4P9NA

Crystal structure of sshesti pe mutant
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
PLDPRIKKLLESGFVVPIGKASVDEVRKIFRQLASAAPKAEVRKVEDIKIPGSETSINARVYFPKAKGPYGVLVYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFDGEMGIAIAGDSAGGNLAAVVALLSKGKLDLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPIIAQDLSGLPPALIITAEYDPLRDPEEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIDQGKDAIGLIGSVLRRTFYDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Structural Insights into the Low pH Adaptation of a Unique Carboxylesterase from Ferroplasma: ALTERING THE pH OPTIMA OF TWO CARBOXYLESTERASES.
pubmed doi rcsb
source organism Sulfolobus shibatae
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p9nA00
1XRNA 1FFBA 3BIWA 4DSZA 4OB6A 3QM1A 1A7UA 1RWQA 1WB6A 4CIBA 4UHBA 4RGYA 3T52A 5AIBA 1S8OA 1QO7A 4LXGA 4K6HA 3KD2A 1BE0A 2BKLA 4GLBA 3BXPA 2BUBA 1Y7HA 5AIAA 4WFKA 4BTLA 1RYYA 1EVEA 3AZPA 2HA5A 3QPCA 3ZLUA 5DJ5A 2AXEA 4WFJA 1WHSA 5T4BA 2WIKA 3VJMA 3AFIA 2GBGA 3WKDA 2Z3WA 2G4LA 2VQ6A 5AKXA 3HYSA 1TKRA 4BC1A 1ZICA 4UHCA 4M0EA 4HXFB 3PF9A 1CUIA 3BJRA 2I78A 1UOQA 4BAUA 3H0CA 3BDIA 3G02A 4X97A 4QDOA 3HSSA 1N5RA 3QITA 4ZWNA 1BCRA 2WUEA 3DD5A 4G9GA 5FUMA 1JFRA 3STVA 4FMPA 3D7RA 4J0DA 2XMCA 3MUOA 1DINA 3WA7A 2OAGA 3V1MA 1PFQA 4G8CA 4ZGBA 5J3JA 3VISA 2BGNA 2WUGA 4GEGA 4B9EA 1CUEA 2RHWA 4DNPA 3M3DA 3DL4A 3VXKA 2ZYHA 2P8SA 1XQWA 5AM0A 1WB5A 1GPKA 1CVLA 5AI9A 4LYDA 4KE7A 2WSLA 3R3UA 1VZ3A 3C45A 5CT4A 3GELA 5AP9A 1XRQA 4W9RA 3STTA 1RP1A 2XDWA 3OPMA 4TPKA 4BB0A 4ZI5A 1F6WA 5CH5A 4MXDA 5AKZA 4G8DA 4L9AA 3IUNA 5EFZA 1UZAA 4DIUA 3G0GA 2FUKA 4H7DA 4BC0A 3CCCA 4H7IA 1VXRA 4H77A 1SFRA 2WQZA 2GYWA 3IVMA 5AK4A 3LP5A 1EINA 1H2WA 3ICWA 4J0HA 3ESCA 3HLKA 1JMKC 1H2XA 1CQZA 2ZVDA 5AKEA 4QZVA 3BJMA 1UK9A 2DSNA 1PJAA 2PU5A 5K3CA 4I3FA 3DOHA 2QVBA 4J0KA 4PSDA 2QUAA 5AHXA 3WK7A 2VT7A 1PV1A 4IHAA 1WCYA 1BU8A 3O95A 1YAHA 4KEAA 1XLUA 1GXSA 1HDEA 5DYTA 4OYLA 3SC2A 4CCYB 5C8VA 1R9NA 3E4DA 2JBWA 4J0GA 2Y6UA 3WYDA 3G7NA 2QOEA 1VE7A 4XIIA 2WIDA 2WHPA 1W75A 1JKMA 2HFKA 2QUBA 3H04A 4P92A 4KAJA 3CN9A 1T4MA 1YA4A 1FFEA 4RE6A 1G42A 3C6YA 1MO2A 4BCCA 1W52X 5JD6A 4Q3KA 3QPAA 2H7XA 4MEAA 1W1IA 1EDBA 2ROQA 5FV4A 1CUUA 1VZ2A 2ZSIA 1H22A 4Z49A 5C81A 4FFVA 2PSJA 1CR6A 1I6WA 5ALMA 3ZWQA 4GI1A 1N5MA 5E4YA 3PFCA 4CFSA 3IA2A 4IH4A 3FVTA 1Q84A 1G4HA 3BE8A 1Q0ZA 4Q82A 2PSHA 1VA5A 4J0JA 3QVMA 2X8BA 2RAUA 4LIPD 3ZLTA 3H17A 2HRQA 1TK3A 5AO9A 3WIOA 2QZPA 4PSUA 1XRRA 1XZKA 5SYMA 2HA0A 1GZ7A 4K6KA 4V2IA 4BYMA 1AZWA 3WZLA 4N5IX 1N1MA 2E3JA 2B4KA 4FDMA 5K3FA 2I3DA 1EA5A 1XKTA 2XE4A 5CT6A 2JIDA 4BRSA 5ALNA 2WG2A 5ALSA 1ACLA 2OQVA 4DYHA 2B20A 4H35A 4ZREA 2ZYIA 4FKBA 1JJBA 2CBGA 3WL7A 5FXMA 2HA4A 5ALRA 4TVKA 1CUVA 3I6MA 3W9UA 2J3QA 3D59A 1JJIA 2XQFA 1EXWA 1CUGA 1DQYA 5ALUA 5D3KA 2GZRA 2RGUA 4GDMA 3R3ZA 4BAGA 5EHXA 5EIHA 1JI3A 4P08A 2HADA 5ALZA 1UOOA 4X00A 3PF8A 4L72A 2QS9A 3I2KA 3V48A 1ZJ4A 3G9TA 1ZD5A 2C58A 4WDQA 1MPXA 5BOVA 3DEAA 1O6GA 2JF0A 4BRZA 2YASA 4O08A 4OYYA 3EIOA 4JYPA 5K3AA 1QIGA 5HQ3A 4KYVA 2XQGA 4X91A 2AJ8A 2RHTA 4C87A 1H2ZA 2XUKA 4E15A 4EA6A 3C87A 3TEJA 5ALXA 3F97A 5LLSA 1R50A 2VJAA 3GUUA 3I2IA 4UBMA 4QDZA 5AK3A 3L1JA 2WFLA 4KRXA 5EI5A 2ONCA 1QFSA 1F0PA 3WI7A 1EK1A 5HCUA 2JGJA 1UT6A 5AI8A 1FSSA 1EH5A 3P2MA 4IQ4A 2J4FA 4AZ3A 4B9AA 5CXXA 5DYWA 3DKKA 4GW3A 5D3ZA 1VKHA 4Q1VA 5HF6A 4PNZA 1QIMA 2RIPA 2VAVA 3BIXA 4H7HA 2HM7A 3BDVA 4KE8A 5JATA 4INZA 1CUAA 1MNQA 2YXPX 3S2ZA 2QKYA 2QTBA 3HC7A 4KAFA 4D9JA 4G5XA 3GA7A 4H0CA 1JT2A 3E3AA 1CUBA 4DMCA 2BCEA 4EBBA 1J2EA 2IITA 3I1IA 5JANA 5CH8A 1T2NA 3UUFA 3GBSA 4DNOA 2X5XA 4WFIA 3FWHA 3G0BA 4H7JA 2I03A 1A8UA 1AC5A 3EQ7A 3OC0A 2YH2A 3R0VA 5JAHA 3A2MA 3PUHA 4B6GA 1YAJA 3H18A 1VLQA 5CBKA 4Y2YA 1AQLA 1CLEA 1AMNA 5AJHA 2OGTA 1AGYA 2CEKA 4UFNA 3WIBA 4Q05A 3X3HA 3WWEA 2QXUA 5HFNA 1CQWA 1ZI6A 3KOOA 3HJUA 2CB9A 2H1IA 4CCWA 1XLWA 2WUFA 4OB8A 5FOQA 4L3WA 3V1NA 4AO7A 2ZJ6A 5LYYA 1EB9A 1Y37A 3WQHA 4AO6A 1IUNA 4PO3X 4QA9A 2WM2A 4ZRDA 3NOXA 5AKGA 1YB6A 4PF1A 5HKAA 2FJ0A 4ITVA 2WU4A 5AKYA 1KEZA 2ZYRA 1IUPA 4GECA 4U2EA 1LGYA 2VT6A 4AMYA 1DT3A 2PPLA 4MYDA 2JEZA 5ALFA 4BE9A 1U2EA 4Y2UA 2VEOA 1SOMA 1NX9A 5A7GA 4G4GA 3DYIA 4WDRA 5EHZA 3RM3A 4N5HX 2Y6VA 1QONA 4FFWA 3DKRA 3D3NA 1LPAB 3PICA 3A6ZA 1VE6A 1CUWA 3FVRA 1GKKA 1QJ4A 5CMLA 5AM2A 3D2BA 4Y2PA 1R3DA 4N8EA 2VJBA 2HFJA 5LZ4A 1ZI9A 1BRTA 2D5LA 2CKMA 1W6RA 3SK0A 3WLAA 1DWQA 4B80A 1CUYA 3GFFA 4PQEA 2WJ4A 4B85A 2WLSA 1XRPA 3WKCA 1HL7A 4FHZA 2GYVA 2GYUA 1WOMA 1XZMA 2XMRA 4UFPA 1QO9A 3UUEA 3PUIA 4KJXA 1IUOA 3AJAA 2WIJA 3FSGA 3KXPA 2WJ3A 1Y7IA 4H7KA 4UBKA 3WJ1A 2VTVA 4XX1A 4DMFA 4PV7A 1XKLA 3BWXA 1R1DA 2HU8A 2J3DA 2W22A 5JAPA 2O7VA 4B83A 5JD4A 4EHBA 2PSFA 5AI4A 4BVKA 4C01A 4QDTA 2C5FA 2BFNA 2C4HA 1MJ5A 2Y1KA 1CUXA 4H18A 5JZSA 1HPLA 4QE3A 4Q3LA 5LIPA 2R8BA 5D7BA 3R40A 4YX9A 4GWLA 2ZYSA 4QEKA 1MX1A 1XFDA 3WL5A 4DGQA 4W1SA 4NMWA 5LZ5A 1R88A 1DWOA 3STWA 3WA6A 2HA6A 2PKYX 7YASA 1ZIYA 2DHDA 3JW8A 4G4JA 2RONA 3S8YA 4MEBA 4MJ3A 4X71A 1YCDA 4X93A 2QXTA 4FNMA 5AM5A 5BWCA 1HBJA 3VVLA 4RPCA 5IVKA 2YYSA 3O4GA 4CIAA 3QMWA 1DT5A 1MX9A 3H2GA 1FFDA 3FOBA 5A71A 3ESAA 2EEPA 4G1FA 5A7FA 1WHTA 4Q3OA 3QMVA 3C5WP 2WKWA 4X3CA 3N2ZB 4MWSA 4F0JA 3WKAA 4X7BA 1CUFA 2H7CA 1UKBA 3IULA 5FPQA 1UK7A 1LBSA 5IVHA 4C6HA 2D0DA 3M83A 4AN1A 2ES4A 2XMBA 2XQIA 3JYHA 3KWFA 5CT5A 3QMMA 5T4EA 2QT9A 1G5FA 4UHHA 5AOAA 2HIHA 1Q0RA 3VVMA 1MU0A 3PDCA 4XJVA 1P0IA 5HKBA 4BDSA 3HZOA 4E11A 1H23A 1ODCA 3LS2A 4XVCA 5CTAA 1CUHA 3DYVA 1QOZA 2PSEA 3FYTA 1CUSA 2QM0A 1E8NA 1U65A 2B61A 1XQYA 1ZD2P 4P93A 3WWPA 2XI4A 2XUQA 2HL6A 3NGMA 2PUHA 4NZZA 1GGVA 5AI0A 4KACA 5C8ZA 2HU5A 5I8PA 5BV7A 5KBYA 3QZUA 4UFOA 4RNCA 4ARAA 4OPMA 2WHQA 4TGLA 5IVIA 3WK6A 3FNBA 2WU3A 5ALTA 1HKHA 4B84A 4OB7A 4X92A 5AK5A 5JASA 1AURA 3Q8WA 1USWA 3C5VA 3DDUA 2BUCA 5AKKA 2XLBA 3YASA 3STXA 3HRHA 1EI9A 1JU3A 1HQDA 2G5TA 2XMDA 3PI6A 1EK2A 1N8SA 2Z5GA 3ZV7A 3QPDA 1CUZA 4U2FA 4FTWA 2C0PA 4PSCA 1QLWA 1HLGA 4ZXFA 4QNNA 5HK8A 3EBLA 5E2IA 4AX4A 1LPSA 1E3QA 3ZPXA 1UOPA 3FCXA 3GROA 5JALA 3ANTA 3WWDA 2XUPA 3FYUB 1CFJA 3ANSA 4QLAA 4WY8A 4C4YA 1ZOIA 1E5TA 5ISMA 1JU4A 3H2HA 2WFMA 4G4IA 4AO8A 4C88A 2ZJ7A 4LYEA 1OXMA 1C4XA 1B41A 2OCKA 1BEZA 3NWOA 3WK9A 3ICVA 5ALKA 4QDUA 5DLPA 4FOLA 1YR2A 4U2GA 5K3EA 1U8EA 3C6ZA 1X2EA 5ALGA 2LIPA 1X2BA 4QWWA 4Y2QA 4U2CA 2VF2A 3I2HA 3KDAA 3TJMA 3R3XA 1LPOA 3LIIA 3F8SA 1K8QA 5A62A 1UXOA 5AKLA 2HA3A 1XQXA 5LZ7A 4HS9A 5DTJA 3DLTA 4RE5A 1QIKA 1IZ7A 5FKJA 4LHEA 2V9ZA 3TRDA 5EIEA 3F67A 4K5QA 4B7ZA 5A7HA 1IZ8A 1QIJA 1B6GA 1K63A 4Y2TA 4X94A 4FWBA 3B5EA 4WCVA 2K2QB 4B82A 5DNVA 2CUTA 3IUMA 5JIBA 1P0QA 4UUQA 2PM8A 4CCYA 4EY5A 3VJKA 1H2YA 1XZCA 5FLKA 3D5EA 3I2JA 5CXUA 3HEAA 3AINA 1R9MA 4N8SA 5HF8A 2DR0A 3D2AA 3RLIA 3H2JA 2HRRA 4GXNA 3O4HA 2O2HA 1LPNA 4X6XA 1MNAA 1W4LA 2WUDA 4JUIA 4G9EA 5CT8A 3DJYA 1UWCA 2WIFA 3HI4A 4KE9A 4Y2SA 5LZ2A 1XRLA 2XMSA 2XT0A 2PX6A 1LPPA 1SCIA 4AB1A 4UHEA 1UKAA 5K5EA 5DNWA 1LBTA 4F60A 3QBJA 3FSGD 2XLCA 3STYA 4G8BA 3O9MA 3WZMA 1DWPA 3C8HA 1JMYA 3BL8A 5ALQA 2Y2VA 4IH1A 3B12A 4Q34A 3FLBA 3C6BA 1UK6A 1MAHA 3H19A 3AILA 4B81A 3IBTA 3UMJA 2V98A 4AQDA 4FLMA 2VJCA 5ALVA 1CEXA 2Y2UA 4JEIA 3WMRA 1UFOA 4X90A 2DFPA 1CRLA 5KWIA 3HXKA 5EHQA 4DLNA 3WKEA 4BVLA 1BEEA 4X6YA 1CPYA 3SWWA 1MTZA 5ALHA 1E89A 1MN6A 2VJDA 2XMQA 4J03A 3RARA 2H7YA 5KWJA 4FBMA 1L7AA 3ILSA 2JGFA 4EB0A 1ACJA 1IVYA 3W06A 1U4NA 2QJWA 1E8DA 1KU0A 4OD0A 1OCEA 4QDXA 2PUJA 3O0DA 3W9BA 4ETWA 4HTAA 5I7UA 1JJFA 2VA9A 3F9CA 3WL8A 2QMQA 3BF7A 3C8DA 3WJ2A 5CT9A 4FLEA 1LNSA 2WIGA 3D2CA 2QR5A 4UBIA 3LIPA 1LZLA 4XWGA 4U2BA 4OCZA 5T4FA 3WK5A 4A23A 3E1GA 2G63A 1ZD4A 1O6FA 3G9ZA 3A70A 4CG2A 1XZEA 4FNGA 4MYSA 4Y2XA 3AIKA 1ETHA 3ZLVA 4EY4A 4DSAA 5ALWA 1ORWA 4BZZA 2AJLI 1QIIA 1FFCA 2VSQA 5CRIA 5AKHA 2FJPA 2OCIA 2GZSA 3H1AA 1QZ3A 1XZDA 1XZFA 5ALYA 2Z3ZA 1CIJA 2HA2A 4YASA 1BCSA 3R3VA 1J1IA 3U1TA 2ECFA 1WB4A 3IDAA 4DM7A 1YS1X 2IIVA 3Q0TA 5A2GA 2WTMA 5AH0A 3G9UA 3TGLA 4PW0A 1UKCA 3FAKA 2OLEA 3KWJA 1LPMA 3FLEA 1M33A 4C89A 1YSCA 2WG0A 1L7QA 1QTIA 3WWOA 5T4HA 2WHPB 4JNCA 1THGA 4BTVA 3I1YA 3B3QA 2VATA 5HFAA 1Z68A 4AMZA 4H7FA 2XUFA 1ORVA 3WK4A 1XRMA 4DMKA 1TCAA 2R11A 5D6OA 1DX4A 2B9VA 3L1IA 4K6GA 4U2DA 1E66A 2GBCA 3N0TA 1EDDA 2ZJFA 4BATA 3WWCA 5LKAA 2HU7A 5IH7A 1YB7A 5FRDA 2I3ZA 1FJ2A 2OPHA 5E4JA 3CCBA 4L0CA 1TAHA 1XZLA 2WILA 3H2IA 1SCKA 5JAOA 2O2IA 4QWMA 1SC9A 4K2AA 3M82A 5AI5A 3NUZA 3BF8A 2BGRA 3EQ9A 1K6EA 1ZGBA 1ZI8A 4EY7A 4Y7DA 5SYNA 2DHEA 1UK8A 2ACEA 4DMHA 3QYJA 1MX5A 3L1HA 4X95A 2PSDA 5JZBA 3R41A 1P0MA 3HABA 2PVSA 4YK7A 5ALOA 4CG3A 1AKNA 2WJ6A 3ESDA 5AKIA 1XQVA 2ZSHA 5AM4A 5DTIA 3U0VA 2XUHA 5K3FB 2DCMA 2DQYA 1QIEA 1F0NA 5JD5A 2BAGA 2AJDA 5E4TA 3K2IA 1XZBA 1XROA 3I2FA 4BZWA 5LP1A 4UBNA 4HZGA 4YPVA 3ESBA 1A8SA 2X76A 2XB6A 3R3YA 4JYMA 4MQMA 1BROA 4MQLA 3AZQA 2PL5A 4X6UA 5JYCA 5AM1A 5ALJA 4J0CA 5ALDA 4BCBA 1CUCA 1C7JA 3O9VA 2Z8XA 4LXIA 3ED1A 3D4LA 5HZGA 3AIOA 5FP0A 3A2NA 2XUAA 4E46A 5CURA 5HF5A 1VA4A 3V9AA 3CXUA 1AUOA 1A88A 3R3WA 5JAUA 2IX9A 1THTA 4DNQA 4C4ZA 3KSRA 3V1KA 2AJCA 3JWEA 1MT3A 1YS2X 2XQKA 2BJHA 2WTNA 1XZAA 3SX4A 3T4UA 4Y2JA 3OTQA 1QTRA 4IH9A 4UBLA 3WL6A 2WG1A 2GBIA 3IB3A 3AZOA 3OG9A 3FLAA 4X85A 2PU7A 3K9BA 5HQ3B 1ZGCA 5AKJA 4FLFA 2NW6A 4OSEA 3FBWA 4IO0A 3WYNA 4BDTA 4BVJA 3PFBA 5I9IA 4A5SA 4A16A 1LLFA 2XUJA 2FX5A 3I6ZA 2QRUA 3RKSA 3G0DA 1D07A 2WFLB 4ARBA 2UZ0A 1E8MA 4UHFA 3IUQA 5AK6A 3W04A 2C5GA 1XZGA 1BN7A 3MUNA 4AXBA 4UHDA 4HAIA 5ALIA 2XUIA 5AOBA 4W1QA 5DYYA 1QFMA 3MGAA 1A8QA 4UBOA 2O7RA 4OUKX 5ALLA 3EQ8A 4B0PA 4HXGA 1DQZA 4Y9SA 3OM8A 2EDCA 1NU6A 2XUGA 3K6KA 4W1RA 4KRYA 5K3DA 5EGNA 4AN0A 4Y2RA 3O4JA 3A2LA 4JH0A 3GZJA 4AZ0A 2PBLA 5A6VA 5LZ8A 1YA8A 1IMJA 1DTEA 4NVRA 1VOTA 3AIMA 5H3HA 3LCRA 4BP9A 5KREA 2VAXA 4W1PA 4I19A 3V1LA 1EB8A 2HDWA 4DTCA 3DL7A 3OOSA 4ROTA 1FFAA 3C6XA 3VJLA 1TCCA 3RK4A 2OCGA 1CUJA 2O2GA 4NS4A 1XZJA 3EF3A 1ZJ5A 2BUAA 1TIBA 1QIDA 2C7BA 4HRXA 4UPDA 2Q0XA 5AI6A 5LZ9A 5FDFA 1XZHA 4ZV7A 4CG1A 3I2GA 2CMFA 4W63A 1OILA 1XLVA 4OU5A 4BE4A 1DX6A 4DNFA 4GHWA 4J7AA 1BN6A 3W05A 1F8UA 1QIHA 5AOCA 2EDAA 4KE6A 3IUJA 2JGEA 2XUOA 4HRYA 2OGZA 3DS8A 2XUDA 3MVEA 1WPXA 2DHCA 1K5PA 2XMZA 4F21A 5C8XA 3E0XA 2G5PA 4F5ZA 5HF9A 1TRHA 1QIFA 1EX9A 5C7YA 1ODSA 1GQRA 2ACKA 4I4CA 1CUDA 2RI6A 2JGMA 2V96A 4FBLA 1DU4A 1L7RA 3H2KA 3OURA 2GBFA 1GT6A 1ZIXA 4GBGA 1WPRA 1YASA 1R4ZA 3STUA 1LPBB 3FYUC 1EVQA 1WM1A 3PE6A 3F98A 1ISPA 3VKFA 4UBJA 4LKOA 1G66A 3HACA 2H9YA 2OCLA 3VDXA 3M81A 3DOIA 6YASA 4BCDA 2CZQA 5AICA 5K3BA 4LXHA 2C0QA 3DQZA 5EHNA 2WFZA 3W2TA 5EIAA 1C7IA 3H1BA 2XQJA 1ZD3A 4M0FA 4M0MA 4H7EA 3FCYA 5JADA 4BP8A 4CI9A 1LZKA 4MWTA 4KAAA 2W6CX 1MAAA 5JZ9A 1QGED 3I28A 1Q83A 2ORYA 1GKLA 4HXEB 3FYUA 4N8DA 1AX9A 4B0OA 1SCQA 4J3JA 1J07A 2OQIA 2AJBA 1GQSA 4OU4A 2JGLA 4BAZA 3WKBA 1KU6A 1K4YA 1GPLA 2XMGA 1EHYA 4KR0A 1EDEA 3G9XA 5DWDA 4WJLA 2OG1A 3DCNA 1XZIA 4ZV9A 2OAEA 1P0PA 1ODTC 5IVDA 5ALEA 3LLCA 3IIIA 4EY6A 4S0XA 3O4IA 3DNMA 1GPNA 5JARA 4J0IA 2QJRA 4EY8A 1TQHA 3ZI7A 3C70A 4BBZA 3IURA 4C4XA 5HK9A 3AUKA 3C43A 4E14A 4EZIA 5CW2A 4Y2VA 2HHAA 5ESRA 3CN7A 2Z8ZA 2JGKA 5YASA 3D0KA 1BS9A 5DNUA 2OXEA 4EUSA 2HA7A 4HVTA 5F4ZA 3G8YA 3G0IA 2WHRA 1VXOA 3QH4A 4P9NA 2JEYA 5LKRA 3WK8A 4QLOA 5CH3A 5AM3A 1TCBA 2JGIA 5FPPA 2OGSA 3I6YA 5BWBA 1W76A 1X70A 1NU8A 4WY5A 2V97A 5ALPA 1VJ5A 5IKXA 3G0CA 1QE3A 3F96A 2CJPA 2J4CA 2DQZA 1CV2A 1J06A
chains in the Genus database with same CATH superfamily
2CNBA 3CH5A 5J63A 3JQ9C 2VHTA 3BIWA 3VTKA 4ZU1X 4L73A 1NRIA 4GYWA 4CV0A 2AF4C 1I01A 1WKBA 3KHTA 5DHRA 4CZ2A 1RWQA 3V4LA 1YHNA 2BH9A 3QF7A 1JHQA 4HDMB 2AD1A 4QJ5A 3CWQA 2QIOA 4C0HA 2QAGB 2UVPB 4WW0A 5CCDA 4HYEA 2IEDA 5AIBA 1VMIA 2PA0A 3KAJA 1U2GC 4MS4A 2IK8A 5J2UA 4YJ2F 4MIYA 3EY4A 2V6BA 4BVEA 4XE5A 3LVRE 4P7JA 1QO7A 3BH6A 3GRCA 1ONSA 1ZNYA 4K0KB 1NVWQ 4P3YA 4LXGA 1ML4A 4PGHA 3RV4A 5BOSB 3WWZA 4HATA 1B2RA 2TMYA 1BE0A 2IZ0A 1MDFA 1Q77A 1WVMA 2NZUG 1XKXA 5AXAA 2WINI 5AIAA 3H16A 1ISRA 4FMCF 4WFKA 2ORVA 3QEMA 1L7OA 4LOLA 4RM2A 4DDHA 1VYVA 4UNPA 3QPCA 1U3UA 1G6HA 3G82C 3UNXA 3ZLUA 1R4AA 4WFJA 1RMYA 5TDHA 1T0UA 5T4BA 2AFHB 3NYRA 3V3KA 2R5NA 3EGEA 2WIKA 3ZW9A 5LQDA 1JDUA 5JWOA 1OBCA 5CYGA 3AFIA 4I4TB 1DXOA 3NUQA 4LDNA 2JFUA 4J16A 4N7JA 4PS0A 4BB0A 4D0GA 4QU0A 1HRDA 1XYYA 4F2WA 3ZIDA 3BXFA 4AM8A 3FVVA 1PD0A 1NWCA 1XK7A 4Q4JB 5SV2A 1TKRA 2YN0A 3DMPA 3I23A 2VDVE 4BB9A 1ZICA 4IVPA 1PJTA 5E0OA 1DMSA 4M0EA 4M36A 1NBIA 1PR2A 2BFOA 2FN9A 2IZ5A 2MJLA 4XYBA 1SNYA 3QELA 1T4BA 4HXFB 4RV5A 3PF9A 1CUIA 1ZEJA 3D81A 1U2GA 3CURA 1X14A 2Z6QA 1VHLA 3G68A 1V3TA 2CLFB 3BDIA 3G02A 2ZRLA 2XY4A 3DDZX 1UMCB 1RRPA 2AHOA 3QQPA 1DBQA 2FZCA 4JB3A 4P84A 3W90A 5B2EA 2ERYA 1HQYE 3L4EA 4S3MA 1KMQA 2X2OA 2IL1A 4Z8YA 1PS9A 1BCRA 2L2QA 4LFBB 2WE8A 1CS0B 1PUXA 3K09C 5FUMA 5KX5B 1R6AA 4CTMA 2HZBA 5D5PA 1DKRA 1SQ0A 4HSEA 3STVA 4B32A 2TS1A 1EWTA 2IE8A 2XE7A 4L9WA 4RZXA 5HR5A 4J0DA 1HE5A 1X7GA 2ODPA 1L5KA 3MEQA 2BHTA 3KYCB 5LP6B 1NR1A 4C0BA 2TMGA 4NMHA 1RC0A 3CYFA 3VBCA 1PFQA 2XBUA 3FSEA 4IKPA 1N7GA 4ABYA 4F9FA 1K8RA 2VK2A 1J9GA 2I2WA 5BQ3A 3PWZA 5EGSA 4GEGA 4IIUA 1CUEA 5HHTA 2RHWA 3THWB 5HM8A 3WV5A 2G88A 3BMCA 3M3DA 3IJEB 4RWEA 2GRAA 5LA6B 2OA0A 1PK7A 3TLZA 4E13A 5C7IO 4HY3A 3WGTA 1SB8A 1E61A 1EYZA 2VKQA 2QB5A 1C7ZA 4ILEA 4F1KA 3OEYA 4OLFA 1E99A 2DU8A 2ZYTX 1XQWA 1FDVA 2GSWA 4Z9YA 1KSHA 2H7VA 2G1AA 1E9BA 4GR5A 5BR1A 1ID8A 1PJSA 1Q1GA 2ZI7A 4CMEA 5I51A 3S40A 2IY8A 3FOAA 3W2IA 1O4VA 4BLWA 2CSUA 4P83A 2ZZKA 3UWOA 2DXIA 5B58T 5JYEA 1CZRA 5BUSA 3BXHA 2KBEA 3UOGA 1W36D 3MA0A 5ADUS 1D0SA 3HBNA 3BD8A 3CVXA 1DJOA 4Y1GA 3CV3A 1X80A 2RHHA 4J2OA 3RHZA 1M0SA 1C41A 3GELA 5AP9A 1GGHA 2RB4A 1VG8A 4KFTA 3PUKA 3TXYA 4EGFA 1WG8A 5ENVA 2FXVA 3P27A 1RJGA 3D6HA 5BN3A 4TPKA 3DAOA 3KVVA 1H66A 2ZE7A 1F6WA 4ZI5A 3M33A 4KYTA 4A03A 4E51A 4QU9A 3ZY6A 1RBYA 3LY5A 4DC1A 1OTXA 2HH9A 1KZGB 2WJIA 2VBCA 4QECA 3IJRA 3DFIA 4D99A 1QRSA 2ZR8A 3R24A 1W8DA 3BXEA 5ICCA 1E2FA 2ZWOA 2G06A 1OB5A 2QUZA 2XQVA 3RSGA 3HY3A 2VAPA 5DNCA 3SOPA 1YFZA 2IWRA 3RIEA 5H68A 4EFMA 1FF9A 3G0GA 4JY7A 4N41A 4B3GA 5KZMB 4IIVA 1ZP6A 1YZQA 4F06A 1IZYA 2G40A 1GITA 2I76A 2E5WA 5T6BA 4CLOB 3MBOA 2Z0MA 5HIAA 2REBA 3GVHA 1U2SA 2VL7A 4JYBA 3K5PA 2P78A 4QDJA 5E1DA 4H3VA 2AL7A 1NXSA 2GYWA 3IVMA 5AK4A 1E32A 3R5FA 3ZBQA 1XPUA 2F1JA 5IJAA 3H4TA 4CT0A 4O8ZA 2P9HA 1EINA 2JL1A 1H2WA 2WWGA 3OPQA 3ICWA 3ESYA 3LC2O 4GX0A 3USES 3ZDAA 3NONA 4N0MA 3NATA 4MWEA 3AR6A 2V3CC 3NHLA 4TRNA 2HWKA 5FI1B 1H2XA 3JWIA 3QE2A 2FK7A 4QZVA 2BGIA 2WF9A 1VI2A 1UK9A 2AUMA 3USZA 3F1LA 4B6OA 2DSNA 3DMDA 2QGNA 1XCOA 1BOOA 4IIHA 4E7OA 4KXLA 3NWPA 4D8XA 1Y4SA 4BMXA 5FHQA 4C07A 4EKIA 3RT9A 2FW8A 5LQUA 3COJA 4M0UA 1A9SA 1V26A 5K3CA 3W8RA 5ES4B 1YI0A 1KFKB 1NVGA 3DOHA 3OQ6A 1CY7A 5EKDA 1E2HA 9ATCA 2ZRQA 3EWNA 3QYPA 2R4TA 4ISBA 4EKEA 1OU0A 3P9XA 2JI7A 2PQ2A 1C3OB 3G2IA 3Q0EA 2H2GA 4HZIA 4XGRA 4XARA 4C20A 4RXTA 1MORA 1WUJS 1ECPA 1NDQA 3OJFA 1YAHA 1RQXA 2OV3A 1YBMA 1KORA 3N5KA 3GJ4A 1UZUA 3V4PB 2WKQA 5EWLA 4PZ9A 1FP4A 2Z1NA 1KXJA 3E2IA 4EHNA 1M67A 1G7TA 3LYUA 1YULA 3MGKA 2JBAA 2NPIA 4O2RA 2Y6UA 2CHUA 1WAMA 4LC9A 4PLFA 3TD2A 5KSZA 1RKUA 2IDJA 2IBTA 1SC6A 1ZC4A 4U8HA 1LI5A 2WM3A 3HGTA 4NL4H 4JFRA 5J9FA 1VE7A 1XLTC 1XQ9A 2WIDA 3DE4X 3E9MA 2ZRGA 4XPIA 1Z2PX 2WVAA 3HU3A 4ZVQA 4D43A 3B1WA 3TMAA 3FXAA 3FWZA 1A9XA 3M8KA 2A1TS 3CSUA 2XCSB 3D6UA 4YNBA 3ILXA 4KAJA 4Q4CA 4R2IA 3EB9A 2Q99A 4Y6LA 4OREX 1JEEA 1SA0B 2OCAA 2ZAIA 3D3KA 3WYAA 5AW9A 5KDDA 4IDCA 4RE6A 2RG1A 4YP9A 2O3QA 2VNAA 2ZIUB 2OSVA 3C6YA 1V9SA 3B1ZA 4R2WA 1GGKA 3W8DA 3FMPB 1WBBA 5FBRB 4FC7A 1SOVA 3SKVA 1K5GA 4KXUA 5JD6A 4B6RA 4Q3KA 3BTVA 2B8JA 1TGVA 2XYVA 4ZI7A 1J49A 1VRCA 3AI7A 3B70A 5LB4A 1DBPA 1KBZA 1HZJA 1T6NA 1J9EA 4GX1A 5ESXA 1JIKA 3D4BA 4HX5A 1FYDA 3KZNA 4PZ0A 2ROQA 2R4UA 1K4MA 4JL8A 1CUUA 1JT9A 3MUFA 4C4SA 1W5AA 2V7UA 1NVEA 1DO2A 1KQNA 5CVEA 2PH5A 1XX6A 2A9VA 1PN3A 3GL9A 1YTUA 2DETA 4GMGA 1KMHB 1WD7A 1WUHS 1XD2B 4FS8A 3TVTA 1TYAE 3F47A 1A9RA 3T1OA 4EYQA 4DUPA 3JAMA 3EZGA 4C43A 3HBAA 4UUPA 4NCBA 2RMKA 4QUDA 1PSWA 3PA6A 1YZFA 4L22A 1FU7A 1LFAA 2P2NA 3KQTA 1I3OA 3U40A 1W25A 4XX0A 4XZ3A 5GAJA 3ZWQA 1N5MA 3EFEA 3GP5A 3L6DA 5HYVA 3PFCA 1GZ5A 4CFSA 1XLTA 621PA 1GDTA 4URWR 1SIUA 3WRWA 1II8B 2XF2A 5ELMA 4E4RA 4IH4A 1F3OA 1IRIA 1NSFA 1T3SA 3KPYA 1G4HA 3BE8A 1C9JA 2HF7A 2VUIB 4IRUB 1RLOA 2QSUA 4ZANA 3BJEA 1VLVA 1L0BA 3N07A 3QU4A 2IYEA 4J0JA 3UTDA 3QVMA 1PVDA 2WOJA 3QF4A 3V4SA 3ZLTA 2PPVA 3RGWS 1SEVA 3HTXA 2H6EA 1L5RA 1K2VN 3E35A 3Q11A 5AO9A 2R1ZA 3CJTA 4E6PA 1LTKA 3KZKA 4M1YA 2ZZMA 1XRRA 3TQHA 1QR6A 1CY1A 1OBHA 4JLDA 2OK7A 1UMBB 3VYWA 4MRNA 2MHCA 1THZA 4RMNA 1AHIA 2EZ9A 1Q16A 3WDSA 3B6KA 4BYMA 3PNPA 4GWGA 5K8TA 1AZWA 3GD5A 3E0QA 2RGRA 2V6IA 4NARA 4D9GA 1D04A 4R69A 1BXRB 1L4MA 3BWBA 2E3JA 1N1MA 3FGPA 4LRTB 3PLAE 3OKCA 5CA0A 4P4SB 2PBFA 3FPGA 2O54A 4Z4IA 5CT6A 5CM2Z 5BSVA 4BQRA 1W1WA 3QLUC 3EVEA 1T43A 1C9NA 2HIGA 4HLQB 1ACLA 4O29A 2IZ7A 5ALSA 4BGIA 1DOAA 1F8FA 4YCMA 5KU1A 1TEZA 4HTFB 3O3NB 1PGOA 2CXSA 3U3DA 4AS3A 4ZA2A 1OI4A 4Y30A 3AG5A 1LS1A 2QTCA 1K0FA 4O8CA 5AHOA 1T26A 2FKAA 2PL9A 2ZXUA 2AOXA 5H82A 1NT2A 4EYSA 3K4HA 3R1IA 3VR3D 3I01M 4KL8S 1W5BA 2PT5A 2VJKA 3CUEF 4P0QB 1XVTA 2ZQYA 3HCCA 3EGXA 4DQXA 1ISIA 1CUVA 3I6MA 4NFHA 3ETGA 3W9UA 3AKZA 3D59A 4DIDA 1DEAA 2VPXA 2FZWA 4R3WA 5K09A 5CCXA 2NV2B 3WAGA 4PAGA 4TRMA 5FBVB 2WF5A 4HUTA 4U9HS 5KMGB 4GPIB 1N3LA 3MTBA 4B6EA 2BP7B 2OO5C 4J3FA 1P6UA 4NPCA 4YJGA 5ALUA 2YRFA 4YMTA 1YUBA 3ZWMA 1UDWA 2RGUA 5E2AA 2GTHA 3DE2X 3R3ZA 3C3EA 3EYWA 4KDRA 3OKFA 2Z2YA 3EOBI 4C7JA 4BAGA 1RHRA 3ECCA 3LCVB 1PT8A 2HPVA 4GZ6A 1AA9A 4X41A 4PPYA 4AXXA 2VOEA 5ALZA 4Q1AA 4UTPA 1I36A 3AVVA 3BOSA 4D4LA 1VBMA 1XFAA 1PEAA 4JJ6A 1Y98A 1ISFA 4FOOA 3RRMA 2GXUA 3MTGA 3AEUB 3PF8A 4BO4A 3QLUA 3PC3A 4X65B 2YNMD 4KPYA 5KQSA 3FM9A 3MAGA 4YRMA 3NH9A 1XKQA 4Q9KA 2JIOA 3I62A 3V48A 1O0BA 2ZK7A 3MK31 2AMVA 1X9IA 4RK4A 1ZJ4A 2EP7A 1E2DA 3GIDA 4TWJA 4B1FA 7REQB 3G9TA 4AF6A 3CKMA 3DLPX 1JR2A 2X4GA 3S2SA 5LL6P 3AHDA 1TVKB 1S3IA 4W7IA 3B13B 5TE9A 4HDCA 4XUDA 3VO9A 2XMPA 2ZAMA 4XWWA 5CFRA 1BMTA 3H8SA 4E5SA 5JZVA 1XXLA 2JDID 4JBGA 5BMVF 2GM4A 3VZDA 3OCJA 2DFDA 4YRFA 4A26A 1O6GA 5H5JA 2JF0A 3LZCA 1NW6A 1ZISA 3QX7A 2Y4NA 3QNMA 3FGNA 4DC9A 3R6LA 4BIIA 2C7PA 1VPTA 4OHCA 3TUIC 3IL2A 2QX6A 3Q8KA 2ECKA 2OO5A 4KLNA 4X91A 1R3UA 2XADA 3TL3A 2O5VA 1Q22A 1Z2AA 1JG1A 4OL9A 5FYDA 4MARA 2AQ8A 3NP7A 2RHTA 4OGFA 5AVJA 5H0IA 3SBEA 3U7QB 2YOHA 1UPCA 2ODWA 1Y1TA 4RM3A 3SF0A 2QORA 2E5LB 3PVCA 3TZBA 3VR4H 4RZIA 4XLZA 4EA6A 1G60A 5AQEA 1L7BA 4F8YA 5ALXA 4K8RB 5JH7B 5G4KB 2NV0A 1OLSA 1T34A 3F97A 3ETNA 1P62B 5EHGA 1F14A 1W0JD 4A2CA 1Y8AA 4JZKA 4G37A 4NV3A 2IEGA 4Q4HB 3U0BA 3ZDRA 4ZJUA 3I2IA 3RADC 3DZDA 5K6AA 1BAPA 1HG1A 2H59A 3DTYA 2B35A 1JHVA 3LPLA 3DDSA 1T9DA 2P0AA 3EVBA 2A0UA 4O1HA 4CQJA 1L9XA 4NBUA 4DILA 4B43A 1RAHA 3FDIA 3PIIA 3HKDB 5ELLA 2Y1LA 2G8LA 1AKTA 1WQ1R 1WU8A 1ZNZA 2CL5A 3BRWD 3AKYA 4HMQA 4RV4A 2ACVA 1QK5A 4JLMA 3ACBA 1J0AA 3SU8A 4Q37A 1Y5RA 5DTQA 1FSSA 1KMNA 3G6WA 2QLLA 1Y1PA 3P2MA 4M4SA 2J4FA 1TF2A 2Q50A 1KAMA 3OEHA 1Z5PA 4H60A 5COBA 3RS8A 3DCJA 3VX4A 5BWLA 1WIWA 3ITEA 3KO8A 3TCXB 3OLWA 4RHEA 5CNMA 5CXXA 1JDJA 4PLCA 3T8YA 1K9SA 4JR2A 4XYGA 3GJ7A 5KKCA 1TC2A 3AHHA 3PFHA 5MF6A 4CQMA 4GW3A 1VJTA 3V8QA 4UOEA 3Q2KA 2A67A 1NW7A 1OV4A 3KBOA 3TD6A 4CIVA 3P32A 1C2YA 3TSOA 4NDZA 1UPXA 4XAQA 3TNJA 2GD2A 1JLMA 2ASEA 1QOQB 1QIMA 4YRIA 4Q16A 2MTBA 3PBKA 3FPAA 4GOKA 3BIXA 1Y3DE 5REQA 1Q91A 1TKAA 5I9LA 2G1JA 4H7HA 2REQA 5K4GA 5KNLA 3CGWA 4MYTA 2HM7A 4BE7B 1M1YA 2F1IA 2GHIA 2ZRKA 4KE8A 5JATA 3EZ6A 4INZA 1L7XA 3SJUA 1IRXA 3OKPA 5DX8A 2OCPA 4O2BA 4U7DA 4O4LF 4WXMA 3L7MA 2YXPX 4CMJA 3Q3EA 3VNQA 3L7OA 1U7XA 5FWXB 1T8SA 1VIYA 3I32A 2N75A 4RC9A 1IE3A 4UOQA 4FMBB 4QGFA 2ZE8A 3AL3A 2H5LA 4G5GA 3WLHA 2QD1A 1LNZA 2O8BB 3PRJA 3CLSC 2DC1A 4H0CA 1CLUA 1JT2A 1ZUIA 2FLWA 4JASB 1CUBA 1WMFA 2JFFA 3GNLA 4GPZA 3I9JA 2ZS7A 2MYUA 4GLLA 4DMCA 5BSFA 1IQ0A 4PFSA 4GBED 5K8LA 3G2HA 3I1IA 3TPFA 3JQFA 2XXJA 4QPJC 3VNBA 5JANA 5CH8A 1T2NA 4DRYA 2J0UB 3JTEA 1FP7A 4XDYA 1PX0A 4XVUA 5CDYA 2H48A 3DTVB 1JYSA 3GBSA 4KXVA 4N3CA 5DV9A 4F3NA 3EF0A 3OUZA 5BW4A 2HGZA 2X5XA 1XHFA 2B83A 1JR3A 2ZT5A 3LP6A 4YRRA 3DE1X 3G0BA 3OJ0A 4YO7A 1X7WA 5DSTA 5I8ZA 3U4AA 1PJ2A 3ZV4A 1NYTA 2YOGA 1GDDA 3WJAA 3ADCA 3LSTA 2HI0A 3A2MA 5E6SB 4DQLA 1KMMA 1VLQA 3LPNA 4WSOA 5JLAA 3Q12A 5THXA 3T9CA 4BLPA 1AMNA 1R0XA 4UFNA 2X2FA 3HP1A 4YYEA 5IT5A 2PR2A 3JWGA 1VMKA 1G19A 1BDBA 2GAOA 2GNOA 3OLQA 4G0YA 2ZRPA 1RC8A 1E7QA 2Z83A 2QXUA 3EQ6A 3WHPA 4KVZA 1QJCA 4YAFA 3HJUA 4LQLA 3THYB 2P1RA 4RUKA 1S2LA 1UIRA 2PGXA 3PFGA 1D2HA 1XHEA 1JG4A 4BMDA 2DKNA 3TSZA 3U4HA 2XF8A 1EFVB 1FRZA 5A4JA 2BONA 1KI4A 4HNAB 3O8OA 2NPOA 3RRZA 3T7TA 4ME6A 3P9IA 5D2CA 1E3TA 5FOQA 3FMOB 3LOPA 2VK8A 4AO7A 3G1UA 3PFFA 1ILEA 4JSYA 5K05A 4I4LA 1VECA 5M29A 2FNAA 4YUAA 1XWFA 3QKRA 2X0DA 2GJ8A 5B53A 4Q00A 4EWLA 2XUZA 2PKWA 1MQAA 3CH4B 2PDAA 1UJNA 1ODLA 4QA9A 2WM2A 4WXRA 3TOCA 2OHGA 4ZRDA 1N9KA 4DY6A 5JO0A 3GGJA 2RHJA 1OWMA 2DP4E 2GI4A 4UDOA 5AKGA 4N3AA 5JZOA 5HKAA 5FOUA 2C97A 4ITVA 2D7DA 4MVJI 2TYSB 1FLNA 5C9ZA 1C7EA 4GECA 4L2IB 1MR3F 4BLOA 1M7BA 1G16A 2VP6A 5JMTA 2DWUA 2ZWMA 3GCGA 3HHPA 2YJZA 1V71A 1UPUA 4MCJA 5ALFA 1W4CA 4OO3A 4BE9A 2ZETA 3A14A 3IKTA 1W2GA 2VHJA 2VEOA 4GT1A 4W7HA 5BYAA 1OASA 2CXHA 1S3GA 3SC6A 1IHXA 2VPYA 2NZXA 5AVZA 3BXOA 3DYIA 2N47A 2QYSA 3L7DA 4IV0A 2OYCA 2YYAA 4YDHB 5M7EA 2R25B 1W49A 5AJWA 2J3JA 1V6AA 4LZJA 4QG3A 1YBFA 3ZK8A 4XB2A 4ZYUA 4JROA 4N5HX 2VDRB 3A26A 4RPGA 3IE1A 1VHJA 3A0RB 2PKCA 4FFWA 2HJWA 2XKAA 3DKRA 1NBOA 1XNGA 4FEYA 4R1UA 4DLUA 2BGLA 4FKZA 4TV8F 4ALKA 4AU1A 4G2NA 4WCFB 5K0ZA 1NKSA 3AX6A 2H1WA 1VYHA 4XDHA 3MGBA 5BY2A 2ETVA 2GK7A 3CE9A 2IHYA 4L15A 1WRBA 1UDAA 1CUWA 1YRBA 4LZWA 1AHPA 1JPVA 1U5BA 4QXOA 4UNNA 3T3HA 4FGUA 4LDJA 4I1SA 5DGTA 4LF4B 3WHKA 3REOA 2PUFA 4RD1A 4BGDA 2XVAA 1C3JA 4RFVA 3VI4B 1Y5MA 2W2LD 5CMLA 1U6JA 1OGJA 3O91A 4B73A 4EFDA 1H4SA 1JXAA 4MIEA 1FDIA 1PVVA 5KVQA 5CB0A 1ZL0A 2GNPA 4E2WA 2DLNA 1CXZA 3RYIA 1R3DA 3RG2A 2PJZA 2UYYA 3WGJA 2O2SA 5C0OE 5JSUA 3PUWA 3VNAA 5F23A 5EN4A 1PWEA 1BWPA 5JNWA 3AR4A 5THKA 3QEBZ 1P73A 1W6RA 4B6QA 4WACA 5T57A 5T5QA 1Y9AA 4IDGA 2B1GA 2ZTHA 4MDHA 4Z6KA 1CUYA 3GFFA 1YB5A 1RHKA 3EEBA 3AM1A 4BYGA 2FRXA 1XN4A 1IM5A 5B7PA 5JSQA 3T34A 2A5FA 2G71A 2PRIA 3JU3A 4F12A 2EW2A 1XRPA 3HDHA 1ABEA 4HDKB 1N5KA 4I1OA 4C0SA 4DL9A 2P3OA 4LE0A 1OH7A 3N0VA 2GYUA 2G0NA 4ZARA 1NW9B 2JIQA 2ZBQA 4FEGA 2RGEA 4I9GA 1ZJWA 4G67A 2JJ1A 2A33A 4FR0A 1W73A 4MVJD 1PZMA 1I4DD 3KQMA 4CW7A 3AJAA 3ASYA 3HA7A 3FBTA 1E94E 3IBSA 2WJ3A 3IAEA 5EINA 2A88A 2Z2KA 3HKBA 1FFSA 1RYBA 1Y7IA 3L8GA 3NW9A 1NVBA 3Q87B 4YACA 4AMVA 3E7XA 2YV5A 1D2GA 1SG9A 1W5SA 3A9SA 3FPBA 1RQLA 1JG7A 3LUDA 4MRMA 1E3IA 5IBCA 1UKZA 1S1CA 3B9BA 3O93A 1XKLA 1DV1A 1TYEB 2QLMA 2B0CA 3ET5A 3WNDA 2F8TA 3W5SA 2JLCA 2B2NA 3GJZA 1ZQ9A 3RHSA 2HU8A 2IIBA 3O1HB 1R4MA 1FQJA 4B83A 3F5MA 4JLVA 2PSFA 4WESB 3R7WB 1THMA 4MUNA 1RJWA 4X6LA 1JEAA 4LYGA 4LNHA 2ABWA 4DMGA 2XSZD 4MQ4A 3QJ5A 1XHLA 3IRUA 2OHIA 2XVXA 4X8LA 4JI6B 3OESA 3Q9SA 2C5LA 4AKHA 2C4HA 1B8PA 3NCHA 4KFSA 5J2TA 2F3TA 5ITVA 1MJ5A 4F46A 1JHZA 4I9UA 4H18A 2OVBA 1SWVA 1K75A 4G0ZA 2IUUA 2SKCA 3GUVA 2CHGA 2X8LA 3TN7A 1ODFA 3O8CA 3JQ8B 4NHOA 2X4IA 2YUIA 4I50A 3X1DA 5B1EA 2Y92A 4ZOLA 3REFA 3UK2A 4MIKA 1QAOA 3BUSA 1E3WB 2ZYSA 1IXSB 2WVGA 1Y3CE 3AB8A 2AF3C 1AY0A 1R2QA 5AXBA 4XD7A 2F9FA 1G7SA 2EZUA 1AXEA 4BVHA 2Z2JA 4OLJA 5C80A 1AK9A 1EXNA 1NR7A 1XC7A 1NUPA 1MAVA 3OE5A 4NMWA 3E03A 4CIXA 3EGDA 2ENWA 3JQRA 1XU7A 1P9NA 2HA6A 3U6KA 3ER6A 1FVHA 2PKYX 7YASA 2UDPA 2DHDA 3ABSB 3MZ0A 2B7BA 3EQ2A 2UU9B 3BWEA 4I08A 1H69A 3ZJYA 4A27A 4ZPXA 3CNEA 1G21A 2AG6A 3NDRA 3Q98A 1NZDA 5F9MA 1YCDA 4X93A 5FOWA 4EMUA 4YQFA 2DFLA 4IKEA 2QMUA 5BPFA 3TUJC 5AM5A 1PJ3A 3WDKA 1ZL2A 4G25A 3N70A 4HNQA 3T3DA 5IVKA 4OMDA 3BCUA 2CUNA 1CNMA 1UBCA 2YYSA 4QLBA 2H57A 1R0BA 3O4GA 4YAEA 4EKYA 2D54A 2NN3C 3NIWA 5F78A 1JZSA 2C9MA 1XTTA 3FZQA 2FMXA 2VHYA 1GCGA 5DIFA 3HCOA 4MZXA 3TTXA 2O3JA 3FOBA 4RKFA 4BOYA 3EDQA 1U1DA 3OEWA 2EEPA 2IEYA 4H6XA 4YUXA 3G6KA 3E22B 2PX8A 3CEPB 1JPJA 3IAM1 1WHTA 1JBEA 3AERB 4UUOA 3CUTA 3QMVA 3C5WP 4ZGWA 1S02A 4M98A 1J23A 4URXR 4WINA 1KDOA 4REMA 3EMDA 3REQA 1Z6ZA 3RTEA 3X43A 5JDIC 4F0JA 4CIYA 1G3RA 1QYVA 3COVA 3N59A 3OJCA 4BMYA 1M2NA 3I1FA 3IULA 4Y98A 5DASA 1UK7A 2HMSA 4JA2A 5E6UB 2QTNA 4EF4A 4MI1A 3JS5A 5IMSA 3IAS6 3UMFA 1U2DC 1NG9A 1P2DA 3HV0A 1BW9A 4AN1A 4R1NA 1NQAO 4QYTA 3LQ2A 1QAMA 4BBJA 4NI5A 1Q7TA 4J07A 2AN5A 1J8DA 2XQIA 4FHEA 2VBIA 4Q4DA 1JSRA 5B37A 1HTTA 1C50A 3LBIA 1DMRA 3PGJA 4GR4A 4C30A 3MS4A 1S1MA 4R81A 2CXUA 4UHHA 4BO5A 4BN0A 3FHTA 2HIHA 1BWRA 2VVTA 1VKOA 1A9TA 1GEGA 3LT0A 4W9NC 3TX2A 5HDQA 4F1JA 3KQOA 1MU0A 3PDCA 4PAWA 3TIIA 2GQ0A 3U3OA 1PFYA 3ROEA 1WA5A 4LJ8A 1BXGA 3QE3A 1WTCA 1K3UB 1W46A 1WW3A 3C8MA 3N2GA 4IUBS 4WLOA 4ZDIA 4CF3A 1M6WA 3J7TA 1K3TA 2Z58A 2GJ9A 4NYMR 2VDWB 3LDAA 1O9GA 2VCYA 1GQQA 1QOZA 2XGJA 4EF5A 3FYTA 4EHFA 4N0DA 3VR1A 1KVRA 4WXYB 2O3UA 1P6QA 4JVOA 3AVTA 2QM0A 1KTVA 3Q85A 1YQUA 3AIIA 5AXCA 3I4CA 3RSLA 3FTCA 3ZKAA 2JFVA 4MO2A 3OCCA 2Q6TA 4L4YA 1G3IA 2IELA 2XYRA 3ETEA 4G3XA 4OHOA 5KJFA 2XWQA 2XUQA 4JCOA 1YRWA 3IFSA 1Y1KE 2ZYAA 2PUHA 2C31A 3DZGA 2G4VA 4N82A 5AI0A 4A4DA 1AN0A 5JT1A 3SKYA 2FW6A 1H4QA 2HU5A 4ED9A 3HDJA 2J87A 4J29A 2WHQA 2OYSA 5IVIA 1CQIB 3AF5A 2K7FA 3ZHRA 4LZPA 4YBZA 3RC1A 4B84A 5HUJA 1VFNA 3R7BA 3BT7A 1KFBB 4Z8XA 3TTTA 4QOJA 2YUTA 4TTVA 1MG5A 4OB7A 4OGGA 3LKVA 5KUTA 3NHFA 4U5QA 2PZFA 5T41A 5LMUB 5AJZA 3HVJA 1AURA 3OF2A 2IYVA 2EIXA 3BE5A 5DBOA 2C8LA 4LJAA 4U39A 3FJOA 4W9NA 2I9PA 3LT4A 1EE9A 1VCMA 4L8WB 5AKKA 1QYRA 4R8SA 1B6RA 4JJEA 2UYQA 4G0MA 5CDTA 3R44A 1E1CA 4EOGA 1GGFA 5LNK6 1G3QA 4W5OA 3SQXA 3YASA 2GCIA 4IJQA 3M1YA 1WMAA 2Q1UA 3IP5A 5BV2P 5EZYB 3UATA 13PKA 1DP4A 1ZSVA 2BBSA 4QXAA 3UJDA 4DJFC 1Y8RA 2GKSA 1S96A 1O87A 1OW3B 2G5TA 3SNHA 1E0JA 2AJTA 4LOKA 2IRWA 1D1QA 1SHJA 3M1LA 2XMDA 2ATEA 4US2R 1EFPA 5JG7A 1B0AA 4RGVA 1MQ8B 1K8ZB 4BMNA 4ZC8A 1RZVA 4UM7A 3SBDA 4EG1A 1NQXA 2I4OA 4L95C 4WNAA 1BE1A 3EIUA 4LI0A 5IT4A 3I6QA 2R8YA 5K51A 1CKEA 4RLQA 2ZRIA 5TGZA 2HRDA 2XAAA 3HY6A 3LVFO 5A4FS 1OFVA 4AJNA 2N1MA 1E7YA 4B7AA 1NVTA 2C0PA 1QLWA 1U9YA 4WQMA 4Z1OA 2VJMB 4XGKA 3LZ6A 1QZZA 4EB3A 4MV0A 4ZXFA 3U7GA 3CLUD 2NO7A 1I3LA 4D57A 3NJ4A 3LO8A 4QNNA 5DF1A 5HK8A 3TL6A 3UG6A 1P4AA 2HWWA 1SZJG 3MCUA 4HBZA 3PVZA 3DMNA 3K15A 5JO9A 3ZHXA 3WBFA 1LPSA 1E3QA 3A31A 4CL2A 4N0EA 4KR6A 1CJSA 5BRNA 2E4XA 2HDNB 5K9ZA 1V43A 2P67A 4HPXB 4A8JB 2AG5A 2DUJA 4ZZ2A 4AJ9A 4KR7A 3T41A 3TM4A 4AZVA 3DZKA 1Q50A 2JVIA 2WJAA 1LW7A 4ROSA 1KR5A 4IOKA 4WJKB 1FLAA 2PRZA 1BX0A 2WWWA 2F3UA 1TD9A 3B1JA 2PCLA 5FWAA 3RUHA 1H3FA 1LUAA 1T24A 2JFOA 3JZAA 4QHYA 1PK9A 5ISMA 1VLJA 3ORHA 1XJWA 4ZCQA 3A06A 3ZVKA 1OX4B 4YMLA 2YFQA 3DXYA 4JOCA 3X44A 3R9XA 3WFJA 3H2HA 2VAMA 2WFMA 4LSMA 3QV2A 4FN5A 3H2BA 1LF5A 1J21A 5FUQA 1ZBQA 2F1RA 1H6CA 5KYUA 4Z7JA 1N6LA 3CG0A 1LBHA 2WU1A 4QVKA 1O8BA 1DJNA 1FBTA 3C5CA 1F06A 3DBHB 3IP6A 2I4IA 3LK6A 4LYEA 2PZEA 4FYMA 4G1MB 4OXNA 3VOAA 1OXMA 5A02A 1KBOA 3OJXA 3HB4X 2EW1A 3E9YA 4GMFA 3WLMA 1QC5B 4IXDA 1KY2A 5A6SB 1EPUA 1A8HA 5EXEA 1RLJA 1SXJD 2OCKA 1Z4MA 4D4MA 2P9CA 1V3QE 2I3AA 3QJYA 3ZU3A 4CEIB 1HNWB 4QDUA 5DLPA 2JFPA 1BGVA 1D9XA 3I9NA 3KU1A 2VTBB 1NUHA 4D02A 1REQB 3GMDA 2EJWA 2XKKA 1I0ZA 5IEJA 2GAAA 1UFKA 3GFTA 5A9SA 2GRUA 1X8KA 1L7NA 2BM9A 3WICA 3AU9A 3EPPA 4D9EA 1ADFA 3QIVA 1RIFA 4QWWA 4Y2QA 2H1LA 4OI4A 5D3MB 3LFTA 2VF2A 1P8JA 1ONNA 3I2HA 3ER9A 3OQMA 1I3MA 3GWZA 1ISHA 4LNUB 4JIGA 4A10A 1G8AA 2C92A 4BLSA 3I9V1 2YMMA 2YMPA 5D5HA 1TZ2A 3A32A 3LAWA 3V42A 5A62A 1ZM2A 2Q8QA 3M89A 2QM8A 3I04A 1VGQA 3OE7D 2IFTA 3FMFA 5FHRA 1P9LA 3GMTA 2AEMA 2Q29A 2I3BA 1J8MF 3L0OA 4HDAA 4KVGA 4RE5A 4P58A 3NS7A 1AG9A 1IULA 1HFEL 5BN5B 1IZ7A 1VDZA 3I42A 4JA0A 4NZPA 5FKJA 5CDFA 3LGAA 4JI1B 4RZQA 1E2PA 1RAFA 4UM9B 1YOVB 4ESHA 3U44B 4B7ZA 5JXHA 1EGVB 3CO5A 3CLVA 2DLCX 1K63A 1Z08A 1TM1E 3B5EA 4WOJA 4DG8A 3NHJA 4KSYA 4BJ5A 1XPJA 4BQFA 2CLEB 2XRMA 3HYRA 2CUTA 5CU7A 1LRKA 2Y93A 2GN8A 5JIBA 4BVGA 5L45A 1P0QA 3DSRA 3OQPA 5C5DA 4UUQA 1RPZA 3QG5A 4CCYA 4E5PA 3GLGA 4RZ2A 4EY5A 1HT1E 1GRQA 4KTVE 3RG8A 5CXUA 4ZAXA 2OO3A 5L40A 2VJYA 2XE6A 3QP9A 3GD7A 1PFWA 2PH3A 3RQSA 3AINA 4JN6B 1V3VA 4HO1X 4N8SA 2Z5FA 2V7VA 5HF8A 1OLOA 2H00A 2NU7B 3TBFA 3H9UA 4F2DA 4MR8A 4PZZA 1PQUA 2QX4A 1KJ9A 1ZONA 4Q24A 3H2JA 2HCFA 3JQ6A 4OHUA 4RANA 1NLMA 1WL8A 5IU6A 4HN9A 1KH2A 4PAMA 3S2EA 1COZA 2PUBA 2V1XA 4GXNA 3O4HA 3HADA 4IZIA 4MS1A 4X6XA 3OTWA 5IFKA 4NFYA 2IYQA 2PBRA 2ZPAA 1ENZA 1W4LA 2D2XA 2NZ2A 5TT1A 5IWAB 4RADA 2P6PA 4JUIA 5FB3A 2ET6A 4EEKA 2OXCA 1FRQA 5CT8A 4MS4B 5J2UB 2X8AA 2G5GX 2NU8A 4KKXB 4U0JA 2OXRA 1JDBC 3AWIA 2J0EA 3VDNB 2II6A 3Q5GA 1P75A 4KE9A 1KI8A 3DOJA 2CNNA 4Y2SA 2B0JA 3UGJA 1IHYA 2XMSA 3VC7A 1P1RA 2XT0A 4JT8A 2PX6A 1UBLS 3N7TA 2W6OA 4CDGA 5TARA 3T94A 4JKIA 4JJ7A 4P0TA 1YQDA 2BYTA 1Q12A 2CVQA 1BE8A 3F6EX 2CMDA 4JZYA 4GRIA 3K70D 1RW4A 4ZVVA 3C3CA 3P19A 5HJ2A 2IWHA 2YVKA 2W83A 2ZTUA 2YWGA 3FYCA 3KEMA 2BMVA 3QEMB 4G81A 4YH1A 3CXRA 5DNWA 4EK9A 1LBTA 1M2JA 5FUVA 4ARUA 4NH4A 4HDNB 2QJFA 3EXG1 4YVFA 1YS9A 3GFQA 4MRSA 3O82A 4ID3A 1A4UA 3F90A 4DC0A 2FUG6 2H29A 1TFUA 2P27A 2HDHA 1UFQA 3C8ZA 4DBVO 5T6MA 3GN2A 1MVOA 1N8NA 1F2UA 1EGHA 2XX3A 3O9MA 2HLHA 3N53A 1SUPA 3EVZA 1NV9A 2JGAA 5SZJA 1AGNA 3WZMA 5IKMA 3OIVA 2QU8A 3BL8A 2EJVA 4FJ1A 5LDDC 2MSDB 1UC4B 4MPPA 2NTNA 3W6ZA 3MRVA 3WLTA 3ZY2A 4M21A 1QMPA 4LY3A 4V2UA 1RZUA 2CD9A 4IH1A 1H6BA 4PR3A 3AW8A 3L04A 4W8GA 2FN3A 5C18A 2IX3A 2CT8A 4R01A 1ZGJA 2ZRMA 5TMEA 3W1WA 3IPRA 1O97D 4B33A 4FILA 2DMRA 3S7TA 4YT8A 3F4KA 4GMDA 3AILA 2R85A 4AJJA 4DQUA 4QAQA 3RC9A 4D8TA 4IMRA 2KQUA 3MSXA 2Q5OA 1B23P 1I5RA 1S7CA 5GONA 4GS5A 4MWCA 5L3SA 1UT5A 3UWSA 3N75A 4NZOA 3WLKX 2GLTA 1M2FA 2PLWA 3ODPA 2C4UA 3KR9A 3NBXX 3LTEA 3D4PA 4L9SA 4Q9DA 3A1CA 1BCRB 2WRZA 2WWTA 1L5HA 3PEYA 3D8UA 4IEFB 4JJIA 1NVVR 1PLLA 4TSRA 4FFBB 3S0JA 5KWIA 3VU1A 1SN7A 1QG6A 5L9AA 2R4QA 1M1UA 1SHUX 4V0RA 3PYXA 3R3HA 4DLNA 1WDTA 4N5DA 1I14A 4PLVA 3BGVA 5E9AA 5TS3A 1SUAA 2DUMA 4EW2A 1CPYA 1P1HA 4F3KA 2UUAB 3X2EA 3NDIA 1NVUQ 5ALHA 1XWIA 1BZYA 5DSZA 5KBYA 4OXXA 4TZ6A 2H65A 2H5JA 4U7FA 5L7TA 1OH5A 3OQOA 2XVMA 2BZGA 3PD0A 4GI7A 4IIDA 5IJWA 3EIQA 1ID1A 1V95A 3ZGNA 2FWJA 3H42B 4ZVUA 2RGGA 3PFIA 2RJ3A 4LZNA 4OMCA 1FU8A 5I7OA 1M0WA 1TM5E 4YP6A 1AK1A 1LC3A 4AZSA 2JAOA 4GOLD 4JYCA 5BSHA 2JJ2D 3TDNA 2VDJA 1MF7A 3DMTC 4R1QA 1ZPDA 3DPSA 5FUXA 5F7ZA 3HBJA 2ZITA 1IVYA 3TQRA 2O1WA 1W48A 2UKDA 3LX5A 1GG9A 2Q2QA 3IS3A 4O4HB 1IM2A 4F3TA 2QJWA 4E5NA 1ZN2A 1UQUA 3MWLA 4HDQB 2VDMB 4QGSA 4ABTA 1N9ZA 4MPDA 1KU0A 3IQIX 3MTDA 4IIEA 4P53A 3CPEA 4QDXA 1JG2A 4IGEA 4EY3A 2OHHA 4PYNA 3VR3A 1WP4A 2H1FA 1K8XB 2XZPA 4HDOB 5EUQB 1KZ7B 4JELA 3W9BA 3BBPA 5G1OA 4HB3A 4D9MA 2R79A 5P21A 2B4YA 1X80B 3AG6A 1PZFA 1T1IA 4KLCA 1CJMA 2VPWA 5DHFA 5JECA 4I5FA 4YQYA 1HT3A 2HT1A 3TLAA 1GO2A 5EXTA 3R5JA 4RIFA 2EFGA 5FA5A 2VKTA 4DCNA 5LVAA 5BN3B 3C3PA 4DREA 1LNSA 1NLFA 2C2GA 3RT7A 2F8SA 3LBFA 3LNTA 2E55A 3UAYA 3BMNA 1MC5A 1GSHA 1HURA 3NO4A 1QFXA 4HI0E 4NONA 4UBIA 5DISB 4M22A 3RFXA 3WNCA 4TMKA 2EKLA 2VK4A 3CW8X 1K5DA 4QYIA 5K2MA 5T4FA 1D4OA 2VHEA 4R51A 4D4IA 2ZUVA 1WCIA 3ILYA 1PYOA 1BMFD 4CKXA 3IC5A 1V5WA 2FP3A 2X8WA 4U02A 3TKLA 1F2DA 2FEXA 3JD4A 5FEMA 1N0IA 2OKCA 1IJKA 3NNDA 4PBTA 4R6WA 2C2OA 4IHKA 4CG2A 1XZEA 3HU1A 4FNGA 4MYSA 3ZWOA 4OLAA 3ZLVA 2WUVA 1E2JA 5ALWA 4C7KA 2QP4A 4YRTA 4Q9JA 4QPPA 1N0WA 2A9FA 2AJLI 1E2NA 3D4OA 1L1RA 4L16A 4EI8A 4DR3B 1I4OA 4DG9A 3D4IA 4LEIA 3WR5A 2VSQA 5JPDA 2BKUA 1M34E 1FUUA 5CRIA 4UUBA 3M3HA 5KNDH 5AKHA 5A2QA 4QYSA 2OCIA 4DV4B 3A36A 4L76A 1XZDA 3HVKA 4I5DA 5J47A 4HGNA 1TLTA 2JRCA 4LPKA 4K6CA 3OMLA 4E2YA 3T1YB 5ALYA 3U3MA 1RWWA 1T0HB 4WECA 4HLUC 3L18A 3K0KA 4WWHA 2XB8A 3E70C 2AI2A 1UJ4A 4IIJF 5GWXA 1GQOA 2F9MA 3U1TA 2ECFA 4BXOA 1WB4A 1JVBA 1K86A 2OAP1 3FOWA 2QRQA 2YQ5A 1OUMA 2DULA 3QA9A 5F21A 2IIVA 4QGHA 1IEXA 3OICA 3Q0TA 4UM5A 4MW2A 3DPUA 5I9NA 5JDCC 4EW1A 4IRXA 3O8BA 5K3OA 1SHTX 1JJVA 2AX4A 3OZWA 4TYWA 4DV5B 1EE1A 2WTMA 1B2LA 4AC9A 4EX7A 5AH0A 2GN2A 3HJTA 1VSUA 4YRAA 1B14A 4UTOA 3S55A 4HDSB 2IDKA 4HQNA 3HNRA 1NIJA 3L41A 1MQ9A 5KNCH 2AR7A 4ODIA 5B12A 2C99A 1W0JA 1M33A 1ND6A 2B34A 2BFFA 4R16A 4RAOA 3K5WA 1FP4B 4I4NA 2QDKA 5EWLB 3JQCA 4BX0A 1MGPA 1YSCA 2JRLA 2FGKA 1QHHA 2BH2A 5DSXA 2EQAA 2V03A 5CYPA 4YV2A 1PRYA 2O8VA 2RBGA 2WZBA 3DKPA 3ITDA 3CPJB 2QUHA 4RHYA 4YXWD 2RCYA 3WWOA 2R7NA 2VDPB 1NBME 2A9PA 2IUFA 3BRWA 3HO8A 3MCWA 2PD3A 3MWEB 2DRIA 4JNCA 3C8UA 1A9XB 3I1YA 2ZZNA 3TGPA 4MQFA 1GAXA 1PE0A 3N58A 1CP3A 3PNBA 4Q9AA 4Y9RA 3KXKA 3SYRA 6NULA 3U60B 1OHHD 4D81A 3O2QB 2NSYA 4KZPA 1JIJA 3GLTA 1RKQA 1U0EA 2ZIFA 3CZ5A 2ODAA 3FVWA 3I76A 4BO3A 1WXGA 4XTRA 4DV7B 1RQNA 3LUJA 4KN9S 3WK4A 4EDFA 3JXEA 1XRMA 1TCAA 2P9QA 3ZJ5A 1QO0A 1DG9A 4LCBA 4QJIA 3NVAA 2XCQA 2PANA 2BMFA 2HHCA 2QD3A 4G0OA 4JQSA 2JLAA 3VZCA 1YJBA 4PYOA 5JXGA 5JDCA 2NO5A 1XAIA 3UGQA 3D7SA 2WMOB 3UENA 5EUBA 3HSYA 3BWYA 4QEZA 4KGDA 1P7VA 3H87A 1JH8A 2XH8A 4D8WA 2BMDA 2BTQA 2CN1A 3VU0A 2FPIA 1YJCA 1ZQ1A 1TA4A 3SVZA 3WWCA 1SK8A 3LQYA 2PS9A 4LJ9A 1X39A 4Q3DA 4FYIA 3BVPA 4CKCA 2NTYC 4F91B 4TLEA 4C6RA 2O5RA 1FJ2A 2XNSA 3JD1A 3HYTA 3V1YA 1O5TA 3VPHA 1NMYA 4L0CA 2AUNA 2V6FA 3PCTA 1S01A 2WDZA 2O57A 2WILA 4K05A 4MVXA 3WS7A 4C7MA 3H2IA 1E7SA 1VIAA 2HOQA 4N76A 3GNSA 3FH0A 4FD2A 4PLTA 2O2IA 1VJGA 2OQ2A 2QVXX 1M72A 1GLVA 2D3WA 3M82A 1Z4OA 3KVRA 4PQRA 4KKVA 4R2XA 4TSKA 2R8RA 4JMLA 5AI5A 1RI5A 1W96A 2VRCD 4QEDA 3RASA 2J0QA 3PIDA 4S2UA 1QAQA 1P4GA 3CU5A 1RAAA 4D1YA 3UXHA 1E59A 1Z18A 3D6AA 3QYJA 2FV8A 3D1JA 4F71A 3QF4B 5FA6A 3KG2A 5EY5B 4GH5A 2H5EA 5BWNA 4MR7A 3SC4A 5TC4A 1P0MA 2HMTA 5F2KA 2GXAA 2FEAA 3UHOA 4ZMRA 5FXMA 1RWNA 4IX1A 1NYLA 1AKNA 3WIVA 4BNLA 2BEWA 3PJEA 4D41A 4TZTA 4YBRA 1OIVA 1N6RA 1T9CA 3EIEA 3TXAA 5DWQA 1A4RA 1HDZA 1Z4LA 2WR8A 3H2YA 5AKIA 4NXMB 2CB0A 4F8JA 1QHEA 2FK8A 4PZLA 1E9CA 5FULA 3UBTA 1GV1A 1IY0A 4KK4A 1DJMA 4B3HA 2XDYA 1XAGA 3U0VA 1ZGHA 4F85A 2C4KA 3DBOB 2PGDA 3A9RA 3M4ZA 2O20A 5CA0B 3IE2A 3L7NA 3QYFA 2GCGA 2P2CA 5BNFA 1QIEA 1EDOA 3ZHUA 5LUAA 2PS3A 5BYKA 3ZJTA 4IPTA 2HDOA 1QUEA 2G3YA 3IXLA 3MT7A 2AJDA 3RRXA 5KWVA 3P9KA 2V7QD 1HYGA 1P9WA 3T3NA 1Z7GA 4M0LA 3BRSA 5LP1A 4IWYA 5HTKA 1OKKD 2W58A 4WA7A 3TLKA 5BW8A 1PSZA 1B15A 1W88B 3OM9A 2XB6A 4BRWA 3VOTA 3R3YA 4JYMA 3K92A 1CYEA 1AZSC 3OECA 1BROA 1MRNA 5B1IA 3AZQA 3T5DA 5CR9A 3EGXB 4DYDA 1DS6A 2JVKA 3LPAA 3AF3A 3PFWO 1K4KA 1PT9A 1PYGA 3CRQA 4K26A 1NONA 4E21A 1C29B 4NCIA 4DPLA 3RH0A 4MLDA 3SM3A 3UJ7A 3P20A 3GYBA 4BCBA 3GGPA 1KEPA 2QL5A 3M6MD 2NSJA 4K1XA 4WK2B 4YHBA 1Q1QA 5EP1A 3UBMA 3ZZUA 3B9PA 2JIBA 3W3AH 4XR4A 1QYCA 2YICA 2PN1A 4CKBA 1VLHA 4OKIA 1PIWA 2AH5A 5DW3A 1Y7PA 1S2GA 2AFVA 2XUAA 4E46A 4OI0A 1UBHS 1A2QA 3HU5A 4Q1CA 1AQYA 1MO6A 5FNVA 5TMBA 3F7OA 4MTLA 1KPGA 3V9AA 2CNOA 1DL5A 1XIVA 2GLUA 2WWHA 3B2NA 4WY2A 2NGRA 2O4UX 3I3OA 1WXQA 2AZ4A 2PK3A 3QXCA 3EVDA 4IIBA 4Z7OB 2A5JA 1KYTA 1QGZA 2QVLA 1I33A 1GZDA 4C4ZA 3N28A 4U6NA 1Z4JA 5A0VA 3ELDA 4AKEA 3NFYA 1JAHA 1U3TA 1YCGA 3V1KA 3T3MB 4LRUA 3W77A 3UJAA 2AJCA 2C9BA 4LDQA 5G0UA 4DLKA 5AVOA 3EAGA 2Z6UA 4F3YA 1YS2X 2AYYA 2XQKA 5K03A 2I2FA 2PMWB 2J33A 3TCNA 3HH8A 2PWPA 2WTNA 3VZPA 3VKVA 3T4UA 4Y2JA 2JI6A 1PP4A 1II0A 3HM2A 3WZ2A 5JCZA 5JYDA 5KYYA 2O8FA 1PDOA 1UZLA 2I5PO 3CW2A 2QWXA 1NXWA 2X7JA 3I9LA 2WG1A 3KM0A 2C8JA 5COAA 2JB9A 3BFKA 2W2LA 4JQOA 4RCYA 4ALLA 2GBIA 3ESZA 4D56A 3OG9A 4LVOA 5CDUA 3FLAA 3K2QA 3NLLA 1QNLA 3ZYCA 4Q21A 1WDWB 1Y4UA 1E2GA 3HNOA 3HWWA 3IA7A 5CYFA 4F5YA 4YRZA 2P2YA 3NH6A 2W70A 5L53A 3EXIA 1E6LA 1MKYA 4MVYA 3TZCA 4TWIA 3P4XA 2XXAB 4LF7B 3DVSX 4OEHA 4DARA 2CBXA 4YJKA 1K6JA 1OMOA 4ZI3A 1HOXA 1MRSA 3GQVA 2A0FA 1RKXA 4TSFA 3ORRA 1SKBA 4AY5A 5L3VA 3UAGA 2AKAB 2PT7A 5LQKA 1OLSB 2CVPA 1YMUA 4ZJYA 5EE3A 1N6NA 2QRUA 1GL9B 3OFVA 1TVCA 4IJUA 4US0R 4ARZA 4MHSA 3ZLBA 2GDZA 4Q3BA 4RKYA 3CF0A 1F48A 1QS0A 2QDXA 2WDPA 2UZ0A 3BPSA 1E8MA 3R23A 4PLGA 3EH1A 4PICA 4V03A 3VTAA 3IUQA 1YR8A 1EVZA 1QFYA 1VIVA 4KB5A 4MVJA 5FLYA 4Q5IA 3K1AA 1T35A 4H4EA 1HYEA 1TJ3A 3ZWDA 4ZZ0A 5BWMA 1EESA 1IOLA 3S68A 4HAIA 2VYCA 2VXYA 3SE0A 3IO5A 3P2JA 3DD1A 5DYYA 5KHAA 5FBHA 3FIUA 2O7RA 3D3JA 4MV1A 2QBYB 1U8YA 4PC7A 5ALLA 1C81A 4L07A 1RTKA 2O0MA 5F9FA 1GL7A 1GTL1 3O03A 1I24A 1PNVA 1RAEA 1EDZA 1A0OA 4UCXA 4X0EA 5F5LA 4DRXB 1DAIA 5HOQA 4ZODA 3IH5A 4DOMA 4MULA 5KTSA 2OD9A 3DOCA 2IH2A 2BT4A 2WSSD 4TVSA 1V5FA 1EVJA 1C1DA 1P7YA 2VWHA 3UAXA 3RVRA 1E1MA 2W2TA 3T9DA 4X61A 3OMXA 1P5ZB 1G2OA 2VRBA 5BXQC 2Y8EA 4EJMA 1P1KA 1MABA 1Z7YA 4F6CA 4OQNA 2BSQA 3K1TA 2F1HA 3PE4A 4L08A 1NPTO 1ZS9A 3MT9A 4Y2RA 1ESZA 2BBOA 3GZJA 3OZDA 4FGLA 4AWAA 1V35A 4B47A 5A6VA 2REQB 1L5OA 5LZ8A 3M3PA 1B43A 1D7OA 1Z62A 1EVIA 3FNEA 3RSCA 5IK2A 3JQ7A 4G0VA 2IEBA 3H5RA 3JARB 2CXNA 4HVAA 4FNOA 4I9FA 3THOA 3WBBA 1VPLA 4O2BB 4JC5A 3CGGA 4NK4A 2C2KA 2W4IA 3AIMA 1QH1A 3TFWA 1DXHA 3JV7A 3WB9A 1ST2A 4F97A 4ZJPA 1NP3A 3RS7A 1YIDA 2H9AA 2OPBA 1RSZA 1T2EA 2Z3VA 3IEMA 2PUAA 3FHJA 3F5SA 1GR0A 3IHLA 4KFRA 4FE4A 3U3KA 5EZ6B 3AUFA 4G1UC 1LV8A 3N8GA 5FQOA 4EB6B 1KI7A 5E38A 3PSAA 1PKEA 2XTMA 3NC4A 2GZ1A 3KVOA 1R0WA 2I54A 1Z63A 1KAHA 3OOSA 4LDAA 3OJWA 2F3PA 3NJRA 1Z6TA 1FFAA 3GPDG 4ZOQI 3C6XA 1KFEB 5MGBA 1J22A 2I33A 1P1BA 1U3FA 4LXUA 1JA9A 2ZIXA 4HP8A 4YPFA 1LA2A 1TCVA 3PTLA 1E1LA 1Q5PA 1TCCA 3ZHYA 1ZH6A 4JBWA 1X7WB 4L1KA 3RK4A 1CUJA 3T7RA 8ATCA 2AVNA 2O2GA 2VZ0A 2Q5FA 1PU2A 4NFSA 4WZ6A 3BBLA 4GRDA 4MRAA 3DEJA 3PDWA 4MQEA 7ADHA 4Y0NA 1JHUA 3DT8A 3CRZA 1UPFA 3MF4A 2AR0A 1ZJ5A 3MBIA 1TFRA 2FUNB 1YQXA 3L4BC 3VU3A 5FIUA 2X7HA 1NP7A 2FJUA 1TIBA 2KW5A 3F5DA 1P9OA 4L5YA 5CVDA 5FR2A 4LY6A 3Q7PA 1S9DA 4J0FA 3UANA 1T5SA 1U4SA 2ANCA 1MAWA 2VXBA 1KK1A 5FOXA 1UBRS 2Q0XA 1IVNA 1T6ZA 2JS7A 3AEKA 3BXZA 4NBTA 5AI6A 1XMIA 5LZ9A 5FDFA 1XJ0A 1X1CA 3MQFA 1DCKA 1DKNA 2IXDA 4Z0TA 5BSWA 1MO4A 4Q0MA 2HRCA 3N76A 4W63A 4XPIB 5ICGA 3DMFA 3O8OB 1XLVA 2B4QA 2FG5A 3FHCB 4OU5A 3PK0A 4X3OA 4BQEA 4ML3A 4QBGB 3CE6A 2ANBA 4S24A 4DNFA 3VGPA 1BN6A 1YQQA 3GVPA 3L8MA 3UB4A 3W05A 1UAAA 3HCBA 3KB6A 4CXMA 1H1TA 1ZXXA 3GRUA 1VL5A 4QOGA 1KRXA 4KE6A 4JS0A 1MRZA 3CCFA 4V0MA 4IXTA 5EJEA 1I9GA 4ZDJA 1OWLA 3EPHA 4HRYA 4TYYA 4B3JA 1D6NA 1OPXA 2PLAA 5DWVA 2XUDA 3IERA 1T6BY 2NVUA 4KQ6A 3T12A 2GFHA 3OZCA 3WQSB 5MGNA 2FTKE 1HR0B 5E95A 1NI5A 1IH8A 2HCTA 3HP4A 5JFGA 3GMSA 1NBHA 2FX3A 2L18A 3ZXUB 3W0LB 2DQSA 2Z30A 3L6BA 4WLUA 2DX7A 5E8RA 4NKRA 3QLJA 3SS7X 3IT2A 4PAQA 3SPXA 1YIOA 4OP2A 3TW6A 3BWMA 4XYEA 2ZBDA 3GNQA 5HF9A 3R8XA 1ZH8A 3C1AA 1TRHA 1XTJA 2IOFK 5EZQA 3UWMA 1EX9A 1OD6A 3KAQA 3L7KA 3E5RA 2ZPUA 3NTOA 3ZHQA 1ODSA 1SKMA 2ACKA 3ZTWA 3L6UA 2GCNA 4PIMA 1M1YE 4W8OA 3WRVA 1CUDA 2WVHA 2O48X 2QQ5A 1MW9X 5KINB 1Z5NA 2V96A 3E6AA 3LPMA 4FBLA 1M9NA 3OLCX 4H1VA 2W93A 5G1NA 2YYYA 4QOEA 3NIDB 4NJEA 3ZHSA 4TVBA 4J2TA 4PHTA 4R84A 5I7AA 4EYEA 4LE1A 4O3FA 1F6DA 4F11A 1ZIXA 2BHNA 1CZHA 3MJEA 2VF4X 2R6AA 3LPCA 2YYZA 3DHEA 5TQ0A 5ITSA 5KX5F 2R7KA 5L6LB 1Q21A 3FRIA 4MMXB 4NTZA 2ZBEA 9GPBA 3KQSA 4MB6A 3W8FA 4F9EA 2LV8A 4ETIA 1U5BB 1WCWA 2CXXA 2GCEA 3CKLA 1Z4PX 1ZH0A 4H4DA 3CLUC 5L3RA 4A2PA 1PL7A 4DLZA 1POXA 1EUZA 3BSWA 4M8LA 4EI7A 3ZS8A 2BV3A 4FB4A 5CDHA 5LP6F 4ZTUB 4MGYR 1PKXA 3WLJA 4BUJA 4ACAA 1XBTA 1R6TA 1MC1A 3TQSA 2B5OA 3DHWC 2A84A 2YY6A 4QJ4A 1M1NB 4YONB 2J7PD 3OC6A 5DCYA 4JHXA 1JR3E 4YJ2A 4W4TA 2IVFA 3EFOA 1E92A 3CLTD 3RYIB 6YASA 1WSBA 5DX1A 3MRSA 5B1SA 3BH7A 5LA6F 1M5TA 5K3BA 3WHLA 1Z8HA 2LXNA 5EHNA 3IQHX 5JC8A 2RC5A 3M4JA 4E12A 1K6MA 2GZAA 2UVDA 2BGTA 5LR6A 2DTEA 4K86A 5TNXA 3SHFA 2JLZA 3LF1A 4MVCA 4UD2A 3NZEA 5F76A 1PS8A 2PX2A 3A4VA 3DDNA 1VE1A 4WLVA 2V1UA 1YV9A 4H7EA 2PHZA 2WAOA 2O9JA 1E9EA 4FFRA 2OVFA 4A1OA 1JKXA 2QVZX 2WTAA 3LUFA 4M0KA 5DE3A 2BKXA 3DEHA 3LLVA 3UZUA 2WA2A 3L0IB 1KAEA 4YUZA 3IAAA 3ONWA 3TQFA 4EMSA 4XVRA 4KQJA 1U63A 3PNVA 3B1YA 3B52X 3V3TA 1Z3IX 4F4IA 2XCTB 1UPTA 2FSGA 3M70A 2PZGA 2I6FA 2QV7A 1GKLA 4A36A 4S1WA 4IMIB 5FI5A 1L7PA 3BXXA 3HKBB 3RB8A 1DJQA 4K9RA 1AX9A 4TMWA 3SQOA 2FVYA 4YCCA 6PFKA 4MRMB 1KXZA 3KJHA 2E7ZA 5I9BA 4EPWA 3P2OA 1OPRA 3Q10A 4LDZA 1J07A 3EIWA 1L4EA 1TEXA 2OQIA 2Q3FA 3B48A 1PJBA 2D5AA 3DTVD 3DUFA 2CXRA 3GEIA 1FNMA 3NNNA 3NV9A 1R4MB 4FYXA 1KU6A 1K4YA 2GAIA 5EIBD 4CVNA 1GPLA 4AJPA 1GYQA 3R74A 4DCCA 3G9XA 4WJLA 8GPBA 3F4BA 2XZLA 1RRVA 2P9YA 3T7KA 1L8AA 1IUKA 1YB2A 1B8NA 1MDBA 1R4NB 1TKCA 2GN4A 4YJFA 4ZV9A 3ZGYA 5JFOA 3KZ1E 1BMDA 4DV6B 5J2TB 2Q9CA 2CDNA 2PAFA 3BMXA 1EFHA 4D4GA 1LCIA 1NMQA 1Z36A 1G1AA 3LLCA 4OQDA 4EJ2A 5IP5A 2BBTA 2A1UA 4OGKA 1KS2A 2A7XA 1Z0SA 4GIBA 4YP1A 2F8LA 3CINA 1IN4A 2A9QA 1ZK1A 2BR4A 3B9QA 3NHPA 1GT91 4I50B 3KOZA 3QW2A 1WTAA 4ON9A 3ZDXB 3WE7A 1GPNA 2PBZA 4ZOLB 1QX4A 4MMZB 4IKOA 2QJRA 1PGNA 4LE2A 4R8RA 4AI6A 2JAPA 3L4JA 3LGSA 3B9RA 4QHSA 5HIIA 4BNVA 4LQDA 2ZCJA 3IURA 1AT1A 5EYPA 5CLJA 4C4XA 2PLRA 1ZOOA 1JH9A 4GOXA 4DEXA 3D3QA 5KYVA 3QUCA 4WJZA 4UTRA 4A0RA 3K7EA 2B8EA 3AUKA 4TXLA 2OCXA 2BSAA 3Q72A 3C43A 4C0QC 5AUOB 3F6CA 1SXHA 4E14A 2NYVA 3IT3A 1ILWA 3KJXA 4ZTBA 1K97A 3PQ8A 4GP9A 2HHAA 3LT5A 2FGJA 3PNOA 1V37A 5F5XA 1DE0A 1PHRA 1HLPA 3KKZA 4OLHA 4DA0A 3FRHA 3VR5H 1FTSA 1G21B 1Z88A 2Z8ZA 2C07A 2XD9A 3HWX1 3MJRA 1RM3A 1V11A 4JUCA 4LSWA 4PYLA 2ZSFA 1Y1SA 5YASA 1R0CA 4LC0A 3ST7A 3ZXSA 4NDAA 1RHJA 3MINA 5G0WA 2OXEA 4FW8A 4TXHA 1KK0A 2DCUA 1CFZA 4ZHQA 3UK0A 2P4QA 3WLLA 1Y8ZA 1FS6A 3KOYA 4FDVA 3VZSA 1RRKA 1LXCA 2Q1XA 5LN1A