4PA4A

Structure of navms in complex with channel blocking compound
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa4A00
2X6AA 3SYPA 3E8BA 1BL8A 2WLLA 3IFXA 3ZRSA 3FB8C 2IH3C 3E8GA 1R3JC 4XDLA 1ORQC 3LDEA 4HYOA 2DYRC 3ABMC 3OR6C 3PJSK 2BOCC 3SJQC 4DXWA 2WLNA 4MVZA 4MVOA 2YEVA 3ZJZA 5EC2C 3FB7C 4JTCB 3FB6C 3RVYA 5BZBA 3X2QC 2ATKC 2WLIB 4P9PA 4G27B 4H37A 3T1CA 3WG7C 4GX5A 4GX2A 3E8FA 2X6BA 4QE7A 2Q69A 4MTOA 2IH1C 2EIKC 2WLLB 5CBHA 2HVKC 3K08A 1M57C 2HVJC 3SPGA 5E1AC 4X8AA 4XDKA 5KUMA 3SPCA 1OCCC 2Y69C 3LDDA 2DYSC 2H8PC 3EFFK 4KFMA 3JYCA 2HG5C 3FB5C 3VOUA 2HJFC 4WFHA 1K4CC 3LNMB 1V54C 4P9OA 4H33A 2DWEC 3TETA 4PA9A 1OCZC 3TCUA 4MVUA 2P7TC 3F7YC 4ZBMA 1S5HC 3R65A 2AHYA 3SYQA 4TWKA 3UKMA 1KKDA 1ZWIC 2EINC 4BW5A 3SPJA 5B3SC 4WFFA 3AG3C 2WLIA 4MSWC 2W0FC 5EK0A 4I9WA 4MVQA 3SPHA 4QE9A 5B1AC 2OCCC 3GB7C 4PDLA 3OUSA 1M56C 3RW0A 3ASOC 4RO2A 4JTAB 4EKWA 3K0DA 3AG4C 4CBCA 3AG1C 3HPLC 1R3KC 1OCOC 4MVRA 4P30A 4LP8A 5CBFA 4P2ZA 4J9ZB 1OCRC 2Q6AA 4HZ3A 3SYOA 3ASNC 2R9RB 2DWDC 4R6ZA 2BOBC 4PA3A 2A9HA 3K06A 3KG2A 2JK5C 3IGAC 4X89A 5IY5C 2QTOA 4GX1A 4X88A 3T4ZA 5EBWC 2QKSA 3BEHA 2WLHA 3F7VC 1R3IC 4LBEC 5CBGA 3T2MA 4OXSA 3LUTB 4PA4A 4PDRA 4R7CA 5EBLC 4MVSA 5J9PC 3SPIA 1LNQA 2K1EA 2AHZA 3OR7C 2NLJC 2ITDC 3F5WC 4XDJA 4MVMA 3AG2C 3OUFA 3STLC 3E89A 4PDMA 3K0GA 3UM7A 3RBZA 4WFEA 2EIJC 5KUKA 3K04A 1R3LC 3E83A 4MW8A 4R50A 3T4DA 1QLEC 1JVMA 2Q67A 4MW3A 4QNHB 1V55C 3SYCA 2WLKA 2KB1A 1K4DC 3SYAA 2WLJA 3LDCA 2ZD9A 3E8HA 2EIMC 4PA7A 4RUFA 1G4YB 2WLMA 2A0LA 5EBMC 4UUJC 1J95A 3ABKC 4RAIA 1XL6A 3OGCC 4J9YB 4MS2A 4PDVA 4G28B 3RVZA 3ABLC 2X6CA 5EC1C 4WFGA 4LCUC 2ITCC 2HFEC 4PA6A 1P7BA 1XL4A 2EILC 3E86A 3K03A 4GX0A 4F4LA 4JTDB 2Q68A 2ZXWC 2A79B 4RUEA 3STZC 4R8CA 4MTFA 4MTGA 5B1BC
chains in the Genus database with same CATH superfamily
4F6RA 4FFBA 3OE7G 3SJQC 2PI5A 1SKVA 2UXCO 2Q7HA 3IJ4A 2ZIMA 1Z5WA 3SJCC 2NR5A 2F66C 4DV4B 3JAKB 2UXBO 2QSAA 2CH7A 3K59A 4LF8O 1N32B 1FXHA 3K08A 4X8AA 1JMKC 1GN3A 1WJZA 4LH7A 1HNZB 4OGQB 1TGOA 3KCXA 1BS3A 3E22A 3CJHB 2E3CA 3W7SA 2UUAO 2JJ2G 5A2QN 3CRRA 1IURA 3E22B 2ADQB 4JF3A 1Q86W 1MZFA 1GTOA 3ZRVA 1BCCH 1XMOB 1NJIW 3CD6V 2QGNA 3K0DA 1I5XA 3G80A 4CBCA 2A7WA 4RQFA 1M1KW 3RYIB 3ZMVA 2R9RB 1VIBA 1VF6A 5IY5C 1OCCB 2QKSA 4A5UB 4O2BA 5KAIZ 3CC7V 2ITDC 3AG2C 2EULA 4FMTA 4CH6A 2CDYA 4JYYA 1S3JA 4X66O 1LUVA 1FXVA 3BABA 3JD2A 2QEXV 1SESA 1Q90D 4U7OA 2A3QA 4PA7A 3HKBB 2WAMA 5JJNB 2LFRA 3W7WA 3ZRWB 4O2BB 1AJPA 4J9YB 2JEUA 1K73W 4JI3B 1GK9A 2ITCC 1K33A 4PA6A 1P7BA 1P4RA 3QNEA 4JYBA 4B3RO 1RPOA 4JPRA 2WA3A 2R9IA 1Y74A 4AHCA 1VQ5V 1NVPD 2ZE5A 4XDLA 4DW1A 3T1HO 2RQ6A 4DRXB 4DR2B 1SQPH 1E1RG 5LOVB 2O57A 1GO3F 2RDCA 1CEZA 3WG7C 4DV1B 3HR0A 4X62B 3T1YB 1VP7A 1M57C 1Q43A 3EFFK 3N2GA 1H2GA 4UV8A 1WA8A 4IIJA 2XAJA 5KA5A 3VOUA 4N21A 3ETGA 1FXKC 3RYFA 4I55B 2F93B 4P9OA 3CYOA 4JYAB 2CE4A 2VQEO 3ZHSA 4BW5A 2OTLV 1F51A 1YCIA 1TVKA 4MSWC 2PF4E 1IZ3A 4I9WA 4MVQA 5B1AC 4ZOLB 1V55B 3A0RA 1ZL8B 3AG1B 5CA0A 3ZEDA 1HNXO 1V9PA 2QE7G 2QTOA 4UCRA 3CSXA 3G6EV 4NXMO 2B1GA 5JH7A 1K9MW 5ITZB 2Q5ZA 3NR7A 4NTWA 3K04A 2X0LA 3CCMV 3ZHQA 2IJHA 1K4DC 1TUEB 4LF6O 3ML0A 1QLNA 3AK1A 3ABKC 2PTMA 5CMUA 2Y0PA 3ABLC 3PN1A 4ICGA 4GT1A 2HFEC 4UVBA 2DMXA 2VWJA 4JI6B 1Y76A 4LF7O 3ZRSA 4JAAA 1XNQB 5B66Z 1BHBA 1IBLB 1NS1A 4J80A 3KZIZ 5JJJB 5L3GA 5IYZA 4DR4O 1Q5OA 4X62O 4TV9A 4ASUG 3JAWB 5CBHA 2Q7EA 2YUAA 1M9NA 5E79Z 2EIKB 2Y69C 3EXAA 1K34A 5J2TA 1SQGA 4CC6A 5LP6C 3LNMB 3TGUH 4DR1O 5KA6A 1PKXA 2N04A 3K5MA 1VQ7V 4AQYO 4TUYA 4B3RB 1MMMA 2RN9A 2DW4A 1BSMA 3F7YC 2OYQA 5J2UB 1AILA 1QBZA 3H9VA 3MDSA 3CP1A 2EINB 5HFLA 3SPHA 5LA6B 3CCEV 1LUWA 3ABUA 3NXSA 4X64O 2NN4A 1R3KC 1OCOC 3CRMA 5LA6A 4X66B 3KG2A 1PV0A 5J2UA 4E4EA 5LHIA 1HNWO 4MVSA 4DR1B 3SPIA 3CE2A 1RFYA 3F5WC 1AI7A 3N2GB 2EILB 3K0GA 4UCOA 3OM3B 1THZA 4MW8A 4UCVA 3DC5A 1SQQH 1Z2GA 4MW3A 3ABMB 5D5QA 3E8HA 1VQMV 4Q6GA 4RUFA 5EBMC 4J11A 2DYRB 3IC7A 4UUJC 4JI8O 4W4LA 1XILA 4LR3A 1U96A 4DK0A 2UUCO 1BE3H 4X1YA 4MS2A 2YEVB 4AQYB 1KD1W 4ZHQA 4LF9O 4PELA 5IYZB 1H2SB 4GYCB 1M4UA 3B40A 2B9ZA 5IJ0A 2CTQA 1XQ8A 1A32A 2PGGA 2CH7B 2JS5A 2YIDA 3ABMC 2JEXA 4HNAB 1VQPV 4H13B 3FD9A 3N2KB 4DV5B 2IJIA 2D3OW 1TVKB 1DTOA 1OCOB 3I5DA 1S77D 4G27B 3T1CA 3QVNA 1XNQO 4FLVA 1K3EA 2HVKC 2HVJC 5E1AC 2CTRA 2UXCB 3E2EA 3FB5C 3RWRD 1S5LZ 5IWAO 4NXNO 2DWEC 1ROPA 1EZJA 2P7TC 4FLWA 1HWYA 3L75H 3UT5A 3C90A 1FD9A 1XHXA 1HP8A 3EVKA 1MG1A 3U0ZA 1IBMO 4RQEA 1AI6A 2PYJA 4NVPA 1BQZA 3OTOO 5IJ9A 3HPLC 4B08A 1TA8A 4UFZA 2D2CB 1GH6A 3W7UA 3S3WA 2IBZH 3TK1A 4FFKA 1KP3A 1IXBA 4WBNA 4X88A 1URFA 1GRJA 3CMAV 2L6LA 1KB9F 5EZYB 3OEHG 3HKBA 3JD3A 1MNGA 4QNHB 2Q0AA 1D5NA 2UU9O 1H2KA 4L87A 1N36O 2Q8VA 4PHZA 2GTSA 3KKYA 2MW2B 5JQGA 1O9HA 1OHHG 1OCRB 1H2MA 4DO2A 5B1BC 3SYPA 2Z3YA 2W0XA 2Y0IA 3OFNG 2P06A 3G67A 3A2FA 4YJ2B 4CS4A 3WB2A 4DV7B 2AGAA 3ABTA 3OEEG 4DV7O 1M90W 4GX5A 3RFRA 4BAYA 4MTOA 1KP2A 4JI2O 2YIBD 4J7JA 4EB6A 4FLUA 4DK1A 3LDDA 2Q73A 4LF4O 3OTFA 1VQLV 5IYBO 2Q4PA 5KMGB 4I0XA 1K4CC 4EFBA 3RYHA 3O9OA 3TXQA 4DV3B 4JI5O 1H8HG 1EN6A 4H33A 3IAYA 1XHZA 1ZTEA 2P67A 2HJDA 2YXHA 3AG3C 4JI1B 4EFEA 1WN7A 3DGEA 3E35A 3RW0A 3CS5A 4YXWG 4H0LB 4P30A 5CBFA 5LGUA 3LSUA 4CC5A 1AR5A 5K1PA 2DN9A 5KHKA 5TISZ 1JR9A 2GV9A 5GTIZ 1Q82W 1X4TA 4XBFA 1V54B 2F4VB 1M93A 2IJJA 1JVMA 4LFBO 1V55C 5L3DA 1F4NA 1AR1B 2RCVA 3RT3C 4RAIA 3CRAA 1MABG 3AG7A 1OCZB 4KP4A 5IWAB 1QLEB 1FJGO 5F2VO 2XHBA 3JATB 2PYLA 1HNZO 4DXWA 4X20B 1JJOA 5IE9A 5B1NA 3E8BA 2E76B 3CRCA 3LDEA 1AP5A 5B3SB 4MVOA 5IT9N 1SQVH 1YTFB 3FB6C 4DV5O 4OX9O 5C8YB 4D6TH 4DR6B 1B04A 5GW7A 3BY6A 4DR4B 2XOKG 1N36B 2OT5A 2H8PC 2HJFC 2G38A 3MD0A 3ZN0A 1JFFA 2Q0OC 5IJ0B 1PPJH 2LGWA 1XI1A 4TV9B 5LP6A 3TCUA 2QWQB 4TWKA 1VF7A 1YEWA 4X1YB 1PNMA 5CA1A 1FS0G 2YI9A 2IU0A 4PDLA 1G8MA 1M56C 4H44B 3OUSA 2LP7A 1UJWB 1NQTA 1ZSPA 4J9ZB 4TQFA 3P32A 2CGOA 4DUYB 1IBMB 2GTAA 4Z1VA 1PP9H 1AI4A 1QVFU 1BMFG 1D5AA 1Q6HA 4QGPA 2N05A 4R7CA 4FVMA 4XDJA 1GN6A 3CRQA 4MVMA 2C2AA 4FK5C 3L70H 2QWNB 1P84F 2YXYA 1VEWA 1Y4MA 1G4YB 1S72V 4LWSA 1NU1H 5BR8B 3S3XA 5JH7B 3B2EE 4GKJO 2YC0A 1M5IA 2QKCA 5LMUB 1FKAO 1F7YA 4RUEA 3ZS8C 4DV2O 1YJNV 3J7AU 1GM8A 4FLXA 4DUZO 2DYRC 3PJSK 3OW2U 2XAQA 3JCZA 2JGDB 1L8DA 1EN4A 2CAZC 1SC5B 1IBLO 1KC8W 5EYPA 3OT7A 2KQXA 4JI8B 2JJ1G 5HFMA 3ZMUA 2VQFB 4BR6A 3AK3A 4JASA 3U10A 4LF9B 2EX3A 3FYIB 5JCOC 5FPRA 1RSOA 2ARHA 1KKDA 4LC1A 3SYQA 3MHHC 4TV8B 4LF5O 5LOVA 4JZ2A 4DR7O 5C93A 4JGSA 1XNRO 4B7KA 3UO2A 1GM7A 1Y6XA 4YHHB 3X2QB 3FKSG 3I55V 4X1IA 5H5NA 3ZIAG 2XNDG 2DWDC 4X64B 4WFAV 3D3IA 4DV6O 1HDJA 2QKAA 2JGUA 3LUTB 4FM0A 5J9PC 5L3CA 4B3MB 2LGQA 4LF5B 1E79G 2NLJC 4UV9A 1K5QA 4JYCA 3CMEV 4B3TO 3QF7A 3CC2V 3CWBH 1R6KA 1KUQA 2UXDB 1JJ2U 4WFBV 4AILC 1DGSA 3CXHF 2GBOA 1E1QG 1VQ8V 5D5PA 3RYHB 4LFAB 2JGDA 2YDEA 4F4LA 1R73A 2VS0A 3DXRA 1RPRA 2X6AA 1YITV 1GN2A 2ZDIC 4HYOA 1GM9A 4LF7B 5LXTB 3RN4A 1N34B 2WWWA 4ZHQB 4DR3B 4DV2B 3RVYA 4YY3B 1L0NH 2YXLA 1SA0A 2EIKC 3J81N 1YXBA 4NKGB 4XDKA 3CCSV 3ETEA 5BR8O 3CEIA 1NBMG 3JYCA 3JARA 3SJBC 2EIJB 3ZMTA 3G4SV 3CCJV 3RGBA 4PA9A 4MVUA 4ZBMA 2K9PA 4O4HA 5B3SC 1RM1C 3WFVA 4YJ3B 1VQ4V 4LF6B 4I9QA 1FXKB 2CTWA 3GB7C 5K1XA 3APOA 4RO2A 3DSQA 4C7UA 4EB6B 2IW5A 2UUBO 4IGGA 1QCEA 4I50B 1YDXA 1NI8A 3HKCB 4J42A 4UCUA 4PDRA 2ZNJA 2K1EA 3QO5A 1F4MA 5LYJA 2FYUH 1XMQO 1R3LC 1JA8A 1EZVH 5KAFZ 4JI7B 5BMVB 3DC6A 2WLKA 2KG7B 1X59A 2WLJA 2A0LA 4PI0A 1EBOA 5B1BB 3IC9A 1WP7A 4DV1O 2Q7GA 4DV0B 2OWOA 2OIEA 5BY1A 2YIBA 4UVCA 5KHHA 1VQKV 2A79B 2XT9A 5B1AB 3H1JH 1KECA 3K3WA 3APQA 4FLZA 1Y66A 5EC2C 1NR1A 1K8AW 5DN6G 2ATKC 2P5OA 3JSLA 3CXCU 3AG4B 5LMNB 1N0NA 4DV0O 4JI3O 4DYLA 2ZR2A 2HEPA 5KUMA 2YIAA 2FMLA 2VWKA 1CPYA 1Y67A 4WFHA 1WPXA 1JQ0A 3D36A 1COWG 4LFBB 4KHPB 1SRYA 5A9GA 3JAWA 2W6IG 1YVWA 1H2NA 1MZEA 1CXZB 1SETA 2EJRA 2FB5A 4X1KA 5EK0A 3G6BA 2LJ2A 5J2TB 1YIJV 2ETNA 2OCCC 3CX5F 3BRCA 4IL6Z 1AJNA 3ZBHA 1OJHA 1OCRC 4RWUA 2LW1A 2BE3A 4JI7O 2QA4V 1AJQA 2JK5C 1EFRG 4KUMA 2WLHA 4LBEC 5DEDA 4I55A 4FJCC 1NKDA 4KHPO 3OR7C 4UB6Z 5GONB 4HAMA 4PDMA 1HR0O 4NXNB 2GDSA 4IYIA 1XMOO 3ASOB 3RYFB 4Q20A 1DK1A 1N8RW 4JV5B 1FXKA 5KHGA 3B8NA 2DQ3A 5B5EZ 3D36C 3K5OA 2OCHA 3CCUV 3ICXA 5EZYA 4HNAA 4DV4O 4UXNA 3CC4V 5KLVH 2AW9A 4LCUC 2JRIA 3ZHRA 4JTDB 3MAQA 2P6JA 4J7KA 3KCYA 5KHIA 3RYCA 4I5SA 1PD3A 2Z5UA 2YEVA 4X1KB 3B4SA 3X2QC 3F5TA 3CJHA 1RSOB 1YF2A 1Q7YW 4LFAO 1AB3A 4QE7A 5FNVB 1VF5B 3SR2C 1NTZH 1ZL8A 1G1XB 2CGNA 1Q8IA 4B3SB 3CCLV 1XMQB 2YICA 5GTHZ 2IU3A 2UXDO 3CB2A 1QR8A 2QM4A 2RMKB 3UO3A 1JPXA 1BQ0A 1W0KG 1QVGU 2EINC 1R1BA 3N2KA 3FFQA 2JVDA 3JD4A 1WLEA 5DM6V 3ZMSA 2YSUB 4JTAB 1NTKH 1BT8A 2FTKA 3U11A 1NT2B 1WPBA 4R6ZA 4PA3A 1XNRB 2DYSB 3WB1A 2Y69B 1NH2B 2YS8A 3LNNA 4DR7B 5EBLC 3L73H 3K57A 3STLC 3D8CA 1QNMA 2F23A 2M7WA 4WFEA 3OD4A 3ZHVA 2R72A 5LHGA 4K8XA 3SYCA 4X9QA 2XTAA 3SYAA 4MT8A 1PNLA 4CH3A 4IHJA 3J80N 3BCCH 1WB8A 5GONA 4JI4O 1JX9A 4DR5O 1NZ6A 1B3QA 3BA9A 2DJVA 1TUBA 1I94B 4JI0B 3STZC 3ABKB 4GCZA 2R70A 2IH3C 4GUNA 4E2LA 2P22C 1ORQC 1KU9A 2BOCC 1H38A 3GWKC 1D2DA 3UQ8A 2ZM6O 4JTCB 2UXXA 4QPKA 2ADPA 2ZDIA 3ETQA 1KYOF 2ZE6A 1SQXH 4CS2A 3JARB 2M6YA 1JFFB 2NNUA 1UFIA 2B1IA 4FM2A 3CHXA 4CZZA 3H1KH 5DECA 3RYCB 2XASA 4BIUA 4B3MO 3B8MA 1HW7A 3K79A 5H6QA 2WSSG 1I0HA 3ETDA 3WU2Z 3HB3B 1S5HC 4K0KO 4TQDA 2DOSA 1W2BU 3N27A 4NXMB 1QR9A 4X65B 1HNWB 2W0FC 4GKJB 1QU7A 4NTYA 1OV9A 4DUYO 2EZOA 4P2ZA 5AG2A 1FAFA 2BOBC 3AEIA 3L74H 3IGAC 3A0HZ 3ABLB 3HKEB 2F43G 1R3IC 2FKXA 4TUYB 2VQEB 1EN5A 3HKDB 3UM7A 4JYAO 2EIJC 4FFBB 4WF9V 4R50A 4UCTA 1QLEC 4DRXA 3CCVV 2OCCB 2EZPA 3FYEB 1GAXA 1Y74B 3K58A 3L72H 2QWPB 1NTMH 3EHBB 4PV1B 4Z2WA 3SDLA 1KMIZ 1XL6A 5EIBC 4G28B 2QR4A 5LYJB 2B5UA 2IM9A 1VARA 4Z1MG 5LXTA 1ZUQA 2F95B 1CP9A 1XREA 2PY5A 3BPZA 2Q68A 2LW7A 1DF5A 4X1IB 1BGYH 4K8ZA 1BL8A 5FL7G 3JAKA 3FB8C 3DXRB 3R66A 1R3JC 1MSWD 2UXNA 3AG3B 2ZQMA 3LSQA 4O4LB 3VQWA 1GMGA 1K7DA 4DR2O 1BZKA 3FX7A 4FPPA 1PL0A 1OCCC 3P3NA 3Q4HA 1RM1B 1U97A 2LFSA 3WG7B 1SF9A 1XOUA 2E5LO 2MK3A 5FNVA 1UPGA 1TAEA 1SA0B 1QQCA 4DV6B 3SJAC 5LBQA 1GKFA 1FJGB 2QM8A 1G6UA 2KG7A 1B6QA 4QE9A 4MTXA 1K5SA 4BW9A 3OMNB 1MSDA 4MVRA 2JS3A 3SYOA 4JV5O 1AP6A 1I5YA 1N4CA 5IDJA 2VRZA 4X89A 3BEHA 5IYDO 3F7VC 4OXSA 1ZX3A 4JI1O 2PZSA 1LNQA 4I4TB 4BWAA 5LGNA 1BHAA 3G71V 2VQFO 3OUFA 4TV8A 1YJWV 3E83A 2KKWA 2JIZG 3T4DA 5KHJA 4BIOA 1FPOA 1NR7A 1GN4A 2Y4TA 2ZD9A 4GLXA 2EIMC 4DR6O 2WLMA 1J5EB 1IDSA 2ODMA 5FPOA 1B06A 1K92A 3JD1A 1T5EA 2ZXWB 3RVZA 3JAMN 4NB5A 4LNUB 2GSMB 4DUZB 4ZIBA 3E86A 1Q6UA 3W7XA 1KKCA 2E5LB 4I0XB 1SS3A 2V4DA 1WNSA 2BCCH 3IFXA 2PUSA 2DQ0A 5BMVA 3OR6C 1YTFD 2BSKB 1L1FA 1W59A 3L71H 3D3QA 3MHSC 1SZTA 4J41A 1MOFA 4LH6A 2DE0X 3A0BZ 3BFRA 1Q6IA 2ZE7A 5FLXN 4H37A 4PD4F 5LMNO 4YY3O 3E8FA 3UCSC 4O2AA 2IH1C 2WLLB 4B7EA 1JOYA 2H3OA 4YJ2A 1N34O 4AI8A 1VQ6V 1S76D 1XUQA 3ASNB 2F4VO 4GKKB 2HG5C 3GWOA 1L0LH 2JDIG 3QTCA 5JJEB 1YJ9V 1IVSA 3TETA 4YIPA 2V1DA 5CA3A 2LO1A 3GVMA 3VBBA 2AHYA 3H01A 4O4LA 4WFFA 1J5EO 2WLIA 3JASB 3ZRXA 4ZI7B 2Q9LA 1PL4A 3BAAA 1IXMA 2WA4A 1US6A 4IT5A 5CA1B 5IYCO 1M56B 2Q6AA 2UU9B 4IYHA 3ASNC 3CCRV 1IBKB 4TOIA 3M8AA 3TXSA 5KX5B 5LL6Y 1AVMA 3L9DA 1PNKA 1FFXB 2AZ2A 1DLBA 3QO8A 4LF4B 2XAFA 4KXRA 1S5JA 1VF6C 3JCUZ 2KB1A 3QG5A 2ZNIA 2LQTA 1WP8A 5JWPA 4D7SA 3OGCC 5EC1C 4LF8B 1N32O 5CB4B 2XAHA 2CUGA 4U3JB 3HKEA 3HKCA 4JAUA 1WAZA 2CTPA 2A06H 4K0KB 4OPAA 2GUZB 4K3AA 2ZXWC 4GKKO 1R6TA 4MTFA 2QJ1A 2X7RB 4CH5A 2EIMB 3E8GA 3QO7A 2ILMA 3JALA 2WLNA 4O4IA 1SERA 4MVZA 2RJZA 3OMAB 4YJ3A 4FLYA 2HR3A 2GUZA 3ZMZA 2ZR3A 3C3SA 5JCOA 5LP6B 4U3JA 5KMGA 3OAAG 1PM9A 2P90A 3W7TA 4O4JB 4U3FH 2BSKA 4CS3A 1IX9A 2F1MA 3BA8A 1H2LA 4D7TA 1V54C 5KX5A 4F6EA 4UCSA 4I50A 2ZCEA 1SZXA 3ZCCA 1I7FA 3M99B 3P30A 4OPHA 3OTOB 4O4JA 4O4IB 1WB7A 2IJKA 3K9SA 3ASOC 4LWSB 3AG4C 3AG1C 1XEQA 4LP8A 1Y76B 1ZLZA 5JQGB 4LNUA 2UUAB 4CH4A 4O4HB 2AXTZ 3C3TA 4FIPC 3T2MA 3JATA 4PA4A 5LHHA 1YSCA 2UUBB 1Q3EA 3E89A 1F23A 1ZAUA 2Q67A 2HHHO 3LDCA 5L3FA 4F6RB 2P4VA 3VQVA 4K35A 4YHHO 3THOA 1M57B 4EEQA 4I4TA 5ITZA 5CN0A 4WFGA 3BVOA 3DTUB 4WBNB 3CCQV 1XDCA 5JVDA 1XL4A 3OMIB 4QIWF 2QTSA 4TT3G 4J7ZA 4R8CA 4DW0A 2QWRB 1FYJA 5EIBD 3O65A 1H8EG 4ZOLA 5H9CA 5C8YA 1R6NA 2YI8A 1O9GA 1S0VA 3ZJZA 4G2KA 2HLDG 1KBHA 4JI6O 4TSFG 2Y48A 1XBLA 4ZKIA 4DR3O 2WLIB 2UUCB 4P9PA 2HKOA 4I7ZB 2X6BA 1P7GA 3SPCA 1SQBH 3JALB 2KSDA 4B3TB 4KFMA 4NTXA 1FFTB 3SGIA 2HHHB 3H1LH 5L3EA 5EYPB 1OCZC 1LR1A 4FZ1A 1ZWIC 2BTQA 3JD0A 3SPJA 5LMUO 1ENVA 1RP3B 3CPWU 2CK3G 1YZBA 4QPJA 4L8JA 3FAVB 1YHQV 2ZT9B 3H1IH 3I56V 3FAVA 1KQSU 3TJTA 2A9HA 3K06A 4GX1A 3T4ZA 3H1HH 2ZINA 2BTQB 4UB8Z 5JVDB 5CBGA 1MA1A 1P49A 1NH2D 2AHZA 4ABMA 4QJFB 4LFCO 4N23A 3UT5B 3RBZA 5KUKA 3LSSA 1I08A 4BIZA 5CA0B 3AK2A 4GZRB 2ZIOA 3JASA 4ZI7A 3ZN1A 2AZ0A 4KL1A 5L3BA 4X65O 3AG2B 4X20A 2EBOA 2ZE8A 1J95A 1N33B 2QM7A 4W4KA 1AROP 1AR4A 4PDVA 2PI4A 5IY5B 1JCHA 2HP8A 3VQYA 2BTOA 2ZM6B 1NVPB 4MTGA 4B3SO 1K97A 2OTJV 4FM1A 2E74B 1WA8B 4IIJB 3ZX6A 2ZKOA 2WLLA 4JI5B 4DV3O 2XAGA 2GHYA 2QDOA 3K9AA 5CB4A 3VQXA 2EJ7A 2Y4UA 4J10A 3FB7C 1I94O 5BZBA 1DF4A 4JI2B 4DR5B 1N33O 4GX2A 4NYKA 2Q69A 2E75B 4NR1A 1VMGA 2W6JG 5IJ9B 3ZHTA 3SPGA 4FZ0A 2DYSC 2Z0AA 1Q81W 4JI0O 5BXZA 4LFCB 1VQ9V 4YIOA 3B09A 1YI2V 1VQNV 4JI4B 4FLTA 1OZ0A 4U7NA 3WB0A 1EM1A 3P3PA 3R65A 1W0JG 3UKMA 2R9AA 1N0JA 2QWOB 3JSNA 4PJ0Z 1SQFA 3ZRWA 1HNXB 5B1OA 3B77A 2RNBA 1IBKO 4EKWA 1HR0B 3K5LA 4IHJB 4WCEV 1TUBB 3M7MX 4HZ3A 1Z5VA 2P4KA 4O2AB 5EBWC 1AI5A 2WPDG 5H6RA 4UVAA 3OGIB 4PI2A 3RYIA 1QHTA 3ZHUA 5H2FZ 3A8TA 2L35A 3T1YO 2V7QG 4OX9B 4HBNA 2H94A 5LGTA 2XUMA 2N74A 4JAVA 2X6CA 1FFXA 1VQOV 2UXBB 3HKDA 3T1HB 2EILC 3K03A 4GX0A 3K5NA 2FL4A 3BHPA 3Q4HB 4JZGA 2OIGA
chains in the Genus database with same CATH topology
3SYPA 2Z3YA 3IFXA 3OFNG 3OE7G 2DQ0A 3OR6C 3SJQC 1YTFD 2PI5A 1KECA 3K3WA 1L1FA 3ABTA 1Y66A 5EC2C 3MHSC 1SZTA 3OEEG 1MOFA 1NR1A 1K8AW 5DN6G 2ATKC 3CXCU 4H37A 3AG4B 1M90W 4GX5A 3E8FA 4BAYA 4MTOA 2IH1C 1KP2A 2ZR2A 2WLLB 1FXHA 3K08A 1JOYA 4X8AA 5KUMA 1VQ6V 1S76D 3LDDA 3ASNB 1VQLV 2HG5C 1CPYA 5IYBO 3GWOA 4WFHA 1K4CC 1WPXA 2JDIG 1JQ0A 3D36A 1COWG 1H8HG 1SRYA 1YJ9V 4H33A 3W7SA 3TETA 5CA3A 2V1DA 2W6IG 2JJ2G 3VBBA 2AHYA 1SETA 2EJRA 3H01A 2P67A 4WFFA 3AG3C 2WLIA 4JF3A 1Q86W 5EK0A 3ZRXA 1GTOA 1YIJV 3DGEA 3ZRVA 2OCCC 3E35A 1NJIW 1IXMA 3RW0A 3CD6V 3K0DA 1I5XA 4CBCA 4YXWG 1AJNA 4P30A 5CBFA 4RQFA 5IYCO 1M56B 1OCRC 2Q6AA 5LGUA 3ZMVA 1M1KW 3ASNC 2R9RB 3CCRV 5IY5C 1AJQA 2JK5C 1EFRG 2QA4V 1OCCB 4KUMA 2QKSA 2WLHA 4LBEC 4FJCC 1NKDA 3OR7C 3CC7V 1PNKA 2ITDC 1Q82W 4XBFA 3AG2C 1DLBA 4HAMA 4PDMA 3QO8A 4PDLA 1V54B 4FMTA 2XAFA 2IJJA 1JVMA 1S3JA 3ASOB 1V55C 1FXVA 3JD2A 4Q20A 2QEXV 1SESA 4U7OA 2KB1A 5L3DA 1N8RW 4PA7A 1FXKA 1F4NA 1AR1B 3B8NA 2WAMA 2DQ3A 2LFRA 3W7WA 3ZRWB 4RAIA 1AJPA 3OGCC 4J9YB 1MABG 3CCUV 2JEUA 5EC1C 1OCZB 4KP4A 1K73W 4UXNA 3CC4V 2XAHA 1QLEB 4LCUC 1GK9A 2ITCC 1K33A 4JAUA 4PA6A 1P7BA 1P4RA 4JTDB 2ZXWC 3QNEA 4JYBA 1RPOA 4MTFA 4JPRA 4DXWA 2R9IA 2P6JA 2X7RB 3E8BA 5B1NA 1VQ5V 1NVPD 2EIMB 3E8GA 4XDLA 3LDEA 4I5SA 1PD3A 3QO7A 2WLNA 5B3SB 2Z5UA 1SERA 4MVZA 4MVOA 2YEVA 1YTFB 3OMAB 3FB6C 1E1RG 3X2QC 1GO3F 2HR3A 1CEZA 3ZMZA 2ZR3A 3WG7C 1Q7YW 4QE7A 1M57C 5GW7A 3BY6A 3OAAG 2P90A 2XOKG 3W7TA 2OT5A 2H8PC 3EFFK 3CCLV 1H2GA 4UV8A 2XAJA 5KA5A 3VOUA 2HJFC 3MD0A 3ZN0A 2IU3A 4N21A 3ETGA 1FXKC 1V54C 1QR8A 4P9OA 3CYOA 3TCUA 1JPXA 1W0KG 4TWKA 1QVGU 2EINC 4BW5A 2OTLV 3ZCCA 1F51A 1PNMA 4MSWC 3M99B 3P30A 4I9WA 4MVQA 3JD4A 1FS0G 5B1AC 1WLEA 5DM6V 2IU0A 3ZMSA 1G8MA 2IJKA 1M56C 1V55B 2YSUB 3ASOC 3A0RA 2LP7A 3OUSA 4JTAB 3AG4C 3AG1C 3AG1B 1UJWB 1NQTA 4LP8A 2FTKA 4J9ZB 3P32A 4R6ZA 4PA3A 2QE7G 2DYSB 2QTOA 2Y69B 1AI4A 1NH2B 1QVFU 1BMFG 4FIPC 3T2MA 4PA4A 4R7CA 1YSCA 5EBLC 5LHHA 3G6EV 2B1GA 1K9MW 4XDJA 4MVMA 3STLC 3E89A 2M7WA 4WFEA 2C2AA 4FK5C 1F23A 3K04A 5LHGA 2X0LA 2Q67A 3SYCA 3CCMV 2IJHA 1K4DC 4MT8A 3SYAA 3LDCA 5L3FA 1TUEB 1PNLA 1Y4MA 1G4YB 1S72V 1M57B 3ML0A 1QLNA 3ABKC 5CMUA 5CN0A 3ABLC 4WFGA 3DTUB 1JX9A 3CCQV 4GT1A 2HFEC 4UVBA 1XL4A 3OMIB 4QIWF 4TT3G 4RUEA 3STZC 4R8CA 1YJNV 1GM8A 3ABKB 4GCZA 3ZRSA 2IH3C 4E2LA 1ORQC 2DYRC 1H8EG 1BHBA 5H9CA 3PJSK 2BOCC 3OW2U 1R6NA 1H38A 2XAQA 3JCZA 1S0VA 3ZJZA 4G2KA 5L3GA 2HLDG 4JTCB 2UXXA 4QPKA 4TSFG 2Y48A 2ZDIA 4ZKIA 2WLIB 4P9PA 2HKOA 4ASUG 1KC8W 2X6BA 5CBHA 2NNUA 1M9NA 2B1IA 3SPCA 2EIKB 2Y69C 4CZZA 2JJ1G 4KFMA 1K34A 5HFMA 3ZMUA 1FFTB 2XASA 4BIUA 4JASA 3LNMB 5L3EA 3B8MA 1PKXA 3K79A 5KA6A 3FYIB 1VQ7V 5H6QA 2WSSG 2DW4A 3ETDA 1OCZC 3F7YC 3HB3B 1S5HC 4LC1A 3MHHC 3SYQA 1KKDA 1ZWIC 3JD0A 3SPJA 1W2BU 1QBZA 1ENVA 3CPWU 1QR9A 2CK3G 2W0FC 5C93A 3CP1A 2EINB 4QPJA 5HFLA 3SPHA 4JGSA 1YHQV 3CCEV 1GM7A 3ABUA 3NXSA 2EZOA 3X2QB 3FKSG 3I55V 1R3KC 1OCOC 3I56V 4P2ZA 3ZIAG 2XNDG 2DWDC 1KQSU 2BOBC 4WFAV 3D3IA 2A9HA 3AEIA 3K06A 3KG2A 3IGAC 4GX1A 3T4ZA 3ABLB 2F43G 1R3IC 5CBGA 5LHIA 3LUTB 4MVSA 5J9PC 3SPIA 5L3CA 1NH2D 2AHZA 4QJFB 1E79G 2NLJC 1AI7A 3F5WC 1K5QA 4UV9A 4JYCA 4N23A 2EILB 3UM7A 3K0GA 3RBZA 3CMEV 2EIJC 5KUKA 3OM3B 3LSSA 1THZA 4MW8A 4BIZA 4WF9V 4R50A 3CC2V 1QLEC 4MW3A 1R6KA 3CCVV 3ABMB 1JJ2U 2OCCB 2EZPA 3FYEB 3E8HA 3ZN1A 4WFBV 5L3BA 1VQMV 4RUFA 3AG2B 5EBMC 2DYRB 3IC7A 2EBOA 4UUJC 3EHBB 1J95A 2QM7A 1AROP 1XL6A 1E1QG 4MS2A 4PDVA 4G28B 2PI4A 1VQ8V 2YEVB 2B5UA 1KD1W 5IY5B 4Z1MG 1JCHA 4PELA 1CP9A 4F4LA 1R73A 2Q68A 1RPRA 1DF5A 1NVPB 4MTGA 1K97A 2OTJV 2X6AA 1YITV 1BL8A 2WLLA 5FL7G 2XAGA 3FB8C 1R3JC 1MSWD 2ZDIC 2GHYA 4HYOA 1GM9A 3ABMC 2UXNA 3AG3B 3K9AA 2ZQMA 2JEXA 3LSQA 2WWWA 1VQPV 3FB7C 2IJIA 3RVYA 5BZBA 2D3OW 1DF4A 1DTOA 1OCOB 1S77D 4G27B 1GMGA 1K7DA 3T1CA 4GX2A 2Q69A 2W6JG 2EIKC 1K3EA 2HVKC 4FPPA 2HVJC 3SPGA 5E1AC 4XDKA 3CCSV 1PL0A 1OCCC 3ETEA 1RM1B 2DYSC 1Q81W 1NBMG 3JYCA 3E2EA 3FB5C 1VQ9V 2LFSA 3WG7B 1YI2V 1VQNV 2EIJB 3ZMTA 1OZ0A 2MK3A 3G4SV 3CCJV 2DWEC 1ROPA 4PA9A 1EZJA 4U7NA 4MVUA 2P7TC 4ZBMA 1HWYA 3R65A 1W0JG 3UKMA 5LBQA 1GKFA 5B3SC 1RM1C 2QM8A 3WFVA 3ZRWA 1VQ4V 5B1OA 1B6QA 3B77A 4QE9A 4MTXA 1K5SA 1MG1A 4RQEA 1AI6A 1FXKB 3GB7C 3OMNB 4RO2A 4EKWA 3HPLC 4MVRA 4WCEV 4HZ3A 3SYOA 1I5YA 3W7UA 5IDJA 3TK1A 2IW5A 1KP3A 4X89A 1QCEA 4X88A 5EBWC 3BEHA 5IYDO 3F7VC 4OXSA 3CMAV 1AI5A 4PDRA 1LNQA 2K1EA 2WPDG 5LGNA 3QO5A 5H6RA 1BHAA 3G71V 1F4MA 3OUFA 4UVAA 1YJWV 3OEHG 1R3LC 3E83A 2JIZG 3T4DA 3JD3A 4QNHB 2WLKA 1NR7A 2WLJA 2ZD9A 2EIMC 2WLMA 2A0LA 2V7QG 4L87A 1EBOA 1K92A 2H94A 5LGTA 3JD1A 2ZXWB 4JAVA 3RVZA 2X6CA 5B1BB 1VQOV 2GSMB 1OHHG 1OCRB 2EILC 3E86A 3K03A 4GX0A 4UVCA 3W7XA 1VQKV 2A79B 4DO2A 5B1AB 5B1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6A A;  3SYP A;  3E8B A;  1BL8 A;  2WLL A;  3IFX A;  3ZRS A;  3FB8 C;  2IH3 C;  3E8G A;  1R3J C;  4XDL A;  1ORQ C;  3LDE A;  4HYO A;  2DYR C;  3ABM C;  3OR6 C;  3PJS K;  2BOC C;  3SJQ C;  4DXW A;  2WLN A;  4MVZ A;  4MVO A;  2YEV A;  3ZJZ A;  5EC2 C;  3FB7 C;  4JTC B;  3FB6 C;  3RVY A;  5BZB A;  3X2Q C;  2ATK C;  2WLI B;  4P9P A;  4G27 B;  4H37 A;  3T1C A;  3WG7 C;  4GX5 A;  4GX2 A;  3E8F A;  2X6B A;  4QE7 A;  2Q69 A;  4MTO A;  2IH1 C;  2EIK C;  2WLL B;  5CBH A;  2HVK C;  3K08 A;  1M57 C;  2HVJ C;  3SPG A;  5E1A C;  4X8A A;  4XDK A;  5KUM A;  3SPC A;  1OCC C;  2Y69 C;  3LDD A;  2DYS C;  2H8P C;  3EFF K;  4KFM A;  3JYC A;  2HG5 C;  3FB5 C;  3VOU A;  2HJF C;  4WFH A;  1K4C C;  3LNM B;  1V54 C;  4P9O A;  4H33 A;  2DWE C;  3TET A;  4PA9 A;  1OCZ C;  3TCU A;  4MVU A;  2P7T C;  3F7Y C;  4ZBM A;  1S5H C;  3R65 A;  2AHY A;  3SYQ A;  4TWK A;  3UKM A;  1KKD A;  1ZWI C;  2EIN C;  4BW5 A;  3SPJ A;  5B3S C;  4WFF A;  3AG3 C;  2WLI A;  4MSW C;  2W0F C;  5EK0 A;  4I9W A;  4MVQ A;  3SPH A;  4QE9 A;  5B1A C;  2OCC C;  3GB7 C;  4PDL A;  3OUS A;  1M56 C;  3RW0 A;  3ASO C;  4RO2 A;  4JTA B;  4EKW A;  3K0D A;  3AG4 C;  4CBC A;  3AG1 C;  3HPL C;  1R3K C;  1OCO C;  4MVR A;  4P30 A;  4LP8 A;  5CBF A;  4P2Z A;  4J9Z B;  1OCR C;  2Q6A A;  4HZ3 A;  3SYO A;  3ASN C;  2R9R B;  2DWD C;  4R6Z A;  2BOB C;  4PA3 A;  2A9H A;  3K06 A;  3KG2 A;  2JK5 C;  3IGA C;  4X89 A;  5IY5 C;  2QTO A;  4GX1 A;  4X88 A;  3T4Z A;  5EBW C;  2QKS A;  3BEH A;  2WLH A;  3F7V C;  1R3I C;  4LBE C;  5CBG A;  3T2M A;  4OXS A;  3LUT B;  4PA4 A;  4PDR A;  4R7C A;  5EBL C;  4MVS A;  5J9P C;  3SPI A;  1LNQ A;  2K1E A;  2AHZ A;  3OR7 C;  2NLJ C;  2ITD C;  3F5W C;  4XDJ A;  4MVM A;  3AG2 C;  3OUF A;  3STL C;  3E89 A;  4PDM A;  3K0G A;  3UM7 A;  3RBZ A;  4WFE A;  2EIJ C;  5KUK A;  3K04 A;  1R3L C;  3E83 A;  4MW8 A;  4R50 A;  3T4D A;  1QLE C;  1JVM A;  2Q67 A;  4MW3 A;  4QNH B;  1V55 C;  3SYC A;  2WLK A;  2KB1 A;  1K4D C;  3SYA A;  2WLJ A;  3LDC A;  2ZD9 A;  3E8H A;  2EIM C;  4PA7 A;  4RUF A;  1G4Y B;  2WLM A;  2A0L A;  5EBM C;  4UUJ C;  1J95 A;  3ABK C;  4RAI A;  1XL6 A;  3OGC C;  4J9Y B;  4MS2 A;  4PDV A;  4G28 B;  3RVZ A;  3ABL C;  2X6C A;  5EC1 C;  4WFG A;  4LCU C;  2ITC C;  2HFE C;  4PA6 A;  1P7B A;  1XL4 A;  2EIL C;  3E86 A;  3K03 A;  4GX0 A;  4F4L A;  4JTD B;  2Q68 A;  2ZXW C;  2A79 B;  4RUE A;  3STZ C;  4R8C A;  4MTF A;  4MTG A;  5B1B C; 
#chains in the Genus database with same CATH topology
 4F6R A;  4FFB A;  3OE7 G;  3SJQ C;  2PI5 A;  1SKV A;  2UXC O;  2Q7H A;  3IJ4 A;  2ZIM A;  1Z5W A;  3SJC C;  2NR5 A;  2F66 C;  4DV4 B;  3JAK B;  2UXB O;  2QSA A;  2CH7 A;  3K59 A;  4LF8 O;  1N32 B;  1FXH A;  3K08 A;  4X8A A;  1JMK C;  1GN3 A;  1WJZ A;  4LH7 A;  1HNZ B;  4OGQ B;  1TGO A;  3KCX A;  1BS3 A;  3E22 A;  3CJH B;  2E3C A;  3W7S A;  2UUA O;  2JJ2 G;  5A2Q N;  3CRR A;  1IUR A;  3E22 B;  2ADQ B;  4JF3 A;  1Q86 W;  1MZF A;  1GTO A;  3ZRV A;  1BCC H;  1XMO B;  1NJI W;  3CD6 V;  2QGN A;  3K0D A;  1I5X A;  3G80 A;  4CBC A;  2A7W A;  4RQF A;  1M1K W;  3RYI B;  3ZMV A;  2R9R B;  1VIB A;  1VF6 A;  5IY5 C;  1OCC B;  2QKS A;  4A5U B;  4O2B A;  5KAI Z;  3CC7 V;  2ITD C;  3AG2 C;  2EUL A;  4FMT A;  4CH6 A;  2CDY A;  4JYY A;  1S3J A;  4X66 O;  1LUV A;  1FXV A;  3BAB A;  3JD2 A;  2QEX V;  1SES A;  1Q90 D;  4U7O A;  2A3Q A;  4PA7 A;  3HKB B;  2WAM A;  5JJN B;  2LFR A;  3W7W A;  3ZRW B;  4O2B B;  1AJP A;  4J9Y B;  2JEU A;  1K73 W;  4JI3 B;  1GK9 A;  2ITC C;  1K33 A;  4PA6 A;  1P7B A;  1P4R A;  3QNE A;  4JYB A;  4B3R O;  1RPO A;  4JPR A;  2WA3 A;  2R9I A;  1Y74 A;  4AHC A;  1VQ5 V;  1NVP D;  2ZE5 A;  4XDL A;  4DW1 A;  3T1H O;  2RQ6 A;  4DRX B;  4DR2 B;  1SQP H;  1E1R G;  5LOV B;  2O57 A;  1GO3 F;  2RDC A;  1CEZ A;  3WG7 C;  4DV1 B;  3HR0 A;  4X62 B;  3T1Y B;  1VP7 A;  1M57 C;  1Q43 A;  3EFF K;  3N2G A;  1H2G A;  4UV8 A;  1WA8 A;  4IIJ A;  2XAJ A;  5KA5 A;  3VOU A;  4N21 A;  3ETG A;  1FXK C;  3RYF A;  4I55 B;  2F93 B;  4P9O A;  3CYO A;  4JYA B;  2CE4 A;  2VQE O;  3ZHS A;  4BW5 A;  2OTL V;  1F51 A;  1YCI A;  1TVK A;  4MSW C;  2PF4 E;  1IZ3 A;  4I9W A;  4MVQ A;  5B1A C;  4ZOL B;  1V55 B;  3A0R A;  1ZL8 B;  3AG1 B;  5CA0 A;  3ZED A;  1HNX O;  1V9P A;  2QE7 G;  2QTO A;  4UCR A;  3CSX A;  3G6E V;  4NXM O;  2B1G A;  5JH7 A;  1K9M W;  5ITZ B;  2Q5Z A;  3NR7 A;  4NTW A;  3K04 A;  2X0L A;  3CCM V;  3ZHQ A;  2IJH A;  1K4D C;  1TUE B;  4LF6 O;  3ML0 A;  1QLN A;  3AK1 A;  3ABK C;  2PTM A;  5CMU A;  2Y0P A;  3ABL C;  3PN1 A;  4ICG A;  4GT1 A;  2HFE C;  4UVB A;  2DMX A;  2VWJ A;  4JI6 B;  1Y76 A;  4LF7 O;  3ZRS A;  4JAA A;  1XNQ B;  5B66 Z;  1BHB A;  1IBL B;  1NS1 A;  4J80 A;  3KZI Z;  5JJJ B;  5L3G A;  5IYZ A;  4DR4 O;  1Q5O A;  4X62 O;  4TV9 A;  4ASU G;  3JAW B;  5CBH A;  2Q7E A;  2YUA A;  1M9N A;  5E79 Z;  2EIK B;  2Y69 C;  3EXA A;  1K34 A;  5J2T A;  1SQG A;  4CC6 A;  5LP6 C;  3LNM B;  3TGU H;  4DR1 O;  5KA6 A;  1PKX A;  2N04 A;  3K5M A;  1VQ7 V;  4AQY O;  4TUY A;  4B3R B;  1MMM A;  2RN9 A;  2DW4 A;  1BSM A;  3F7Y C;  2OYQ A;  5J2U B;  1AIL A;  1QBZ A;  3H9V A;  3MDS A;  3CP1 A;  2EIN B;  5HFL A;  3SPH A;  5LA6 B;  3CCE V;  1LUW A;  3ABU A;  3NXS A;  4X64 O;  2NN4 A;  1R3K C;  1OCO C;  3CRM A;  5LA6 A;  4X66 B;  3KG2 A;  1PV0 A;  5J2U A;  4E4E A;  5LHI A;  1HNW O;  4MVS A;  4DR1 B;  3SPI A;  3CE2 A;  1RFY A;  3F5W C;  1AI7 A;  3N2G B;  2EIL B;  3K0G A;  4UCO A;  3OM3 B;  1THZ A;  4MW8 A;  4UCV A;  3DC5 A;  1SQQ H;  1Z2G A;  4MW3 A;  3ABM B;  5D5Q A;  3E8H A;  1VQM V;  4Q6G A;  4RUF A;  5EBM C;  4J11 A;  2DYR B;  3IC7 A;  4UUJ C;  4JI8 O;  4W4L A;  1XIL A;  4LR3 A;  1U96 A;  4DK0 A;  2UUC O;  1BE3 H;  4X1Y A;  4MS2 A;  2YEV B;  4AQY B;  1KD1 W;  4ZHQ A;  4LF9 O;  4PEL A;  5IYZ B;  1H2S B;  4GYC B;  1M4U A;  3B40 A;  2B9Z A;  5IJ0 A;  2CTQ A;  1XQ8 A;  1A32 A;  2PGG A;  2CH7 B;  2JS5 A;  2YID A;  3ABM C;  2JEX A;  4HNA B;  1VQP V;  4H13 B;  3FD9 A;  3N2K B;  4DV5 B;  2IJI A;  2D3O W;  1TVK B;  1DTO A;  1OCO B;  3I5D A;  1S77 D;  4G27 B;  3T1C A;  3QVN A;  1XNQ O;  4FLV A;  1K3E A;  2HVK C;  2HVJ C;  5E1A C;  2CTR A;  2UXC B;  3E2E A;  3FB5 C;  3RWR D;  1S5L Z;  5IWA O;  4NXN O;  2DWE C;  1ROP A;  1EZJ A;  2P7T C;  4FLW A;  1HWY A;  3L75 H;  3UT5 A;  3C90 A;  1FD9 A;  1XHX A;  1HP8 A;  3EVK A;  1MG1 A;  3U0Z A;  1IBM O;  4RQE A;  1AI6 A;  2PYJ A;  4NVP A;  1BQZ A;  3OTO O;  5IJ9 A;  3HPL C;  4B08 A;  1TA8 A;  4UFZ A;  2D2C B;  1GH6 A;  3W7U A;  3S3W A;  2IBZ H;  3TK1 A;  4FFK A;  1KP3 A;  1IXB A;  4WBN A;  4X88 A;  1URF A;  1GRJ A;  3CMA V;  2L6L A;  1KB9 F;  5EZY B;  3OEH G;  3HKB A;  3JD3 A;  1MNG A;  4QNH B;  2Q0A A;  1D5N A;  2UU9 O;  1H2K A;  4L87 A;  1N36 O;  2Q8V A;  4PHZ A;  2GTS A;  3KKY A;  2MW2 B;  5JQG A;  1O9H A;  1OHH G;  1OCR B;  1H2M A;  4DO2 A;  5B1B C;  3SYP A;  2Z3Y A;  2W0X A;  2Y0I A;  3OFN G;  2P06 A;  3G67 A;  3A2F A;  4YJ2 B;  4CS4 A;  3WB2 A;  4DV7 B;  2AGA A;  3ABT A;  3OEE G;  4DV7 O;  1M90 W;  4GX5 A;  3RFR A;  4BAY A;  4MTO A;  1KP2 A;  4JI2 O;  2YIB D;  4J7J A;  4EB6 A;  4FLU A;  4DK1 A;  3LDD A;  2Q73 A;  4LF4 O;  3OTF A;  1VQL V;  5IYB O;  2Q4P A;  5KMG B;  4I0X A;  1K4C C;  4EFB A;  3RYH A;  3O9O A;  3TXQ A;  4DV3 B;  4JI5 O;  1H8H G;  1EN6 A;  4H33 A;  3IAY A;  1XHZ A;  1ZTE A;  2P67 A;  2HJD A;  2YXH A;  3AG3 C;  4JI1 B;  4EFE A;  1WN7 A;  3DGE A;  3E35 A;  3RW0 A;  3CS5 A;  4YXW G;  4H0L B;  4P30 A;  5CBF A;  5LGU A;  3LSU A;  4CC5 A;  1AR5 A;  5K1P A;  2DN9 A;  5KHK A;  5TIS Z;  1JR9 A;  2GV9 A;  5GTI Z;  1Q82 W;  1X4T A;  4XBF A;  1V54 B;  2F4V B;  1M93 A;  2IJJ A;  1JVM A;  4LFB O;  1V55 C;  5L3D A;  1F4N A;  1AR1 B;  2RCV A;  3RT3 C;  4RAI A;  3CRA A;  1MAB G;  3AG7 A;  1OCZ B;  4KP4 A;  5IWA B;  1QLE B;  1FJG O;  5F2V O;  2XHB A;  3JAT B;  2PYL A;  1HNZ O;  4DXW A;  4X20 B;  1JJO A;  5IE9 A;  5B1N A;  3E8B A;  2E76 B;  3CRC A;  3LDE A;  1AP5 A;  5B3S B;  4MVO A;  5IT9 N;  1SQV H;  1YTF B;  3FB6 C;  4DV5 O;  4OX9 O;  5C8Y B;  4D6T H;  4DR6 B;  1B04 A;  5GW7 A;  3BY6 A;  4DR4 B;  2XOK G;  1N36 B;  2OT5 A;  2H8P C;  2HJF C;  2G38 A;  3MD0 A;  3ZN0 A;  1JFF A;  2Q0O C;  5IJ0 B;  1PPJ H;  2LGW A;  1XI1 A;  4TV9 B;  5LP6 A;  3TCU A;  2QWQ B;  4TWK A;  1VF7 A;  1YEW A;  4X1Y B;  1PNM A;  5CA1 A;  1FS0 G;  2YI9 A;  2IU0 A;  4PDL A;  1G8M A;  1M56 C;  4H44 B;  3OUS A;  2LP7 A;  1UJW B;  1NQT A;  1ZSP A;  4J9Z B;  4TQF A;  3P32 A;  2CGO A;  4DUY B;  1IBM B;  2GTA A;  4Z1V A;  1PP9 H;  1AI4 A;  1QVF U;  1BMF G;  1D5A A;  1Q6H A;  4QGP A;  2N05 A;  4R7C A;  4FVM A;  4XDJ A;  1GN6 A;  3CRQ A;  4MVM A;  2C2A A;  4FK5 C;  3L70 H;  2QWN B;  1P84 F;  2YXY A;  1VEW A;  1Y4M A;  1G4Y B;  1S72 V;  4LWS A;  1NU1 H;  5BR8 B;  3S3X A;  5JH7 B;  3B2E E;  4GKJ O;  2YC0 A;  1M5I A;  2QKC A;  5LMU B;  1FKA O;  1F7Y A;  4RUE A;  3ZS8 C;  4DV2 O;  1YJN V;  3J7A U;  1GM8 A;  4FLX A;  4DUZ O;  2DYR C;  3PJS K;  3OW2 U;  2XAQ A;  3JCZ A;  2JGD B;  1L8D A;  1EN4 A;  2CAZ C;  1SC5 B;  1IBL O;  1KC8 W;  5EYP A;  3OT7 A;  2KQX A;  4JI8 B;  2JJ1 G;  5HFM A;  3ZMU A;  2VQF B;  4BR6 A;  3AK3 A;  4JAS A;  3U10 A;  4LF9 B;  2EX3 A;  3FYI B;  5JCO C;  5FPR A;  1RSO A;  2ARH A;  1KKD A;  4LC1 A;  3SYQ A;  3MHH C;  4TV8 B;  4LF5 O;  5LOV A;  4JZ2 A;  4DR7 O;  5C93 A;  4JGS A;  1XNR O;  4B7K A;  3UO2 A;  1GM7 A;  1Y6X A;  4YHH B;  3X2Q B;  3FKS G;  3I55 V;  4X1I A;  5H5N A;  3ZIA G;  2XND G;  2DWD C;  4X64 B;  4WFA V;  3D3I A;  4DV6 O;  1HDJ A;  2QKA A;  2JGU A;  3LUT B;  4FM0 A;  5J9P C;  5L3C A;  4B3M B;  2LGQ A;  4LF5 B;  1E79 G;  2NLJ C;  4UV9 A;  1K5Q A;  4JYC A;  3CME V;  4B3T O;  3QF7 A;  3CC2 V;  3CWB H;  1R6K A;  1KUQ A;  2UXD B;  1JJ2 U;  4WFB V;  4AIL C;  1DGS A;  3CXH F;  2GBO A;  1E1Q G;  1VQ8 V;  5D5P A;  3RYH B;  4LFA B;  2JGD A;  2YDE A;  4F4L A;  1R73 A;  2VS0 A;  3DXR A;  1RPR A;  2X6A A;  1YIT V;  1GN2 A;  2ZDI C;  4HYO A;  1GM9 A;  4LF7 B;  5LXT B;  3RN4 A;  1N34 B;  2WWW A;  4ZHQ B;  4DR3 B;  4DV2 B;  3RVY A;  4YY3 B;  1L0N H;  2YXL A;  1SA0 A;  2EIK C;  3J81 N;  1YXB A;  4NKG B;  4XDK A;  3CCS V;  3ETE A;  5BR8 O;  3CEI A;  1NBM G;  3JYC A;  3JAR A;  3SJB C;  2EIJ B;  3ZMT A;  3G4S V;  3CCJ V;  3RGB A;  4PA9 A;  4MVU A;  4ZBM A;  2K9P A;  4O4H A;  5B3S C;  1RM1 C;  3WFV A;  4YJ3 B;  1VQ4 V;  4LF6 B;  4I9Q A;  1FXK B;  2CTW A;  3GB7 C;  5K1X A;  3APO A;  4RO2 A;  3DSQ A;  4C7U A;  4EB6 B;  2IW5 A;  2UUB O;  4IGG A;  1QCE A;  4I50 B;  1YDX A;  1NI8 A;  3HKC B;  4J42 A;  4UCU A;  4PDR A;  2ZNJ A;  2K1E A;  3QO5 A;  1F4M A;  5LYJ A;  2FYU H;  1XMQ O;  1R3L C;  1JA8 A;  1EZV H;  5KAF Z;  4JI7 B;  5BMV B;  3DC6 A;  2WLK A;  2KG7 B;  1X59 A;  2WLJ A;  2A0L A;  4PI0 A;  1EBO A;  5B1B B;  3IC9 A;  1WP7 A;  4DV1 O;  2Q7G A;  4DV0 B;  2OWO A;  2OIE A;  5BY1 A;  2YIB A;  4UVC A;  5KHH A;  1VQK V;  2A79 B;  2XT9 A;  5B1A B;  3H1J H;  1KEC A;  3K3W A;  3APQ A;  4FLZ A;  1Y66 A;  5EC2 C;  1NR1 A;  1K8A W;  5DN6 G;  2ATK C;  2P5O A;  3JSL A;  3CXC U;  3AG4 B;  5LMN B;  1N0N A;  4DV0 O;  4JI3 O;  4DYL A;  2ZR2 A;  2HEP A;  5KUM A;  2YIA A;  2FML A;  2VWK A;  1CPY A;  1Y67 A;  4WFH A;  1WPX A;  1JQ0 A;  3D36 A;  1COW G;  4LFB B;  4KHP B;  1SRY A;  5A9G A;  3JAW A;  2W6I G;  1YVW A;  1H2N A;  1MZE A;  1CXZ B;  1SET A;  2EJR A;  2FB5 A;  4X1K A;  5EK0 A;  3G6B A;  2LJ2 A;  5J2T B;  1YIJ V;  2ETN A;  2OCC C;  3CX5 F;  3BRC A;  4IL6 Z;  1AJN A;  3ZBH A;  1OJH A;  1OCR C;  4RWU A;  2LW1 A;  2BE3 A;  4JI7 O;  2QA4 V;  1AJQ A;  2JK5 C;  1EFR G;  4KUM A;  2WLH A;  4LBE C;  5DED A;  4I55 A;  4FJC C;  1NKD A;  4KHP O;  3OR7 C;  4UB6 Z;  5GON B;  4HAM A;  4PDM A;  1HR0 O;  4NXN B;  2GDS A;  4IYI A;  1XMO O;  3ASO B;  3RYF B;  4Q20 A;  1DK1 A;  1N8R W;  4JV5 B;  1FXK A;  5KHG A;  3B8N A;  2DQ3 A;  5B5E Z;  3D36 C;  3K5O A;  2OCH A;  3CCU V;  3ICX A;  5EZY A;  4HNA A;  4DV4 O;  4UXN A;  3CC4 V;  5KLV H;  2AW9 A;  4LCU C;  2JRI A;  3ZHR A;  4JTD B;  3MAQ A;  2P6J A;  4J7K A;  3KCY A;  5KHI A;  3RYC A;  4I5S A;  1PD3 A;  2Z5U A;  2YEV A;  4X1K B;  3B4S A;  3X2Q C;  3F5T A;  3CJH A;  1RSO B;  1YF2 A;  1Q7Y W;  4LFA O;  1AB3 A;  4QE7 A;  5FNV B;  1VF5 B;  3SR2 C;  1NTZ H;  1ZL8 A;  1G1X B;  2CGN A;  1Q8I A;  4B3S B;  3CCL V;  1XMQ B;  2YIC A;  5GTH Z;  2IU3 A;  2UXD O;  3CB2 A;  1QR8 A;  2QM4 A;  2RMK B;  3UO3 A;  1JPX A;  1BQ0 A;  1W0K G;  1QVG U;  2EIN C;  1R1B A;  3N2K A;  3FFQ A;  2JVD A;  3JD4 A;  1WLE A;  5DM6 V;  3ZMS A;  2YSU B;  4JTA B;  1NTK H;  1BT8 A;  2FTK A;  3U11 A;  1NT2 B;  1WPB A;  4R6Z A;  4PA3 A;  1XNR B;  2DYS B;  3WB1 A;  2Y69 B;  1NH2 B;  2YS8 A;  3LNN A;  4DR7 B;  5EBL C;  3L73 H;  3K57 A;  3STL C;  3D8C A;  1QNM A;  2F23 A;  2M7W A;  4WFE A;  3OD4 A;  3ZHV A;  2R72 A;  5LHG A;  4K8X A;  3SYC A;  4X9Q A;  2XTA A;  3SYA A;  4MT8 A;  1PNL A;  4CH3 A;  4IHJ A;  3J80 N;  3BCC H;  1WB8 A;  5GON A;  4JI4 O;  1JX9 A;  4DR5 O;  1NZ6 A;  1B3Q A;  3BA9 A;  2DJV A;  1TUB A;  1I94 B;  4JI0 B;  3STZ C;  3ABK B;  4GCZ A;  2R70 A;  2IH3 C;  4GUN A;  4E2L A;  2P22 C;  1ORQ C;  1KU9 A;  2BOC C;  1H38 A;  3GWK C;  1D2D A;  3UQ8 A;  2ZM6 O;  4JTC B;  2UXX A;  4QPK A;  2ADP A;  2ZDI A;  3ETQ A;  1KYO F;  2ZE6 A;  1SQX H;  4CS2 A;  3JAR B;  2M6Y A;  1JFF B;  2NNU A;  1UFI A;  2B1I A;  4FM2 A;  3CHX A;  4CZZ A;  3H1K H;  5DEC A;  3RYC B;  2XAS A;  4BIU A;  4B3M O;  3B8M A;  1HW7 A;  3K79 A;  5H6Q A;  2WSS G;  1I0H A;  3ETD A;  3WU2 Z;  3HB3 B;  1S5H C;  4K0K O;  4TQD A;  2DOS A;  1W2B U;  3N27 A;  4NXM B;  1QR9 A;  4X65 B;  1HNW B;  2W0F C;  4GKJ B;  1QU7 A;  4NTY A;  1OV9 A;  4DUY O;  2EZO A;  4P2Z A;  5AG2 A;  1FAF A;  2BOB C;  3AEI A;  3L74 H;  3IGA C;  3A0H Z;  3ABL B;  3HKE B;  2F43 G;  1R3I C;  2FKX A;  4TUY B;  2VQE B;  1EN5 A;  3HKD B;  3UM7 A;  4JYA O;  2EIJ C;  4FFB B;  4WF9 V;  4R50 A;  4UCT A;  1QLE C;  4DRX A;  3CCV V;  2OCC B;  2EZP A;  3FYE B;  1GAX A;  1Y74 B;  3K58 A;  3L72 H;  2QWP B;  1NTM H;  3EHB B;  4PV1 B;  4Z2W A;  3SDL A;  1KMI Z;  1XL6 A;  5EIB C;  4G28 B;  2QR4 A;  5LYJ B;  2B5U A;  2IM9 A;  1VAR A;  4Z1M G;  5LXT A;  1ZUQ A;  2F95 B;  1CP9 A;  1XRE A;  2PY5 A;  3BPZ A;  2Q68 A;  2LW7 A;  1DF5 A;  4X1I B;  1BGY H;  4K8Z A;  1BL8 A;  5FL7 G;  3JAK A;  3FB8 C;  3DXR B;  3R66 A;  1R3J C;  1MSW D;  2UXN A;  3AG3 B;  2ZQM A;  3LSQ A;  4O4L B;  3VQW A;  1GMG A;  1K7D A;  4DR2 O;  1BZK A;  3FX7 A;  4FPP A;  1PL0 A;  1OCC C;  3P3N A;  3Q4H A;  1RM1 B;  1U97 A;  2LFS A;  3WG7 B;  1SF9 A;  1XOU A;  2E5L O;  2MK3 A;  5FNV A;  1UPG A;  1TAE A;  1SA0 B;  1QQC A;  4DV6 B;  3SJA C;  5LBQ A;  1GKF A;  1FJG B;  2QM8 A;  1G6U A;  2KG7 A;  1B6Q A;  4QE9 A;  4MTX A;  1K5S A;  4BW9 A;  3OMN B;  1MSD A;  4MVR A;  2JS3 A;  3SYO A;  4JV5 O;  1AP6 A;  1I5Y A;  1N4C A;  5IDJ A;  2VRZ A;  4X89 A;  3BEH A;  5IYD O;  3F7V C;  4OXS A;  1ZX3 A;  4JI1 O;  2PZS A;  1LNQ A;  4I4T B;  4BWA A;  5LGN A;  1BHA A;  3G71 V;  2VQF O;  3OUF A;  4TV8 A;  1YJW V;  3E83 A;  2KKW A;  2JIZ G;  3T4D A;  5KHJ A;  4BIO A;  1FPO A;  1NR7 A;  1GN4 A;  2Y4T A;  2ZD9 A;  4GLX A;  2EIM C;  4DR6 O;  2WLM A;  1J5E B;  1IDS A;  2ODM A;  5FPO A;  1B06 A;  1K92 A;  3JD1 A;  1T5E A;  2ZXW B;  3RVZ A;  3JAM N;  4NB5 A;  4LNU B;  2GSM B;  4DUZ B;  4ZIB A;  3E86 A;  1Q6U A;  3W7X A;  1KKC A;  2E5L B;  4I0X B;  1SS3 A;  2V4D A;  1WNS A;  2BCC H;  3IFX A;  2PUS A;  2DQ0 A;  5BMV A;  3OR6 C;  1YTF D;  2BSK B;  1L1F A;  1W59 A;  3L71 H;  3D3Q A;  3MHS C;  1SZT A;  4J41 A;  1MOF A;  4LH6 A;  2DE0 X;  3A0B Z;  3BFR A;  1Q6I A;  2ZE7 A;  5FLX N;  4H37 A;  4PD4 F;  5LMN O;  4YY3 O;  3E8F A;  3UCS C;  4O2A A;  2IH1 C;  2WLL B;  4B7E A;  1JOY A;  2H3O A;  4YJ2 A;  1N34 O;  4AI8 A;  1VQ6 V;  1S76 D;  1XUQ A;  3ASN B;  2F4V O;  4GKK B;  2HG5 C;  3GWO A;  1L0L H;  2JDI G;  3QTC A;  5JJE B;  1YJ9 V;  1IVS A;  3TET A;  4YIP A;  2V1D A;  5CA3 A;  2LO1 A;  3GVM A;  3VBB A;  2AHY A;  3H01 A;  4O4L A;  4WFF A;  1J5E O;  2WLI A;  3JAS B;  3ZRX A;  4ZI7 B;  2Q9L A;  1PL4 A;  3BAA A;  1IXM A;  2WA4 A;  1US6 A;  4IT5 A;  5CA1 B;  5IYC O;  1M56 B;  2Q6A A;  2UU9 B;  4IYH A;  3ASN C;  3CCR V;  1IBK B;  4TOI A;  3M8A A;  3TXS A;  5KX5 B;  5LL6 Y;  1AVM A;  3L9D A;  1PNK A;  1FFX B;  2AZ2 A;  1DLB A;  3QO8 A;  4LF4 B;  2XAF A;  4KXR A;  1S5J A;  1VF6 C;  3JCU Z;  2KB1 A;  3QG5 A;  2ZNI A;  2LQT A;  1WP8 A;  5JWP A;  4D7S A;  3OGC C;  5EC1 C;  4LF8 B;  1N32 O;  5CB4 B;  2XAH A;  2CUG A;  4U3J B;  3HKE A;  3HKC A;  4JAU A;  1WAZ A;  2CTP A;  2A06 H;  4K0K B;  4OPA A;  2GUZ B;  4K3A A;  2ZXW C;  4GKK O;  1R6T A;  4MTF A;  2QJ1 A;  2X7R B;  4CH5 A;  2EIM B;  3E8G A;  3QO7 A;  2ILM A;  3JAL A;  2WLN A;  4O4I A;  1SER A;  4MVZ A;  2RJZ A;  3OMA B;  4YJ3 A;  4FLY A;  2HR3 A;  2GUZ A;  3ZMZ A;  2ZR3 A;  3C3S A;  5JCO A;  5LP6 B;  4U3J A;  5KMG A;  3OAA G;  1PM9 A;  2P90 A;  3W7T A;  4O4J B;  4U3F H;  2BSK A;  4CS3 A;  1IX9 A;  2F1M A;  3BA8 A;  1H2L A;  4D7T A;  1V54 C;  5KX5 A;  4F6E A;  4UCS A;  4I50 A;  2ZCE A;  1SZX A;  3ZCC A;  1I7F A;  3M99 B;  3P30 A;  4OPH A;  3OTO B;  4O4J A;  4O4I B;  1WB7 A;  2IJK A;  3K9S A;  3ASO C;  4LWS B;  3AG4 C;  3AG1 C;  1XEQ A;  4LP8 A;  1Y76 B;  1ZLZ A;  5JQG B;  4LNU A;  2UUA B;  4CH4 A;  4O4H B;  2AXT Z;  3C3T A;  4FIP C;  3T2M A;  3JAT A;  4PA4 A;  5LHH A;  1YSC A;  2UUB B;  1Q3E A;  3E89 A;  1F23 A;  1ZAU A;  2Q67 A;  2HHH O;  3LDC A;  5L3F A;  4F6R B;  2P4V A;  3VQV A;  4K35 A;  4YHH O;  3THO A;  1M57 B;  4EEQ A;  4I4T A;  5ITZ A;  5CN0 A;  4WFG A;  3BVO A;  3DTU B;  4WBN B;  3CCQ V;  1XDC A;  5JVD A;  1XL4 A;  3OMI B;  4QIW F;  2QTS A;  4TT3 G;  4J7Z A;  4R8C A;  4DW0 A;  2QWR B;  1FYJ A;  5EIB D;  3O65 A;  1H8E G;  4ZOL A;  5H9C A;  5C8Y A;  1R6N A;  2YI8 A;  1O9G A;  1S0V A;  3ZJZ A;  4G2K A;  2HLD G;  1KBH A;  4JI6 O;  4TSF G;  2Y48 A;  1XBL A;  4ZKI A;  4DR3 O;  2WLI B;  2UUC B;  4P9P A;  2HKO A;  4I7Z B;  2X6B A;  1P7G A;  3SPC A;  1SQB H;  3JAL B;  2KSD A;  4B3T B;  4KFM A;  4NTX A;  1FFT B;  3SGI A;  2HHH B;  3H1L H;  5L3E A;  5EYP B;  1OCZ C;  1LR1 A;  4FZ1 A;  1ZWI C;  2BTQ A;  3JD0 A;  3SPJ A;  5LMU O;  1ENV A;  1RP3 B;  3CPW U;  2CK3 G;  1YZB A;  4QPJ A;  4L8J A;  3FAV B;  1YHQ V;  2ZT9 B;  3H1I H;  3I56 V;  3FAV A;  1KQS U;  3TJT A;  2A9H A;  3K06 A;  4GX1 A;  3T4Z A;  3H1H H;  2ZIN A;  2BTQ B;  4UB8 Z;  5JVD B;  5CBG A;  1MA1 A;  1P49 A;  1NH2 D;  2AHZ A;  4ABM A;  4QJF B;  4LFC O;  4N23 A;  3UT5 B;  3RBZ A;  5KUK A;  3LSS A;  1I08 A;  4BIZ A;  5CA0 B;  3AK2 A;  4GZR B;  2ZIO A;  3JAS A;  4ZI7 A;  3ZN1 A;  2AZ0 A;  4KL1 A;  5L3B A;  4X65 O;  3AG2 B;  4X20 A;  2EBO A;  2ZE8 A;  1J95 A;  1N33 B;  2QM7 A;  4W4K A;  1ARO P;  1AR4 A;  4PDV A;  2PI4 A;  5IY5 B;  1JCH A;  2HP8 A;  3VQY A;  2BTO A;  2ZM6 B;  1NVP B;  4MTG A;  4B3S O;  1K97 A;  2OTJ V;  4FM1 A;  2E74 B;  1WA8 B;  4IIJ B;  3ZX6 A;  2ZKO A;  2WLL A;  4JI5 B;  4DV3 O;  2XAG A;  2GHY A;  2QDO A;  3K9A A;  5CB4 A;  3VQX A;  2EJ7 A;  2Y4U A;  4J10 A;  3FB7 C;  1I94 O;  5BZB A;  1DF4 A;  4JI2 B;  4DR5 B;  1N33 O;  4GX2 A;  4NYK A;  2Q69 A;  2E75 B;  4NR1 A;  1VMG A;  2W6J G;  5IJ9 B;  3ZHT A;  3SPG A;  4FZ0 A;  2DYS C;  2Z0A A;  1Q81 W;  4JI0 O;  5BXZ A;  4LFC B;  1VQ9 V;  4YIO A;  3B09 A;  1YI2 V;  1VQN V;  4JI4 B;  4FLT A;  1OZ0 A;  4U7N A;  3WB0 A;  1EM1 A;  3P3P A;  3R65 A;  1W0J G;  3UKM A;  2R9A A;  1N0J A;  2QWO B;  3JSN A;  4PJ0 Z;  1SQF A;  3ZRW A;  1HNX B;  5B1O A;  3B77 A;  2RNB A;  1IBK O;  4EKW A;  1HR0 B;  3K5L A;  4IHJ B;  4WCE V;  1TUB B;  3M7M X;  4HZ3 A;  1Z5V A;  2P4K A;  4O2A B;  5EBW C;  1AI5 A;  2WPD G;  5H6R A;  4UVA A;  3OGI B;  4PI2 A;  3RYI A;  1QHT A;  3ZHU A;  5H2F Z;  3A8T A;  2L35 A;  3T1Y O;  2V7Q G;  4OX9 B;  4HBN A;  2H94 A;  5LGT A;  2XUM A;  2N74 A;  4JAV A;  2X6C A;  1FFX A;  1VQO V;  2UXB B;  3HKD A;  3T1H B;  2EIL C;  3K03 A;  4GX0 A;  3K5N A;  2FL4 A;  3BHP A;  3Q4H B;  4JZG A;  2OIG A; 
#chains in the Genus database with same CATH homology
 3SYP A;  2Z3Y A;  3IFX A;  3OFN G;  3OE7 G;  2DQ0 A;  3OR6 C;  3SJQ C;  1YTF D;  2PI5 A;  1KEC A;  3K3W A;  1L1F A;  3ABT A;  1Y66 A;  5EC2 C;  3MHS C;  1SZT A;  3OEE G;  1MOF A;  1NR1 A;  1K8A W;  5DN6 G;  2ATK C;  3CXC U;  4H37 A;  3AG4 B;  1M90 W;  4GX5 A;  3E8F A;  4BAY A;  4MTO A;  2IH1 C;  1KP2 A;  2ZR2 A;  2WLL B;  1FXH A;  3K08 A;  1JOY A;  4X8A A;  5KUM A;  1VQ6 V;  1S76 D;  3LDD A;  3ASN B;  1VQL V;  2HG5 C;  1CPY A;  5IYB O;  3GWO A;  4WFH A;  1K4C C;  1WPX A;  2JDI G;  1JQ0 A;  3D36 A;  1COW G;  1H8H G;  1SRY A;  1YJ9 V;  4H33 A;  3W7S A;  3TET A;  5CA3 A;  2V1D A;  2W6I G;  2JJ2 G;  3VBB A;  2AHY A;  1SET A;  2EJR A;  3H01 A;  2P67 A;  4WFF A;  3AG3 C;  2WLI A;  4JF3 A;  1Q86 W;  5EK0 A;  3ZRX A;  1GTO A;  1YIJ V;  3DGE A;  3ZRV A;  2OCC C;  3E35 A;  1NJI W;  1IXM A;  3RW0 A;  3CD6 V;  3K0D A;  1I5X A;  4CBC A;  4YXW G;  1AJN A;  4P30 A;  5CBF A;  4RQF A;  5IYC O;  1M56 B;  1OCR C;  2Q6A A;  5LGU A;  3ZMV A;  1M1K W;  3ASN C;  2R9R B;  3CCR V;  5IY5 C;  1AJQ A;  2JK5 C;  1EFR G;  2QA4 V;  1OCC B;  4KUM A;  2QKS A;  2WLH A;  4LBE C;  4FJC C;  1NKD A;  3OR7 C;  3CC7 V;  1PNK A;  2ITD C;  1Q82 W;  4XBF A;  3AG2 C;  1DLB A;  4HAM A;  4PDM A;  3QO8 A;  4PDL A;  1V54 B;  4FMT A;  2XAF A;  2IJJ A;  1JVM A;  1S3J A;  3ASO B;  1V55 C;  1FXV A;  3JD2 A;  4Q20 A;  2QEX V;  1SES A;  4U7O A;  2KB1 A;  5L3D A;  1N8R W;  4PA7 A;  1FXK A;  1F4N A;  1AR1 B;  3B8N A;  2WAM A;  2DQ3 A;  2LFR A;  3W7W A;  3ZRW B;  4RAI A;  1AJP A;  3OGC C;  4J9Y B;  1MAB G;  3CCU V;  2JEU A;  5EC1 C;  1OCZ B;  4KP4 A;  1K73 W;  4UXN A;  3CC4 V;  2XAH A;  1QLE B;  4LCU C;  1GK9 A;  2ITC C;  1K33 A;  4JAU A;  4PA6 A;  1P7B A;  1P4R A;  4JTD B;  2ZXW C;  3QNE A;  4JYB A;  1RPO A;  4MTF A;  4JPR A;  4DXW A;  2R9I A;  2P6J A;  2X7R B;  3E8B A;  5B1N A;  1VQ5 V;  1NVP D;  2EIM B;  3E8G A;  4XDL A;  3LDE A;  4I5S A;  1PD3 A;  3QO7 A;  2WLN A;  5B3S B;  2Z5U A;  1SER A;  4MVZ A;  4MVO A;  2YEV A;  1YTF B;  3OMA B;  3FB6 C;  1E1R G;  3X2Q C;  1GO3 F;  2HR3 A;  1CEZ A;  3ZMZ A;  2ZR3 A;  3WG7 C;  1Q7Y W;  4QE7 A;  1M57 C;  5GW7 A;  3BY6 A;  3OAA G;  2P90 A;  2XOK G;  3W7T A;  2OT5 A;  2H8P C;  3EFF K;  3CCL V;  1H2G A;  4UV8 A;  2XAJ A;  5KA5 A;  3VOU A;  2HJF C;  3MD0 A;  3ZN0 A;  2IU3 A;  4N21 A;  3ETG A;  1FXK C;  1V54 C;  1QR8 A;  4P9O A;  3CYO A;  3TCU A;  1JPX A;  1W0K G;  4TWK A;  1QVG U;  2EIN C;  4BW5 A;  2OTL V;  3ZCC A;  1F51 A;  1PNM A;  4MSW C;  3M99 B;  3P30 A;  4I9W A;  4MVQ A;  3JD4 A;  1FS0 G;  5B1A C;  1WLE A;  5DM6 V;  2IU0 A;  3ZMS A;  1G8M A;  2IJK A;  1M56 C;  1V55 B;  2YSU B;  3ASO C;  3A0R A;  2LP7 A;  3OUS A;  4JTA B;  3AG4 C;  3AG1 C;  3AG1 B;  1UJW B;  1NQT A;  4LP8 A;  2FTK A;  4J9Z B;  3P32 A;  4R6Z A;  4PA3 A;  2QE7 G;  2DYS B;  2QTO A;  2Y69 B;  1AI4 A;  1NH2 B;  1QVF U;  1BMF G;  4FIP C;  3T2M A;  4PA4 A;  4R7C A;  1YSC A;  5EBL C;  5LHH A;  3G6E V;  2B1G A;  1K9M W;  4XDJ A;  4MVM A;  3STL C;  3E89 A;  2M7W A;  4WFE A;  2C2A A;  4FK5 C;  1F23 A;  3K04 A;  5LHG A;  2X0L A;  2Q67 A;  3SYC A;  3CCM V;  2IJH A;  1K4D C;  4MT8 A;  3SYA A;  3LDC A;  5L3F A;  1TUE B;  1PNL A;  1Y4M A;  1G4Y B;  1S72 V;  1M57 B;  3ML0 A;  1QLN A;  3ABK C;  5CMU A;  5CN0 A;  3ABL C;  4WFG A;  3DTU B;  1JX9 A;  3CCQ V;  4GT1 A;  2HFE C;  4UVB A;  1XL4 A;  3OMI B;  4QIW F;  4TT3 G;  4RUE A;  3STZ C;  4R8C A;  1YJN V;  1GM8 A;  3ABK B;  4GCZ A;  3ZRS A;  2IH3 C;  4E2L A;  1ORQ C;  2DYR C;  1H8E G;  1BHB A;  5H9C A;  3PJS K;  2BOC C;  3OW2 U;  1R6N A;  1H38 A;  2XAQ A;  3JCZ A;  1S0V A;  3ZJZ A;  4G2K A;  5L3G A;  2HLD G;  4JTC B;  2UXX A;  4QPK A;  4TSF G;  2Y48 A;  2ZDI A;  4ZKI A;  2WLI B;  4P9P A;  2HKO A;  4ASU G;  1KC8 W;  2X6B A;  5CBH A;  2NNU A;  1M9N A;  2B1I A;  3SPC A;  2EIK B;  2Y69 C;  4CZZ A;  2JJ1 G;  4KFM A;  1K34 A;  5HFM A;  3ZMU A;  1FFT B;  2XAS A;  4BIU A;  4JAS A;  3LNM B;  5L3E A;  3B8M A;  1PKX A;  3K79 A;  5KA6 A;  3FYI B;  1VQ7 V;  5H6Q A;  2WSS G;  2DW4 A;  3ETD A;  1OCZ C;  3F7Y C;  3HB3 B;  1S5H C;  4LC1 A;  3MHH C;  3SYQ A;  1KKD A;  1ZWI C;  3JD0 A;  3SPJ A;  1W2B U;  1QBZ A;  1ENV A;  3CPW U;  1QR9 A;  2CK3 G;  2W0F C;  5C93 A;  3CP1 A;  2EIN B;  4QPJ A;  5HFL A;  3SPH A;  4JGS A;  1YHQ V;  3CCE V;  1GM7 A;  3ABU A;  3NXS A;  2EZO A;  3X2Q B;  3FKS G;  3I55 V;  1R3K C;  1OCO C;  3I56 V;  4P2Z A;  3ZIA G;  2XND G;  2DWD C;  1KQS U;  2BOB C;  4WFA V;  3D3I A;  2A9H A;  3AEI A;  3K06 A;  3KG2 A;  3IGA C;  4GX1 A;  3T4Z A;  3ABL B;  2F43 G;  1R3I C;  5CBG A;  5LHI A;  3LUT B;  4MVS A;  5J9P C;  3SPI A;  5L3C A;  1NH2 D;  2AHZ A;  4QJF B;  1E79 G;  2NLJ C;  1AI7 A;  3F5W C;  1K5Q A;  4UV9 A;  4JYC A;  4N23 A;  2EIL B;  3UM7 A;  3K0G A;  3RBZ A;  3CME V;  2EIJ C;  5KUK A;  3OM3 B;  3LSS A;  1THZ A;  4MW8 A;  4BIZ A;  4WF9 V;  4R50 A;  3CC2 V;  1QLE C;  4MW3 A;  1R6K A;  3CCV V;  3ABM B;  1JJ2 U;  2OCC B;  2EZP A;  3FYE B;  3E8H A;  3ZN1 A;  4WFB V;  5L3B A;  1VQM V;  4RUF A;  3AG2 B;  5EBM C;  2DYR B;  3IC7 A;  2EBO A;  4UUJ C;  3EHB B;  1J95 A;  2QM7 A;  1ARO P;  1XL6 A;  1E1Q G;  4MS2 A;  4PDV A;  4G28 B;  2PI4 A;  1VQ8 V;  2YEV B;  2B5U A;  1KD1 W;  5IY5 B;  4Z1M G;  1JCH A;  4PEL A;  1CP9 A;  4F4L A;  1R73 A;  2Q68 A;  1RPR A;  1DF5 A;  1NVP B;  4MTG A;  1K97 A;  2OTJ V;  2X6A A;  1YIT V;  1BL8 A;  2WLL A;  5FL7 G;  2XAG A;  3FB8 C;  1R3J C;  1MSW D;  2ZDI C;  2GHY A;  4HYO A;  1GM9 A;  3ABM C;  2UXN A;  3AG3 B;  3K9A A;  2ZQM A;  2JEX A;  3LSQ A;  2WWW A;  1VQP V;  3FB7 C;  2IJI A;  3RVY A;  5BZB A;  2D3O W;  1DF4 A;  1DTO A;  1OCO B;  1S77 D;  4G27 B;  1GMG A;  1K7D A;  3T1C A;  4GX2 A;  2Q69 A;  2W6J G;  2EIK C;  1K3E A;  2HVK C;  4FPP A;  2HVJ C;  3SPG A;  5E1A C;  4XDK A;  3CCS V;  1PL0 A;  1OCC C;  3ETE A;  1RM1 B;  2DYS C;  1Q81 W;  1NBM G;  3JYC A;  3E2E A;  3FB5 C;  1VQ9 V;  2LFS A;  3WG7 B;  1YI2 V;  1VQN V;  2EIJ B;  3ZMT A;  1OZ0 A;  2MK3 A;  3G4S V;  3CCJ V;  2DWE C;  1ROP A;  4PA9 A;  1EZJ A;  4U7N A;  4MVU A;  2P7T C;  4ZBM A;  1HWY A;  3R65 A;  1W0J G;  3UKM A;  5LBQ A;  1GKF A;  5B3S C;  1RM1 C;  2QM8 A;  3WFV A;  3ZRW A;  1VQ4 V;  5B1O A;  1B6Q A;  3B77 A;  4QE9 A;  4MTX A;  1K5S A;  1MG1 A;  4RQE A;  1AI6 A;  1FXK B;  3GB7 C;  3OMN B;  4RO2 A;  4EKW A;  3HPL C;  4MVR A;  4WCE V;  4HZ3 A;  3SYO A;  1I5Y A;  3W7U A;  5IDJ A;  3TK1 A;  2IW5 A;  1KP3 A;  4X89 A;  1QCE A;  4X88 A;  5EBW C;  3BEH A;  5IYD O;  3F7V C;  4OXS A;  3CMA V;  1AI5 A;  4PDR A;  1LNQ A;  2K1E A;  2WPD G;  5LGN A;  3QO5 A;  5H6R A;  1BHA A;  3G71 V;  1F4M A;  3OUF A;  4UVA A;  1YJW V;  3OEH G;  1R3L C;  3E83 A;  2JIZ G;  3T4D A;  3JD3 A;  4QNH B;  2WLK A;  1NR7 A;  2WLJ A;  2ZD9 A;  2EIM C;  2WLM A;  2A0L A;  2V7Q G;  4L87 A;  1EBO A;  1K92 A;  2H94 A;  5LGT A;  3JD1 A;  2ZXW B;  4JAV A;  3RVZ A;  2X6C A;  5B1B B;  1VQO V;  2GSM B;  1OHH G;  1OCR B;  2EIL C;  3E86 A;  3K03 A;  4GX0 A;  4UVC A;  3W7X A;  1VQK V;  2A79 B;  4DO2 A;  5B1A B;  5B1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...