4P9PA

Structure of navms in complex with channel blocking compound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p9pA00
3E83A 1K4DC 1M56C 4RUEA 3T1CA 3BEHA 4WFFA 4WFHA 4BW5A 4QE9A 3SPHA 3SYCA 3KG2A 4R50A 2R9RB 4QNHB 2AHYA 4LP8A 1R3LC 3SPIA 5EK0A 4LCUC 2WLKA 3IGAC 2JK5C 1QLEC 3R65A 4GX5A 3RBZA 2Y69C 4XDLA 3LDCA 3RVYA 2A79B 2YEVA 5EBMC 4JTDB 4PA9A 3K0DA 4KFMA 3TETA 2HJFC 2HVJC 5B1BC 2X6BA 3F5WC 3VOUA 2QKSA 3K06A 4DXWA 4TWKA 4P9OA 3LNMB 3F7YC 4GX1A 3K08A 1R3JC 3FB5C 3UM7A 2IH3C 4MTFA 2WLHA 3LDEA 3SYOA 2AHZA 3PJSK 2QTOA 1P7BA 2EIKC 3ASNC 1G4YB 3E86A 3HPLC 3OR7C 4MVQA 2EILC 4LBEC 5KUMA 3SPCA 4P9PA 5B3SC 3F7VC 4J9ZB 3OR6C 3FB6C 4OXSA 4R8CA 4ZBMA 1R3KC 1J95A 2OCCC 2Q69A 3UKMA 2WLLA 1LNQA 3SYAA 4PA7A 1K4CC 4G27B 1OCOC 1V55C 2K1EA 4WFEA 2ATKC 3ASOC 4MVSA 4RO2A 5EBLC 4H37A 4QE7A 3STLC 1V54C 3E89A 4H33A 5IY5C 3ZRSA 5KUKA 5CBHA 4MVOA 5J9PC 4MVMA 4PDMA 4PDVA 2WLJA 3AG3C 4MSWC 2Q6AA 4WFGA 4CBCA 1ORQC 2Q68A 4PA6A 4UUJC 2W0FC 3WG7C 4XDKA 1XL4A 4RUFA 4F4LA 3AG4C 3LUTB 3T2MA 2HG5C 3AG1C 4RAIA 2DWEC 2P7TC 2ZXWC 1OCZC 3X2QC 2BOCC 4G28B 3OUFA 4J9YB 4P30A 1M57C 3SJQC 5CBGA 1R3IC 1OCCC 2NLJC 3IFXA 4MS2A 4P2ZA 3LDDA 3SYQA 1KKDA 3ABLC 1OCRC 4X89A 2BOBC 2EIJC 3SYPA 4MW3A 3FB7C 1BL8A 5EBWC 4MTOA 4HYOA 2DWDC 2HFEC 2ITDC 3E8FA 3GB7C 3RW0A 2EINC 3T4DA 2IH1C 4PA4A 4XDJA 4X88A 3RVZA 2H8PC 3TCUA 1S5HC 4GX0A 4MTGA 4PDLA 2X6AA 1XL6A 2WLIA 4I9WA 4X8AA 4MVUA 2ZD9A 3JYCA 3E8GA 5EC2C 5B1AC 4EKWA 3E8HA 2WLNA 2Q67A 2A9HA 1ZWIC 2DYSC 3ABKC 3K0GA 2WLMA 2WLLB 3OGCC 4JTAB 2EIMC 4PA3A 5E1AC 3OUSA 3EFFK 4PDRA 4MW8A 2HVKC 2KB1A 2A0LA 4GX2A 3FB8C 4MVRA 2DYRC 4R6ZA 2ITCC 4HZ3A 4JTCB 5CBFA 5EC1C 4R7CA 3K04A 2X6CA 1JVMA 3AG2C 3ZJZA 3T4ZA 4MVZA 3SPJA 3K03A 3STZC 5BZBA 3SPGA 3E8BA 2WLIB 3ABMC
chains in the Genus database with same CATH superfamily
3T1HO 1GO3F 3T1CA 4FFKA 3HKCA 1CEZA 1K5SA 2AHYA 1EFRG 2N04A 2JK5C 2LFSA 4AILC 4XDLA 4GKJO 4DR1B 3K0DA 3D3QA 3KCXA 4X64O 1D5NA 1FXKC 3EXAA 5D5QA 1IBLO 5E79Z 1GK9A 2A3QA 4XBFA 1KP3A 2BTOA 4IIJB 4OPHA 2VRZA 3HB3B 2OCCC 4X20B 3SDLA 2DN9A 2K1EA 3ASOC 3RYHB 1I0HA 3ZN1A 2YIBD 2RDCA 2Q6AA 5IE9A 1YJWV 1GN6A 1NTMH 1Q8IA 2QTSA 3GWOA 1SERA 1JQ0A 4FLVA 1BS3A 1WPBA 5IWAB 2OCHA 5LMNB 3FD9A 4LF8O 5B66Z 3QG5A 3N2KA 2DWDC 1Q6HA 4IHJA 2NN4A 4ZHQB 2DJVA 1BSMA 3K5LA 2WLIA 5CA0B 2A9HA 3K0GA 3G80A 4B3SB 1WP7A 4MW8A 3FB8C 4C7UA 4U3JB 3NXSA 4PD4F 1JX9A 4FLYA 4O4JB 5BMVB 1DF5A 3CC2V 1WNSA 5LXTA 4JYYA 2CTQA 4DV4O 4YXWG 1IXBA 1YF2A 1VQNV 2HLDG 2HP8A 2A79B 1RM1B 2QWNB 2QM7A 3JCUZ 4WBNB 2ZM6O 3I55V 3JALA 3D8CA 2ZT9B 3U10A 3LSQA 2VWKA 2D3OW 2UXDO 3JATB 3APOA 1SZXA 5CA1A 3CJHA 4MVQA 1BMFG 1PNKA 3ZMTA 2VQFB 4K0KB 3CS5A 4UCTA 1KYOF 4JAVA 2Q69A 4ZOLA 4KL1A 5KMGB 3IC7A 4WFAV 4WFEA 1VQKV 2DOSA 1V54C 1ZX3A 3ZRSA 2FB5A 5LYJB 5BY1A 4DW0A 1K73W 1VQLV 4GLXA 1XMQB 2Q7EA 4LFBB 3TXSA 4O2BA 2HG5C 5IY5B 4YIPA 1FFXB 4DYLA 4J9YB 2ZCEA 3ZMSA 1FJGB 2NLJC 4P2ZA 1TGOA 2QR4A 4X1KB 1XHXA 4B08A 4DV7O 4J10A 2OCCB 1GMGA 2H94A 4JV5B 4J7JA 4X1IB 5KX5B 4X8AA 5EC2C 3E8GA 5B1AC 1I08A 1JA8A 2Q67A 4JTAB 2XASA 4PA3A 3OD4A 4X66B 2DYRC 1YHQV 2Q4PA 4HZ3A 2X7RB 4KXRA 1K33A 3P3NA 1ZSPA 4UV9A 1H2LA 3QVNA 1N8RW 4JI4O 4NXMO 3ZIAG 3E83A 1QVGU 5DECA 2PTMA 2JRIA 3WB1A 3IGAC 1WPXA 1M5IA 3RBZA 4UVCA 1KKCA 1HNWB 1S5JA 3ZHRA 2PGGA 3CCJV 3CD6V 3G6BA 2VWJA 4DV6O 3M8AA 1IBMO 3K3WA 3MAQA 4DRXB 3F7YC 2JJ1G 4MTFA 1YJ9V 1H38A 1AR1B 3G67A 4DR5B 5L3GA 1GM7A 5B1BB 2ILMA 3P3PA 1B6QA 1IBKO 4UCOA 1H2GA 2AGAA 4DR2O 2YICA 3K58A 4Q20A 1AR5A 2VS0A 3E89A 3CX5F 4IYHA 2UUCO 4ZI7A 4DV2O 5L3CA 5BR8O 2GSMB 4UUJC 1V55B 2BSKB 3LUTB 3AG1C 4RAIA 4DR3B 4LF4B 3H1IH 4JI2B 2R9IA 2PY5A 2IW5A 4Q6GA 4ZIBA 1S72V 2BOBC 4LF5B 4MW3A 1P4RA 5EYPA 3F5TA 5DN6G 1JOYA 3ZHVA 1M57B 4ICGA 3UCSC 1JCHA 5J2TA 1XL6A 3L9DA 3W7SA 5ITZB 2PI5A 1YITV 1V54B 2WLNA 1XNRB 4LF9O 3K79A 4UXNA 2OTLV 2W6IG 1FKAO 2V4DA 2UXNA 2QM8A 1MNGA 4Z1VA 1L0NH 1JVMA 4LF6B 2ARHA 3K03A 1OZ0A 1NZ6A 1LR1A 4CC6A 1M4UA 2WPDG 2Q7GA 2B9ZA 1N0NA 1JFFB 1AR4A 1S3JA 3BEHA 4X65B 2LJ2A 3ETQA 3T1HB 1JPXA 3OW2U 3QO7A 4NTWA 2CTPA 3ZN0A 3R65A 3CXHF 5JJNB 1RSOB 3CYOA 2IBZH 2HKOA 2IH3C 1TUBA 2Y69B 5J2UA 1N4CA 2R70A 2ADQB 3OTFA 3VQYA 1I94O 3ASNC 2ZIMA 3BPZA 4P9PA 4J42A 3J80N 1LNQA 3OMNB 3CRMA 3FKSG 4O4HB 4WFBV 3ZRVA 1XI1A 1W0KG 3JAMN 5KUKA 1THZA 2FMLA 1FAFA 5IJ0A 1QNMA 1E79G 2RN9A 4FZ0A 1VQ6V 1XREA 1K92A 3D36A 1VQMV 1KKDA 5LHHA 4J7ZA 3LNNA 3RGBA 1GN2A 1AVMA 4UCSA 3E8FA 2C2AA 2Q0AA 1OCRB 2XUMA 3CMEV 4HNAA 5LMUO 2ZD9A 5H2FZ 1K34A 5JVDB 3CMAV 2Q8VA 4I55B 4O2AB 4DV0B 1WLEA 3D36C 5LP6C 3SPGA 3E8BA 2JVDA 1DK1A 2UU9B 1BE3H 3BA8A 3JARB 2WLKA 4H44B 2ZDIA 1YCIA 4AQYO 4DV4B 3ZRWB 1JMKC 1ZL8B 1GM8A 2QKCA 2OIEA 2ZE7A 5GTIZ 2F1MA 3K08A 2ZM6B 3FB5C 1N0JA 3ETDA 2XAFA 3UT5A 1AILA 2V7QG 1HR0O 1H8HG 1AJNA 2MK3A 5JH7B 1FXHA 5IJ9B 4YY3B 1G6UA 1FFTB 2Z3YA 4H33A 1AJPA 5TISZ 3E35A 2JGUA 4MSWC 4PELA 5LL6Y 2RQ6A 1KMIZ 1T5EA 1EN5A 1Q6UA 1O9HA 2EJ7A 3ASNB 3X2QB 4TV9B 4JI8B 4DV7B 2Y4TA 2B1IA 1V9PA 2H8PC 3TK1A 4EKWA 2B5UA 4DV3B 3K9SA 1BT8A 3AK2A 1WAZA 3BABA 3OAAG 2F43G 2FKXA 5LGNA 2FYUH 3ABTA 4DR6O 5LOVA 1KUQA 3RYIB 4TV8B 1Q82W 5KMGA 1YDXA 2E3CA 4TSFG 2EIMB 1URFA 1W59A 2P6JA 5LYJA 1DF4A 1XNQO 3Q4HB 4DV5B 1BQZA 3AK1A 2R9RB 1NH2D 4LP8A 1F4NA 1CPYA 2ZNIA 4N21A 4D6TH 1FXKA 2LGQA 4PA9A 4X1KA 2CH7A 1MMMA 2EBOA 1PPJH 3ZS8C 3APQA 1QLEB 2KKWA 4DV6B 4JZGA 4WCEV 1IDSA 2VQEO 1IBMB 2KG7A 3RN4A 4X1IA 5KX5A 2PF4E 1VQ5V 4BR6A 2IJIA 5A9GA 5LP6B 4TUYB 3SR2C 5BXZA 3RFRA 1PL0A 4JI3O 1Q6IA 4FM1A 1IBKB 3C3TA 2EILB 3K57A 1Z5VA 4DR2B 5IDJA 5IY5C 2IU0A 3VQWA 3CCUV 1OCOB 5F2VO 4GKKO 3S3WA 4F4LA 4DV2B 5BR8B 2DWEC 3SJBC 4LFCO 3CPWU 1UFIA 3AG3B 2H3OA 3GWKC 2Q73A 1P7GA 4JYCA 1WB8A 1TA8A 3HKDA 1XILA 1VF6C 4DRXA 5JCOA 4UCUA 1QU7A 1E1RG 4PDLA 1XBLA 3J7AU 5CB4A 1BHBA 3H1KH 2WLLB 1H2SB 5E1AC 4GUNA 3ZMVA 2XAQA 2F93B 4O4IB 2XT9A 1SA0A 4OPAA 5IYZB 2KQXA 5CMUA 1IVSA 2ZINA 1HDJA 1QVFU 1H2MA 2EULA 2ZKOA 5H6RA 3P32A 1GKFA 1W2BU 3LSSA 2RNBA 3RYCA 2BSKA 1SQFA 5JCOC 3ABMB 4GX5A 2GBOA 4QPKA 5B1BC 2QKSA 1ZTEA 3CP1A 4GX1A 1QR8A 3H1LH 1G1XB 3C90A 2UUBO 2ZE6A 1QBZA 2QTOA 5EZYB 4FIPC 5ITZA 1I94B 4DV1O 2OTJV 4O4LA 2EIKB 1V55C 1SQXH 1Q43A 3KZIZ 2YIAA 2N74A 5EBLC 4QE7A 1GH6A 1N32O 3K59A 1MZEA 5J9PC 2CTWA 2F4VO 2LFRA 3JAKB 2W0FC 3A2FA 2P7TC 1WA8B 3OUFA 1M57C 3W7XA 4B7EA 3BCCH 3DXRB 2DQ0A 5GONB 1KC8W 4MTOA 3CCEV 3TJTA 1SETA 2UUAB 4KUMA 3J81N 1RSOA 3HKEB 3IJ4A 1VQ9V 3CB2A 2X6AA 2EIJB 4BIOA 3ZX6A 1HNZO 5L3EA 5FL7G 5LMUB 5D5PA 4FFBB 3HKBB 4PDRA 3KCYA 1Y76B 4R6ZA 4JTCB 3C3SA 4EEQA 2GDSA 4O4HA 3T4ZA 3B8MA 4X1YB 2CK3G 1AI7A 2XOKG 5GTHZ 3JD1A 3JAWA 4YHHB 2X0LA 2CGNA 3JD4A 1I5XA 3DC6A 3K5OA 1MZFA 3ZBHA 4WFHA 4F6RB 2F66C 2UXBO 4JYAO 2K9PA 2HR3A 2Y69C 1L1FA 2YUAA 5EBMC 2UXCO 4JI0O 4AQYB 2HVJC 4LH6A 2P06A 2WA3A 1QR9A 5K1PA 2OIGA 3E22A 2WAMA 5LHIA 5KHKA 1G4YB 3OR7C 3AK3A 1NU1H 1NTKH 4OXSA 1AROP 3CCSV 2CTRA 1HR0B 3UKMA 3WU2Z 4I55A 1R1BA 2ATKC 2R72A 4L8JA 3ZEDA 2XAJA 1MOFA 2Q68A 4PA6A 3L75H 3AG4C 1P49A 1K9MW 4BW9A 3RT3C 1K8AW 4DK0A 1MG1A 1S0VA 1SESA 1EZVH 3W7UA 3SJQC 5CBGA 2CE4A 4JI6O 1OCCC 4LF7O 1OCRC 1Z5WA 2YXYA 5HFMA 5EIBD 1PL4A 1Y74A 2O57A 1NBMG 1Y4MA 1XMOB 2YXLA 4OX9O 4J7KA 2GV9A 3RW0A 2EINC 3T4DA 1L0LH 1FXVA 4PA4A 2XAHA 3JD2A 4XDJA 3ABLB 2ZNJA 2CGOA 4JGSA 4U7OA 2KB1A 4PI0A 2AZ0A 3GVMA 3OEHG 1HWYA 2GHYA 4K3AA 2PZSA 3N2KB 2ZE5A 2YI8A 4IHJB 3AEIA 4DR6B 3JASA 4MVZA 3STZC 1AI6A 3QF7A 2WLIB 3W7WA 1QCEA 4I50B 2M6YA 2JS5A 4R50A 3MHSC 4DR7O 1NR1A 1D2DA 1ROPA 2P5OA 1M90W 1K3EA 4JTDB 4YJ2A 4FLWA 1ZAUA 2X6BA 3TXQA 1NTZH 4TV9A 4JI5O 4EB6A 1SQVH 2A7WA 5K1XA 1P7BA 1TUEB 5KAFZ 2VQEB 3I56V 2JGDB 1PD3A 4B3TO 1UPGA 3CC7V 1M93A 3N27A 2QWPB 5GW7A 4JI3B 3STLC 3JD0A 3JD3A 4GKJB 5CBHA 1BCCH 3B8NA 2WLJA 5CA1B 1ORQC 1NVPD 4X64B 1IBLB 3QO5A 3OE7G 3X2QC 4GKKB 2QWQB 3ZMUA 3FX7A 2QM4A 4JI7O 4LFCB 1HNXO 3VQVA 2GUZA 2GTAA 1KB9F 2ZXWB 1OCZB 3FB7C 2CUGA 2IU3A 4RQEA 5JQGB 1I7FA 4J11A 3UQ8A 1BGYH 3RYFB 1W0JG 1YTFD 4I0XB 3E8HA 5FNVB 1B04A 2EIMC 4H0LB 4PHZA 5H9CA 1HP8A 3NR7A 5LP6A 2L35A 4TUYA 4KHPO 3KKYA 3FYIB 3AG4B 4JI1O 3UO2A 4UVAA 3ABKB 4LNUB 4LF8B 2FL4A 1OCCB 4NYKA 1K4DC 3VQXA 4FM0A 4IIJA 3SPHA 2F23A 3KG2A 1HW7A 3E2EA 3SPIA 5EK0A 2Q7HA 1QLEC 1CXZB 4EFEA 2EINB 4PI2A 1M56B 3ZHSA 4X20A 4GZRB 4LFBO 5B1OA 2ODMA 3RYHA 3LNMB 4LFAO 3BFRA 2JS3A 1S77D 3CCVV 1L8DA 4DO2A 2UUBB 2EILC 4LBEC 1SZTA 2BTQB 4J9ZB 4NTXA 2L6LA 1UJWB 2WWWA 3TGUH 2WLLA 1OCOC 2E5LO 1AB3A 5LGTA 4DV1B 2JEUA 4H37A 4EFBA 3BA9A 1F51A 1U97A 2P67A 4BIUA 1YJNV 1EZJA 3AG3C 4RWUA 4U3FH 5KHIA 1N32B 4ZHQA 4E4EA 3T2MA 3L74H 2BCCH 4W4KA 5CA0A 2UXDB 1VQPV 5IYCO 1R3IC 3U11A 1J5EO 3SYQA 4NXNO 3WG7B 1GAXA 2ZE8A 3BRCA 3H1JH 4CH5A 5KA6A 4U3JA 3M99B 3PN1A 3TCUA 4MTGA 4O4JA 2IJKA 5BMVA 2KSDA 3ICXA 4FMTA 3DGEA 4TOIA 5EZYA 3OGCC 3ZHTA 4I5SA 1HNZB 2JIZG 3OFNG 2GTSA 1WN7A 2E75B 5L3BA 1JR9A 2G38A 3AG2C 3ZJZA 2YXHA 1X59A 3SPJA 1OHHG 4QGPA 1WP8A 4WBNA 5J2TB 1MSDA 3G4SV 3ABMC 4E2LA 5B5EZ 2CAZC 4I4TB 4CH4A 4OGQB 3L73H 3JAKA 3JATA 1SQQH 4QNHB 1BQ0A 1YXBA 3RVYA 3L71H 2UXBB 1SF9A 2YIDA 2PI4A 3DXRA 4JYAB 3TETA 4JZ2A 4DXWA 5LBQA 4B3RO 4JAUA 4P9OA 1R3JC 4JI0B 4FK5C 3RWRD 1QQCA 3HKEA 4LF4O 4QPJA 2EIKC 1MSWD 4B3MO 3E86A 4UFZA 3JSLA 1KU9A 4JI4B 2RMKB 3F7VC 4NXMB 1J95A 4BIZA 4YJ3B 1FFXA 3SYAA 4JPRA 3HKBA 1DTOA 3OT7A 1IZ3A 1DGSA 1TUBB 5J2UB 2F95B 5HFLA 4LWSB 4PDMA 1OV9A 4WFGA 3CWBH 1VARA 2HJDA 5IYDO 1B06A 3FAVB 4D7TA 2Y0IA 4F6RA 2BOCC 4P30A 1GRJA 4A5UB 4X9QA 3O65A 2EX3A 1VF6A 4JI6B 2EIJC 4LF7B 2LO1A 5EBWC 1MABG 4HYOA 1VQ4V 3K5MA 4JASA 2HEPA 2IH1C 4FLZA 3RVZA 4OX9B 2UUCB 3AG7A 5C8YB 2Y0PA 4GT1A 4GX2A 2XHBA 1SQBH 3CCMV 5LA6B 3B4SA 3CCQV 5KLVH 3ZCCA 2DYSB 3CRRA 1ZUQA 1YTFB 4HNAB 5IT9N 2EZPA 3K9AA 5B1NA 4QE9A 2OYQA 2PUSA 1NI8A 4AI8A 4DR7B 3H1HH 4UV8A 1XDCA 1A32A 4LF9B 4MTXA 1R6TA 3H9VA 3FYEB 3SGIA 4HAMA 4I7ZB 1KP2A 1SC5B 1VQ7V 4F6EA 4Z1MG 3OMIB 3LDEA 1Z2GA 5DEDA 3SYOA 4JI5B 3AG2B 1SKVA 3B77A 4ZBMA 1H2NA 2QEXV 3ZMZA 2LW1A 3CRAA 4TQDA 3WFVA 4UB8Z 2D2CB 1R6NA 4X62O 3HR0A 2LW7A 3A0HZ 1VEWA 2YIBA 4B3TB 1P84F 1EBOA 3UT5B 4MVOA 4G2KA 3JCZA 1H8EG 1Y6XA 4DR4O 1KBHA 3SJCC 1XL4A 4DUYO 4I50A 4DV0O 1M1KW 4G28B 2FTKA 2OWOA 3IC9A 2JDIG 1AJQA 2YEVB 3ABLC 4K8ZA 1TAEA 4JI7B 1HNXB 3DC5A 2UU9O 3SYPA 1PNLA 2LGWA 4UB6Z 1Y67A 2ITDC 2AXTZ 1NKDA 5KAIZ 3OTOO 3BAAA 4NVPA 3QNEA 4IL6Z 1K97A 4UVBA 2ZR2A 1JFFA 2WLMA 2QWOB 2A06H 2HVKC 2A0LA 1ENVA 2JGDA 4D7SA 1JJ2U 5EC1C 3MHHC 1N33O 2DMXA 2ETNA 4KHPB 2Y48A 1N36O 2ZIOA 4JI1B 2HHHO 4L87A 1I5YA 4LR3A 3T1YO 4RUEA 5FPRA 2DW4A 4FVMA 4BW5A 4PJ0Z 3SYCA 1IURA 4YY3O 1MA1A 1XEQA 2QA4V 5LOVB 1E1QG 1RP3B 3LDCA 3N2GB 1S5LZ 1AI4A 3VOUA 1N34O 4TWKA 1XHZA 3UM7A 5JQGA 3ZHQA 1VF7A 3PJSK 3RYFA 1F7YA 4LFAB 3HPLC 1SRYA 1NQTA 1VQOV 3K5NA 1DLBA 4I0XA 1FXKB 1FS0G 3L72H 5JWPA 5FNVA 1XUQA 2CH7B 3THOA 3ML0A 1TVKB 4JI8O 4NB5A 4RQFA 2Q0OC 4MVSA 1SQPH 2E5LB 4LNUA 4DV3O 1VP7A 1U96A 2LP7A 2KG7B 1AP5A 3S3XA 2Z0AA 3HKCB 4RUFA 3ASOB 4WF9V 1NH2B 1GM9A 3I5DA 2ZXWC 1OCZC 2E76B 2JEXA 3CRQA 2P22C 1JJOA 3QTCA 5H5NA 2YI9A 4FLTA 2QE7G 4NTYA 3IFXA 5JVDA 4GYCB 3LDDA 2CDYA 4O2AA 1BL8A 1Q90D 2AW9A 1J5EB 4NXNB 4K8XA 2HFEC 4DV5O 2QKAA 2P90A 4GX0A 3LSUA 3ABKC 2BTQA 3JARA 2YC0A 4UCRA 2P4VA 4DUZO 3A8TA 3HKDB 1SQGA 3IAYA 2B1GA 2YSUB 3ZRWA 4ZKIA 1ZL8A 4JF3A 4FLUA 1Q7YW 1RPOA 3CHXA 1VMGA 5CB4B 1PKXA 1M56C 2Z5UA 2NNUA 2UXXA 1YIJV 1EN6A 1PM9A 1R3LC 2YDEA 4DR1O 4LCUC 4PV1B 1SA0B 1H2KA 5JH7A 1PV0A 4FPPA 5IJ9A 4KFMA 3K06A 5KHJA 3OGIB 4JAAA 1XOUA 4B3RB 1CP9A 2AHZA 3DTUB 3RYCB 3W7TA 1K5QA 1GN3A 2DE0X 3BHPA 3CE2A 4N23A 1RPRA 4CS3A 4B3MB 1XNQB 4LH7A 5FPOA 3OMAB 3SJAC 4QJFB 1QLNA 1ZLZA 4FLXA 3MD0A 3ZHUA 4MVMA 4B7KA 4CBCA 4CS4A 2Q5ZA 3B40A 1BZKA 4ASUG 1VF5B 5LXTB 4TQFA 3WG7C 4I4TA 4MT8A 2WA4A 5IWAO 1D5AA 2W0XA 4DK1A 4O4LB 5LMNO 2YS8A 5JJJB 1XQ8A 2WSSG 3JALB 4X89A 4NR1A 4U7NA 4IGGA 4CC5A 3RYIA 4TV8A 2MW2B 5CN0A 1K7DA 3CJHB 5EIBC 1PP9H 4B3SO 4YIOA 3JYCA 4K35A 5LHGA 3Q4HA 1ZWIC 4ZOLB 3OUSA 1WB7A 3EFFK 3ABUA 4YJ3A 2W6JG 4HBNA 2ITCC 2PYLA 2ZQMA 5KHGA 5B1AB 3CSXA 3K04A 2X6CA 1OJHA 3CCRV 3UO3A 3O9OA 3M7MX 1X4TA 2DYRB 2QDOA 4LWSA 4O2BB 2M7WA 1YEWA 3A0RA 1KQSU 5H6QA 4WFFA 2EJRA 3FAVA 1GTOA 3R66A 4CZZA 3ZRXA 3U0ZA 1M9NA 3D3IA 2LQTA 4QIWF 4KP4A 3ETEA 1AI5A 3JAWB 5CA3A 3JSNA 5IYBO 1US6A 3ETGA 1FPOA 3CRCA 3OM3B 2VQFO 2WLHA 2QJ1A 4K0KO 1G8MA 1FYJA 3SPCA 5B3SC 3OR6C 1R3KC 1LUVA 1NT2B 5C8YA 4PA7A 1K4CC 2Y4UA 5JJEB 2UUAO 3G71V 3EVKA 1YZBA 4RO2A 5LA6A 3BVOA 1KD1W 2EZOA 2IM9A 1XMQO 3E22B 1NS1A 4X62B 4J41A 2RCVA 2P4KA 4J80A 4AHCA 1FJGO 4DR4B 4JYBA 2E74B 2AZ2A 2OT5A 5DM6V 1YSCA 5AG2A 4DUYB 4MS2A 1O9GA 5L3DA 4YHHO 3AG1B 1EM1A 4O4IA 2Q9LA 4I9QA 3CC4V 4JV5O 5IYZA 5KA5A 1FD9A 1B3QA 4MVUA 5FLXN 4X66O 4TT3G 3OTOB 1PNMA 2F4VB 2DYSC 4H13B 1IXMA 1VIBA 3OEEG 2JJ2G 4MVRA 1Y74B 2RJZA 5CBFA 4ZI7B 4NKGB 4UCVA 1N33B 1S76D 4Z2WA 4BWAA 2XNDG 3QO8A 1YI2V 1N36B 2ADPA 2HHHB 4ABMA 4CH6A 2XAGA 5LGUA 3T1YB 1SS3A 1HNWO 1AP6A 2NR5A 2QGNA 2V1DA 3P30A 5EYPB 2YEVA 3JASB 5C93A 1Q3EA 2HJFC 4IT5A 1IX9A 3F5WC 2ZDIC 2QSAA 2ZR3A 5L3FA 1WJZA 3MDSA 4IYIA 4LC1A 4DR5O 1N34B 1Q86W 3H01A 5KUMA 1BHAA 3FB6C 4R8CA 4W4LA 3BY6A 3G6EV 1WA8A 1R6KA 4YJ2B 4G27B 1XMOO 3WB2A 5KHHA 1COWG 4GCZA 1NR7A 4EB6B 1R73A 5GONA 4PDVA 2UXCB 1YVWA 2R9AA 4DR3O 3CXCU 2PYJA 1F23A 4DW1A 3L70H 2IJJA 4XDKA 3CCLV 4JI2O 2IJHA 1EN4A 4CS2A 3CEIA 4LF5O 3B2EE 4FFBA 3N2GA 1Y76A 1GN4A 1Q5OA 1VQ8V 2BE3A 5B3SB 3EHBB 1Q81W 2QWRB 4X1YA 3GB7C 1F4MA 4X88A 3A0BZ 1RM1C 1S5HC 3VBBA 2N05A 1XNRO 4I9WA 4BAYA 4CH3A 2GUZB 3WB0A 3B09A 4LF6O 2XTAA 2DQ3A 4FJCC 1RFYA 4R7CA 4FM2A 1NJIW 1TVKA 5A2QN 1QHTA 4DUZB 3FFQA 5BZBA 1LUWA 5IJ0B 1NVPB 4FZ1A 1Y66A 4X65O 3DSQA 1KECA
chains in the Genus database with same CATH topology
1I5YA 1QCEA 4RUEA 1GO3F 3T1CA 2DW4A 4BW5A 3SYCA 4R50A 1CEZA 1K5SA 2AHYA 3MHSC 1NR1A 1EFRG 2WLKA 2QA4V 2JK5C 2LFSA 2ZDIA 1E1QG 1ROPA 4XDLA 1M90W 3LDCA 1K3EA 3ZRWB 4JTDB 3K0DA 1GM8A 1AI4A 2X6BA 3VOUA 4TWKA 1FXKC 3K08A 3FB5C 3UM7A 1GK9A 4XBFA 1KP3A 3ETDA 2XAFA 3PJSK 2V7QG 1P7BA 3HPLC 1SRYA 1TUEB 1NQTA 1H8HG 1VQOV 3I56V 1AJNA 1DLBA 2MK3A 1FXKB 3HB3B 1FS0G 2OCCC 1FXHA 1PD3A 3ML0A 3CC7V 2K1EA 4RQFA 3ASOC 1FFTB 4MVSA 5GW7A 3STLC 2Z3YA 3JD0A 4H33A 3ZN1A 1AJPA 3JD3A 5CBHA 3E35A 3B8NA 2WLJA 4MSWC 2Q6AA 1ORQC 2LP7A 1YJWV 1NVPD 4PELA 4RUFA 3ASOB 4WF9V 1NH2B 1GM9A 3QO5A 2ZXWC 1OCZC 3OE7G 3X2QC 2JEXA 3GWOA 3ZMUA 1SERA 1JQ0A 2QE7G 3IFXA 3LDDA 3ASNB 2ZXWB 1OCZB 3FB7C 1BL8A 3X2QB 2IU3A 4RQEA 2DWDC 2HFEC 1W0JG 2P90A 2B1IA 2H8PC 4GX0A 3TK1A 2WLIA 1YTFD 4EKWA 2B5UA 3E8HA 2A9HA 3ABKC 3K0GA 3OAAG 2F43G 2EIMC 5H9CA 4MW8A 5LGNA 3FB8C 3ABTA 1Q82W 3FYIB 3AG4B 3NXSA 2B1GA 2YSUB 4UVAA 3ZRWA 3ABKB 4ZKIA 4JF3A 4TSFG 2EIMB 1JX9A 1Q7YW 2P6JA 1OCCB 1RPOA 1DF4A 1DF5A 1PKXA 1K4DC 1M56C 3CC2V 2Z5UA 2NNUA 2UXXA 1YIJV 3SPHA 3KG2A 2R9RB 1NH2D 3E2EA 4LP8A 1R3LC 1F4NA 5EK0A 4LCUC 3SPIA 4YXWG 1CPYA 1QLEC 4N21A 1VQNV 2EINB 2HLDG 1FXKA 1M56B 4FPPA 2A79B 1RM1B 4PA9A 2QM7A 4KFMA 3I55V 2EBOA 5B1OA 3K06A 3LSQA 3LNMB 1QLEB 4WCEV 2D3OW 1CP9A 2AHZA 3DTUB 3W7TA 1K5QA 3CCVV 1S77D 4DO2A 4MVQA 1BMFG 1PNKA 2EILC 4LBEC 4N23A 1SZTA 3ZMTA 1RPRA 1VQ5V 2IJIA 4J9ZB 1UJWB 4JAVA 2Q69A 2WWWA 2WLLA 1PL0A 3OMAB 1OCOC 3IC7A 4WFAV 4WFEA 2EILB 5LGTA 2JEUA 4QJFB 4H37A 1VQKV 5IDJA 1QLNA 1V54C 5IY5C 1F51A 3ZRSA 2IU0A 2P67A 3MD0A 4BIUA 1EZJA 4MVMA 1YJNV 1K73W 4CBCA 3AG3C 1VQLV 3CCUV 4ASUG 1OCOB 3WG7C 4F4LA 3T2MA 2HG5C 2DWEC 5IY5B 4MT8A 3CPWU 4J9YB 3ZMSA 1VQPV 3AG3B 5IYCO 1R3IC 2NLJC 4P2ZA 3SYQA 3WG7B 2WSSG 4X89A 4U7NA 5KA6A 4JYCA 3M99B 5CN0A 1K7DA 2OCCB 3W7WA 1GMGA 2H94A 3TCUA 4MTGA 1E1RG 4PDLA 2IJKA 4X8AA 3JYCA 5EC2C 3E8GA 5B1AC 5LHGA 4FMTA 3DGEA 2Q67A 1ZWIC 3OGCC 4JTAB 2XASA 1BHBA 2WLLB 5E1AC 4PA3A 3OUSA 3EFFK 4I5SA 3ZMVA 2XAQA 3ABUA 2JIZG 3OFNG 2DYRC 2W6JG 1YHQV 2ITCC 2X7RB 4HZ3A 2ZQMA 5B1AB 5L3BA 3K04A 2X6CA 3AG2C 3ZJZA 1K33A 3SPJA 1OHHG 5CMUA 3CCRV 4UV9A 1QVFU 1N8RW 3G4SV 3ABMC 2DYRB 4E2LA 2M7WA 3A0RA 5H6RA 3ZIAG 3E83A 1QVGU 3P32A 1KQSU 1GKFA 5H6QA 4WFFA 1W2BU 3LSSA 2EJRA 4QNHB 1GTOA 4CZZA 3IGAC 3ZRXA 1WPXA 3ABMB 1M9NA 4GX5A 3RBZA 4UVCA 3RVYA 3D3IA 4QIWF 3CD6V 3CCJV 2PI4A 4KP4A 4QPKA 3TETA 3ETEA 1AI5A 5CA3A 5B1BC 5IYBO 2QKSA 3K3WA 4DXWA 5LBQA 3ETGA 3CP1A 4JAUA 4P9OA 3F7YC 4GX1A 1R3JC 1QR8A 2JJ1G 3OM3B 4FK5C 4MTFA 1YJ9V 2WLHA 1H38A 1QBZA 2QTOA 4QPJA 1G8MA 1AR1B 2EIKC 1MSWD 3E86A 5L3GA 1GM7A 5B1BB 3SPCA 4FIPC 5B3SC 1B6QA 3F7VC 3OR6C 1R3KC 1J95A 4BIZA 1H2GA 2OTJV 3SYAA 4PA7A 1K4CC 4JPRA 2EIKB 3G71V 1V55C 4Q20A 1DTOA 4RO2A 5EBLC 4QE7A 1KD1W 2EZOA 3E89A 5J9PC 5HFLA 4PDMA 4WFGA 5L3CA 2GSMB 2LFRA 4UUJC 1V55B 2W0FC 5IYDO 3LUTB 4JYBA 3AG1C 4RAIA 2P7TC 2OT5A 5DM6V 2BOCC 1YSCA 3OUFA 4P30A 1M57C 3W7XA 2R9IA 4MS2A 2IW5A 5L3DA 1S72V 2BOBC 3AG1B 2EIJC 2DQ0A 4MW3A 1P4RA 5EBWC 1KC8W 5DN6G 1MABG 4MTOA 3CC4V 1JOYA 4HYOA 3CCEV 1SETA 5KA5A 1VQ4V 1M57B 4KUMA 4JASA 2IH1C 1VQ9V 3RVZA 1JCHA 2X6AA 1XL6A 2EIJB 4MVUA 3W7SA 2PI5A 5L3EA 4TT3G 1V54B 5FL7G 1PNMA 2WLNA 1YITV 2DYSC 3K79A 4GT1A 4UXNA 4PDRA 1IXMA 4GX2A 2OTLV 3OEEG 2JJ2G 2W6IG 4MVRA 4R6ZA 3CCMV 4JTCB 2UXNA 2QM8A 5CBFA 3CCQV 3ZCCA 1JVMA 3T4ZA 3B8MA 2DYSB 3K03A 1OZ0A 1AI7A 2CK3G 2XOKG 3JD1A 1S76D 2X0LA 3JD4A 1YTFB 2XNDG 2WPDG 1I5XA 3QO8A 1YI2V 2EZPA 1S3JA 3BEHA 3K9AA 5B1NA 2XAGA 4WFHA 4QE9A 1JPXA 5LGUA 3OW2U 3QO7A 2HR3A 3ZN0A 3R65A 2V1DA 2Y69C 1L1FA 3P30A 4UV8A 5EBMC 2YEVA 4MTXA 5C93A 2HJFC 2HVJC 3FYEB 4HAMA 3F5WC 2ZDIC 1KP2A 1QR9A 2ZR3A 5L3FA 3CYOA 1VQ7V 2HKOA 2IH3C 4LC1A 4Z1MG 3OMIB 2Y69B 3LDEA 3SYOA 1Q86W 2WAMA 5LHIA 3ASNC 1G4YB 3H01A 3OR7C 5KUMA 4P9PA 3AG2B 3B77A 3FB6C 4OXSA 4R8CA 1AROP 4ZBMA 3BY6A 3G6EV 3CCSV 1BHAA 2QEXV 3ZMZA 3UKMA 1LNQA 1R6KA 3OMNB 4G27B 3FKSG 3WFVA 4WFBV 1R6NA 2ATKC 3ZRVA 1COWG 4GCZA 1NR7A 1W0KG 5KUKA 1THZA 1EBOA 2XAJA 1R73A 4MVOA 4PDVA 4G2KA 3JCZA 1H8EG 1MOFA 2Q68A 4PA6A 3CXCU 1F23A 1E79G 4XDKA 1XL4A 2IJJA 3CCLV 3AG4C 1VQ6V 1K9MW 2IJHA 1K92A 1K8AW 1M1KW 1MG1A 1S0VA 3D36A 4G28B 1VQMV 1SESA 2FTKA 3W7UA 3SJQC 5CBGA 2JDIG 1OCCC 1AJQA 2YEVB 1KKDA 3ABLC 1OCRC 5LHHA 5HFMA 3SYPA 1VQ8V 1NBMG 1PNLA 1Y4MA 5B3SB 3EHBB 1Q81W 2ITDC 3E8FA 3GB7C 3RW0A 2EINC 1NKDA 2C2AA 1FXVA 4PA4A 3T4DA 1F4MA 2XAHA 3JD2A 3ABLB 4X88A 4XDJA 1OCRB 1RM1C 1S5HC 3VBBA 3CMEV 4I9WA 3QNEA 4BAYA 1K97A 2ZD9A 4UVBA 1K34A 2ZR2A 2WLMA 3CMAV 4JGSA 4U7OA 2HVKC 2KB1A 2A0LA 1ENVA 3OEHG 1HWYA 1JJ2U 2GHYA 2DQ3A 1WLEA 4FJCC 3MHHC 5EC1C 4R7CA 1NJIW 3AEIA 4MVZA 2Y48A 3STZC 1AI6A 5BZBA 3SPGA 3E8BA 1NVPB 1Y66A 1KECA 2WLIB 4L87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E83 A;  1K4D C;  1M56 C;  4RUE A;  3T1C A;  3BEH A;  4WFF A;  4WFH A;  4BW5 A;  4QE9 A;  3SPH A;  3SYC A;  3KG2 A;  4R50 A;  2R9R B;  4QNH B;  2AHY A;  4LP8 A;  1R3L C;  3SPI A;  5EK0 A;  4LCU C;  2WLK A;  3IGA C;  2JK5 C;  1QLE C;  3R65 A;  4GX5 A;  3RBZ A;  2Y69 C;  4XDL A;  3LDC A;  3RVY A;  2A79 B;  2YEV A;  5EBM C;  4JTD B;  4PA9 A;  3K0D A;  4KFM A;  3TET A;  2HJF C;  2HVJ C;  5B1B C;  2X6B A;  3F5W C;  3VOU A;  2QKS A;  3K06 A;  4DXW A;  4TWK A;  4P9O A;  3LNM B;  3F7Y C;  4GX1 A;  3K08 A;  1R3J C;  3FB5 C;  3UM7 A;  2IH3 C;  4MTF A;  2WLH A;  3LDE A;  3SYO A;  2AHZ A;  3PJS K;  2QTO A;  1P7B A;  2EIK C;  3ASN C;  1G4Y B;  3E86 A;  3HPL C;  3OR7 C;  4MVQ A;  2EIL C;  4LBE C;  5KUM A;  3SPC A;  4P9P A;  5B3S C;  3F7V C;  4J9Z B;  3OR6 C;  3FB6 C;  4OXS A;  4R8C A;  4ZBM A;  1R3K C;  1J95 A;  2OCC C;  2Q69 A;  3UKM A;  2WLL A;  1LNQ A;  3SYA A;  4PA7 A;  1K4C C;  4G27 B;  1OCO C;  1V55 C;  2K1E A;  4WFE A;  2ATK C;  3ASO C;  4MVS A;  4RO2 A;  5EBL C;  4H37 A;  4QE7 A;  3STL C;  1V54 C;  3E89 A;  4H33 A;  5IY5 C;  3ZRS A;  5KUK A;  5CBH A;  4MVO A;  5J9P C;  4MVM A;  4PDM A;  4PDV A;  2WLJ A;  3AG3 C;  4MSW C;  2Q6A A;  4WFG A;  4CBC A;  1ORQ C;  2Q68 A;  4PA6 A;  4UUJ C;  2W0F C;  3WG7 C;  4XDK A;  1XL4 A;  4RUF A;  4F4L A;  3AG4 C;  3LUT B;  3T2M A;  2HG5 C;  3AG1 C;  4RAI A;  2DWE C;  2P7T C;  2ZXW C;  1OCZ C;  3X2Q C;  2BOC C;  4G28 B;  3OUF A;  4J9Y B;  4P30 A;  1M57 C;  3SJQ C;  5CBG A;  1R3I C;  1OCC C;  2NLJ C;  3IFX A;  4MS2 A;  4P2Z A;  3LDD A;  3SYQ A;  1KKD A;  3ABL C;  1OCR C;  4X89 A;  2BOB C;  2EIJ C;  3SYP A;  4MW3 A;  3FB7 C;  1BL8 A;  5EBW C;  4MTO A;  4HYO A;  2DWD C;  2HFE C;  2ITD C;  3E8F A;  3GB7 C;  3RW0 A;  2EIN C;  3T4D A;  2IH1 C;  4PA4 A;  4XDJ A;  4X88 A;  3RVZ A;  2H8P C;  3TCU A;  1S5H C;  4GX0 A;  4MTG A;  4PDL A;  2X6A A;  1XL6 A;  2WLI A;  4I9W A;  4X8A A;  4MVU A;  2ZD9 A;  3JYC A;  3E8G A;  5EC2 C;  5B1A C;  4EKW A;  3E8H A;  2WLN A;  2Q67 A;  2A9H A;  1ZWI C;  2DYS C;  3ABK C;  3K0G A;  2WLM A;  2WLL B;  3OGC C;  4JTA B;  2EIM C;  4PA3 A;  5E1A C;  3OUS A;  3EFF K;  4PDR A;  4MW8 A;  2HVK C;  2KB1 A;  2A0L A;  4GX2 A;  3FB8 C;  4MVR A;  2DYR C;  4R6Z A;  2ITC C;  4HZ3 A;  4JTC B;  5CBF A;  5EC1 C;  4R7C A;  3K04 A;  2X6C A;  1JVM A;  3AG2 C;  3ZJZ A;  3T4Z A;  4MVZ A;  3SPJ A;  3K03 A;  3STZ C;  5BZB A;  3SPG A;  3E8B A;  2WLI B;  3ABM C; 
#chains in the Genus database with same CATH topology
 3T1H O;  1GO3 F;  3T1C A;  4FFK A;  3HKC A;  1CEZ A;  1K5S A;  2AHY A;  1EFR G;  2N04 A;  2JK5 C;  2LFS A;  4AIL C;  4XDL A;  4GKJ O;  4DR1 B;  3K0D A;  3D3Q A;  3KCX A;  4X64 O;  1D5N A;  1FXK C;  3EXA A;  5D5Q A;  1IBL O;  5E79 Z;  1GK9 A;  2A3Q A;  4XBF A;  1KP3 A;  2BTO A;  4IIJ B;  4OPH A;  2VRZ A;  3HB3 B;  2OCC C;  4X20 B;  3SDL A;  2DN9 A;  2K1E A;  3ASO C;  3RYH B;  1I0H A;  3ZN1 A;  2YIB D;  2RDC A;  2Q6A A;  5IE9 A;  1YJW V;  1GN6 A;  1NTM H;  1Q8I A;  2QTS A;  3GWO A;  1SER A;  1JQ0 A;  4FLV A;  1BS3 A;  1WPB A;  5IWA B;  2OCH A;  5LMN B;  3FD9 A;  4LF8 O;  5B66 Z;  3QG5 A;  3N2K A;  2DWD C;  1Q6H A;  4IHJ A;  2NN4 A;  4ZHQ B;  2DJV A;  1BSM A;  3K5L A;  2WLI A;  5CA0 B;  2A9H A;  3K0G A;  3G80 A;  4B3S B;  1WP7 A;  4MW8 A;  3FB8 C;  4C7U A;  4U3J B;  3NXS A;  4PD4 F;  1JX9 A;  4FLY A;  4O4J B;  5BMV B;  1DF5 A;  3CC2 V;  1WNS A;  5LXT A;  4JYY A;  2CTQ A;  4DV4 O;  4YXW G;  1IXB A;  1YF2 A;  1VQN V;  2HLD G;  2HP8 A;  2A79 B;  1RM1 B;  2QWN B;  2QM7 A;  3JCU Z;  4WBN B;  2ZM6 O;  3I55 V;  3JAL A;  3D8C A;  2ZT9 B;  3U10 A;  3LSQ A;  2VWK A;  2D3O W;  2UXD O;  3JAT B;  3APO A;  1SZX A;  5CA1 A;  3CJH A;  4MVQ A;  1BMF G;  1PNK A;  3ZMT A;  2VQF B;  4K0K B;  3CS5 A;  4UCT A;  1KYO F;  4JAV A;  2Q69 A;  4ZOL A;  4KL1 A;  5KMG B;  3IC7 A;  4WFA V;  4WFE A;  1VQK V;  2DOS A;  1V54 C;  1ZX3 A;  3ZRS A;  2FB5 A;  5LYJ B;  5BY1 A;  4DW0 A;  1K73 W;  1VQL V;  4GLX A;  1XMQ B;  2Q7E A;  4LFB B;  3TXS A;  4O2B A;  2HG5 C;  5IY5 B;  4YIP A;  1FFX B;  4DYL A;  4J9Y B;  2ZCE A;  3ZMS A;  1FJG B;  2NLJ C;  4P2Z A;  1TGO A;  2QR4 A;  4X1K B;  1XHX A;  4B08 A;  4DV7 O;  4J10 A;  2OCC B;  1GMG A;  2H94 A;  4JV5 B;  4J7J A;  4X1I B;  5KX5 B;  4X8A A;  5EC2 C;  3E8G A;  5B1A C;  1I08 A;  1JA8 A;  2Q67 A;  4JTA B;  2XAS A;  4PA3 A;  3OD4 A;  4X66 B;  2DYR C;  1YHQ V;  2Q4P A;  4HZ3 A;  2X7R B;  4KXR A;  1K33 A;  3P3N A;  1ZSP A;  4UV9 A;  1H2L A;  3QVN A;  1N8R W;  4JI4 O;  4NXM O;  3ZIA G;  3E83 A;  1QVG U;  5DEC A;  2PTM A;  2JRI A;  3WB1 A;  3IGA C;  1WPX A;  1M5I A;  3RBZ A;  4UVC A;  1KKC A;  1HNW B;  1S5J A;  3ZHR A;  2PGG A;  3CCJ V;  3CD6 V;  3G6B A;  2VWJ A;  4DV6 O;  3M8A A;  1IBM O;  3K3W A;  3MAQ A;  4DRX B;  3F7Y C;  2JJ1 G;  4MTF A;  1YJ9 V;  1H38 A;  1AR1 B;  3G67 A;  4DR5 B;  5L3G A;  1GM7 A;  5B1B B;  2ILM A;  3P3P A;  1B6Q A;  1IBK O;  4UCO A;  1H2G A;  2AGA A;  4DR2 O;  2YIC A;  3K58 A;  4Q20 A;  1AR5 A;  2VS0 A;  3E89 A;  3CX5 F;  4IYH A;  2UUC O;  4ZI7 A;  4DV2 O;  5L3C A;  5BR8 O;  2GSM B;  4UUJ C;  1V55 B;  2BSK B;  3LUT B;  3AG1 C;  4RAI A;  4DR3 B;  4LF4 B;  3H1I H;  4JI2 B;  2R9I A;  2PY5 A;  2IW5 A;  4Q6G A;  4ZIB A;  1S72 V;  2BOB C;  4LF5 B;  4MW3 A;  1P4R A;  5EYP A;  3F5T A;  5DN6 G;  1JOY A;  3ZHV A;  1M57 B;  4ICG A;  3UCS C;  1JCH A;  5J2T A;  1XL6 A;  3L9D A;  3W7S A;  5ITZ B;  2PI5 A;  1YIT V;  1V54 B;  2WLN A;  1XNR B;  4LF9 O;  3K79 A;  4UXN A;  2OTL V;  2W6I G;  1FKA O;  2V4D A;  2UXN A;  2QM8 A;  1MNG A;  4Z1V A;  1L0N H;  1JVM A;  4LF6 B;  2ARH A;  3K03 A;  1OZ0 A;  1NZ6 A;  1LR1 A;  4CC6 A;  1M4U A;  2WPD G;  2Q7G A;  2B9Z A;  1N0N A;  1JFF B;  1AR4 A;  1S3J A;  3BEH A;  4X65 B;  2LJ2 A;  3ETQ A;  3T1H B;  1JPX A;  3OW2 U;  3QO7 A;  4NTW A;  2CTP A;  3ZN0 A;  3R65 A;  3CXH F;  5JJN B;  1RSO B;  3CYO A;  2IBZ H;  2HKO A;  2IH3 C;  1TUB A;  2Y69 B;  5J2U A;  1N4C A;  2R70 A;  2ADQ B;  3OTF A;  3VQY A;  1I94 O;  3ASN C;  2ZIM A;  3BPZ A;  4P9P A;  4J42 A;  3J80 N;  1LNQ A;  3OMN B;  3CRM A;  3FKS G;  4O4H B;  4WFB V;  3ZRV A;  1XI1 A;  1W0K G;  3JAM N;  5KUK A;  1THZ A;  2FML A;  1FAF A;  5IJ0 A;  1QNM A;  1E79 G;  2RN9 A;  4FZ0 A;  1VQ6 V;  1XRE A;  1K92 A;  3D36 A;  1VQM V;  1KKD A;  5LHH A;  4J7Z A;  3LNN A;  3RGB A;  1GN2 A;  1AVM A;  4UCS A;  3E8F A;  2C2A A;  2Q0A A;  1OCR B;  2XUM A;  3CME V;  4HNA A;  5LMU O;  2ZD9 A;  5H2F Z;  1K34 A;  5JVD B;  3CMA V;  2Q8V A;  4I55 B;  4O2A B;  4DV0 B;  1WLE A;  3D36 C;  5LP6 C;  3SPG A;  3E8B A;  2JVD A;  1DK1 A;  2UU9 B;  1BE3 H;  3BA8 A;  3JAR B;  2WLK A;  4H44 B;  2ZDI A;  1YCI A;  4AQY O;  4DV4 B;  3ZRW B;  1JMK C;  1ZL8 B;  1GM8 A;  2QKC A;  2OIE A;  2ZE7 A;  5GTI Z;  2F1M A;  3K08 A;  2ZM6 B;  3FB5 C;  1N0J A;  3ETD A;  2XAF A;  3UT5 A;  1AIL A;  2V7Q G;  1HR0 O;  1H8H G;  1AJN A;  2MK3 A;  5JH7 B;  1FXH A;  5IJ9 B;  4YY3 B;  1G6U A;  1FFT B;  2Z3Y A;  4H33 A;  1AJP A;  5TIS Z;  3E35 A;  2JGU A;  4MSW C;  4PEL A;  5LL6 Y;  2RQ6 A;  1KMI Z;  1T5E A;  1EN5 A;  1Q6U A;  1O9H A;  2EJ7 A;  3ASN B;  3X2Q B;  4TV9 B;  4JI8 B;  4DV7 B;  2Y4T A;  2B1I A;  1V9P A;  2H8P C;  3TK1 A;  4EKW A;  2B5U A;  4DV3 B;  3K9S A;  1BT8 A;  3AK2 A;  1WAZ A;  3BAB A;  3OAA G;  2F43 G;  2FKX A;  5LGN A;  2FYU H;  3ABT A;  4DR6 O;  5LOV A;  1KUQ A;  3RYI B;  4TV8 B;  1Q82 W;  5KMG A;  1YDX A;  2E3C A;  4TSF G;  2EIM B;  1URF A;  1W59 A;  2P6J A;  5LYJ A;  1DF4 A;  1XNQ O;  3Q4H B;  4DV5 B;  1BQZ A;  3AK1 A;  2R9R B;  1NH2 D;  4LP8 A;  1F4N A;  1CPY A;  2ZNI A;  4N21 A;  4D6T H;  1FXK A;  2LGQ A;  4PA9 A;  4X1K A;  2CH7 A;  1MMM A;  2EBO A;  1PPJ H;  3ZS8 C;  3APQ A;  1QLE B;  2KKW A;  4DV6 B;  4JZG A;  4WCE V;  1IDS A;  2VQE O;  1IBM B;  2KG7 A;  3RN4 A;  4X1I A;  5KX5 A;  2PF4 E;  1VQ5 V;  4BR6 A;  2IJI A;  5A9G A;  5LP6 B;  4TUY B;  3SR2 C;  5BXZ A;  3RFR A;  1PL0 A;  4JI3 O;  1Q6I A;  4FM1 A;  1IBK B;  3C3T A;  2EIL B;  3K57 A;  1Z5V A;  4DR2 B;  5IDJ A;  5IY5 C;  2IU0 A;  3VQW A;  3CCU V;  1OCO B;  5F2V O;  4GKK O;  3S3W A;  4F4L A;  4DV2 B;  5BR8 B;  2DWE C;  3SJB C;  4LFC O;  3CPW U;  1UFI A;  3AG3 B;  2H3O A;  3GWK C;  2Q73 A;  1P7G A;  4JYC A;  1WB8 A;  1TA8 A;  3HKD A;  1XIL A;  1VF6 C;  4DRX A;  5JCO A;  4UCU A;  1QU7 A;  1E1R G;  4PDL A;  1XBL A;  3J7A U;  5CB4 A;  1BHB A;  3H1K H;  2WLL B;  1H2S B;  5E1A C;  4GUN A;  3ZMV A;  2XAQ A;  2F93 B;  4O4I B;  2XT9 A;  1SA0 A;  4OPA A;  5IYZ B;  2KQX A;  5CMU A;  1IVS A;  2ZIN A;  1HDJ A;  1QVF U;  1H2M A;  2EUL A;  2ZKO A;  5H6R A;  3P32 A;  1GKF A;  1W2B U;  3LSS A;  2RNB A;  3RYC A;  2BSK A;  1SQF A;  5JCO C;  3ABM B;  4GX5 A;  2GBO A;  4QPK A;  5B1B C;  2QKS A;  1ZTE A;  3CP1 A;  4GX1 A;  1QR8 A;  3H1L H;  1G1X B;  3C90 A;  2UUB O;  2ZE6 A;  1QBZ A;  2QTO A;  5EZY B;  4FIP C;  5ITZ A;  1I94 B;  4DV1 O;  2OTJ V;  4O4L A;  2EIK B;  1V55 C;  1SQX H;  1Q43 A;  3KZI Z;  2YIA A;  2N74 A;  5EBL C;  4QE7 A;  1GH6 A;  1N32 O;  3K59 A;  1MZE A;  5J9P C;  2CTW A;  2F4V O;  2LFR A;  3JAK B;  2W0F C;  3A2F A;  2P7T C;  1WA8 B;  3OUF A;  1M57 C;  3W7X A;  4B7E A;  3BCC H;  3DXR B;  2DQ0 A;  5GON B;  1KC8 W;  4MTO A;  3CCE V;  3TJT A;  1SET A;  2UUA B;  4KUM A;  3J81 N;  1RSO A;  3HKE B;  3IJ4 A;  1VQ9 V;  3CB2 A;  2X6A A;  2EIJ B;  4BIO A;  3ZX6 A;  1HNZ O;  5L3E A;  5FL7 G;  5LMU B;  5D5P A;  4FFB B;  3HKB B;  4PDR A;  3KCY A;  1Y76 B;  4R6Z A;  4JTC B;  3C3S A;  4EEQ A;  2GDS A;  4O4H A;  3T4Z A;  3B8M A;  4X1Y B;  2CK3 G;  1AI7 A;  2XOK G;  5GTH Z;  3JD1 A;  3JAW A;  4YHH B;  2X0L A;  2CGN A;  3JD4 A;  1I5X A;  3DC6 A;  3K5O A;  1MZF A;  3ZBH A;  4WFH A;  4F6R B;  2F66 C;  2UXB O;  4JYA O;  2K9P A;  2HR3 A;  2Y69 C;  1L1F A;  2YUA A;  5EBM C;  2UXC O;  4JI0 O;  4AQY B;  2HVJ C;  4LH6 A;  2P06 A;  2WA3 A;  1QR9 A;  5K1P A;  2OIG A;  3E22 A;  2WAM A;  5LHI A;  5KHK A;  1G4Y B;  3OR7 C;  3AK3 A;  1NU1 H;  1NTK H;  4OXS A;  1ARO P;  3CCS V;  2CTR A;  1HR0 B;  3UKM A;  3WU2 Z;  4I55 A;  1R1B A;  2ATK C;  2R72 A;  4L8J A;  3ZED A;  2XAJ A;  1MOF A;  2Q68 A;  4PA6 A;  3L75 H;  3AG4 C;  1P49 A;  1K9M W;  4BW9 A;  3RT3 C;  1K8A W;  4DK0 A;  1MG1 A;  1S0V A;  1SES A;  1EZV H;  3W7U A;  3SJQ C;  5CBG A;  2CE4 A;  4JI6 O;  1OCC C;  4LF7 O;  1OCR C;  1Z5W A;  2YXY A;  5HFM A;  5EIB D;  1PL4 A;  1Y74 A;  2O57 A;  1NBM G;  1Y4M A;  1XMO B;  2YXL A;  4OX9 O;  4J7K A;  2GV9 A;  3RW0 A;  2EIN C;  3T4D A;  1L0L H;  1FXV A;  4PA4 A;  2XAH A;  3JD2 A;  4XDJ A;  3ABL B;  2ZNJ A;  2CGO A;  4JGS A;  4U7O A;  2KB1 A;  4PI0 A;  2AZ0 A;  3GVM A;  3OEH G;  1HWY A;  2GHY A;  4K3A A;  2PZS A;  3N2K B;  2ZE5 A;  2YI8 A;  4IHJ B;  3AEI A;  4DR6 B;  3JAS A;  4MVZ A;  3STZ C;  1AI6 A;  3QF7 A;  2WLI B;  3W7W A;  1QCE A;  4I50 B;  2M6Y A;  2JS5 A;  4R50 A;  3MHS C;  4DR7 O;  1NR1 A;  1D2D A;  1ROP A;  2P5O A;  1M90 W;  1K3E A;  4JTD B;  4YJ2 A;  4FLW A;  1ZAU A;  2X6B A;  3TXQ A;  1NTZ H;  4TV9 A;  4JI5 O;  4EB6 A;  1SQV H;  2A7W A;  5K1X A;  1P7B A;  1TUE B;  5KAF Z;  2VQE B;  3I56 V;  2JGD B;  1PD3 A;  4B3T O;  1UPG A;  3CC7 V;  1M93 A;  3N27 A;  2QWP B;  5GW7 A;  4JI3 B;  3STL C;  3JD0 A;  3JD3 A;  4GKJ B;  5CBH A;  1BCC H;  3B8N A;  2WLJ A;  5CA1 B;  1ORQ C;  1NVP D;  4X64 B;  1IBL B;  3QO5 A;  3OE7 G;  3X2Q C;  4GKK B;  2QWQ B;  3ZMU A;  3FX7 A;  2QM4 A;  4JI7 O;  4LFC B;  1HNX O;  3VQV A;  2GUZ A;  2GTA A;  1KB9 F;  2ZXW B;  1OCZ B;  3FB7 C;  2CUG A;  2IU3 A;  4RQE A;  5JQG B;  1I7F A;  4J11 A;  3UQ8 A;  1BGY H;  3RYF B;  1W0J G;  1YTF D;  4I0X B;  3E8H A;  5FNV B;  1B04 A;  2EIM C;  4H0L B;  4PHZ A;  5H9C A;  1HP8 A;  3NR7 A;  5LP6 A;  2L35 A;  4TUY A;  4KHP O;  3KKY A;  3FYI B;  3AG4 B;  4JI1 O;  3UO2 A;  4UVA A;  3ABK B;  4LNU B;  4LF8 B;  2FL4 A;  1OCC B;  4NYK A;  1K4D C;  3VQX A;  4FM0 A;  4IIJ A;  3SPH A;  2F23 A;  3KG2 A;  1HW7 A;  3E2E A;  3SPI A;  5EK0 A;  2Q7H A;  1QLE C;  1CXZ B;  4EFE A;  2EIN B;  4PI2 A;  1M56 B;  3ZHS A;  4X20 A;  4GZR B;  4LFB O;  5B1O A;  2ODM A;  3RYH A;  3LNM B;  4LFA O;  3BFR A;  2JS3 A;  1S77 D;  3CCV V;  1L8D A;  4DO2 A;  2UUB B;  2EIL C;  4LBE C;  1SZT A;  2BTQ B;  4J9Z B;  4NTX A;  2L6L A;  1UJW B;  2WWW A;  3TGU H;  2WLL A;  1OCO C;  2E5L O;  1AB3 A;  5LGT A;  4DV1 B;  2JEU A;  4H37 A;  4EFB A;  3BA9 A;  1F51 A;  1U97 A;  2P67 A;  4BIU A;  1YJN V;  1EZJ A;  3AG3 C;  4RWU A;  4U3F H;  5KHI A;  1N32 B;  4ZHQ A;  4E4E A;  3T2M A;  3L74 H;  2BCC H;  4W4K A;  5CA0 A;  2UXD B;  1VQP V;  5IYC O;  1R3I C;  3U11 A;  1J5E O;  3SYQ A;  4NXN O;  3WG7 B;  1GAX A;  2ZE8 A;  3BRC A;  3H1J H;  4CH5 A;  5KA6 A;  4U3J A;  3M99 B;  3PN1 A;  3TCU A;  4MTG A;  4O4J A;  2IJK A;  5BMV A;  2KSD A;  3ICX A;  4FMT A;  3DGE A;  4TOI A;  5EZY A;  3OGC C;  3ZHT A;  4I5S A;  1HNZ B;  2JIZ G;  3OFN G;  2GTS A;  1WN7 A;  2E75 B;  5L3B A;  1JR9 A;  2G38 A;  3AG2 C;  3ZJZ A;  2YXH A;  1X59 A;  3SPJ A;  1OHH G;  4QGP A;  1WP8 A;  4WBN A;  5J2T B;  1MSD A;  3G4S V;  3ABM C;  4E2L A;  5B5E Z;  2CAZ C;  4I4T B;  4CH4 A;  4OGQ B;  3L73 H;  3JAK A;  3JAT A;  1SQQ H;  4QNH B;  1BQ0 A;  1YXB A;  3RVY A;  3L71 H;  2UXB B;  1SF9 A;  2YID A;  2PI4 A;  3DXR A;  4JYA B;  3TET A;  4JZ2 A;  4DXW A;  5LBQ A;  4B3R O;  4JAU A;  4P9O A;  1R3J C;  4JI0 B;  4FK5 C;  3RWR D;  1QQC A;  3HKE A;  4LF4 O;  4QPJ A;  2EIK C;  1MSW D;  4B3M O;  3E86 A;  4UFZ A;  3JSL A;  1KU9 A;  4JI4 B;  2RMK B;  3F7V C;  4NXM B;  1J95 A;  4BIZ A;  4YJ3 B;  1FFX A;  3SYA A;  4JPR A;  3HKB A;  1DTO A;  3OT7 A;  1IZ3 A;  1DGS A;  1TUB B;  5J2U B;  2F95 B;  5HFL A;  4LWS B;  4PDM A;  1OV9 A;  4WFG A;  3CWB H;  1VAR A;  2HJD A;  5IYD O;  1B06 A;  3FAV B;  4D7T A;  2Y0I A;  4F6R A;  2BOC C;  4P30 A;  1GRJ A;  4A5U B;  4X9Q A;  3O65 A;  2EX3 A;  1VF6 A;  4JI6 B;  2EIJ C;  4LF7 B;  2LO1 A;  5EBW C;  1MAB G;  4HYO A;  1VQ4 V;  3K5M A;  4JAS A;  2HEP A;  2IH1 C;  4FLZ A;  3RVZ A;  4OX9 B;  2UUC B;  3AG7 A;  5C8Y B;  2Y0P A;  4GT1 A;  4GX2 A;  2XHB A;  1SQB H;  3CCM V;  5LA6 B;  3B4S A;  3CCQ V;  5KLV H;  3ZCC A;  2DYS B;  3CRR A;  1ZUQ A;  1YTF B;  4HNA B;  5IT9 N;  2EZP A;  3K9A A;  5B1N A;  4QE9 A;  2OYQ A;  2PUS A;  1NI8 A;  4AI8 A;  4DR7 B;  3H1H H;  4UV8 A;  1XDC A;  1A32 A;  4LF9 B;  4MTX A;  1R6T A;  3H9V A;  3FYE B;  3SGI A;  4HAM A;  4I7Z B;  1KP2 A;  1SC5 B;  1VQ7 V;  4F6E A;  4Z1M G;  3OMI B;  3LDE A;  1Z2G A;  5DED A;  3SYO A;  4JI5 B;  3AG2 B;  1SKV A;  3B77 A;  4ZBM A;  1H2N A;  2QEX V;  3ZMZ A;  2LW1 A;  3CRA A;  4TQD A;  3WFV A;  4UB8 Z;  2D2C B;  1R6N A;  4X62 O;  3HR0 A;  2LW7 A;  3A0H Z;  1VEW A;  2YIB A;  4B3T B;  1P84 F;  1EBO A;  3UT5 B;  4MVO A;  4G2K A;  3JCZ A;  1H8E G;  1Y6X A;  4DR4 O;  1KBH A;  3SJC C;  1XL4 A;  4DUY O;  4I50 A;  4DV0 O;  1M1K W;  4G28 B;  2FTK A;  2OWO A;  3IC9 A;  2JDI G;  1AJQ A;  2YEV B;  3ABL C;  4K8Z A;  1TAE A;  4JI7 B;  1HNX B;  3DC5 A;  2UU9 O;  3SYP A;  1PNL A;  2LGW A;  4UB6 Z;  1Y67 A;  2ITD C;  2AXT Z;  1NKD A;  5KAI Z;  3OTO O;  3BAA A;  4NVP A;  3QNE A;  4IL6 Z;  1K97 A;  4UVB A;  2ZR2 A;  1JFF A;  2WLM A;  2QWO B;  2A06 H;  2HVK C;  2A0L A;  1ENV A;  2JGD A;  4D7S A;  1JJ2 U;  5EC1 C;  3MHH C;  1N33 O;  2DMX A;  2ETN A;  4KHP B;  2Y48 A;  1N36 O;  2ZIO A;  4JI1 B;  2HHH O;  4L87 A;  1I5Y A;  4LR3 A;  3T1Y O;  4RUE A;  5FPR A;  2DW4 A;  4FVM A;  4BW5 A;  4PJ0 Z;  3SYC A;  1IUR A;  4YY3 O;  1MA1 A;  1XEQ A;  2QA4 V;  5LOV B;  1E1Q G;  1RP3 B;  3LDC A;  3N2G B;  1S5L Z;  1AI4 A;  3VOU A;  1N34 O;  4TWK A;  1XHZ A;  3UM7 A;  5JQG A;  3ZHQ A;  1VF7 A;  3PJS K;  3RYF A;  1F7Y A;  4LFA B;  3HPL C;  1SRY A;  1NQT A;  1VQO V;  3K5N A;  1DLB A;  4I0X A;  1FXK B;  1FS0 G;  3L72 H;  5JWP A;  5FNV A;  1XUQ A;  2CH7 B;  3THO A;  3ML0 A;  1TVK B;  4JI8 O;  4NB5 A;  4RQF A;  2Q0O C;  4MVS A;  1SQP H;  2E5L B;  4LNU A;  4DV3 O;  1VP7 A;  1U96 A;  2LP7 A;  2KG7 B;  1AP5 A;  3S3X A;  2Z0A A;  3HKC B;  4RUF A;  3ASO B;  4WF9 V;  1NH2 B;  1GM9 A;  3I5D A;  2ZXW C;  1OCZ C;  2E76 B;  2JEX A;  3CRQ A;  2P22 C;  1JJO A;  3QTC A;  5H5N A;  2YI9 A;  4FLT A;  2QE7 G;  4NTY A;  3IFX A;  5JVD A;  4GYC B;  3LDD A;  2CDY A;  4O2A A;  1BL8 A;  1Q90 D;  2AW9 A;  1J5E B;  4NXN B;  4K8X A;  2HFE C;  4DV5 O;  2QKA A;  2P90 A;  4GX0 A;  3LSU A;  3ABK C;  2BTQ A;  3JAR A;  2YC0 A;  4UCR A;  2P4V A;  4DUZ O;  3A8T A;  3HKD B;  1SQG A;  3IAY A;  2B1G A;  2YSU B;  3ZRW A;  4ZKI A;  1ZL8 A;  4JF3 A;  4FLU A;  1Q7Y W;  1RPO A;  3CHX A;  1VMG A;  5CB4 B;  1PKX A;  1M56 C;  2Z5U A;  2NNU A;  2UXX A;  1YIJ V;  1EN6 A;  1PM9 A;  1R3L C;  2YDE A;  4DR1 O;  4LCU C;  4PV1 B;  1SA0 B;  1H2K A;  5JH7 A;  1PV0 A;  4FPP A;  5IJ9 A;  4KFM A;  3K06 A;  5KHJ A;  3OGI B;  4JAA A;  1XOU A;  4B3R B;  1CP9 A;  2AHZ A;  3DTU B;  3RYC B;  3W7T A;  1K5Q A;  1GN3 A;  2DE0 X;  3BHP A;  3CE2 A;  4N23 A;  1RPR A;  4CS3 A;  4B3M B;  1XNQ B;  4LH7 A;  5FPO A;  3OMA B;  3SJA C;  4QJF B;  1QLN A;  1ZLZ A;  4FLX A;  3MD0 A;  3ZHU A;  4MVM A;  4B7K A;  4CBC A;  4CS4 A;  2Q5Z A;  3B40 A;  1BZK A;  4ASU G;  1VF5 B;  5LXT B;  4TQF A;  3WG7 C;  4I4T A;  4MT8 A;  2WA4 A;  5IWA O;  1D5A A;  2W0X A;  4DK1 A;  4O4L B;  5LMN O;  2YS8 A;  5JJJ B;  1XQ8 A;  2WSS G;  3JAL B;  4X89 A;  4NR1 A;  4U7N A;  4IGG A;  4CC5 A;  3RYI A;  4TV8 A;  2MW2 B;  5CN0 A;  1K7D A;  3CJH B;  5EIB C;  1PP9 H;  4B3S O;  4YIO A;  3JYC A;  4K35 A;  5LHG A;  3Q4H A;  1ZWI C;  4ZOL B;  3OUS A;  1WB7 A;  3EFF K;  3ABU A;  4YJ3 A;  2W6J G;  4HBN A;  2ITC C;  2PYL A;  2ZQM A;  5KHG A;  5B1A B;  3CSX A;  3K04 A;  2X6C A;  1OJH A;  3CCR V;  3UO3 A;  3O9O A;  3M7M X;  1X4T A;  2DYR B;  2QDO A;  4LWS A;  4O2B B;  2M7W A;  1YEW A;  3A0R A;  1KQS U;  5H6Q A;  4WFF A;  2EJR A;  3FAV A;  1GTO A;  3R66 A;  4CZZ A;  3ZRX A;  3U0Z A;  1M9N A;  3D3I A;  2LQT A;  4QIW F;  4KP4 A;  3ETE A;  1AI5 A;  3JAW B;  5CA3 A;  3JSN A;  5IYB O;  1US6 A;  3ETG A;  1FPO A;  3CRC A;  3OM3 B;  2VQF O;  2WLH A;  2QJ1 A;  4K0K O;  1G8M A;  1FYJ A;  3SPC A;  5B3S C;  3OR6 C;  1R3K C;  1LUV A;  1NT2 B;  5C8Y A;  4PA7 A;  1K4C C;  2Y4U A;  5JJE B;  2UUA O;  3G71 V;  3EVK A;  1YZB A;  4RO2 A;  5LA6 A;  3BVO A;  1KD1 W;  2EZO A;  2IM9 A;  1XMQ O;  3E22 B;  1NS1 A;  4X62 B;  4J41 A;  2RCV A;  2P4K A;  4J80 A;  4AHC A;  1FJG O;  4DR4 B;  4JYB A;  2E74 B;  2AZ2 A;  2OT5 A;  5DM6 V;  1YSC A;  5AG2 A;  4DUY B;  4MS2 A;  1O9G A;  5L3D A;  4YHH O;  3AG1 B;  1EM1 A;  4O4I A;  2Q9L A;  4I9Q A;  3CC4 V;  4JV5 O;  5IYZ A;  5KA5 A;  1FD9 A;  1B3Q A;  4MVU A;  5FLX N;  4X66 O;  4TT3 G;  3OTO B;  1PNM A;  2F4V B;  2DYS C;  4H13 B;  1IXM A;  1VIB A;  3OEE G;  2JJ2 G;  4MVR A;  1Y74 B;  2RJZ A;  5CBF A;  4ZI7 B;  4NKG B;  4UCV A;  1N33 B;  1S76 D;  4Z2W A;  4BWA A;  2XND G;  3QO8 A;  1YI2 V;  1N36 B;  2ADP A;  2HHH B;  4ABM A;  4CH6 A;  2XAG A;  5LGU A;  3T1Y B;  1SS3 A;  1HNW O;  1AP6 A;  2NR5 A;  2QGN A;  2V1D A;  3P30 A;  5EYP B;  2YEV A;  3JAS B;  5C93 A;  1Q3E A;  2HJF C;  4IT5 A;  1IX9 A;  3F5W C;  2ZDI C;  2QSA A;  2ZR3 A;  5L3F A;  1WJZ A;  3MDS A;  4IYI A;  4LC1 A;  4DR5 O;  1N34 B;  1Q86 W;  3H01 A;  5KUM A;  1BHA A;  3FB6 C;  4R8C A;  4W4L A;  3BY6 A;  3G6E V;  1WA8 A;  1R6K A;  4YJ2 B;  4G27 B;  1XMO O;  3WB2 A;  5KHH A;  1COW G;  4GCZ A;  1NR7 A;  4EB6 B;  1R73 A;  5GON A;  4PDV A;  2UXC B;  1YVW A;  2R9A A;  4DR3 O;  3CXC U;  2PYJ A;  1F23 A;  4DW1 A;  3L70 H;  2IJJ A;  4XDK A;  3CCL V;  4JI2 O;  2IJH A;  1EN4 A;  4CS2 A;  3CEI A;  4LF5 O;  3B2E E;  4FFB A;  3N2G A;  1Y76 A;  1GN4 A;  1Q5O A;  1VQ8 V;  2BE3 A;  5B3S B;  3EHB B;  1Q81 W;  2QWR B;  4X1Y A;  3GB7 C;  1F4M A;  4X88 A;  3A0B Z;  1RM1 C;  1S5H C;  3VBB A;  2N05 A;  1XNR O;  4I9W A;  4BAY A;  4CH3 A;  2GUZ B;  3WB0 A;  3B09 A;  4LF6 O;  2XTA A;  2DQ3 A;  4FJC C;  1RFY A;  4R7C A;  4FM2 A;  1NJI W;  1TVK A;  5A2Q N;  1QHT A;  4DUZ B;  3FFQ A;  5BZB A;  1LUW A;  5IJ0 B;  1NVP B;  4FZ1 A;  1Y66 A;  4X65 O;  3DSQ A;  1KEC A; 
#chains in the Genus database with same CATH homology
 1I5Y A;  1QCE A;  4RUE A;  1GO3 F;  3T1C A;  2DW4 A;  4BW5 A;  3SYC A;  4R50 A;  1CEZ A;  1K5S A;  2AHY A;  3MHS C;  1NR1 A;  1EFR G;  2WLK A;  2QA4 V;  2JK5 C;  2LFS A;  2ZDI A;  1E1Q G;  1ROP A;  4XDL A;  1M90 W;  3LDC A;  1K3E A;  3ZRW B;  4JTD B;  3K0D A;  1GM8 A;  1AI4 A;  2X6B A;  3VOU A;  4TWK A;  1FXK C;  3K08 A;  3FB5 C;  3UM7 A;  1GK9 A;  4XBF A;  1KP3 A;  3ETD A;  2XAF A;  3PJS K;  2V7Q G;  1P7B A;  3HPL C;  1SRY A;  1TUE B;  1NQT A;  1H8H G;  1VQO V;  3I56 V;  1AJN A;  1DLB A;  2MK3 A;  1FXK B;  3HB3 B;  1FS0 G;  2OCC C;  1FXH A;  1PD3 A;  3ML0 A;  3CC7 V;  2K1E A;  4RQF A;  3ASO C;  1FFT B;  4MVS A;  5GW7 A;  3STL C;  2Z3Y A;  3JD0 A;  4H33 A;  3ZN1 A;  1AJP A;  3JD3 A;  5CBH A;  3E35 A;  3B8N A;  2WLJ A;  4MSW C;  2Q6A A;  1ORQ C;  2LP7 A;  1YJW V;  1NVP D;  4PEL A;  4RUF A;  3ASO B;  4WF9 V;  1NH2 B;  1GM9 A;  3QO5 A;  2ZXW C;  1OCZ C;  3OE7 G;  3X2Q C;  2JEX A;  3GWO A;  3ZMU A;  1SER A;  1JQ0 A;  2QE7 G;  3IFX A;  3LDD A;  3ASN B;  2ZXW B;  1OCZ B;  3FB7 C;  1BL8 A;  3X2Q B;  2IU3 A;  4RQE A;  2DWD C;  2HFE C;  1W0J G;  2P90 A;  2B1I A;  2H8P C;  4GX0 A;  3TK1 A;  2WLI A;  1YTF D;  4EKW A;  2B5U A;  3E8H A;  2A9H A;  3ABK C;  3K0G A;  3OAA G;  2F43 G;  2EIM C;  5H9C A;  4MW8 A;  5LGN A;  3FB8 C;  3ABT A;  1Q82 W;  3FYI B;  3AG4 B;  3NXS A;  2B1G A;  2YSU B;  4UVA A;  3ZRW A;  3ABK B;  4ZKI A;  4JF3 A;  4TSF G;  2EIM B;  1JX9 A;  1Q7Y W;  2P6J A;  1OCC B;  1RPO A;  1DF4 A;  1DF5 A;  1PKX A;  1K4D C;  1M56 C;  3CC2 V;  2Z5U A;  2NNU A;  2UXX A;  1YIJ V;  3SPH A;  3KG2 A;  2R9R B;  1NH2 D;  3E2E A;  4LP8 A;  1R3L C;  1F4N A;  5EK0 A;  4LCU C;  3SPI A;  4YXW G;  1CPY A;  1QLE C;  4N21 A;  1VQN V;  2EIN B;  2HLD G;  1FXK A;  1M56 B;  4FPP A;  2A79 B;  1RM1 B;  4PA9 A;  2QM7 A;  4KFM A;  3I55 V;  2EBO A;  5B1O A;  3K06 A;  3LSQ A;  3LNM B;  1QLE B;  4WCE V;  2D3O W;  1CP9 A;  2AHZ A;  3DTU B;  3W7T A;  1K5Q A;  3CCV V;  1S77 D;  4DO2 A;  4MVQ A;  1BMF G;  1PNK A;  2EIL C;  4LBE C;  4N23 A;  1SZT A;  3ZMT A;  1RPR A;  1VQ5 V;  2IJI A;  4J9Z B;  1UJW B;  4JAV A;  2Q69 A;  2WWW A;  2WLL A;  1PL0 A;  3OMA B;  1OCO C;  3IC7 A;  4WFA V;  4WFE A;  2EIL B;  5LGT A;  2JEU A;  4QJF B;  4H37 A;  1VQK V;  5IDJ A;  1QLN A;  1V54 C;  5IY5 C;  1F51 A;  3ZRS A;  2IU0 A;  2P67 A;  3MD0 A;  4BIU A;  1EZJ A;  4MVM A;  1YJN V;  1K73 W;  4CBC A;  3AG3 C;  1VQL V;  3CCU V;  4ASU G;  1OCO B;  3WG7 C;  4F4L A;  3T2M A;  2HG5 C;  2DWE C;  5IY5 B;  4MT8 A;  3CPW U;  4J9Y B;  3ZMS A;  1VQP V;  3AG3 B;  5IYC O;  1R3I C;  2NLJ C;  4P2Z A;  3SYQ A;  3WG7 B;  2WSS G;  4X89 A;  4U7N A;  5KA6 A;  4JYC A;  3M99 B;  5CN0 A;  1K7D A;  2OCC B;  3W7W A;  1GMG A;  2H94 A;  3TCU A;  4MTG A;  1E1R G;  4PDL A;  2IJK A;  4X8A A;  3JYC A;  5EC2 C;  3E8G A;  5B1A C;  5LHG A;  4FMT A;  3DGE A;  2Q67 A;  1ZWI C;  3OGC C;  4JTA B;  2XAS A;  1BHB A;  2WLL B;  5E1A C;  4PA3 A;  3OUS A;  3EFF K;  4I5S A;  3ZMV A;  2XAQ A;  3ABU A;  2JIZ G;  3OFN G;  2DYR C;  2W6J G;  1YHQ V;  2ITC C;  2X7R B;  4HZ3 A;  2ZQM A;  5B1A B;  5L3B A;  3K04 A;  2X6C A;  3AG2 C;  3ZJZ A;  1K33 A;  3SPJ A;  1OHH G;  5CMU A;  3CCR V;  4UV9 A;  1QVF U;  1N8R W;  3G4S V;  3ABM C;  2DYR B;  4E2L A;  2M7W A;  3A0R A;  5H6R A;  3ZIA G;  3E83 A;  1QVG U;  3P32 A;  1KQS U;  1GKF A;  5H6Q A;  4WFF A;  1W2B U;  3LSS A;  2EJR A;  4QNH B;  1GTO A;  4CZZ A;  3IGA C;  3ZRX A;  1WPX A;  3ABM B;  1M9N A;  4GX5 A;  3RBZ A;  4UVC A;  3RVY A;  3D3I A;  4QIW F;  3CD6 V;  3CCJ V;  2PI4 A;  4KP4 A;  4QPK A;  3TET A;  3ETE A;  1AI5 A;  5CA3 A;  5B1B C;  5IYB O;  2QKS A;  3K3W A;  4DXW A;  5LBQ A;  3ETG A;  3CP1 A;  4JAU A;  4P9O A;  3F7Y C;  4GX1 A;  1R3J C;  1QR8 A;  2JJ1 G;  3OM3 B;  4FK5 C;  4MTF A;  1YJ9 V;  2WLH A;  1H38 A;  1QBZ A;  2QTO A;  4QPJ A;  1G8M A;  1AR1 B;  2EIK C;  1MSW D;  3E86 A;  5L3G A;  1GM7 A;  5B1B B;  3SPC A;  4FIP C;  5B3S C;  1B6Q A;  3F7V C;  3OR6 C;  1R3K C;  1J95 A;  4BIZ A;  1H2G A;  2OTJ V;  3SYA A;  4PA7 A;  1K4C C;  4JPR A;  2EIK B;  3G71 V;  1V55 C;  4Q20 A;  1DTO A;  4RO2 A;  5EBL C;  4QE7 A;  1KD1 W;  2EZO A;  3E89 A;  5J9P C;  5HFL A;  4PDM A;  4WFG A;  5L3C A;  2GSM B;  2LFR A;  4UUJ C;  1V55 B;  2W0F C;  5IYD O;  3LUT B;  4JYB A;  3AG1 C;  4RAI A;  2P7T C;  2OT5 A;  5DM6 V;  2BOC C;  1YSC A;  3OUF A;  4P30 A;  1M57 C;  3W7X A;  2R9I A;  4MS2 A;  2IW5 A;  5L3D A;  1S72 V;  2BOB C;  3AG1 B;  2EIJ C;  2DQ0 A;  4MW3 A;  1P4R A;  5EBW C;  1KC8 W;  5DN6 G;  1MAB G;  4MTO A;  3CC4 V;  1JOY A;  4HYO A;  3CCE V;  1SET A;  5KA5 A;  1VQ4 V;  1M57 B;  4KUM A;  4JAS A;  2IH1 C;  1VQ9 V;  3RVZ A;  1JCH A;  2X6A A;  1XL6 A;  2EIJ B;  4MVU A;  3W7S A;  2PI5 A;  5L3E A;  4TT3 G;  1V54 B;  5FL7 G;  1PNM A;  2WLN A;  1YIT V;  2DYS C;  3K79 A;  4GT1 A;  4UXN A;  4PDR A;  1IXM A;  4GX2 A;  2OTL V;  3OEE G;  2JJ2 G;  2W6I G;  4MVR A;  4R6Z A;  3CCM V;  4JTC B;  2UXN A;  2QM8 A;  5CBF A;  3CCQ V;  3ZCC A;  1JVM A;  3T4Z A;  3B8M A;  2DYS B;  3K03 A;  1OZ0 A;  1AI7 A;  2CK3 G;  2XOK G;  3JD1 A;  1S76 D;  2X0L A;  3JD4 A;  1YTF B;  2XND G;  2WPD G;  1I5X A;  3QO8 A;  1YI2 V;  2EZP A;  1S3J A;  3BEH A;  3K9A A;  5B1N A;  2XAG A;  4WFH A;  4QE9 A;  1JPX A;  5LGU A;  3OW2 U;  3QO7 A;  2HR3 A;  3ZN0 A;  3R65 A;  2V1D A;  2Y69 C;  1L1F A;  3P30 A;  4UV8 A;  5EBM C;  2YEV A;  4MTX A;  5C93 A;  2HJF C;  2HVJ C;  3FYE B;  4HAM A;  3F5W C;  2ZDI C;  1KP2 A;  1QR9 A;  2ZR3 A;  5L3F A;  3CYO A;  1VQ7 V;  2HKO A;  2IH3 C;  4LC1 A;  4Z1M G;  3OMI B;  2Y69 B;  3LDE A;  3SYO A;  1Q86 W;  2WAM A;  5LHI A;  3ASN C;  1G4Y B;  3H01 A;  3OR7 C;  5KUM A;  4P9P A;  3AG2 B;  3B77 A;  3FB6 C;  4OXS A;  4R8C A;  1ARO P;  4ZBM A;  3BY6 A;  3G6E V;  3CCS V;  1BHA A;  2QEX V;  3ZMZ A;  3UKM A;  1LNQ A;  1R6K A;  3OMN B;  4G27 B;  3FKS G;  3WFV A;  4WFB V;  1R6N A;  2ATK C;  3ZRV A;  1COW G;  4GCZ A;  1NR7 A;  1W0K G;  5KUK A;  1THZ A;  1EBO A;  2XAJ A;  1R73 A;  4MVO A;  4PDV A;  4G2K A;  3JCZ A;  1H8E G;  1MOF A;  2Q68 A;  4PA6 A;  3CXC U;  1F23 A;  1E79 G;  4XDK A;  1XL4 A;  2IJJ A;  3CCL V;  3AG4 C;  1VQ6 V;  1K9M W;  2IJH A;  1K92 A;  1K8A W;  1M1K W;  1MG1 A;  1S0V A;  3D36 A;  4G28 B;  1VQM V;  1SES A;  2FTK A;  3W7U A;  3SJQ C;  5CBG A;  2JDI G;  1OCC C;  1AJQ A;  2YEV B;  1KKD A;  3ABL C;  1OCR C;  5LHH A;  5HFM A;  3SYP A;  1VQ8 V;  1NBM G;  1PNL A;  1Y4M A;  5B3S B;  3EHB B;  1Q81 W;  2ITD C;  3E8F A;  3GB7 C;  3RW0 A;  2EIN C;  1NKD A;  2C2A A;  1FXV A;  4PA4 A;  3T4D A;  1F4M A;  2XAH A;  3JD2 A;  3ABL B;  4X88 A;  4XDJ A;  1OCR B;  1RM1 C;  1S5H C;  3VBB A;  3CME V;  4I9W A;  3QNE A;  4BAY A;  1K97 A;  2ZD9 A;  4UVB A;  1K34 A;  2ZR2 A;  2WLM A;  3CMA V;  4JGS A;  4U7O A;  2HVK C;  2KB1 A;  2A0L A;  1ENV A;  3OEH G;  1HWY A;  1JJ2 U;  2GHY A;  2DQ3 A;  1WLE A;  4FJC C;  3MHH C;  5EC1 C;  4R7C A;  1NJI W;  3AEI A;  4MVZ A;  2Y48 A;  3STZ C;  1AI6 A;  5BZB A;  3SPG A;  3E8B A;  1NVP B;  1Y66 A;  1KEC A;  2WLI B;  4L87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...