNA 4W8GA 4JOCA 3ND7A 3G8DA 2XYQA 2XCTB 1LRKA 1MKYA 2SICE 5H83A 3P0FA 3EIHA 1ENZA 3GG9A 5CB6A 2BP7A 4KIJA 4WACA 3HCCA 3QVUA 1RM5A 2XE4A 2DSTA 2ZXEA 2C3UA 3H8WA 1VMEA 2R1VA 3KFXA 4RKFA 4TPKA 4GOXA 4WFKA 3INYA 3RC7A 3IBTA 2PVSA 2Y4NA 3COWA 1X77A 3OCVA 4JL8A 3E9RA 4P08A 2O1SA 3S1LA 3LK7A 2BFFA 2ZE8A 3SSOA 1XUOA 2FWRA 3FMVA 4YCLA 1BE8A 3ILXA 2IV7A 4FLMA 4RJLA 1PF7E 2XCLA 3FLMA 4MLCA 2OV8A 2ZYGA 4TRJA 4E5YA 4F6LA 3H65A 3MVEA 4M1ZA 3K70C 2BLNA 4REQA 1XRRA 2C7VA 1Z26A 4ROSA 1XJ0A 1NR1A 2VJOA 3QEOA 4FBMA 4YJGB 5BW6B 2WM2A 1TEVA 3DMNA 1PJ2A 1HPLA 1LI4A 3EZ9A 1RC8A 4H4EA 5LQNA 5T5QA 4Q6BA 3URKA 4BV9A 4YJHA 1JZTA 3RI3A 4UHCA 2B4RO 3CJQA 2A86A 4ZGWA 2YJ5A 2YFYA 1H2FA 3ASYA 3E9ZA 2ZYRA 2WJGA 5HKOA 1QTQA 3PVCA 1EE2A 4ZALA 5LBIA 1BG6A 1H1LA 4BB9A 3COJA 4BMVA 3PLRA 3H7IA 3RROA 1A5BB 3SOPA 4E4TA 1JFFA 4F3YA 5IM4F 2WIGA 4DA4A 1BHQ1 3REQA 2M1XA 4ZYUA 2EC5A 2PN1A 1MX1A 1RLMA 1X19A 3PDIA 5F7JA 4BMYA 3T0GA 1IU9A 3KT0A 2WBLC 5I5EA 4NAUA 2QQFA 4QQKA 4A15A 2XNCA 1P0IA 2FZKA 4YREA 3QIVA 2VDNB 4NJEA 4EL5A 5HKKA 2A1IA 1WSAA 4Z0TA 1CLUA 1HG1A 1EP2B 3VO1A 4C0SA 4FCWA 3KPWA 2XMSA 2OP0A 3OP4A 3R6DA 3IKTA 2BFCA 2XPCA 3DZHA 5DK4A 3CYFA 1TF5A 2GCIA 5C31A 4OB7A 3JZFA 1LS6A 3H83A 2BSAA 3UXEA 4EY7A 3I01A 5EERA 4RTNA 3IERA 2D7DA 3REGA 3U3ZA 3FTPA 3NFYA 3NETA 3OQHA 1QO9A 1IB6A 3KJXA 4TMWA 2W90A 3U9LA 1DTWB 2X0NA 4HEHA 3GI1A 4ZCIA 1EFUA 4OXXA 1SHZA 1OGJA 3A9RA 3MXOA 4Z86A 4G67A 2E9SA 4TUYA 2YXBA 4AECA 5A3RA 1OASA 3F1LA 3LUAA 3J80A 1Z4OA 2EWMA 4J0JA 1KNQA 2ZDQA 3VKFA 5HGXA 1NJ5A 4PZLA 2WSMA 2XKKA 1FRQA 2RBEA 1MABA 2MSWA 4CFSA 1H6CA 1XA4A 1QYDA 3AZPA 3OX3A 5IM4A 1PJZA 1SXPA 4HBZA 3D3QA 5EWJA 4P4GA 3RT1A 3H3JA 1E79A 4QICA 4B75A 5EXSA 1NVVQ 3G5LA 3STXA 1ZEMA 1NF8A 4FJ0A 2AMVA 3H2JA 5E4JA 1OKKA 5DCWA 2VTBA 2NO5A 4EVIA 1RMTA 2BGUA 2VJCA 3FSGA 4V2IA 3SSMA 3GAFA 1QS0B 5JS1A 3UWMA 2NVUA 3L4BC 4UOZA 3M82A 4EAAA 4QU8A 1TUBB 3CLRC 5H70A 5CA1F 4OK3A 2GBGA 1FQWA 2P9BA 3ETCA 4CF3A 1FP1D 2AR9A 3R3SA 4EATA 1W36B 3G1UA 1G20B 1ADBA 1HNNA 2NLOA 2YWFA 5CM2Z 1WQ3A 5E1BA 4NZ9A 3KYBA 3QLTA 1GV0A 4N65A 4X45A 2FPSA 5ED4A 1F4PA 3DBIA 3TOXA 2IDZA 4C6TB 3ZCTA 5KBYA 3EVAA 2MMCA 2Z5VA 4DIKA 5K0FA 1XEXA 4BX3A 5BUZA 3F8SA 2DPGA 2B0CA 1ICEA 3QPDA 3WO0A 3ZKWA 1AKUA 2PTGA 1DAMA 3DV2A 4QNMA 5JPCA 3AR9A 4BO4A 1G4HA 2YFHA 4WLVA 3WQRA 2XF8A 2YWXA 4L07A 3SYRA 4OI1A 1MOZA 1I8TA 2QJRA 1Q95A 4Q4AA 5I7WA 1V43A 3T7EA 3TD2A 4YJFB 1XCOA 5HZKA 2NPOA 2ZE6A 4EPWA 5KQPA 1PS8A 2DJIA 4OH1A 4DNXA 1OH7A 5JS8A 4IJKA 5AR1A 5C18A 4QEDA 2H9YA 2I3GA 3VQTA 5KYGA 4LECA 1GILA 2DR2A 1HA3A 2O8CA 4JT8A 3EZGA 2WM8A 2CXNA 4OK6A 2G9VA 2NU8A 2ZTMA 1RAEA 1KBZA 2FG7C 1CFZA 5CA0A 2FGKA 3CLTD 4LE1A 5T8KC 4BOYA 3SM9A 3ZDFA 1U3DA 1NIPA 4RM3A 1B41A 1JB1A 2J41A 2TRSB 3ZW7A 1DG3A 5A5GA 4FGLA 5E4FA 1Z37A 1TCAA 2EFDB 2W6ID 3GPIA 3RUHA 1KDTA 2CYAA 1DIRA 3H1FA 5AVQA 2ZROA 3VH3A 2VP2A 2I3DA 4KO4S 1NM5A 1Q0PA 4RADA 3L0SA 3RG2A 5J47A 1FFAA 2NV6A 3BX1A 5LMNB 1I7SB 1A7KA 3N3BC 4Y1FA 4K46A 3LCRA 2Y71A 4X61A 1GFZA 5G4LA 4FKZA 1YRLA 4N5MA 1JS1X 1E9VA 5HVNA 1Z83A 2GN0A 3ZWWA 1MP0A 1XDDA 1XALA 1T1RA 1LNQA 2OHIA 2OV1A 3AIOA 3CIFA 1NZFA 2PKQP 2R1TB 3DL2A 5AJVB 2XB8A 4A27A 1PGQA 4OUDA 2I9KA 4B4VA 4AROA 1BCRB 1O1YA 3GUVA 4LJLA 1AQNA 1F3OA 1WOMA 1I3LA 2K4MA 2CMDA 1Z08A 3H8VA 2FLVA 3L92A 3TTYA 2LW7A 4AXXA 3V3TA 5CVVA 3I1JA 3QITA 4UJ5A 1NI4A 1COWD 1U8CB 3KSRA 3KP1A 5ALEA 1X9HA 3NUGA 1Z6XA 3UENA 2G0TA 2A9QA 3GGOA 4BFZA 1HQKA 2Z08A 1Z6AA 2YHAA 4S35A 5H82A 4WEOA 3DP9A 3TXXA 1U6IA 2ETXA 4D80A 4NOJA 2OM6A 1YQTA 3ED5A 5LQJA 2GPAA 2IYOA 2AZ4A 1EMDA 1OWLA 3H2KA 4X8OA 1FFDA 3N7AA 2JI4A 1AZWA 4N9QA 3Q12A 2PX6A 1JR6A 1E3EA 2ZM5A 1UINA 5K3BA 5JDIC 5J1SB 3R5FA 5DBHX 4CI9A 2HTFA 1WIWA 2JLRA 3ZUGA 4EDHA 4EB6B 2CXPA 1GG9A 3EA4A 4JP5A 5HKKD 4ZRNA 1NLMA 3PUZA 4YPFA 1VHQA 1Y9AA 2GCOB 3ETJA 4OHUA 3UAGA 4WX2B 4KQMA 3IQXA 3Q3GE 5HS6A 5HJEA 3R9XB 2B1QA 2O5VA 2GN2A 4KQEA 4YVFA 2FK7A 4FSHA 4CM8B 2VPTA 4UCXA 3IT0A 1WB5A 3A2LA 3VXKA 4JMPA 3D0QA 5BYKA 1E7RA 4MXDA 4X3CA 5IAJA 3PICA 1OVGA 2QTLA 1R6UA 3AL2A 3BTOA 4BNKA 4EQ6B 4PYJA 1MU0A 3HCBA 1CE8A 3EPKA 4DUYB 1HDYA 2QZ4A 2TECE 3FHOA 3C1TA 4FSXA 4X1KB 4EI8A 5IVPA 3H17A 4GSYA 3D6FA 3GNQA 4WCFB 4M89A 4P53A 1JT9A 2AFRA 4J4HA 3SBEA 4DABA 1ULAA 2I7VA 3FZYA 4ER5A 1SB8A 1ODIA 3C39A 1U02A 1FNNA 5CH5A 3F6EX 3AHDA 5GJWC 3GCDA 4I1IA 1H2YA 3AP3A 1GEGA 1U8UA 4ZFNA 5DWVA 2VYCA 3RFFA 3HFRA 1KYIA 1N2CB 2XNDA 4QODA 4FCVA 4DYHA 4RPLA 4WT7A 3DBHA 3BZWA 1QV7A 1V47A 3KTAA 4HD8A 2HV9A 1L1EA 5H02A 5BRNA 3ZBTA 3FRHA 4QBIA 5F5LA 5F64A 4X7BA 5L3ZA 3H9BA 4C0LA 1BVUA 1UMKA 3OT1B 5EIXA 2HBQA 2HBRA 3EEBA 1YB5A 1BXRA 1KJIA 3NIFB 1KSFX 4G41A 4P33A 4QBGB 1QCDA 1QQTA 1T24A 3QY0A 3RVOA 2PKCA 3PPXA 5E7QA 5LYJA 2MSNA 1REQA 3L0YA 4G26A 3SJUA 1SUDA 5DBIA 4CM4B 3PT9A 1OW3B 3SDBA 1QIDA 2WHPA 2WT8A 2FDXA 2Y05A 1LBQA 1XZPA 2FYTA 5DM2A 3QHQA 4QHSA 2DE0X 3HA5A 4ZTUB 2IE8A 3QKRB 1W4RA 5H8WA 1PEKE 2NV0A 2P5UA 1F0NA 1N5IA 3GFFA 3N58A 4G4JA 3R8XA 4BO6A 4CMHA 2Y0PA 4PE5B 3TDKA 2FSUA 2N47A 1OX5A 5DI9A 4BGUA 3AHIA 3BILA 1ZUHA 4H7JA 4Y9UA 3TSAA 1NG1A 1XEWX 4F91B 1PQ4A 2C5GA 2XXBA 2G25A 4N5DA 4UHJA 2JGJA 2CFCA 2J5RA 5ARCA 2V7UA 3JD0A 3AIKA 3OG9A 3AUXA 1TD1A 1TL7C 4MR7B 1GR0A 4HUJA 1RZRA 1FFCA 4C89A 2HW8A 2GRAA 2AOXA 3CX8A 2YXLA 5I8ZA 1WMEA 3JATB 2WUWE 2HA5A 1TX4B 3U7FB 1Z5UA 3C3YA 1P1RA 2Y1WA 3PB3A 5CGQB 1U3CA 2VPPA 2PZJA 3G17A 2QWXA 2BTQB 1O8CA 2JFFA 3NCTA 4MQUA 1JA9A 2DWCA 1UL1X 2FG6C 4UKDA 3SIWA 1ZOLA 1XAGA 3VYRB 4GPBA 4AY2A 4ZI5A 2XVYA 2X0EA 2RC6A 3M5CA 5I6DA 2G4CA 2DFDA 2GVZC 3TMYA 1X80A 1DT5A 1ZNZA 2AGVA 3PC8C 4RKEA 1Z6ZA 2RHDA 1N78A 3DVAA 1LCIA 2A9KA 1BCSA 2WHRA 1PQYA 1FDTA 3HNPA 2AVNA 2CK3D 1Z6QA 3E70C 4H1HA 4RTKA 1PL8A 4RLSA 1QP8A 2HHLA 1CUGA 3EX7C 1DC4A 2JGFA 1JA1A 4AWAA 2ZIXB 1JDTA 3K8QA 4QU9A 5L3RA 2VF8A 4FX5A 4CG1A 3A3YA 1FMLA 2FQWA 3WA7A 1Z7YA 2EERA 3D5QA 4BTVA 5BNFA 4I5DA 5JVDA 2GETA 7YASA 1KNXA 3I4CA 3B60A 5DI3A 3B7GA 1UM9B 3ROQA 1YTUA 3GLQA 4BB6A 3S8MA 3MGKA 5BNIA 3VAYA 4MGKR 4EKDA 5JZBA 2FA9A 4E5KA 1U90A 1JEDA 2P7HA 1IEXA 2YY7A 1SGWA 3DFIA 3FX2A 4PM4A 2J5KA 1UAAA 4CI0B 3BGSA 5B2ZA 4LVNA 3H86A 4HHEA 5D6OA 1SG6A 3CH4B 2XDAA 4JBXA 2QT0A 1UJ5A 2MOKA 3F8TA 3K0CA 2ES4A 1BGVA 1ZA1A 4ZRMA 4AWBA 4DY4A 1TJNA 5KTYA 1C3EA 1LSUA 5LP6A 5ULLA 5B6IA 2R4TA 1WZUA 3OQMA 5EPUA 1QSGA 2OORA 5EXTA 1FDVA 2G1JA 4O2AF 2H52A 1PV2A 4G81A 3JQAA 4IYRA 5DCUA 2MTBA 2JAXA 3C3BA 2IHKA 3N8KA 2F00A 3SZUA 2A59A 4OHMA 3QXGA 3WMEA 5HIAA 3FM9A 4HNSA 4R84A 3U4GA 1MHTA 4KR3A 3FYTA 1XDSA 2G70A 1MW9X 3ZS9A 1RC0A 1J9EA 2QTRA 4LNAA 4F71A 2C94A 1ODKA 1SB9A 2IKQA 4WJZA 2ZSKA 5DH9A 3GGJA 3ZV4A 1FCJA 3E1KA 4H0FA 4IP0A 1D0SA 5IDXA 2FMTA 3UMJA 1BD4A 4ATNA 3ISJA 4INZA 3UKDA 5C5DA 2GXSA 4CLRA 4BYGA 2VXYA 5KNDD 4J9VA 1IH8A 3OZVA 2FWAA 4HLUC 1SCKA 1N9GA 3MINA 1MJ5A 2WFMA 2H1RA 1PGJA 1DCMA 1UUFA 4LXQA 1FDRA 3V9PA 1K98A 2OZPA 3MLBA 5LQKA 2HWUA 5J2UB 1CIPA 1L4HA 2PS9A 3PC2A 1IUOA 5ECGC 1WHSA 4Z5XA 4QPCA 3PK0A 1VE3A 1N5LA 1XMIA 5JCXA 1KI1A 3F9CA 3EODA 4B4OA 2XEXA 1UPTA 2B9VA 3GJSA 1Y80A 4BVKA 3CRZA 4RW0A 3AVVA 3D43A 2JGMA 2WTEA 1DARA 3KZ1E 3QMWA 3ZY5A 1CR4A 4LC1A 3RIMA 2CBGA 2UVPB 1P74A 1UMBB 4S3MA 1FP4B 4EG7A 3K72B 1F7VA 2VF2A 4O0MA 4OHOA 2RHGB 4KODA 4XB1A 3UGJA 2F1RA 1AO0A 5A9SB 1G2PA 2OXRA 5EMLA 2BM8A 4QVKA 3ROMA 4ZAYA 3ZLJA 1L8AA 1PO7A 2A84A 1PWZA 2ZE7A 1Y3HA 3CF6R 3FMOB 1OTXA 4JLNA 2PNJA 3SICE 2WK1A 1EWTA 3QVLA 4HFNA 2NVBA 4D57A 3UAWA 2QTWB 1ULUA 5FWDA 1DCKA 3ZDBA 1W4AA 1C0IA 2QSZA 2PD4A 3QM1A 4LHWA 4RXMA 3V8VA 3GLFA 4NOKA 4LN1A 5F9HA 1NPTO 1O95D 1QF7A 3A9UA 3DFMA 3NXSA 4GQIA 4YMVA 5JH7A 1PBTA 2GX6A 2WE8A 3LGAA 1AS0A 3NYIA 5C5CA 5BMVF 4DV5B 3IIKA 2HRDA 3FTFA 1TNDA 1SUAA 2N75A 2VHYA 4FBLA 2IYAA 4N5LA 5JCZA 4NMWA 3H1PA 2HL6A 2AFIA 3SEFA 4G1EB 3I28A 1BQEA 3ZBQA 5BRJA 4F4JA 1P0FA 3ZWPA 4D82A 1O5IA 1U1IA 4PG6A 4D81A 1Z2OX 3AL0C 2Z1NA 3DLBA 4RD2A 1Q83A 2E49A 2ONCA 4YR7A 3TG2A 1U1DA 4LZJA 2FEWB 2EL9A 3GQBB 4L51A 4YROA 1KO5A 3VDNB 4X5OA 3RF7A 1XFAA 2G4VA 2R8ZA 1P2GA 1S7CA 5B1EA 5KQRA 3HKCB 4DM3A 4G1CA 5G4KB 2OCYC 4ABTA 2DRIA 4R7ZA 4HATA 3KC2A 3QOFA 3MB5A 1Q1AA 4XWYA 2Z5LA 4GLBA 1YU9A 4BNZA 1J2YA 4BGDA 2JKZA 1OBCA 2H1SA 1ZN2A 3KQQA 1R0SA 1MJHA 3PR1A 3ZWCA 3P5BA 3DKKA 3PNMA 4QD3A 1KVQA 4C2UA 3RG8A 1SXJC 1NW4A 2J3KA 1O6GA 5BYJA 1AX9A 4JHXA 4ZKEA 3D7MA 1A3CA 3D4PA 2X8WA 1YB1A 3JD4A 3T5GA 2KHZA 3FTDA 4O5AA 4BMDA 1ZVVA 2I7TA 1A9XB 2RHRA 3TR0A 1WX1A 1GG2A 3T9FA 1V5GA 4ZQHA 2O8EB 1FTNA 1GFWA 3PGKA 4UEWA 3G59A 1GZSA 3BBLA 1NLYA 5LQRA 3U4QA 3AQ4A 4DTIA 3ER6A 3OJEA 4EA7A 4URVR 1QV6A 2B1JA 1XRPA 2MSEB 3QPWA 4RENA 2DX7A 4DANA 5EN4A 3O38A 5KOJA 1ZR4A 3GAAA 4V0KA 3RPEA 4GDMA 4I8DA 4X6UA 1W2WB 4UDXX 1CETA 1J8MF 2GXQA 1OAOA 2W7TA 3HSSA 2QQ0A 3DZFA 3PI7A 4B44A 1M0EA 5F33A 2CJWA 1ZAYA 1JU9A 5DMHA 4O4HA 5ICGA 1A8SA 2W2LA 4N40A 2AUTA 3I9V6 2R84A 4PN3A 1A69A 1YV9A 2MDTA 2OFOA 4G1FA 3EZNA 4KFUA 1E2PA 3NIBA 2FMUA 2XCOA 3CUEF 3NM6B 4MQFB 4RA6B 1IB0A 3I2YX 1NN5A 2E85A 4LXGA 3LUGA 4EI7A 5FH9A 4BS9A 2AN5A 4F9FA 1U8TA 1I30A 3EG5A 2NVOA 4IIBA 3S81A 1VXOA 1BFKA 1EZZA 3EJWA 3EIOA 3RUCA 1ULSA 3SEQA 2VS1A 2C20A 4UAJA 3RC1A 5J4KA 1J0CA 3FPGA 1EHIA 4YMSA 2BFPA 2VOJA 1ADYA 1J7JA 3GFBA 2ZU6A 1CJMA 3FDXA 4B3DA 2HYIC 1DWQA 2L19A 2ODQA 4DV3B 3LUCA 1T36B 5FL3A 3W5VA 3BXOA 3O9VA 4OKSA 3MGBA 1FMTA 2WJJA 2VJBA 3D0RA 4TKUB 1JFSA 1YZUA 5FBQB 1KJNA 3A1DA 5F12A 4B6FA 1S4MA 5K6AA 3LFTA 2BFNA 4XDGA 3E7DA 4G5HA 4I3GA 5DHPA 4NR0A 4OAPA 4G0YA 4JBGA 3ZXSA 3QV2A 4E1BA 4KO3S 5EZYA 1DKNA 2Q1SA 3N2YA 1NWHA 3SJBA 4UCQA 1JRLA 2YRWA 4NPCA 5JCOC 4PW0A 1CEQA 5BN5A 3EQ9A 1PJLA 2AC7A 1T8UA 1IN5A 1Z18A 4R01A 3BTSA 1TEZA 3CISA 4GM0A 2TYSB 3ZOZA 4MA5A 1Y7LA 1UDCA 2E55A 3ZK7A 1F1BA 4UPEA 4OREX 2XMDA 4AKEA 4D9GA 4E21A 4MWSA 1U0NA 4XQ0A 3K0EA 3OPXA 3KKLA 2YHBA 5I7VA 4P3PA 3EISA 3VR2D 1CZNA 1JJFA 3HRHA 4L3OA 4P4LA 4J0FA 3M6VA 1RYYA 3P0EA 2BWJA 2CUNA 2EBUA 3NC0C 3PDHA 4XUGB 1T26A 2IEZA 5K0TA 5LNK1 2P3SA 3VNRA 3O4JA 1GA6A 2Q5HA 2XUIA 1D0IA 3HXKA 1XRNA 1ISGA 3NHKA 1Z2NX 1XZEA 4YMIA 3VO9A 4DA9A 4QBFA 4EJ2A 1JSXA 1K7SN 1M73E 4XI9A 3U16A 2BH2A 1XT6A 2RHWA 3CC8A 2OHFA 3CRMA 5L40A 2QAGA 3MWEA 4FFBA 5IKMA 2WV9A 2ZWMA 5U9CA 4N9WA 2JC3A 1BWQA 1SAYA 3AY3A 3ZU2A 4C7MA 2Y2VA 4J0EA 4GLFA 4AZ0A 3QWBA 1XTVA 2GH1A 1LPSA 2CXSA 2A0YA 3RIYA 3GFQA 1DBVO 1J7KA 2VJMA 3LBAA 5C51B 2O06A 3QKTA 2HJRA 3LQ4A 2DFKB 3W4KA 4A5SA 3BOSA 1DKRA 5F3WB 1YZYA 4L76A 4CDRA 2FMXA 3ENZA 2FPGA 4K6MA 4NX2A 1H0RA 3K1YA 4Z9AA 1VLVA 1P9NA 1XROA 2PRSA 2OMEA 2Q1YA 2WKRA 4L6CA 3F7NA 3HEBA 1OA0A 5IZCA 4F5WA 4E5MA 1H42A 3G8BA 4IFEA 1JQKA 1WG8A 2QD3A 3CLKA 3H3FA 5JEEA 1GRNA 4ASUA 3Q8WA 4IX1A 2JHGA 1JDNA 2YHSA 2I3ZA 3S2IA 4D46A 2O2GA 2QTCA 2XITA 1UZNA 5A4FS 1DADA 4JEMA 3KJFA 3NHAA 3OX1A 2A3RA 1C3XA 1PYDA 1SUEA 2BI7A 1UKCA 1LX6A 4LK3A 3OFSA 1AGNA 1JHRA 4RS3A 1KU0A 3VC7A 2VT2A 1KO7A 2MIIA 3HUTA 1GUYA 1RJGA 1RMYA 1ZOOA 2UZ4A 1M8JA 3TLCA 4LXIA 2X2PA 4BNDB 4CQLA 2CLSA 5JJKA 1SRRA 3IS3A 4II7A 4C4XA 1LJUA 2VYQA 3B12A 1O8BA 4HK4A 3C7CB 2Y76A 4RY2A 3FHLA 2WOOA 5ICMA 1K0FA 4J16A 3UG6A 2H2FA 2R6ZA 2JARA 1K97A 1E89A 1SVWA 4C6HA 3UK2A 4KE7A 3ZWMA 1Y6QA 4B9EA 1MOSA 1TZKA 1SHLA 4C0HA 1SVIA 1GDTA 1HUQA 3E3MA 5FTMA 1X0VA 2FPIA 5HJ5A 5IWCA 3WJ7A 5LLSA 1P2TA 3IDFA 1Q2XA 3WLKX 1UQTA 1IONA 2GCNA 4LCJA 2R9VA 4MUIA 3L0IB 4H31A 1NMEA 3LUHA 4YCAA 1TTPB 4LMPA 1YXMA 3IR6A 4AM8A 4C3UA 3ITDA 1PCXA 3PXUA 4G5QA 3WQQA 4BNIA 2QNRA 3O4VA 3RF6A 2Q1TA 3T4PA 2WLSA 3TJMA 1ZMTA 1B8VA 2VHWA 2HI0A 4IILA 4MDHA 5ALJA 3ROGA 1UOQA 5I48A 1L7OA 5I4IA 3FR7A 3ND9A 4DEXA 1W29A 2YMLA 3OZWA 1HOTA 4FJ2A 1NMZA 3LP6A 3EQ7A 4YEDA 3PTAA 1OH8A 2Z8YM 5DIZA 1YCGA 1NG9A 4IF4A 3X43A 3ZHRA 4GI5A 4WESB 1N7JA 1O4VA 3FVTA 4QTZA 3WTBA 1MQAA 3TQTA 3JQRA 4YV1A 1WJGA 3ZCXA 3H99A 1L7DA 1MB9A 2IS4A 3A3OA 4PLZA 1HNWB 2E87A 1VSTA 2QUBA 5E6RB 1KVRA 5SYMA 1A9RA 4G63A 1EZ1A 4U4AA 2I4OA 3V8BA 4FB4A 1I6WA 3GLHB 4NBSA 2QRLA 2IYNA 5EHNA 4MS1A 5CJPA 3U7RA 4LMAA 3ISVA 4M4SA 2QVGA 4LXYA 4JJKA 4FYPA 3FPLA 1U31A 5M34A 3PTLA 3KV3O 1NXXA 3DZ8A 3P71T 4UDNA 1CUIA 4EMUA 1QNFA 3EVEA 1G7SA 2CV2A 2PSDA 1ORTA 4XX0A 3LP5A 3GDHA 2QN1A 3P5SA 4BATA 3W2EA 1CX9B 1W85A 2VNSA 2YZ7A 3W6PA 2ZUWA 3NBXX 4BC0A 4CEHB 3S5UA 4N7BA 1PG0A 5JSUA 3CUUA 2QTZA 1DLJA 4Q7JB 1SU8A 2H65A 2FW1A 1BWRA 2HZBA 3FD8A 4IKEA 3MC1A 2AOVA 4MJ7A 4KSYA 4WWHA 2XYVA 3OE4A 3V32A 3WDMA 4F6CA 1ZGJA 3K32A 4CYMA 1B2RA 3NBUA 1ZD2P 4HYTA 3JVDA 1JHZA 1QFJA 1WMSA 3WK4A 5F3RA 4HRVA 4MQ6A 3K9HA 4LWQA 3M5WA 1QLHA 4J76A 3X2FA 1TDJA 1FE8A 3JS5A 2DHDA 2QPAA 4UVIA 4CIBA 1I3CA 2QI9C 3NBFA 4HAZA 5FTNA 1SA0B 1S8OA 3CRNA 3GL9A 2B6NA 4OQ4A 1PE0A 3OJFA 4F1JA 3M70A 4TTVA 2CUZA 1QR6A 4WLOA 5A03A 5A2QA 3QEAZ 2ZU0C 2ZRJA 2OQIA 4DIEA 4D8VA 3AETB 3KWFA 4RMIA 4Q7EA 2GPBA 1T8TA 2W8BB 5DM70 1XE3A 4UBKA 5AMXA 3QVGB 1J70A 3CTPA 1K6JA 4E1VA 2BEVB 1S3FA 1SZDA 3V4ZA 2IOHA 2QYSA 1GAWA 4EHDA 1UBSB 3X44A 4JLUA 2WD8A 3LM8A 3VPBA 2IYEA 3G2QA 1OROA 2JKVA 2EG9A 2J46A 3PJEA 5EP3A 3G68A 2VJQA 3VSDA 2MHCA 2Y2UA 1TYEB 1OYYA 3L7KA 4RJ2A 3ZCRA 1A2KC 3ICVA 5JNRA 2HX1A 5IJXA 1JVSA 1MD9A 4P2BA 3QWIA 4CKBA 1GNRA 3RS7A 2EKLA 5TMBA 4B85A 3ED1A 4YT4A 2RHCA 4QXQA 4L0QA 1OX6A 2PU5A 3W04A 4C0QC 1OH5A 2PRZA 3P2MA 3G79A 2WJHA 4Q7LA 4I1SA 3BMQA 2JAPA 3QVOA 1N5DA 4Q0MA 3V1MA 1ULHA 3FFTA 1YR3A 3QPBA 3IA2A 3UMFA 2WU8A 4DIFA 1C3OB 4YPOA 1G5FA 1L4FA 2YIVX 1EESA 2WIBA 1HOXA 1UK8A 2V5UA 2VBFA 3OEHA 5T7BA 3PEFA 1R6VA 4BB0A 4IGKA 3MTBA 1VFNA 2QVLA 3UUFA 4PAOA 3GJ5A 3S1SA 1BHJA 5ALLA 5AXAA 1XTZA 4F92B 4TTJA 4B43A 1FY2A 3PU6A 2ZRBA 2C2GA 1OD6A 3E9DA 3PGJA 1P6XA 3HU1A 3L5OA 3L7CA 4MV4A 5T3UA 2GD2A 1USVA 4TXLA 3FUTA 4Y6QA 1M1NB 2ZR0A 3C0KA 1O6ZA 1UZUA 2UYYA 2F55A 1R5BA 3OOSA 4Y2JA 4NEGA 2G5CA 1KQFA 3E7WA 2ZI4A 1J9ZA 2H4FA 3C7AA 4FNGA 3CZMA 1IY0A 1KP9A 2BJVA 2X8BA 3QBJA 2BKAA 1VHTA 3G2HA 4N7RA 5LA6B 4RORA 1KARA 2QVXX 3IVGA 3NGXA 2X6QA 3EF3A 1ODSA 3OJOA 2ZI6A 1TZCA 3SIPA 8ATCA 2A0KA 5FJJA 2JJQA 2O3JA 4N3CA 4DIUA 2J09A 4DMRA 3SQLA 1I4WA 2HK6A 4IV5A 1B8NA 2QRPA 3H4TA 4S2EA 3C1OA 3A7EA 5HK8A 3TLGB 1LW6E 1QH0A 4KRYA 1GZ5A 2ZSHA 3BJMA 1WDLA 1PEAA 5E7IA 2ZVPX 5IASA 3WY9A 2QMOA 4C7OB 1PD0A 2Q3FA 1XCPA 1BJTA 4IWYA 5FHRA 1Y3AA 4ARVA 3HI4A 4YX9A 3KFVA 5K09A 3G0CA 5KMGB 3VNUA 2CF5A 3RFXA 1MJGM 2VNIA 3G2LA 3KJEA 4IDEA 2UZ3A 3BRWA 3DPUA 3QKWA 1L5VA 4WV3A 1KO4A 2AZMA 2PWAA 1GRQA 2HM7A 3RVJA 3TOSA 1A7JA 2GI4A 1NBAA 5CAEA 3UMYA 1YDFA 2WIKA 4YRSA 1N2XA 4NWIA 3UMVA 1W6RA 2HEIA 5EI5A 1MT0A 3MT0A 2ADFA 1YL7A 3W2GA 2C03A 4P5EA 5LM3A 1E1RA 1XG5A 4RHEA 1TGVA 1E2JA 2HHJA 2O4UX 1JQAA 1SCNE 1N6NA 2V9PA 4WBSA 3LRPA 1NRJB 4GICA 1IDOA 1Y3IA 1QO7A 3KZKA 3UIEA 4EHAA 3R5SA 4BGIA 4II3A 2ERCA 5JYDA 3BSFA 3OOWA 1U8EA 4Z3KA 1P8AA 2AJBA 3HJUA 1XYVA 1LLDA 2AOUA 4M1EA 3N8GA 2FOIA 3FB4A 3QEMA 3W5AA 1LDMA 3HU5A 4PLVA 2NVWA 1JDBB 3DEZA 3RADC 1RAGA 1Z4IA 2IUSA 4JIMA 4EVQA 3QVJA 4UBOA 4S1VA 4WK0B 2G8NA 3PQ8A 2OB2A 4F9EA 5P8WA 2DERA 1IZZA 5DTJA 3JPWA 5GOZA 2XA9A 5K3SA 1YRHA 1DRJA 1ESMA 1WD5A 1ZBQA 2VNJA 1S9DA 2HA6A 4X8HA 3FUUA 3FYUA 1C9YA 4UUQA 2D74A 3OA2A 3ETEA 5JAQA 4YACA 4PCVA 2ZAGA 1NRIA 4XOUA 5KYTA 4HDRB 3KHUA 1QFSA 3W3AH 3DWFA 2B4AA 3HYNA 1NW3A 3BIWA 4MS4B 1TO1E 1TM2A 4LSMA 3WYAA 3GCWA 4RWZA 1AA9A 1TUEA 2HMTA 3FOFC 4K86A 1CUXA 3DA8A 5DT9A 1EFPB 4B45A 2C5BA 4XQCA 1ZAKA 2A7QA 2CXOA 3SR3A 4WVLA 5C5IA 3QJYA 3WVNA 1TA0A 3LLUA 3T5TA 5JR3A 2RKBA 4MHSA 2PEYA 5K3AA 1QWSA 4MS4A 2Z56A 5JQGF 1YBFA 3VX4A 5ELXA 1QQBA 1JI3A 1A5TA 2NXNA 4BGVA 4L9WA 5IMSA 1DAPA 2H51A 5TJHA 1CT9A 2JJ2A 2JHPA 3ESDA 1TM1E 3FYUB 2AS0A 1E7WA 2Y9MB 5E8JA 3SNKA 4BKRA 2D7JA 4G37A 4UBJA 5HE9A 3ZJUA 1R8JA 1VG9B 3MRSA 1KYWA 1YDGA 4FYYA 1PEYA 2HRBA 4KQCA 4QUAA 4R2WA 4DMFA 4B34A 4GBJA 1P33A 2XSZA 4XTCS 1GNLA 1GFIA 2GMWA 4UARA 5JBQA 1G18A 2HPVA 1INLA 1NUSA 1ZM9A 3GAZA 4JEHA 5JD4A 2Q3EA 3PEYA 1IWOA 1ZIXA 2FGJA 4IGIA 4G86A 5EGNA 4WH0A 5AW8A 5JZSA 1WB9A 2YR0A 3DT9A 2YQ5A 1H94A 3IXLA 5JJBA 3QE3A 5DHFA 1Z5NA 3OAAA 2C3MA 4CMJA 3PYMA 4ZN6A 4XGRA 1EK5A 1H3FA 5TQ2B 4ZI2A 3D02A 3PHGA 1XMQB 3RVSA 2UVQA 2PX0A 1X1TA 1XDBA 1PK7A 3COVA 3RVRA 1YDHA 5AKLA 4QGFA 4JYMA 3D3EA 3IQGX 4DV2B 1BC5A 4HLCA 4LZOA 1A9QA 3B6KA 3O4RA 4O4JB 2CMKA 4OFZA 1YUMA 1U9JA 3GUZA 3P9PA 5EG5A 1KJQA 5DN6A 4ARCA 2VP4A 1ECJA 1GL7A 3INGA 4BFCA 5G0TA 1M2KA 2OKCA 1MQ8B 2UYOA 1Z15A 4EG5A 3TLEA 3L9XA 1L0BA 4R0MA 4RLFA 3NH9A 3QYAA 4ROTA 1PZHA 1UJCA 2ATCA 3W9UA 5IJ0B 3W5BA 2H2GA 5FRDA 1K6XA 2VNHA 3FNQA 1T5IA 1D5WA 3COYA 1ODTC 3GFVA 4MGHA 4ZC8A 3GNSA 5AOCA 1WCWA 3GC6A 1AA6A 5DWDA 4DMCA 1YVUA 1A1VA 2PH5A 2I5PO 2D1RA 1W9MA 3AHFA 1QIJA 4BVJA 3DZKA 5BWMA 1HDEA 2VN8A 1AUOA 1MJGA 3LO5A 3MTDA 4HAYA 5KQGA 1K9VF 4YMLA 4NYIR 4UNPA 1T5DX 1GKYA 3GXOA 4D0NA 2XUOA 2LKDA 5IJZA 3JQ6A 3JQ7A 2IW1A 4ZYLA 1YJ8A 1Y82A 3RUIA 5B64A 1UPCA 3PR3A 2C4UA 4NFYA 2D5AA 5CGZA 1BDMA 4BBJA 4Z7NB 2DHRA 4AS2A 1AGXA 4EZBA 3GLIA 3AVOA 2AIRA 2GF2A 3FTCA 3ONVA 4AJNA 3FPKA 2KBEA 4KLNA 4L8WB 3JXEA 3HUFA 1M1NA 2FJUA 2V3VA 5EP2A 4HNAB 3RRXA 5BORA 2VH2A 1QANA 4I19A 1X8JA 4PNZA 1YO6A 3T06B 1OYWA 5I9SA 4YWHA 4P0TA 2FP3A 3KJGA 2W2PA 3B8EA 4M8SA 5I4BA 1APBA 3WK9A 4DPKA 3VV2A 1X2BA 4ZO7A 1ACLA 1HRKA 3ET5A 2UKDA 5I9NA 1CY6A 3FWNA 3OCXA 4Y9DA 5F1YA 1A4RA 1H8HD 1TJ3A 2WILA 2WW8A 4JXJA 4RFSB 5CLHA 3TLXA 1TF2A 3ZX5A 4HF7A 1CUBA 1SN7A 1WXXA 1WU8A 4KCGA 2HUPA 4EM6A 3PFBA 3C41J 4EUNA 1TT5A 3T3NA 4OGGA 4M1OA 3LXUX 4WKBA 3PD0A 2XUFA 4KNWA 4CKBB 1ZIDA 3C8UA 1JHYA 1OXMA 3G0OA 4IIYA 3LFHA 3TMKA 1XPUA 1L7NA 3NTRA 4FGWA 4HWRA 1W5SA 3ADDA 4TSKA 2CT8A 1JU4A 2Y27A 5GINE 2V0GA 1NSFA 2ICAA 3UV6A 4E08A 1ZICA 4YRRA 4JOBA 4ME6A 5HUQA 4INPA 2GZSA 2JI8A 3HBJA 3SE0A 2BMJA 1Y8RA 2QL5A 3OUTA 1F60A 1CRQA 1HFKA 2EXXA 2IXTA 2ZSUA 4IFIA 3F2VA 3UUWA 4P54A 3WA6A 1M1YB 4TS4A 2E48A 5EFZA 2NUAB 5GONF 3DM9B 4CUZA 3LGXA 4WADA 4G8DA 3AGPA 2PWYA 1BVHA 3EMDA 1Y6JA 1FRFS 3N6XA 4B4DA 4ZK2A 5BV7A 2BC9A 3DYVA 4OJTA 5GJCA 4DM7A 1BFDA 1E8DA 1QAQA 3B6EA 4WE3A 3AR5A 5DHRA 5DJ5A 4PLGA 4ENTA 3L3BA 5I51A 1AUPA 4I1YA 5ALDA 3OX2A 3L7OA 2UUBB 2Z04A 4MKHA 4X93A 3KKZA 2ZIEA 3ILYA 3GP8A 1Q44A 1PDOA 2ZBDA 3BSWA 2IYVA 2VYVD 1RPTA 3LH5A 2X1LA 4Y7CA 5AUOB 3BQ9A 4GO1A 4BWYA 5BR4A 2I6QA 3D6TB 3D3WA 3TQOA 1PR4A 1H85A 4ZI7B 1MORA 4CKZA 3KLNA 3PG5A 1GP2A 3NQ41 3U4IA 3FUCA 3DZGA 1AJEA 3Q6MA 1F8YA 1RKUA 2WZQA 2ZUSA 3MTAA 3PBKA 1UCFA 3FOBA 4FKMA 1VB3A 4LUCA 3R7SA 5LLDA 2PL1A 1ZRSA 2PX8A 5DK6A 2ENWA 1T15A 1W85B 2JDID 1QDEA 2NYUA 1O94C 2PZMA 3GT3A 3IV6A 4RABA 4I50A 4RETA 4ND1A 4IUYA 2J33A 3Q15C 2RBGA 4CKWB 2YZNA 4H2DA 4ZK6A 4BBPA 2D0DA 4GKJB 2Q8PA 5I7OA 1WUYA 2PS1A 3PHIA 5CLIA 3TF5A 4D26A 4Q4DA 2QRZA 3B20A 3WL4A 3ACBA 4RZQA 5IG2A 2XT6A 2ZWIA 1GRVA 3K0AB 3I9V1 4R1UA 3KALA 4RK7A 3UJ7A 1AMOA 2GN4A 1Q11A 3HU2A 4NNOA 3COSA 2HAEA 2QP3A 4LHEA 3PGVA 5GGXA 3GJXC 2BMDA 3ELYA 4P86A 5AJUA 2FVXA 2Q50A 5GADl 5JWRA 1WU7A 3O8NA 1TK9A 1UBOS 3BGVA 4PC3A 5IDWA 2I3AA 1O54A 2FF7A 4QBTA 3H5AA 3PNYA 4J4TA 1T35A 3GRZA 4E07A 1JQBA 1NVAA 1E1LA 4QQFA 3IE2A 4ER0A 1D2HA 2J1LA 4FK8A 1RYFA 1M2GA 1OXVA 2TMDA 2VRNA 2HDWA 4TRMA 1UPFA 4JEIA 2RJ3A 3GVPA 4B76A 3NJ4A 1U2GA 2OLEA 3DXXA 1VGRA 2B8TA 3BICA 3UA4A 4A8JB 3VPFA 3SNHA 5EJ5A 3B2QA 4AMGA 2FEMA 3NDPA 4WK4B 4BNVA 4PZDA 1OT5A 2HJVA 2GNAA 4XSGA 2C2OA 2O7VA 2PWPA 2PLAA 5CPFA 2EGGA 5FPPA 2X6TA 1EFRD 1SUIA 3GPDG 1NP6A 1J99A 3A1UA 2R6JA 2VHCA 2OFXA 2V8BA 1L6RA 2VWHA 1CRPA 1EVJA 3ZWBA 3R4VA 4C06A 1LZLA 2G06A 4GS5A 1SRQA 1TKAA 3COPA 1YT5A 1O96B 3H4MA 4IPTA 5HZMA 1QIGA 4MPDA 3TO5A 1U7OA 3G9XA 3M1IA 2O8FB 4JLSA 4Q1AA 1EEHA 2RKWA 4RK1A 5KNBH 5C1PA 4K6HA 3ADKA 4R51A 1GT6A 2JEOA 4HGYA 4XE5A 2V65A 2R96A 4DBZA 1M5RA 2F4VB 4NICA 4KLAA 1MC1A 4K9SA 4BNDA 3K70D 1A88A 3AUUA 2ZUTA 1QFZA 2Z2KA 3FG9A 1SHJA 4PGAA 4LYHA 5I5GA 4AUEA 3Q3VA 4BMPB 2J3EA 5EZSA 1R8XA 2ID7A 3OPQA 2WIJA 3CLHA 2F59A 1HLPA 3WAGA 4JR2A 3SAJA 5ALRA 5A0TA 5CXQA 1G7TA 2AK2A 2CEAA 2UZIR 2XZDA 5BMOA 3IKVA 4FT2A 2B3DA 4ZZIA 3W5HA 3RVKA 1I4LD 2F43B 5EXPA 3S40A 5I9IA 4D3SA 4Q21A 3ZDRA 2V7GA 1NL3A 3MELA 2C29D 1Z8DA 4OSOA 2REBA 1XQXA 2P2GA 1UQUA 2FZEA 3PKZA 1PD1A 1OXXK 3VJLA 3SX2A 4JX8A 2BGRA 2BKLA 1B16A 2Z9DA 3KKEA 2G17A 4V0RA 3U60B 2BE9A 3E0XA 3FNIA 1RWPA 4RK4A 2VXCA 4Q3EA 4V03A 3R0JA 5T57A 4YCCA 2YZ2A 2DG2A 3VGJA 4BBAA 2EYUA 2GS9A 3DF9A 4IFBA 1IXKA 3DLPX 2Q5FA 2ECOA 2AE1A 3MMXA 1XKQA 3MPUA 4D4JA 1RKVA 2RI6A 1SJ9A 4F93B 1YR7A 2CXTA 2R8YA 1MT3A 3RS2A 4FFBB 4ZMBA 2QAGB 3MWEB 4LYFA 4O08A 2OLKA 2PVCA 2BRUC 2WSLA 1TIKA 1KJ8A 4XQEA 1K75A 2P8JA 1XIVA 1Y3DE 1Y5MA 2JW5A 1FSZA 1EWYA 5FOXA 2WQZA 1G8SA 1R4NB 1RXEA 3QUQA 3OKAA 4KQ2A 1E3DA 4RPJA 1FU8A 5BWLA 1VI2A 1WDKA 5DNAA 1ZWLA 2J0VA 4PTLA 3O8DA 5HK9A 2HDHA 4TWJA 5JFTA 1M1YE 1WZEA 1TC2A 1D7OA 3LF2A 3HKEA 4OQZA 4CBVA 1YONA 5CXSA 2QR2A 3I37X 3VNBA 2G1AA 3F9IA 4DIMA 1EUCA 1HYGA 1SIBE 2CFIA 3CIOA 4GSLA 3RFUA 2M98A 3SYKA 5JYEA 3WLTA 3VVMA 5JYBA 1ISMA 1C9NA 1VRWA 1HDGO 3QLUC 1KOLA 2F1HA 1FFGA 1UZAA 2CHUA 1PAUA 1MG0A 4ZDJA 1E2FA 2H63A 3DG9A 4EY4A 1ZSYA 5IVHA 3CW8X 5FAXA 1IPHA 1GGJA 4FCTA 3U5TA 4G5YA 1I3NA 1Q0TA 2D2FA 2OK8A 3HB9A 5TVGA 1L5MA 1XVLA 2QJOA 5AI5A 3HU3A 1L7EA 2RB5A 1UPAA 3C85A 5G3YA 4F5DA 1OXTA 2BEUB 4D1YA 2GBLC 4B3CA 1BXGA 3R9WA 1WKCA 2P4UA 4AYXA 2ISSD 5A62A 3CUKA 1WQ1R 3ASZA 1JR4A 4DDKA 1QHIA 4P7GA 2WMDA 3L4EA 1VPLA 3BK1A 5FOSA 3F3KA 3ZWDA 2KSQA 5DBGA 1OC2A 2ZJ2A 3NM5A 2EZ9A 1TCVA 1ZK1A 2W6OA 2ZB4A 2EU8A 3F47A 4MR8B 4DQVA 3OQIA 3D1VA 1P5JA 1XDUA 2R7NA 1V16B 4QG3A 1SWVA 2YZGA 5JNWA 5E0OA 3RSCA 3KAJA 3Q9SA 1DIAA 4L9AA 1KY3A 1Y4UA 4UBNA 4MYCA 4B6GA 4FHFA 4DDMA 2I7CA 5EIBC 4OLBA 2HWWA 4ETMA 2HSGA 2I6UA 1C14A 3Q7SA 3AUYA 2J9XB 3MJ4A 4RNCA 3UAXA 2X13A 3R0QA 1AKEA 3IP1A 1GTMA 5FLKA 2FX2A 3ONFA 2V45A 2ZJ3A 1D4OA 1JHUA 1LF0A 3SF8B 4XEHA 2RCYA 1C0PA 2XKJE 2Y1OA 3OQPA 3SMQA 3O8CA 1II8A 2A0XA 4HTFA 5A2GA 2IEYA 1S5PA 1P75A 3ON5A 2CLDX 1P80A 5KEIA 5EJAA 5DVZA 1T1SA 2QOEA 2HMSA 1L4LA 3CLUD 3D64A 2FJ0A 3F1KA 4QE3A 5FBHA 4DJDC 1K06A 1S89A 1NXSA 4NEHB 4B40A 3ZWKA 1S2LA 2OENG 1YB2A 3KV1A 3UHFA 2X2EA 3PQ7A 3DKIA 1WETA 1CJTC 3EMVA 4RSGA 3I61A 3RJTA 3W34A 5E4TA 1VKHA 4ESOA 5A04A 3QPAA 1T8PA 3ANNA 3NMUF 1RD4A 1H2AS 4OLFA 4TLEA 4WBNA 2O8EA 3EJ6A 1Q6YA 2FXIA 1LZKA 4GR4A 3VR3D 1M1ZA 2YOHA 3X1XA 4JT9A 1J22A 4E5NA 4L5JA 1L2TA 5FQOA 4DMKA 4DVGA 3JQBA 4ZOLA 5THQA 1POWA 3GHHA 4JJ8A 7MDHA 2BFDB 1KEKA 4ZTZB 5JBIA 2RK4A 5ALKA 2D5IA 4CNBA 4FQ8A 1SG0A 1M74A 4QOIA 4B3GA 1W5EA 3MD0A 3PQ6A 4PCLA 3U3DA 3MQ2A 4WKGA 5EXXA 1ZGHA 5TY0A 4EY6A 2NZ2A 5EMNA 5CBPB 4PO1A 5KYWA 4R1MA 3L4KA 5GV8A 1AK1A 1JLSA 2BGNA 4CRWB 3SJCA 5AI4A 4L5AA 5D84A 5ABPA 1ADFA 1DEOA 3MF4A 3HKCA 2ADOA 2JCBA 2C83A 3F7OA 3X2EA 2ZLBA 4FDAA 1TCBA 4H1WA 2NSDA 3C43A 4AAYA 3VU9B 2GUGA 4ZA2A 2BMAA 3GQBA 3CEAA 1UJ6A 1MLDA 1NBOA 3FNBA 2WTXA 5F73A 3UK6A 3ZY2A 5GTDA 3PC7A 1GD1O 4C20A 3ZJ4A 1W7AA 4NCJA 2Q9AA 2I2AA 3PPVA 4MWDA 1XV5A 1EI9A 1GTL1 5HUJA 1GYQA 4UU1A 5T3YA 2AFIB 1VL0A 3T1HB 3TW4A 4N76A 4E14A 3DEHA 3BE5A 1ONOA 2XY4A 5JBNA 4KWIA 1RHKA 5DYWA 3ZWXA 3ZZTA 4Q3CA 1IOLA 1SKMA 3M4NA 4BO1A 1EEXB 4DSUA 2C4KA 4FZRA 3AVTA 1R9GA 1K3FA 2D5CA 3JQ8A 4PIPA 4UZFA 3TB4A 1SELA 4EPVA 1XVUA 2NXEA 4U6SA 1O57A 1U2DA 2NYRA 1ZH8A 5H9WA 1Z07A 4HX9A 3OU6A 4JJAA 5JD6A 3AVYA 3O03A 3AKZA 5FXMA 3FMFA 4JLAA 3W4JA 4JYBA 4IQ8A 1UOEA 1KFBB 1YOBA 4RIGA 4XR9A 2H4XA 1HKUA 3PLNA 5DLEA 3T5MA 2Z2XA 1RRVA 2ZJ7A 5A9SA 4R4JA 5ILGA 3L18A 5B53A 3T1YB 1GCOA 3TSZA 1FP4A 1LB1B 3T3PB 3OX4A 2I1LA 1IWPB 3BRCA 3IHTA 4LZAA 4NFHA 3UJ3X 4M0UA 1TK3A 2Z2JA 3EVDA 4EB3A 1PZMA 1KR5A 2K2QB 4KLZA 5DNYB 4DV4B 3JYOA 1I94B 3KTOA 2GJAA 4ID9A 3HNOA 1TAHA 4OI2A 1N2SA 2F64A 2QRKA 4RVUA 2Z4RA 3GUCA 2E82A 4YC7A 1BMTA 3EF0A 4JLMA 5DFAA 3WIEA 5E6UA 2EKBA 3M3DA 3KR2A 4BMCA 1TM4E 3OUUA 2I6SA 2DY0A 2C99A 2P4QA 5T41A 1A5ZA 2N46A 2J3JA 4L2IA 1X7ZB 2IHTA 3GJQA 4N5NA 4OFWA 4R2IA 1T3TA 4RHTA 1M6EX 1YHZA 4W4TA 4ZVNA 1D0VA 4ZAWA 4ZIRB 1XNRB 5AM4A 3TGWA 1GKIA 4ZCPA 1J0EA 4CLRB 3JSAA 3B1VA 2DVMA 4B73A 2RD2A 3I2KA 3AR6A 1WCV1 1PG5A 2BT4A 2AW3A 2B99A 2J59A 2B30A 1Z3IX 3CCCA 1EGHA 1S8FA 2O2JA 1NN1A 2HIAA 3ZDCA 3P26A 2IUEA 3NP9A 2FTKE 5H0IA 4LZNA 4F38A 2ATVA 1XQVA 4BE7B 1NVKA 1Z4KA 3TD6A 1UXGA 1UJ2A 1VMKA 3QVKA 1DV1A 4XWAA 1FRZA 2C8VA 3BCHA 3EWAA 3FA2A 4JVSB 2WF8A 3GLSA 3IVCA 2QN7A 3LW8A 3BH6A 2E4XA 3RFCA 3UATA 4AFNA 4BQPA 3CGGA 2OYSA 2QLMA 4N49A 1YVRA 1RADA 3O26A 4PRKA 3TL2A 3PNSA 1Z47A 1KMNA 5DTMA 2ZTHA 5TE9A 2J9GA 3PFHA 3RIEA 5HXAA 3REFA 5FNVB 4MAAA 4MW4A 1SU6A 3N5CA 1AM4D 3R5TA 4P80A 3MAAC 4D4LA 3WLPA 4K7JA 1XMJA 2QEQA 3SYNA 1E0KA 3SQMA 3W5JA 4CMCA 1U2RA 4RC9A 1P31A 1QRAA 4KITB 2FZCA 4KQHA 3QLEA 1P5HA 3EAGA 5ILOA 2HJWA 5LL6P 3AOGA 4L4UA 4DBVO 4FVTA 2AJCA 1GL6A 4MRVA 5KYKA 1F9EA 1ORDA 2E6KA 1NQTA 1IXYA 1DGQA 4RSRA 3AF1A 1Y3CE 1VP9A 5BXYA 4Y0VA 2R1UA 1GDDA 3PTZA 4BNMA 2R62A 1W49A 4OLAA 1NWCA 1VLMA 4O4IF 2AKAB 4K05A 3HY4A 4M1SA 5C4GB 2EEZA 2O3UA 2AJ8A 2D2EA 5AWFC 2AI3A 3UK0A 2FUNB 2RIPA 1I36A 1U8FO 3AG6A 5A7GA 4DHWA 2X5XA 5D1HA 3K05A 1KZGB 1NFQA 2FUKA 1XCMA 1C7ZA 2YV3A 3CMMA 4BNJA 1RR6A 3DKVA 1JTEA 1NVFA 1FFXB 1EK2A 2OK7A 4HAUA 3UYLA 3DJFA 3N53A 5K0LA 1J90A 3WGVA 3ZI4A 6PFKA 5EUMA 2NYAA 1SULA 3B2EA 3OZ7A 4MJ3A 4FFPA 3DVAB 4EYSA 2W83A 4GYYA 2IWRA 2VPXA 1UDWA 1Z6PA 3S44A 2UZ0A 2W2VA 4XWTA 4YXFA 2VXOA 1QH8B 1IOWA 1CUJA 3AB7A 3KQOA 4GI3A 1XVAA 2ARKA 4U63A 5D3ZA 1WBBA 1CCWA 5IYZA 2C3PA 4YLYA 1TQ4A 5CVTA 2NO1A 5BV2P 1LXCA 1SQ5A 2CMFA 4PAMA 2A58A 2CCGA 2Y1DA 1NXWA 4N54A 1YBVA 3HMKA 3HHEA 2IE0A 3FAZA 3B51X 3JATA 4OM7A 1PT6A 1AKRA 5JASA 2GA9A 2ZRHA 4XJVA 4UTRA 3T7TA 2BSXA 2Q4BA 3EDOA 2UYQA 1JDUA 4MR7A 4OFBA 4YCMA 2IHYA 3OPYB 4EECA 3SIRA 1LPNA 3OESA 3VPAA 4FOTA 2ZYDA 3LKZA 3DMGA 4PVDA 5CNKA 1PR1A 4E12A 1N34B 3IJEB 4GP9A 2VJDA 4GP6A 1CQJA 3H1EA 4MV9A 4B6SA 2ZJ8A 4UQOA 5AVRA 1EX9A 1JHVA 3L93A 8MHTA 2UYGA 5ENVA 3WBKA 3BFPA 4V39A 1UBJS 4B79A 3DD1A 2JFVA 4BLSA 5G2OA 1QFMA 3DQZA 2B9EA 3C3KA 2R8OA 4KXNA 1A8IA 3CN9A 3D6VA 3JQQA 1NIJA 2BKEA 4OPMA 2QMHA 5KVQA 3KHSA 3KXKA 1YFJA 2DTEA 2RGRA 1D4AA 2V0NA 1X38A 2ATXA 2QL9A 5MFZA 1N3YA 2GHTA 2ZQYA 4M98A 4OA8A 3M7IA 5B2EA 1NVUQ 5LNK6 1GNVA 1SY7A 1KY2A 2CLCX 3FPJA 2J0QA 1BXKA 2AG1A 3OT1A 1IDN1 4Q00A 4IDHA 4EWLA 3UH0A 4KG7A 4HPWA 1FK8A 1VSUA 2LR0A 2H2AA 2QM0A 2CMGA 5A3QA 3PA6A 4CM1A 1TM3E 4G0UA 5D3MA 1TO6A 3QNMA 4PQFA 3ESCA 2XBMA 2G3YA 3DE5X 3EDQA 3GLIE 3OFJA 4RH0A 1QHGA 3JARB 5AVSA 1U7DA 3E6AA 4BPRA 2A1UB 2IZ0A 5K51A 4Q1FA 2VQ6A 1BSVA 3NZEA 4PBRA 1RW4A 2ZYAA 3BB1A 5JC1A 1Q7CA 2YCLA 3B3FA 1ZA2A 3V34A 2C9OA 1WXWA 2D54A 1S02A 2YASA 3TINA 1KEPA 1H2BA 3BXHA 3AU9A 3UY4A 3WGQA 3WJAA 1IRIA 3HXLA 5A5FA 4LMRA 4KQWA 4AKHA 3BS4A 3CRQA 4KAXA 5A3JA 3W8EA 3QY9A 1CB7A 3L0PA 4U2KA 1E5VA 1RIIA 3RE1A 1AK2A 3HWRA 1NNEA 1EVZA 3VDXA 3IP5A 1ATZA 2IUUA 3T95A 5JO9A 2YV2A 1XTIA 4X60A 4PAWA 2DT5A 4RV5A 4R2KA 2QG6A 3GP5A 3W7VA 4LKRA 3KOXA 5ECYA 3KX2A 3V6LA 1JKMA 2WG2A 5A9RA 4K0RA 2RFLA 3WBFA 2J07A 3P52A 4LBYA 1GNQA 2B20A 3JWIA 3KSMA 2HYDA 2CKMA 3HCRA 4FB5A 3E2PA 3U37A 5LZ5A 4EB6A 1ZU5A 1HE1C 3BZBA 3E82A 3EDRA 4ETWA 3TSYA 3ZHXA 3UJCA 3UK1A 4DLAA 1R6DA 1L7MA 1W94A 4YYZA 3T5PA 2JCYA 1GDHA 4X8LA 4PLFA 2WTUA 1PJ4A 2HHAA 2RI1A 1ZEJA 3B1JA 2ZB8A 2R751 1Z2PX 2AJTA 1GPNA 4ZV9A 4HAOA 4ZT6A 4RTPA 1BH6A 2B1RA 3HABA 3GOHA 4CLHA 3IEVA 2JEYA 4N3BA 4NYMR 4TTSA 1QHEA 3QELB 4NS1A 2XMRA 3AVPA 2IS6A 5C8ZA 4GWGA 3F46A 1V96A 4EHLA 3TSOA 1IPEA 3T1VA 3LQFA 2V59A 2ZJ4A 2G9RA 2WZBA 3IIMA 4FI3C 3UOWA 4F97A 3KVNA 3IP6A 5C9ZA 1J00A 2VJNA 2GTIA 5JW6A 5A0VA 2WWFA 1N6PA 5BT8A 4GEGA 3NS7A 1YRQA 2A33A 1AO3A 3ND5A 5ER9A 5DX8A 1VXRA 4TWZA 3H1BA 4UE6A 3WTCA 3ZHSA 2Q4OA 3IEKA 2X9LA 1JJ7A 4MGIR 2XMPA 1R6XA 1N0IA 2EZUA 3DBRA 5IT0A 1N5JA 4A5OA 3W9SA 2ZBQA 2V7WA 3ROPA 3R7WB 3R7FA 1XDZA 3D4LA 3LWBA 3STYA 4MUEA 2MWMA 1N0VC 2FWMX 3I3OA 3RWOA 5B3JC 2H08A 1MXFA 5TXGA 3QVMA 3PV0A 5ICFA 5HJ7A 2R5FA 3HYRA 3MTJA 1FW6A 3DEJA 3B5IA 1QC5A 2FZ5A 4RYDA 3VV3A 5J2UF 2VL7A 2WJAA 1KEEB 3E9NA 1XLTC 4DSTA 4F8JA 4ZKDA 3RIXA 1FNCA 5TT0A 2O2CA 2X15A 3VR4D 5BO5A 4WA7A 4R0VA 5CHEA 4X0EA 5ELLA 3WGJA 4AIRA 3UHOA 1DKOA 4NOLA 3CUTA 4IJQA 1E2DA 4XLTA 5EAIA 5CDSA 3BDAA 4J6EA 3FZGA 5CCDA 2YW2A 4LWPA 2OAP1 3L46A 2FPOA 3WLMA 3F98A 2X3UA 4DA6A 1QVVA 2WD7B 5I7SA 3CT6A 2H1FA 2RK6A 1K2VN 1ZMRA 3HR4A 3NDJA 5AJYA 4BBZA 1JXOA 4B3TB 4HWSA 1RDFA 3GLGE 3N28A 2WR8A 4GI1A 1FS6A 1EX6A 4U9IS 1Z4JA 4BQRA 1L4UA 1P2UA 5C4MA 2ZVDA 1CJUC 1XEXB 1QM5A 4U2EA 5E3JA 3ORFA 3ADOA 3OZFA 2AUMA 3I9JA 3VTFA 1VE1A 2UVDA 3O47A 3KCQA 1JHMA 2QLLA 4C6TA 4KDCA 4N0EA 1OWMA 1P7ZA 2WVAA 1ZP6A 1Y5NA 5GVRA 2RG1A 2C2KA 2EHDA 3D6HA 4IR7A 3W1VA 1G20A 2WVJA 3JAMA 1YRAA 3NHLA 5CT9A 1ZHOA 1DPGA 2ZJAA 4GLJA 1C4OA 3QX3A 1LK7A 2BISA 2QUJA 3M9WA 2EKQA 1YJQA 2X4DA 4IDOA 2DFLA 4NAHA 1L5HA 5BQFA 2BGTA 3GJ4A 4Z2YA 3IOEA 1NTOA 4BVHA 4ENWA 5L7WA 3CVXA 3DFUA 4CTOA 4UTOA 4ZC1A 2NVUB 5EZYF 1QS0A 3OSUA 5CB4B 2HLHA 2Z4TA 3IUEA 3ZV3A 2GAAA 2CE7A 1SD5A 1T29A 1KAQA 2H29A 2PGDA 1GVNB 2V7TA 1D6MA 1QPGA 2VKQA 2W2XA 1KI7A 4HEA6 1RYHA 3OY7A 2E6UX 4JC4A 4KGXA 3QPCA 1C9MA 1U11A 1VM6A 3JW8A 2AD5A 2N9UA 1ZN9A 4C4ZA 1N6OA 2XMCA 2JIQA 3N74A 3P45A 4H3VA 4E3WA 2POCA 1ANKA 2BGJA 3MQFA 1CQIB 3OJ0A 1G59A 3F6CA 3O8RA 1WPGA 4G85A 1MABB 2O9JA 3FWKA 3ZXIA 1JNXX 1WM1A 1UMCB 1Z2DA 4H4CA 4HMQA 4LOLA 1AKWA 5H5JA 1XN4A 1AG9A 2JK0A 1HBJA 1ULZA 2ZPUA 3BB4A 5A4IS 1JI0A 3M4XA 2EL7A 1YI1A 3ESRA 3WMRA 2DH6A 1BKSB 2VZ8A 3SYTA 5MN6A 3THWA 5F2KA 5ALGA 5DZSA 3RS3A 3GAMA 3R5XA 3PCRB 5E7JA 1RLUA