4PA4A

Structure of navms in complex with channel blocking compound
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa4A00
3F5WC 1R3LC 2X6CA 4PDLA 3E8BA 3WG7C 2H8PC 5BZBA 4MS2A 4R8CA 2X6AA 3LDCA 3AG4C 4P9PA 4P9OA 4GX5A 4MW3A 4PA7A 2WLHA 5B3SC 4MTGA 3SYOA 5EBMC 2IH1C 2ZD9A 3E8HA 4MVOA 4MVSA 4WFFA 2Q67A 3OGCC 4RUFA 4WFEA 3K06A 3RVZA 3SPJA 3UM7A 2YEVA 4JTAB 4LBEC 3E8FA 3ABMC 2HJFC 3R65A 1R3KC 1K4CC 2AHZA 2DYSC 3K0DA 3LDDA 4P30A 5EC1C 4J9ZB 1J95A 4WFGA 3E89A 4OXSA 3TCUA 3SPIA 2HG5C 2Q6AA 1LNQA 5KUKA 4GX1A 5KUMA 3AG1C 3SPGA 3JYCA 2ATKC 2WLKA 4XDLA 3SYAA 4PA4A 4CBCA 3KG2A 4R6ZA 1M56C 5CBHA 3LNMB 3OR7C 3UKMA 2BOCC 2P7TC 4ZBMA 2BOBC 3STLC 5IY5C 4RAIA 5EC2C 5B1BC 4MTOA 2Q68A 4XDKA 1XL6A 3ABKC 3K04A 4R50A 1S5HC 1XL4A 4LCUC 4BW5A 2WLLA 3HPLC 4PDMA 2QKSA 2OCCC 4HZ3A 4EKWA 2WLNA 4MVUA 2KB1A 5EK0A 4JTDB 2W0FC 4P2ZA 2DYRC 4MVQA 3SPCA 2JK5C 5E1AC 2WLIB 1ZWIC 2X6BA 4RO2A 1QLEC 2ZXWC 3VOUA 3SYPA 2A0LA 1K4DC 4J9YB 4MW8A 3T1CA 5CBGA 4MVMA 3SYQA 3GB7C 2NLJC 3OUFA 5EBLC 4X8AA 4H37A 4R7CA 4G28B 5EBWC 4KFMA 4PDVA 2DWDC 1V54C 2EIMC 3EFFK 3ABLC 4MSWC 4G27B 4RUEA 4GX0A 3FB6C 2EIKC 3RVYA 3K0GA 1M57C 3FB5C 3LUTB 4X89A 3ZJZA 4MVZA 1R3IC 2ITDC 4QNHB 1OCCC 2WLMA 2HVJC 2A79B 3F7YC 4GX2A 4PDRA 4XDJA 3T4DA 3TETA 3RW0A 4MTFA 3E8GA 4PA9A 4TWKA 4DXWA 3T2MA 2R9RB 2K1EA 1ORQC 1V55C 2WLLB 1R3JC 2EIJC 3E83A 3RBZA 3STZC 4HYOA 3ASNC 3E86A 4QE9A 4WFHA 2EILC 1OCRC 5CBFA 3AG3C 3OUSA 4JTCB 2IH3C 1OCZC 2DWEC 2QTOA 4LP8A 3X2QC 3K08A 5B1AC 3T4ZA 3IFXA 3FB8C 4PA6A 3BEHA 2A9HA 2Y69C 4PA3A 2HFEC 1G4YB 3F7VC 3IGAC 1P7BA 1BL8A 3FB7C 4MVRA 4F4LA 3ZRSA 2AHYA 3OR6C 2WLIA 4UUJC 2ITCC 1JVMA 2Q69A 3SJQC 4QE7A 3SPHA 5J9PC 3AG2C 3K03A 2EINC 3ASOC 3SYCA 4H33A 2WLJA 4X88A 1KKDA 1OCOC 3PJSK 4I9WA 2HVKC 3LDEA
chains in the Genus database with same CATH superfamily
2HR3A 1AI6A 1AJPA 3VQWA 1P4RA 2W6IG 3JD1A 5C8YA 4DV5B 2JIZG 3CRCA 5IYZB 1Q82W 4I4TB 3JCUZ 3RVZA 4UV9A 2YEVA 4LBEC 3E8FA 3SR2C 5KMGA 1VP7A 3CXHF 4JI4O 1YJNV 1KYOF 1JFFA 1R6TA 3AG1B 5GTHZ 3PN1A 1AJQA 3M99B 4RQFA 5LGNA 2IW5A 2B5UA 1W0JG 3LNMB 4AQYB 4FLUA 4YY3O 3CWBH 2QKSA 5L3CA 1YCIA 2YXLA 5LYJA 1AROP 4B7KA 5EZYB 2WLIB 1AI7A 4TSFG 4G28B 4BAYA 3U10A 4TV8B 4FLXA 1VF6C 2CTWA 1M93A 1F23A 4DUZO 2ZKOA 3E8GA 5L3BA 2BTQA 4DXWA 1M4UA 4D6TH 2QWOB 1NVPD 4X1IA 2EIJC 3RBZA 4LF9O 3BA9A 4IYIA 3ASNC 4WFHA 2QM7A 3L75H 4BIZA 3AG3B 1OHHG 5L3EA 1ZL8A 4TUYA 5KAFZ 1KMIZ 3P30A 4DR6B 3OR6C 5A9GA 2LGQA 5KHIA 2UUAB 1AILA 2JGDB 2WLJA 3M7MX 3PJSK 1G8MA 4JPRA 2WAMA 1VQLV 1RPRA 1ZTEA 1NH2D 4G2KA 1Q90D 1WP8A 4JAVA 1MNGA 4U3FH 2CDYA 4X20B 5B3SC 3RN4A 4GKJO 2P6JA 2IH1C 2Y0PA 4X62B 2XHBA 1TA8A 4JTAB 3ABMC 1SA0A 4FPPA 5LHIA 1K7DA 1G6UA 4EB6A 2YICA 1LNQA 3D8CA 5KHGA 1YXBA 5FLXN 3OEEG 2OCHA 2UUBO 1YTFB 1W0KG 3K04A 4BW5A 2N05A 1I94O 4O4JA 4JI1B 1TVKB 1KU9A 1ZWIC 2X6BA 2QEXV 3SYPA 3T1CA 4DV5O 5FNVA 4IL6Z 2DWDC 2G38A 2ODMA 4JAAA 4JI6B 1JJOA 1EZVH 3JALB 4MVZA 3RYFB 2ITDC 4RQEA 2D2CB 3S3WA 3TXQA 1EM1A 3LSUA 3HKBA 1URFA 4H0LB 3E83A 1HP8A 2PUSA 2F95B 4HYOA 4O2AB 4PV1B 4I4TA 5DM6V 4AQYO 3CSXA 1ROPA 2IH3C 3ETQA 4J41A 1XMOB 2DOSA 1GM8A 3IFXA 1Y67A 3OD4A 1SZTA 3BAAA 1NT2B 3OMIB 2ZIOA 1JR9A 4F4LA 4UV8A 5CA3A 3K9AA 1VQPV 5J2UB 1ZSPA 3WG7C 4CS4A 3ZHUA 5IJ0B 4TQDA 3MDSA 1RP3B 1S72V 1BT8A 5EBMC 4RUFA 5EZYA 4U7OA 3SPCA 1HNWB 1B06A 4Z1MG 1PKXA 1DF4A 2VS0A 3ZRVA 1Y66A 4O2BB 4ZKIA 2AW9A 2HJDA 3T1HB 1CXZB 1Q5OA 1MZEA 2Q7HA 4XBFA 4TV8A 3KG2A 1CPYA 1ZUQA 5KAIZ 4ICGA 2UUAO 3A0RA 5LP6C 2V7QG 2EJRA 4HZ3A 4ZI7A 2IM9A 4DW1A 4DR1B 3K58A 2BSKA 4DV3B 2YXYA 4RO2A 5JJNB 1SETA 2ZE8A 3VOUA 2QA4V 2R9IA 5DN6G 4NTYA 2JGDA 4C7UA 1SQVH 1FFTB 3EFFK 4AILC 3ZRXA 2KG7A 4GX0A 5B66Z 4X62O 3K0GA 4TT3G 3ZMVA 3FD9A 2JEXA 4FLZA 3U0ZA 3K5LA 4RWUA 2RN9A 4DV1B 4JI7B 5IT9N 5EIBC 2QGNA 4X20A 3O9OA 1XMQB 2GV9A 3P3PA 3X2QB 1Z2GA 4GZRB 3BEHA 5KLVH 4J10A 1FXHA 1P7BA 4YJ3A 1YTFD 4WFBV 1NI8A 3GVMA 4JI1O 1GO3F 3ASOC 1I0HA 2VQEB 1U97A 5GTIZ 1S76D 2HVKC 1H38A 2M7WA 1NBMG 2QJ1A 1Q7YW 2ZT9B 4TOIA 3CS5A 3D3IA 2W6JG 4JI6O 4P9PA 1XNQB 4ASUG 1KD1W 5JH7A 4DV0B 3VQXA 1AR5A 1TVKA 2HKOA 5LA6B 2RDCA 3LDDA 1O9HA 2B1IA 2RCVA 4J9ZB 1FJGB 4OXSA 3SPGA 1GAXA 2ZQMA 2WLKA 5B1OA 4B7EA 1XMOO 3JALA 4LF6B 3RYFA 1TAEA 4GLXA 2OIEA 3C3TA 1PNLA 1WAZA 4LF5B 1NQTA 2P90A 3ZS8C 5IE9A 1FXVA 4O2AA 4CH4A 1R73A 3JSNA 4FLVA 2CTPA 4UVBA 2ZXWC 5H6RA 1QNMA 3QO7A 4X8AA 4DK1A 2XAGA 1V54B 4LFAB 2EIKC 3RVYA 5J2UA 1UFIA 1HNWO 3OE7G 3L74H 2HVJC 1LR1A 2WLMA 3ABUA 1OCCB 1D2DA 5IJ0A 2FKXA 3T1HO 1TUBB 1M1KW 4QGPA 4JZ2A 2WLLB 1R3JC 3CX5F 2BE3A 5CBFA 2QTOA 1M90W 4PA6A 2Y69B 2ADQB 1OJHA 1R1BA 4MVRA 4O2BA 2XT9A 3IC9A 5F2VO 2CUGA 3H1HH 2V4DA 3FAVA 4DR1O 2PI5A 1ZLZA 3TGUH 4DV3O 5JCOA 2IU3A 2CK3G 1WPXA 4PDLA 1P7GA 4J7KA 2QWPB 1Y76B 2X6AA 2LP7A 4UB6Z 5KHJA 3BPZA 1HW7A 1CP9A 3E8HA 1KP3A 4MVOA 4MVSA 3CCQV 2DN9A 4WFEA 2X7RB 5JVDB 4DV1O 1GKFA 4CH3A 2A06H 2DYSC 3K0DA 4JI7O 1Y74B 4WFGA 2E74B 4O4LB 1XMQO 1K3EA 1FAFA 3LSSA 2L6LA 4J80A 3MAQA 2E76B 1WB8A 2AZ0A 2PZSA 4R6ZA 1AB3A 1L1FA 3CYOA 2ZE5A 3UKMA 1BQ0A 4DR5B 2P7TC 1YHQV 4D7TA 1AR1B 4GKKB 3VBBA 2VRZA 5IY5B 1F7YA 4WBNB 2IJIA 1S5HC 5LOVB 2VQEO 2OCCB 4MVUA 1ZL8B 4BR6A 4I9QA 1NVPB 1BQZA 4FLTA 1JA8A 1XNQO 1JJ2U 2A0LA 2GHYA 1YSCA 2JGUA 2YS8A 2EIMB 4DV0O 1YI2V 2EZPA 2HP8A 1GH6A 1M57C 5BXZA 3ZJZA 3JCZA 1SF9A 1QHTA 3SJAC 4GX2A 1FJGO 2H3OA 4DYLA 4KP4A 1PPJH 3FX7A 3SJCC 1SS3A 4LF6O 1B04A 3VQYA 1NH2B 1SA0B 1K34A 4UCVA 4LF8B 4LF5O 5LA6A 3FB8C 3NXSA 1RSOA 5LMUB 4K35A 3CCLV 3OM3B 2ITCC 1JVMA 4J7JA 5K1XA 3SJQC 1J5EB 3CRAA 3AG2B 2QKCA 4H33A 4DW0A 1OCOC 1XREA 1KQSU 2ETNA 5TISZ 1E79G 2Q7GA 3R66A 4UVAA 1HR0B 5KX5A 2LGWA 4UXNA 3B40A 4O4JB 2B9ZA 4LFAO 2ZD9A 1JPXA 4O4HA 5FNVB 3MD0A 1K8AW 3E89A 2Q6AA 4UCUA 4EEQA 5JQGB 2C2AA 1YDXA 4DR3B 2YUAA 2GTSA 2QM4A 4GUNA 3CRMA 4IT5A 2BOCC 3HKBB 1K5SA 2RMKB 1TUBA 5FPOA 2CE4A 3ABKB 5IDJA 2WLLA 2NR5A 3ZX6A 4UFZA 3UO3A 1WA8B 3ZMZA 4JAUA 3SGIA 4NVPA 2EIJB 3TJTA 4JF3A 1IZ3A 4J9YB 3WFVA 4MVMA 5LHHA 3THOA 4KFMA 1TGOA 4K0KB 2QWRB 1JQ0A 4YJ2B 3ABLC 4TV9A 3FB5C 3OFNG 3DGEA 1LUWA 3CCVV 2VQFB 2Q5ZA 1Q6UA 3T4DA 1N4CA 1Y76A 4W4LA 3IC7A 3T2MA 4WFAV 4PHZA 3WB2A 4DV7B 2EILC 3ZRWA 4DR5O 2DWEC 4DV4B 1BHAA 4IHJB 4GKKO 5JVDA 5B1AC 1E1QG 4YXWG 1I7FA 1Y74A 4O4LA 2PF4E 3A0HZ 2JRIA 4YIOA 3OAAG 3A8TA 3K03A 1N0JA 2DJVA 3EHBB 2EINB 1NTZH 1KKDA 3KZIZ 2A3QA 1N36B 1VF5B 1IXMA 4MS2A 4WBNA 1GTOA 3QF7A 4CC6A 4ZI7B 4DK0A 5LOVA 4GX5A 1NR7A 2BSKB 2ZCEA 3ZMUA 1EBOA 1VQ5V 2R70A 3ZCCA 1BZKA 1R3KC 3CEIA 1J95A 1N32B 2HG5C 2KG7B 4FLWA 3SJBC 2HHHB 3AG1C 1Z5WA 4UVCA 4LF8O 1BE3H 4KHPB 4FMTA 3OR7C 3CCJV 3RYIB 5LMUO 2R9AA 1JOYA 4LNUB 1XL6A 4R50A 1J5EO 2ZM6B 3CCUV 1NTKH 2GBOA 4EKWA 3L9DA 4CS3A 3MHSC 2JDIG 4YJ3B 4EFBA 1HR0O 4ZHQB 4JYAB 5HFMA 4PDVA 1PD3A 2RQ6A 2YC0A 1H2GA 4GT1A 4MT8A 3WB0A 3TETA 3RW0A 4PA9A 1GM7A 2W0XA 4X64B 1GN2A 4NKGB 3JD3A 1SQFA 5JH7B 1SC5B 3JAKB 3E86A 4DR3O 3WG7B 2EULA 3T1YB 3AG3C 2XAQA 1AJNA 3B09A 2YIAA 1F51A 3JATB 2ZR2A 1QR8A 1BS3A 4UCOA 4NB5A 4FIPC 1BL8A 3W7XA 3FYEB 2YIBD 4Q6GA 4FFKA 5JQGA 2YI8A 3JAWB 1I5XA 3SYCA 5LGUA 2DQ0A 3CCMV 4RUEA 3SYOA 4Q20A 2XAJA 4BWAA 4ZOLB 2H94A 5KHHA 4K0KO 2ZE6A 3ZHVA 3JARB 5IJ9B 2GDSA 4H13B 3S3XA 1WA8A 2VQFO 4WFFA 3UM7A 4FM0A 5ITZB 1H2LA 3D3QA 4Z2WA 4JI0B 5CB4B 3TCUA 2D3OW 1PNMA 4DV7O 5KUMA 2Q4PA 3APOA 4YJ2A 2PY5A 2XUMA 4DV4O 2QWQB 2AXTZ 2LFSA 1M56B 2BOBC 5D5PA 3AK2A 3DSQA 2PI4A 5B1BB 1UPGA 3JD2A 2CTQA 1RFYA 1FXKB 2UUCB 1N36O 3AK1A 3CCEV 4O4IB 1YIJV 3BA8A 4IHJA 1US6A 1IVSA 1NS1A 4MW8A 4WCEV 2NN4A 4CS2A 2Z0AA 2VWJA 3FAVB 5CA0B 2MK3A 2QKAA 4MSWC 4DR2B 1XNRB 2JVDA 1QVGU 3FB6C 3CRRA 3AG7A 1N32O 1NU1H 3ASOB 4TQFA 2HHHO 3W7WA 3E2EA 1ORQC 1DGSA 4KHPO 2RJZA 3ZN1A 4LWSB 3KKYA 2QR4A 4L8JA 3CHXA 1S3JA 2ZM6O 4NYKA 3IGAC 3QO5A 1MZFA 3APQA 2EX3A 4JI2B 1Y6XA 4F6RB 3L71H 1YJ9V 3FKSG 1FS0G 3JAMN 4XDJA 5IYCO 2Q7EA 1WPBA 2ZIMA 4JYAO 3F5WC 3RYIA 1Q6HA 1VQKV 1MSWD 4LNUA 1D5NA 1GRJA 3OT7A 1VQOV 4CC5A 2EZOA 2XAFA 3AK3A 3C90A 4E4EA 1QVFU 4KL1A 3ZEDA 3OGCC 1AR4A 1MG1A 3SPJA 3JSLA 4P30A 4ZHQA 4X64O 3WU2Z 2EJ7A 5H6QA 2ILMA 4GYCB 2GTAA 4B3RB 5KUKA 4GX1A 3T1YO 2P5OA 4D7SA 4UB8Z 2YIDA 5JCOC 4U7NA 4JI8B 3STLC 5IYBO 2Q73A 2OT5A 2Q68A 5LL6Y 3JAKA 3TXSA 3N2KB 1F4NA 3RGBA 2OTLV 4L87A 3K57A 3JATA 2OTJV 2F66C 2XNDG 3B2EE 4PI2A 2AZ2A 1RSOB 1XBLA 4NTXA 4PD4F 5CMUA 4I5SA 3QO8A 2LO1A 1WJZA 3K59A 3JAWA 1YZBA 4PJ0Z 1IX9A 1XQ8A 1R3IC 5KX5B 1YF2A 2FB5A 1YVWA 4ZOLA 4JI0O 4FJCC 3JARA 5IJ9A 2R9RB 2LW7A 3LSQA 1AP5A 4O4HB 4HNAA 2IBZH 1QU7A 5JJJB 1Q81W 3H1IH 3G4SV 3ZMSA 3X2QC 5L3GA 1COWG 1GN6A 5ITZA 4AHCA 5CB4A 1A32A 3ZHQA 2UUCO 4OX9B 2CTRA 3ZHTA 1Q43A 2Y4UA 3K5MA 4LF7B 4FM1A 4I55A 5EIBD 2JJ1G 4IIJB 3E22B 5BZBA 1S77D 2A7WA 1IBLB 2B1GA 3LDCA 1FXKA 4BIOA 3K9SA 3AG4B 4DR2O 1XNRO 2DQ3A 4X1KB 3OTFA 3ETGA 1VMGA 4E2LA 1PV0A 4K8ZA 4O4IA 2HEPA 2ARHA 3K06A 4ABMA 4X9QA 2DMXA 2HJFC 4HBNA 3G80A 4FZ1A 1JMKC 3SPIA 3KCXA 4TV9B 3BVOA 1DTOA 3TK1A 1P49A 5CA0A 3QTCA 2F43G 3CP1A 1XHXA 2LW1A 2M6YA 1THZA 5B5EZ 2QSAA 4JI2O 4LFBB 4KXRA 3ZRWB 2UXCB 4LWSA 4X65B 2DYRB 4DRXB 4X66B 4FK5C 5EYPB 1K4DC 3D36C 2ZINA 1VQ4V 3CE2A 5KA6A 4Z1VA 4F6RA 1K9MW 1KC8W 3G67A 1V54C 1S5JA 4G27B 1B6QA 2N74A 1H2KA 3P3NA 1VQNV 5HFLA 1GMGA 1MSDA 1OCCC 2A79B 1M5IA 4DUYB 4TWKA 4B3RO 5L3DA 1V9PA 1V55B 5BMVB 1OCRB 1RM1B 4JTCB 4JI8O 4LP8A 1OCZB 4J11A 2A9HA 2Y69C 1B3QA 2XOKG 2CGNA 3F7VC 3K5NA 2VWKA 4BIUA 2AHYA 4JI3B 1PL0A 1NR1A 1DK1A 1QR9A 3H1LH 3VQVA 3L73H 4W4KA 2BTOA 3G6BA 1QQCA 1GN4A 2NNUA 4P9OA 2K9PA 3QG5A 1YJWV 3N2KA 1I08A 2N04A 4LF4B 1FD9A 1SESA 2ZDIA 3R65A 2AHZA 1K4CC 1WLEA 3Q4HB 5LXTB 1Q86W 1Q6IA 5FL7G 2Y48A 1AI4A 2UXXA 3ABLB 5IY5C 4OX9O 1L8DA 1XHZA 1XL4A 2ADPA 2UXNA 2OCCC 2XTAA 1PP9H 1U96A 4LF7O 2W0FC 5J2TB 4P2ZA 4DR4B 1IBLO 1QLEC 2WA4A 3GB7C 3J80N 1R6NA 1VQMV 3W7TA 1M9NA 1XDCA 2EIMC 1KB9F 4I50B 1VQ8V 1CEZA 1BGYH 4IIJA 5IWAB 1N34B 3DXRB 3E22A 5LGTA 3C3SA 3CCRV 1HNZB 4DR7B 2DE0X 2E3CA 1H2NA 3LNNA 3H1KH 4JGSA 3B8NA 3HKDA 4X1KA 5BR8B 4QE9A 3ASNB 1HDJA 3ZHRA 1I5YA 4FZ0A 3OUSA 1VIBA 3BABA 3ETDA 2OWOA 4B08A 1FFXA 1G4YB 4IGGA 4LFBO 1H8EG 2UXCO 3B8MA 4DV2B 1P84F 1VF7A 2QDOA 2CAZC 3AG2C 4X65O 3DC5A 4X88A 1MA1A 4X66O 1VQ9V 3QNEA 1MMMA 4A5UB 1BSMA 3CMEV 4CH5A 5CN0A 5H9CA 1ENVA 4WF9V 1EN4A 2V1DA 1YEWA 1NJIW 3J81N 3G71V 3F5TA 4NXMB 4PA7A 5B3SB 1QBZA 5H2FZ 2PGGA 4DRXA 4DUYO 3N27A 5EYPA 4OPHA 5EC1C 3ABMB 3HKCB 2JJ2G 1SRYA 3JYCA 1ZAUA 3MHHC 2PYJA 1WN7A 1W2BU 1PM9A 4FM2A 4QPKA 4JI3O 4B3SB 3CCSV 3ABKC 1S0VA 3HB3B 3HKEA 5BMVA 3OMAB 2PTMA 1GM9A 3K5OA 3O65A 4LC1A 1SQBH 3ETEA 3KCYA 5CBGA 1Q3EA 3OUFA 2Y4TA 5EBWC 3ML0A 4LF4O 4NTWA 3W7UA 2IJHA 3LUTB 4AI8A 3CB2A 1K73W 2WSSG 1H2MA 4FFBB 2Q8VA 2Y0IA 4X1YB 4I0XB 4MTFA 4JYBA 1D5AA 1N8RW 3FYIB 3BRCA 3ZIAG 4FVMA 1VARA 3Q4HA 5LXTA 1MOFA 2AGAA 3RT3C 4QE7A 2F1MA 3I5DA 4MTXA 2EINC 5LMNB 4UCRA 4GCZA 4DR4O 1KP2A 3LDEA 4DV6B 5FPRA 1K92A 1R3LC 2H8PC 1W59A 1NTMH 1FKAO 4MW3A 1IURA 3OEHG 2OIGA 2P67A 5J2TA 3WB1A 5CA1A 1GN3A 5IWAO 3I55V 1N34O 1HNZO 2UU9B 1G1XB 4DR7O 4PI0A 5BR8O 1QCEA 3RYHB 1HNXB 1N0NA 4PELA 4I50A 5L3FA 2ATKC 2E5LB 3RYCB 4BW9A 2KQXA 4NR1A 2YIBA 1BHBA 1VF6A 3UO2A 3DXRA 4CZZA 5KHKA 4HNAB 1UJWB 4MTOA 4DV2O 2UXDB 4NXNB 5LP6B 3BHPA 3AEIA 2RNBA 2QWNB 2WLNA 5EK0A 1IDSA 3UQ8A 2XASA 5IYZA 5GONB 3E35A 1SERA 5IYDO 4NXMO 1K33A 1DF5A 4I55B 1Z5VA 2JS5A 2GUZB 1R6KA 2LFRA 1H2SB 4IYHA 1XILA 2FMLA 1E1RG 3G6EV 3RWRD 1AP6A 1FPOA 3OGIB 3N2GB 1XI1A 4LH7A 1HWYA 4B3SO 3IAYA 3OW2U 2GSMB 3K3WA 3HKCA 1WP7A 2WLIA 1XEQA 2Q69A 2YDEA 2ZR3A 3SPHA 2F4VB 1AVMA 4I9WA 3DC6A 4QJFB 1XUQA 3JASB 3E8BA 1PL4A 2FTKA 4R8CA 2KSDA 2Z5UA 3CC2V 4DR6O 3OTOB 1EN5A 4F6EA 1KBHA 4DO2A 5DEDA 4LH6A 4LR3A 5AG2A 3RFRA 2Q9LA 3CJHB 1KECA 1GK9A 4K3AA 4EFEA 2XAHA 3JD0A 4PA4A 1L0NH 1XOUA 1N33B 3B4SA 1M56C 2OYQA 4FFBA 1KUQA 4I0XA 4X1YA 4YHHB 5B1BC 4LFCB 2ZNIA 4U3JB 1FXKC 4LCUC 5LMNO 2QE7G 1S5LZ 4YIPA 4DV6O 4QIWF 4JTDB 3L70H 4OPAA 1BMFG 2FL4A 1SQGA 2YI9A 1EFRG 4MVQA 2JK5C 2QTSA 4K8XA 2ZXWB 2IJKA 3CXCU 4R7CA 5LBQA 3CC7V 1SQQH 2P22C 2UU9O 3HR0A 2JS3A 1TUEB 2EIKB 2Q0OC 1NZ6A 5D5QA 1HNXO 1Y4MA 2E5LO 1LUVA 1VEWA 3STZC 5C93A 3W7SA 3GWOA 3UT5B 3NR7A 5KA5A 1OZ0A 2EBOA 3K79A 4JASA 5E79Z 2UXDO 4KUMA 2CGOA 3RYHA 4NXNO 3FB7C 4HAMA 3RYCA 1KKCA 4JI5B 1F4MA 3UCSC 1K5QA 1VQ6V 2WA3A 2CH7B 1EN6A 5K1PA 5LP6A 1IBKB 1WNSA 3CD6V 1MABG 2LQTA 4B3MB 4MTGA 4N21A 2JEUA 3CPWU 4FLYA 5GONA 4UCSA 2DYSB 2YSUB 2P4VA 2P06A 2DW4A 4XDLA 3SYAA 5CBHA 2GUZA 1IBMB 2O57A 2R72A 3I56V 4ZBMA 2L35A 3HKDB 5EC2C 1JCHA 1EZJA 2BCCH 2F4VO 3HPLC 4B3TB 4PDMA 4JV5B 5C8YB 2LJ2A 2KB1A 1Q8IA 1FFXB 3N2GA 2UXBB 3ZMTA 4CH6A 2ZNJA 2ZDIC 2YEVB 4N23A 5KMGB 5EBLC 3OTOO 4OGQB 4H37A 1RPOA 4UCTA 1JFFB 2Q0AA 4X89A 1M57B 1SQPH 1NKDA 3QVNA 3JASA 1SZXA 4QNHB 1L0LH 2YXHA 3FFQA 3OMNB 3J7AU 3ZHSA 1IXBA 2PYLA 3H1JH 2K1EA 4JI4B 2ZE7A 1N33O 2Z3YA 1SKVA 5LYJB 1T5EA 4YHHO 4LFCO 1BCCH 5JJEB 1X4TA 2HFEC 3A0BZ 4YY3B 3CJHA 4UUJC 3B77A 5J9PC 1JX9A 1SQXH 3SDLA 3ZRSA 1OCOB 1X59A 2X6CA 3HKEB 1AI5A 5A2QN 4U3JA 2MW2B 2BTQB 3AG4C 5JWPA 4X1IB 3H9VA 2WLHA 3M8AA 2Q67A 2IJJA 4TUYB 1O9GA 2E75B 4DUZB 2FYUH 4QPJA 1QLEB 4LF9B 2F93B 1DLBA 4CBCA 1K97A 3H01A 5H5NA 1QLNA 2HLDG 3CC4V 2KKWA 3U11A 4I7ZB 3DTUB 4RAIA 4XDKA 4JYCA 5BY1A 3UT5A 2P4KA 4JI5O 1H8HG 3ZN0A 4JZGA 2WWWA 1YITV 1ZX3A 5B1NA 5LHGA 2DYRC 3EXAA 2IU0A 5E1AC 3ZBHA 1WB7A 5DECA 3BFRA 3SYQA 2NLJC 1IBKO 1VQ7V 4EB6B 4B3MO 3EVKA 3BY6A 4JYYA 3ABTA 3CMAV 2X0LA 1FYJA 4GKJB 3CRQA 4J42A 3GWKC 5GW7A 3F7YC 2CH7A 4PDRA 3ICXA 1V55C 5CA1B 2F23A 2WPDG 1OCRC 1RM1C 2EILB 3A2FA 3BCCH 1IBMO 1OCZC 3K08A 3T4ZA 1OV9A 5B1AB 3IJ4A 4PA3A 4H44B 4B3TO 4J7ZA 3JD4A 4ZIBA 4JV5O 3L72H 3P32A 2UUBB 1PNKA 3D36A 2UXBO 2QM8A 1I94B
chains in the Genus database with same CATH topology
2HR3A 2IU3A 2CK3G 3F5WC 1AI6A 1K92A 1R3LC 1WPXA 4PDLA 1VQKV 1MSWD 2H8PC 1AJPA 2X6AA 1P4RA 2W6IG 1VQOV 3JD1A 2EZOA 2LP7A 2JIZG 2XAFA 4MW3A 3OEHG 1Q82W 1QVFU 1CP9A 2P67A 1KP3A 3E8HA 4MVSA 4MVOA 3OGCC 3CCQV 3I55V 4WFEA 1MG1A 3RVZA 3SPJA 2X7RB 4UV9A 2YEVA 4LBEC 3E8FA 4P30A 1GKFA 2DYSC 3K0DA 5H6QA 1YJNV 4WFGA 1QCEA 5KUKA 4GX1A 1K3EA 3LSSA 4PELA 5L3FA 2ATKC 3AG1B 1AJQA 3M99B 4RQFA 5LGNA 2IW5A 4R6ZA 1BHBA 1L1FA 2B5UA 1W0JG 3CYOA 3LNMB 4U7NA 3UKMA 2P7TC 1YHQV 1AR1B 4CZZA 3STLC 5IYBO 3VBBA 5IY5B 2OT5A 4MTOA 2Q68A 1UJWB 2IJIA 1S5HC 2QKSA 3AEIA 2OCCB 2WLNA 4MVUA 5EK0A 5L3CA 1F4NA 2OTLV 4L87A 2XASA 2OTJV 1NVPB 1AROP 2XNDG 3E35A 2WLIB 5CMUA 4I5SA 1JJ2U 2A0LA 1AI7A 1SERA 2GHYA 3QO8A 4TSFG 5IYDO 1YSCA 4G28B 4BAYA 2EIMB 1K33A 1DF5A 2EZPA 1YI2V 1M57C 3ZJZA 3JCZA 1R3IC 4GX2A 1R6KA 2LFRA 4FJCC 1F23A 3E8GA 4KP4A 5L3BA 4DXWA 1E1RG 2R9RB 3LSQA 3G6EV 1NVPD 2EIJC 3RBZA 3ASNC 4WFHA 2QM7A 1Q81W 1NH2B 4BIZA 3G4SV 1K34A 3AG3B 3ZMSA 3X2QC 5L3GA 1OHHG 5L3EA 1COWG 1HWYA 3FB8C 3P30A 3NXSA 3OW2U 2GSMB 3K3WA 3OR6C 2WLIA 3CCLV 3OM3B 2ITCC 1JVMA 2Q69A 3SJQC 2ZR3A 3SPHA 3AG2B 4H33A 2WLJA 1OCOC 3PJSK 4I9WA 4QJFB 1G8MA 1KQSU 4JPRA 2JJ1G 3E8BA 2WAMA 1E79G 4UVAA 1RPRA 5BZBA 1VQLV 2FTKA 1S77D 4R8CA 1NH2D 2B1GA 4G2KA 3LDCA 1FXKA 2Z5UA 4UXNA 3AG4B 4JAVA 3CC2V 2DQ3A 3ETGA 5B3SC 4E2LA 2P6JA 2IH1C 1JPXA 2ZD9A 4DO2A 3K06A 4JTAB 3ABMC 2HJFC 4FPPA 5LHIA 3MD0A 1K8AW 1K7DA 3E89A 3SPIA 1LNQA 2Q6AA 1DTOA 3TK1A 1KECA 1GK9A 2C2AA 2XAHA 3JD0A 4PA4A 3OEEG 1M56C 2F43G 3CP1A 2BOCC 1K5SA 1THZA 5B1BC 1YTFB 1W0KG 3K04A 5IDJA 3ABKB 1FXKC 4LCUC 2WLLA 4BW5A 3ZRWB 2QE7G 4QIWF 4JTDB 1BMFG 3ZMZA 4JAUA 2DYRB 2EIJB 1EFRG 4MVQA 2JK5C 1ZWIC 2X6BA 4FK5C 4JF3A 2QEXV 3SYPA 1K4DC 2ZXWB 4J9YB 3T1CA 3WFVA 4MVMA 1VQ4V 2IJKA 5KA6A 5LHHA 4R7CA 3CXCU 5LBQA 4KFMA 3CC7V 1K9MW 2DWDC 1KC8W 1V54C 1JQ0A 3ABLC 4G27B 1B6QA 3FB5C 1TUEB 2EIKB 3DGEA 3OFNG 4MVZA 1VQNV 3CCVV 5HFLA 1GMGA 2ITDC 4RQEA 1OCCC 2A79B 3T4DA 4TWKA 5L3DA 1Y4MA 3IC7A 3T2MA 4WFAV 1V55B 3E83A 3STZC 5C93A 3GWOA 3W7SA 4HYOA 2EILC 5KA5A 1OZ0A 1OCRB 5DM6V 1RM1B 4JTCB 3ZRWA 1ROPA 2IH3C 2DWEC 4LP8A 2EBOA 1BHAA 1OCZB 3K79A 1GM8A 4JASA 5B1AC 3IFXA 1E1QG 2A9HA 2Y69C 4YXWG 1SZTA 2XOKG 4KUMA 3F7VC 3OMIB 3FB7C 4BIUA 4F4LA 2AHYA 1PL0A 1NR1A 3OAAG 4UV8A 4HAMA 1QR9A 3K03A 5CA3A 3EHBB 2EINB 1F4MA 1K5QA 1KKDA 3K9AA 1VQPV 1VQ6V 3WG7C 1IXMA 4MS2A 1GTOA 2NNUA 4P9OA 4GX5A 1NR7A 1YJWV 1S72V 3CD6V 1MABG 4MTGA 5EBMC 4N21A 4RUFA 3ZMUA 2JEUA 3CPWU 1EBOA 1VQ5V 1SESA 4U7OA 3ZCCA 3SPCA 2ZDIA 3R65A 1R3KC 1K4CC 1WLEA 2AHZA 4Z1MG 1PKXA 2DYSB 1DF4A 2YSUB 1J95A 3ZRVA 2DW4A 1Y66A 2HG5C 4ZKIA 3AG1C 1Q86W 4XDLA 5FL7G 3SYAA 4UVCA 4XBFA 3KG2A 4FMTA 2Y48A 1AI4A 5CBHA 3OR7C 3I56V 1CPYA 2UXXA 4ZBMA 3CCJV 3ABLB 5IY5C 1JOYA 5EC2C 1XL6A 4R50A 1JCHA 1EZJA 1XL4A 3A0RA 3CCUV 3HPLC 4PDMA 2UXNA 2V7QG 2OCCC 2EJRA 4HZ3A 4EKWA 2KB1A 2W0FC 4P2ZA 3ZMTA 3MHSC 2JDIG 2ZDIC 2YEVB 4N23A 4RO2A 1QLEC 1SETA 3VOUA 3GB7C 2QA4V 1R6NA 5EBLC 1VQMV 4H37A 1RPOA 2R9IA 5HFMA 5DN6G 4PDVA 1PD3A 3W7TA 1M9NA 2EIMC 1VQ8V 1H2GA 3EFFK 1FFTB 3ZRXA 1CEZA 4GX0A 3K0GA 4TT3G 4X89A 1M57B 4GT1A 1NKDA 3ZMVA 4MT8A 4QNHB 2JEXA 5LGTA 3CCRV 3TETA 3RW0A 3OMNB 4PA9A 1GM7A 2K1EA 4JGSA 3B8NA 3JD3A 3E86A 3WG7B 4QE9A 3ASNB 1I5YA 3AG3C 2Z3YA 2XAQA 3OUSA 1AJNA 1F51A 3X2QB 3ETDA 2ZR2A 1QR8A 3BEHA 2HFEC 1G4YB 1H8EG 4FIPC 1FXHA 1P7BA 1BL8A 3W7XA 3FYEB 1YTFD 3B8MA 4UUJC 3B77A 4WFBV 5J9PC 1JX9A 3AG2C 1GO3F 3ASOC 1I5XA 3SYCA 1S76D 4X88A 5LGUA 2DQ0A 3CCMV 4RUEA 3SYOA 3ZRSA 1OCOB 2HVKC 4Q20A 1H38A 1VQ9V 2M7WA 3QNEA 1NBMG 2XAJA 1Q7YW 2X6CA 3CMEV 1AI5A 2H94A 5CN0A 3D3IA 2W6JG 1ENVA 5H9CA 4WF9V 3AG4C 4P9PA 2V1DA 1NJIW 3G71V 4ASUG 4PA7A 2WLHA 5B3SB 1QBZA 1KD1W 4WFFA 2Q67A 2IJJA 3UM7A 2HKOA 5EC1C 3ABMB 3LDDA 2B1IA 4J9ZB 2JJ2G 4OXSA 3TCUA 2D3OW 1PNMA 1SRYA 4QPJA 5KUMA 3SPGA 3JYCA 2ZQMA 2WLKA 5B1OA 1QLEB 3MHHC 1DLBA 4CBCA 2LFSA 1K97A 3H01A 1QLNA 2HLDG 3CC4V 1M56B 1W2BU 2BOBC 1PNLA 4QPKA 3DTUB 4RAIA 1NQTA 2PI4A 3CCSV 4XDKA 3ABKC 5B1BB 2P90A 3JD2A 1S0VA 4JYCA 1FXKB 3HB3B 1FXVA 1H8HG 1R73A 3ZN0A 3OMAB 2WWWA 1YITV 1GM9A 5B1NA 3CCEV 5LHGA 1YIJV 4LC1A 2DYRC 2IU0A 5E1AC 3ETEA 4UVBA 2ZXWC 5CBGA 4MW8A 5H6RA 2PI5A 4WCEV 3QO7A 3OUFA 2NLJC 3SYQA 4X8AA 1VQ7V 5EBWC 3BY6A 3ML0A 2MK3A 2XAGA 1V54B 4MSWC 3W7UA 1QVGU 2IJHA 2EIKC 3ABTA 2X0LA 3FB6C 3LUTB 3RVYA 3CMAV 3OE7G 1K73W 2WSSG 2HVJC 2WLMA 3ABUA 3F7YC 5GW7A 1OCCB 4PDRA 3ASOB 4MTFA 4JYBA 1M1KW 3W7WA 3E2EA 1ORQC 1V55C 2WLLB 1R3JC 1N8RW 2WPDG 3FYIB 3ZN1A 1OCRC 1RM1C 2EILB 5CBFA 2QTOA 1OCZC 3ZIAG 3K08A 3T4ZA 1M90W 4PA6A 5B1AB 1S3JA 2Y69B 4PA3A 3IGAC 3JD4A 1MOFA 4MVRA 3P32A 3QO5A 4QE7A 4MTXA 1PNKA 3D36A 2EINC 1YJ9V 2QM8A 3FKSG 1FS0G 4GCZA 1KP2A 4XDJA 5IYCO 3LDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5W C;  1R3L C;  2X6C A;  4PDL A;  3E8B A;  3WG7 C;  2H8P C;  5BZB A;  4MS2 A;  4R8C A;  2X6A A;  3LDC A;  3AG4 C;  4P9P A;  4P9O A;  4GX5 A;  4MW3 A;  4PA7 A;  2WLH A;  5B3S C;  4MTG A;  3SYO A;  5EBM C;  2IH1 C;  2ZD9 A;  3E8H A;  4MVO A;  4MVS A;  4WFF A;  2Q67 A;  3OGC C;  4RUF A;  4WFE A;  3K06 A;  3RVZ A;  3SPJ A;  3UM7 A;  2YEV A;  4JTA B;  4LBE C;  3E8F A;  3ABM C;  2HJF C;  3R65 A;  1R3K C;  1K4C C;  2AHZ A;  2DYS C;  3K0D A;  3LDD A;  4P30 A;  5EC1 C;  4J9Z B;  1J95 A;  4WFG A;  3E89 A;  4OXS A;  3TCU A;  3SPI A;  2HG5 C;  2Q6A A;  1LNQ A;  5KUK A;  4GX1 A;  5KUM A;  3AG1 C;  3SPG A;  3JYC A;  2ATK C;  2WLK A;  4XDL A;  3SYA A;  4PA4 A;  4CBC A;  3KG2 A;  4R6Z A;  1M56 C;  5CBH A;  3LNM B;  3OR7 C;  3UKM A;  2BOC C;  2P7T C;  4ZBM A;  2BOB C;  3STL C;  5IY5 C;  4RAI A;  5EC2 C;  5B1B C;  4MTO A;  2Q68 A;  4XDK A;  1XL6 A;  3ABK C;  3K04 A;  4R50 A;  1S5H C;  1XL4 A;  4LCU C;  4BW5 A;  2WLL A;  3HPL C;  4PDM A;  2QKS A;  2OCC C;  4HZ3 A;  4EKW A;  2WLN A;  4MVU A;  2KB1 A;  5EK0 A;  4JTD B;  2W0F C;  4P2Z A;  2DYR C;  4MVQ A;  3SPC A;  2JK5 C;  5E1A C;  2WLI B;  1ZWI C;  2X6B A;  4RO2 A;  1QLE C;  2ZXW C;  3VOU A;  3SYP A;  2A0L A;  1K4D C;  4J9Y B;  4MW8 A;  3T1C A;  5CBG A;  4MVM A;  3SYQ A;  3GB7 C;  2NLJ C;  3OUF A;  5EBL C;  4X8A A;  4H37 A;  4R7C A;  4G28 B;  5EBW C;  4KFM A;  4PDV A;  2DWD C;  1V54 C;  2EIM C;  3EFF K;  3ABL C;  4MSW C;  4G27 B;  4RUE A;  4GX0 A;  3FB6 C;  2EIK C;  3RVY A;  3K0G A;  1M57 C;  3FB5 C;  3LUT B;  4X89 A;  3ZJZ A;  4MVZ A;  1R3I C;  2ITD C;  4QNH B;  1OCC C;  2WLM A;  2HVJ C;  2A79 B;  3F7Y C;  4GX2 A;  4PDR A;  4XDJ A;  3T4D A;  3TET A;  3RW0 A;  4MTF A;  3E8G A;  4PA9 A;  4TWK A;  4DXW A;  3T2M A;  2R9R B;  2K1E A;  1ORQ C;  1V55 C;  2WLL B;  1R3J C;  2EIJ C;  3E83 A;  3RBZ A;  3STZ C;  4HYO A;  3ASN C;  3E86 A;  4QE9 A;  4WFH A;  2EIL C;  1OCR C;  5CBF A;  3AG3 C;  3OUS A;  4JTC B;  2IH3 C;  1OCZ C;  2DWE C;  2QTO A;  4LP8 A;  3X2Q C;  3K08 A;  5B1A C;  3T4Z A;  3IFX A;  3FB8 C;  4PA6 A;  3BEH A;  2A9H A;  2Y69 C;  4PA3 A;  2HFE C;  1G4Y B;  3F7V C;  3IGA C;  1P7B A;  1BL8 A;  3FB7 C;  4MVR A;  4F4L A;  3ZRS A;  2AHY A;  3OR6 C;  2WLI A;  4UUJ C;  2ITC C;  1JVM A;  2Q69 A;  3SJQ C;  4QE7 A;  3SPH A;  5J9P C;  3AG2 C;  3K03 A;  2EIN C;  3ASO C;  3SYC A;  4H33 A;  2WLJ A;  4X88 A;  1KKD A;  1OCO C;  3PJS K;  4I9W A;  2HVK C;  3LDE A; 
#chains in the Genus database with same CATH topology
 2HR3 A;  1AI6 A;  1AJP A;  3VQW A;  1P4R A;  2W6I G;  3JD1 A;  5C8Y A;  4DV5 B;  2JIZ G;  3CRC A;  5IYZ B;  1Q82 W;  4I4T B;  3JCU Z;  3RVZ A;  4UV9 A;  2YEV A;  4LBE C;  3E8F A;  3SR2 C;  5KMG A;  1VP7 A;  3CXH F;  4JI4 O;  1YJN V;  1KYO F;  1JFF A;  1R6T A;  3AG1 B;  5GTH Z;  3PN1 A;  1AJQ A;  3M99 B;  4RQF A;  5LGN A;  2IW5 A;  2B5U A;  1W0J G;  3LNM B;  4AQY B;  4FLU A;  4YY3 O;  3CWB H;  2QKS A;  5L3C A;  1YCI A;  2YXL A;  5LYJ A;  1ARO P;  4B7K A;  5EZY B;  2WLI B;  1AI7 A;  4TSF G;  4G28 B;  4BAY A;  3U10 A;  4TV8 B;  4FLX A;  1VF6 C;  2CTW A;  1M93 A;  1F23 A;  4DUZ O;  2ZKO A;  3E8G A;  5L3B A;  2BTQ A;  4DXW A;  1M4U A;  4D6T H;  2QWO B;  1NVP D;  4X1I A;  2EIJ C;  3RBZ A;  4LF9 O;  3BA9 A;  4IYI A;  3ASN C;  4WFH A;  2QM7 A;  3L75 H;  4BIZ A;  3AG3 B;  1OHH G;  5L3E A;  1ZL8 A;  4TUY A;  5KAF Z;  1KMI Z;  3P30 A;  4DR6 B;  3OR6 C;  5A9G A;  2LGQ A;  5KHI A;  2UUA B;  1AIL A;  2JGD B;  2WLJ A;  3M7M X;  3PJS K;  1G8M A;  4JPR A;  2WAM A;  1VQL V;  1RPR A;  1ZTE A;  1NH2 D;  4G2K A;  1Q90 D;  1WP8 A;  4JAV A;  1MNG A;  4U3F H;  2CDY A;  4X20 B;  5B3S C;  3RN4 A;  4GKJ O;  2P6J A;  2IH1 C;  2Y0P A;  4X62 B;  2XHB A;  1TA8 A;  4JTA B;  3ABM C;  1SA0 A;  4FPP A;  5LHI A;  1K7D A;  1G6U A;  4EB6 A;  2YIC A;  1LNQ A;  3D8C A;  5KHG A;  1YXB A;  5FLX N;  3OEE G;  2OCH A;  2UUB O;  1YTF B;  1W0K G;  3K04 A;  4BW5 A;  2N05 A;  1I94 O;  4O4J A;  4JI1 B;  1TVK B;  1KU9 A;  1ZWI C;  2X6B A;  2QEX V;  3SYP A;  3T1C A;  4DV5 O;  5FNV A;  4IL6 Z;  2DWD C;  2G38 A;  2ODM A;  4JAA A;  4JI6 B;  1JJO A;  1EZV H;  3JAL B;  4MVZ A;  3RYF B;  2ITD C;  4RQE A;  2D2C B;  3S3W A;  3TXQ A;  1EM1 A;  3LSU A;  3HKB A;  1URF A;  4H0L B;  3E83 A;  1HP8 A;  2PUS A;  2F95 B;  4HYO A;  4O2A B;  4PV1 B;  4I4T A;  5DM6 V;  4AQY O;  3CSX A;  1ROP A;  2IH3 C;  3ETQ A;  4J41 A;  1XMO B;  2DOS A;  1GM8 A;  3IFX A;  1Y67 A;  3OD4 A;  1SZT A;  3BAA A;  1NT2 B;  3OMI B;  2ZIO A;  1JR9 A;  4F4L A;  4UV8 A;  5CA3 A;  3K9A A;  1VQP V;  5J2U B;  1ZSP A;  3WG7 C;  4CS4 A;  3ZHU A;  5IJ0 B;  4TQD A;  3MDS A;  1RP3 B;  1S72 V;  1BT8 A;  5EBM C;  4RUF A;  5EZY A;  4U7O A;  3SPC A;  1HNW B;  1B06 A;  4Z1M G;  1PKX A;  1DF4 A;  2VS0 A;  3ZRV A;  1Y66 A;  4O2B B;  4ZKI A;  2AW9 A;  2HJD A;  3T1H B;  1CXZ B;  1Q5O A;  1MZE A;  2Q7H A;  4XBF A;  4TV8 A;  3KG2 A;  1CPY A;  1ZUQ A;  5KAI Z;  4ICG A;  2UUA O;  3A0R A;  5LP6 C;  2V7Q G;  2EJR A;  4HZ3 A;  4ZI7 A;  2IM9 A;  4DW1 A;  4DR1 B;  3K58 A;  2BSK A;  4DV3 B;  2YXY A;  4RO2 A;  5JJN B;  1SET A;  2ZE8 A;  3VOU A;  2QA4 V;  2R9I A;  5DN6 G;  4NTY A;  2JGD A;  4C7U A;  1SQV H;  1FFT B;  3EFF K;  4AIL C;  3ZRX A;  2KG7 A;  4GX0 A;  5B66 Z;  4X62 O;  3K0G A;  4TT3 G;  3ZMV A;  3FD9 A;  2JEX A;  4FLZ A;  3U0Z A;  3K5L A;  4RWU A;  2RN9 A;  4DV1 B;  4JI7 B;  5IT9 N;  5EIB C;  2QGN A;  4X20 A;  3O9O A;  1XMQ B;  2GV9 A;  3P3P A;  3X2Q B;  1Z2G A;  4GZR B;  3BEH A;  5KLV H;  4J10 A;  1FXH A;  1P7B A;  4YJ3 A;  1YTF D;  4WFB V;  1NI8 A;  3GVM A;  4JI1 O;  1GO3 F;  3ASO C;  1I0H A;  2VQE B;  1U97 A;  5GTI Z;  1S76 D;  2HVK C;  1H38 A;  2M7W A;  1NBM G;  2QJ1 A;  1Q7Y W;  2ZT9 B;  4TOI A;  3CS5 A;  3D3I A;  2W6J G;  4JI6 O;  4P9P A;  1XNQ B;  4ASU G;  1KD1 W;  5JH7 A;  4DV0 B;  3VQX A;  1AR5 A;  1TVK A;  2HKO A;  5LA6 B;  2RDC A;  3LDD A;  1O9H A;  2B1I A;  2RCV A;  4J9Z B;  1FJG B;  4OXS A;  3SPG A;  1GAX A;  2ZQM A;  2WLK A;  5B1O A;  4B7E A;  1XMO O;  3JAL A;  4LF6 B;  3RYF A;  1TAE A;  4GLX A;  2OIE A;  3C3T A;  1PNL A;  1WAZ A;  4LF5 B;  1NQT A;  2P90 A;  3ZS8 C;  5IE9 A;  1FXV A;  4O2A A;  4CH4 A;  1R73 A;  3JSN A;  4FLV A;  2CTP A;  4UVB A;  2ZXW C;  5H6R A;  1QNM A;  3QO7 A;  4X8A A;  4DK1 A;  2XAG A;  1V54 B;  4LFA B;  2EIK C;  3RVY A;  5J2U A;  1UFI A;  1HNW O;  3OE7 G;  3L74 H;  2HVJ C;  1LR1 A;  2WLM A;  3ABU A;  1OCC B;  1D2D A;  5IJ0 A;  2FKX A;  3T1H O;  1TUB B;  1M1K W;  4QGP A;  4JZ2 A;  2WLL B;  1R3J C;  3CX5 F;  2BE3 A;  5CBF A;  2QTO A;  1M90 W;  4PA6 A;  2Y69 B;  2ADQ B;  1OJH A;  1R1B A;  4MVR A;  4O2B A;  2XT9 A;  3IC9 A;  5F2V O;  2CUG A;  3H1H H;  2V4D A;  3FAV A;  4DR1 O;  2PI5 A;  1ZLZ A;  3TGU H;  4DV3 O;  5JCO A;  2IU3 A;  2CK3 G;  1WPX A;  4PDL A;  1P7G A;  4J7K A;  2QWP B;  1Y76 B;  2X6A A;  2LP7 A;  4UB6 Z;  5KHJ A;  3BPZ A;  1HW7 A;  1CP9 A;  3E8H A;  1KP3 A;  4MVO A;  4MVS A;  3CCQ V;  2DN9 A;  4WFE A;  2X7R B;  5JVD B;  4DV1 O;  1GKF A;  4CH3 A;  2A06 H;  2DYS C;  3K0D A;  4JI7 O;  1Y74 B;  4WFG A;  2E74 B;  4O4L B;  1XMQ O;  1K3E A;  1FAF A;  3LSS A;  2L6L A;  4J80 A;  3MAQ A;  2E76 B;  1WB8 A;  2AZ0 A;  2PZS A;  4R6Z A;  1AB3 A;  1L1F A;  3CYO A;  2ZE5 A;  3UKM A;  1BQ0 A;  4DR5 B;  2P7T C;  1YHQ V;  4D7T A;  1AR1 B;  4GKK B;  3VBB A;  2VRZ A;  5IY5 B;  1F7Y A;  4WBN B;  2IJI A;  1S5H C;  5LOV B;  2VQE O;  2OCC B;  4MVU A;  1ZL8 B;  4BR6 A;  4I9Q A;  1NVP B;  1BQZ A;  4FLT A;  1JA8 A;  1XNQ O;  1JJ2 U;  2A0L A;  2GHY A;  1YSC A;  2JGU A;  2YS8 A;  2EIM B;  4DV0 O;  1YI2 V;  2EZP A;  2HP8 A;  1GH6 A;  1M57 C;  5BXZ A;  3ZJZ A;  3JCZ A;  1SF9 A;  1QHT A;  3SJA C;  4GX2 A;  1FJG O;  2H3O A;  4DYL A;  4KP4 A;  1PPJ H;  3FX7 A;  3SJC C;  1SS3 A;  4LF6 O;  1B04 A;  3VQY A;  1NH2 B;  1SA0 B;  1K34 A;  4UCV A;  4LF8 B;  4LF5 O;  5LA6 A;  3FB8 C;  3NXS A;  1RSO A;  5LMU B;  4K35 A;  3CCL V;  3OM3 B;  2ITC C;  1JVM A;  4J7J A;  5K1X A;  3SJQ C;  1J5E B;  3CRA A;  3AG2 B;  2QKC A;  4H33 A;  4DW0 A;  1OCO C;  1XRE A;  1KQS U;  2ETN A;  5TIS Z;  1E79 G;  2Q7G A;  3R66 A;  4UVA A;  1HR0 B;  5KX5 A;  2LGW A;  4UXN A;  3B40 A;  4O4J B;  2B9Z A;  4LFA O;  2ZD9 A;  1JPX A;  4O4H A;  5FNV B;  3MD0 A;  1K8A W;  3E89 A;  2Q6A A;  4UCU A;  4EEQ A;  5JQG B;  2C2A A;  1YDX A;  4DR3 B;  2YUA A;  2GTS A;  2QM4 A;  4GUN A;  3CRM A;  4IT5 A;  2BOC C;  3HKB B;  1K5S A;  2RMK B;  1TUB A;  5FPO A;  2CE4 A;  3ABK B;  5IDJ A;  2WLL A;  2NR5 A;  3ZX6 A;  4UFZ A;  3UO3 A;  1WA8 B;  3ZMZ A;  4JAU A;  3SGI A;  4NVP A;  2EIJ B;  3TJT A;  4JF3 A;  1IZ3 A;  4J9Y B;  3WFV A;  4MVM A;  5LHH A;  3THO A;  4KFM A;  1TGO A;  4K0K B;  2QWR B;  1JQ0 A;  4YJ2 B;  3ABL C;  4TV9 A;  3FB5 C;  3OFN G;  3DGE A;  1LUW A;  3CCV V;  2VQF B;  2Q5Z A;  1Q6U A;  3T4D A;  1N4C A;  1Y76 A;  4W4L A;  3IC7 A;  3T2M A;  4WFA V;  4PHZ A;  3WB2 A;  4DV7 B;  2EIL C;  3ZRW A;  4DR5 O;  2DWE C;  4DV4 B;  1BHA A;  4IHJ B;  4GKK O;  5JVD A;  5B1A C;  1E1Q G;  4YXW G;  1I7F A;  1Y74 A;  4O4L A;  2PF4 E;  3A0H Z;  2JRI A;  4YIO A;  3OAA G;  3A8T A;  3K03 A;  1N0J A;  2DJV A;  3EHB B;  2EIN B;  1NTZ H;  1KKD A;  3KZI Z;  2A3Q A;  1N36 B;  1VF5 B;  1IXM A;  4MS2 A;  4WBN A;  1GTO A;  3QF7 A;  4CC6 A;  4ZI7 B;  4DK0 A;  5LOV A;  4GX5 A;  1NR7 A;  2BSK B;  2ZCE A;  3ZMU A;  1EBO A;  1VQ5 V;  2R70 A;  3ZCC A;  1BZK A;  1R3K C;  3CEI A;  1J95 A;  1N32 B;  2HG5 C;  2KG7 B;  4FLW A;  3SJB C;  2HHH B;  3AG1 C;  1Z5W A;  4UVC A;  4LF8 O;  1BE3 H;  4KHP B;  4FMT A;  3OR7 C;  3CCJ V;  3RYI B;  5LMU O;  2R9A A;  1JOY A;  4LNU B;  1XL6 A;  4R50 A;  1J5E O;  2ZM6 B;  3CCU V;  1NTK H;  2GBO A;  4EKW A;  3L9D A;  4CS3 A;  3MHS C;  2JDI G;  4YJ3 B;  4EFB A;  1HR0 O;  4ZHQ B;  4JYA B;  5HFM A;  4PDV A;  1PD3 A;  2RQ6 A;  2YC0 A;  1H2G A;  4GT1 A;  4MT8 A;  3WB0 A;  3TET A;  3RW0 A;  4PA9 A;  1GM7 A;  2W0X A;  4X64 B;  1GN2 A;  4NKG B;  3JD3 A;  1SQF A;  5JH7 B;  1SC5 B;  3JAK B;  3E86 A;  4DR3 O;  3WG7 B;  2EUL A;  3T1Y B;  3AG3 C;  2XAQ A;  1AJN A;  3B09 A;  2YIA A;  1F51 A;  3JAT B;  2ZR2 A;  1QR8 A;  1BS3 A;  4UCO A;  4NB5 A;  4FIP C;  1BL8 A;  3W7X A;  3FYE B;  2YIB D;  4Q6G A;  4FFK A;  5JQG A;  2YI8 A;  3JAW B;  1I5X A;  3SYC A;  5LGU A;  2DQ0 A;  3CCM V;  4RUE A;  3SYO A;  4Q20 A;  2XAJ A;  4BWA A;  4ZOL B;  2H94 A;  5KHH A;  4K0K O;  2ZE6 A;  3ZHV A;  3JAR B;  5IJ9 B;  2GDS A;  4H13 B;  3S3X A;  1WA8 A;  2VQF O;  4WFF A;  3UM7 A;  4FM0 A;  5ITZ B;  1H2L A;  3D3Q A;  4Z2W A;  4JI0 B;  5CB4 B;  3TCU A;  2D3O W;  1PNM A;  4DV7 O;  5KUM A;  2Q4P A;  3APO A;  4YJ2 A;  2PY5 A;  2XUM A;  4DV4 O;  2QWQ B;  2AXT Z;  2LFS A;  1M56 B;  2BOB C;  5D5P A;  3AK2 A;  3DSQ A;  2PI4 A;  5B1B B;  1UPG A;  3JD2 A;  2CTQ A;  1RFY A;  1FXK B;  2UUC B;  1N36 O;  3AK1 A;  3CCE V;  4O4I B;  1YIJ V;  3BA8 A;  4IHJ A;  1US6 A;  1IVS A;  1NS1 A;  4MW8 A;  4WCE V;  2NN4 A;  4CS2 A;  2Z0A A;  2VWJ A;  3FAV B;  5CA0 B;  2MK3 A;  2QKA A;  4MSW C;  4DR2 B;  1XNR B;  2JVD A;  1QVG U;  3FB6 C;  3CRR A;  3AG7 A;  1N32 O;  1NU1 H;  3ASO B;  4TQF A;  2HHH O;  3W7W A;  3E2E A;  1ORQ C;  1DGS A;  4KHP O;  2RJZ A;  3ZN1 A;  4LWS B;  3KKY A;  2QR4 A;  4L8J A;  3CHX A;  1S3J A;  2ZM6 O;  4NYK A;  3IGA C;  3QO5 A;  1MZF A;  3APQ A;  2EX3 A;  4JI2 B;  1Y6X A;  4F6R B;  3L71 H;  1YJ9 V;  3FKS G;  1FS0 G;  3JAM N;  4XDJ A;  5IYC O;  2Q7E A;  1WPB A;  2ZIM A;  4JYA O;  3F5W C;  3RYI A;  1Q6H A;  1VQK V;  1MSW D;  4LNU A;  1D5N A;  1GRJ A;  3OT7 A;  1VQO V;  4CC5 A;  2EZO A;  2XAF A;  3AK3 A;  3C90 A;  4E4E A;  1QVF U;  4KL1 A;  3ZED A;  3OGC C;  1AR4 A;  1MG1 A;  3SPJ A;  3JSL A;  4P30 A;  4ZHQ A;  4X64 O;  3WU2 Z;  2EJ7 A;  5H6Q A;  2ILM A;  4GYC B;  2GTA A;  4B3R B;  5KUK A;  4GX1 A;  3T1Y O;  2P5O A;  4D7S A;  4UB8 Z;  2YID A;  5JCO C;  4U7N A;  4JI8 B;  3STL C;  5IYB O;  2Q73 A;  2OT5 A;  2Q68 A;  5LL6 Y;  3JAK A;  3TXS A;  3N2K B;  1F4N A;  3RGB A;  2OTL V;  4L87 A;  3K57 A;  3JAT A;  2OTJ V;  2F66 C;  2XND G;  3B2E E;  4PI2 A;  2AZ2 A;  1RSO B;  1XBL A;  4NTX A;  4PD4 F;  5CMU A;  4I5S A;  3QO8 A;  2LO1 A;  1WJZ A;  3K59 A;  3JAW A;  1YZB A;  4PJ0 Z;  1IX9 A;  1XQ8 A;  1R3I C;  5KX5 B;  1YF2 A;  2FB5 A;  1YVW A;  4ZOL A;  4JI0 O;  4FJC C;  3JAR A;  5IJ9 A;  2R9R B;  2LW7 A;  3LSQ A;  1AP5 A;  4O4H B;  4HNA A;  2IBZ H;  1QU7 A;  5JJJ B;  1Q81 W;  3H1I H;  3G4S V;  3ZMS A;  3X2Q C;  5L3G A;  1COW G;  1GN6 A;  5ITZ A;  4AHC A;  5CB4 A;  1A32 A;  3ZHQ A;  2UUC O;  4OX9 B;  2CTR A;  3ZHT A;  1Q43 A;  2Y4U A;  3K5M A;  4LF7 B;  4FM1 A;  4I55 A;  5EIB D;  2JJ1 G;  4IIJ B;  3E22 B;  5BZB A;  1S77 D;  2A7W A;  1IBL B;  2B1G A;  3LDC A;  1FXK A;  4BIO A;  3K9S A;  3AG4 B;  4DR2 O;  1XNR O;  2DQ3 A;  4X1K B;  3OTF A;  3ETG A;  1VMG A;  4E2L A;  1PV0 A;  4K8Z A;  4O4I A;  2HEP A;  2ARH A;  3K06 A;  4ABM A;  4X9Q A;  2DMX A;  2HJF C;  4HBN A;  3G80 A;  4FZ1 A;  1JMK C;  3SPI A;  3KCX A;  4TV9 B;  3BVO A;  1DTO A;  3TK1 A;  1P49 A;  5CA0 A;  3QTC A;  2F43 G;  3CP1 A;  1XHX A;  2LW1 A;  2M6Y A;  1THZ A;  5B5E Z;  2QSA A;  4JI2 O;  4LFB B;  4KXR A;  3ZRW B;  2UXC B;  4LWS A;  4X65 B;  2DYR B;  4DRX B;  4X66 B;  4FK5 C;  5EYP B;  1K4D C;  3D36 C;  2ZIN A;  1VQ4 V;  3CE2 A;  5KA6 A;  4Z1V A;  4F6R A;  1K9M W;  1KC8 W;  3G67 A;  1V54 C;  1S5J A;  4G27 B;  1B6Q A;  2N74 A;  1H2K A;  3P3N A;  1VQN V;  5HFL A;  1GMG A;  1MSD A;  1OCC C;  2A79 B;  1M5I A;  4DUY B;  4TWK A;  4B3R O;  5L3D A;  1V9P A;  1V55 B;  5BMV B;  1OCR B;  1RM1 B;  4JTC B;  4JI8 O;  4LP8 A;  1OCZ B;  4J11 A;  2A9H A;  2Y69 C;  1B3Q A;  2XOK G;  2CGN A;  3F7V C;  3K5N A;  2VWK A;  4BIU A;  2AHY A;  4JI3 B;  1PL0 A;  1NR1 A;  1DK1 A;  1QR9 A;  3H1L H;  3VQV A;  3L73 H;  4W4K A;  2BTO A;  3G6B A;  1QQC A;  1GN4 A;  2NNU A;  4P9O A;  2K9P A;  3QG5 A;  1YJW V;  3N2K A;  1I08 A;  2N04 A;  4LF4 B;  1FD9 A;  1SES A;  2ZDI A;  3R65 A;  2AHZ A;  1K4C C;  1WLE A;  3Q4H B;  5LXT B;  1Q86 W;  1Q6I A;  5FL7 G;  2Y48 A;  1AI4 A;  2UXX A;  3ABL B;  5IY5 C;  4OX9 O;  1L8D A;  1XHZ A;  1XL4 A;  2ADP A;  2UXN A;  2OCC C;  2XTA A;  1PP9 H;  1U96 A;  4LF7 O;  2W0F C;  5J2T B;  4P2Z A;  4DR4 B;  1IBL O;  1QLE C;  2WA4 A;  3GB7 C;  3J80 N;  1R6N A;  1VQM V;  3W7T A;  1M9N A;  1XDC A;  2EIM C;  1KB9 F;  4I50 B;  1VQ8 V;  1CEZ A;  1BGY H;  4IIJ A;  5IWA B;  1N34 B;  3DXR B;  3E22 A;  5LGT A;  3C3S A;  3CCR V;  1HNZ B;  4DR7 B;  2DE0 X;  2E3C A;  1H2N A;  3LNN A;  3H1K H;  4JGS A;  3B8N A;  3HKD A;  4X1K A;  5BR8 B;  4QE9 A;  3ASN B;  1HDJ A;  3ZHR A;  1I5Y A;  4FZ0 A;  3OUS A;  1VIB A;  3BAB A;  3ETD A;  2OWO A;  4B08 A;  1FFX A;  1G4Y B;  4IGG A;  4LFB O;  1H8E G;  2UXC O;  3B8M A;  4DV2 B;  1P84 F;  1VF7 A;  2QDO A;  2CAZ C;  3AG2 C;  4X65 O;  3DC5 A;  4X88 A;  1MA1 A;  4X66 O;  1VQ9 V;  3QNE A;  1MMM A;  4A5U B;  1BSM A;  3CME V;  4CH5 A;  5CN0 A;  5H9C A;  1ENV A;  4WF9 V;  1EN4 A;  2V1D A;  1YEW A;  1NJI W;  3J81 N;  3G71 V;  3F5T A;  4NXM B;  4PA7 A;  5B3S B;  1QBZ A;  5H2F Z;  2PGG A;  4DRX A;  4DUY O;  3N27 A;  5EYP A;  4OPH A;  5EC1 C;  3ABM B;  3HKC B;  2JJ2 G;  1SRY A;  3JYC A;  1ZAU A;  3MHH C;  2PYJ A;  1WN7 A;  1W2B U;  1PM9 A;  4FM2 A;  4QPK A;  4JI3 O;  4B3S B;  3CCS V;  3ABK C;  1S0V A;  3HB3 B;  3HKE A;  5BMV A;  3OMA B;  2PTM A;  1GM9 A;  3K5O A;  3O65 A;  4LC1 A;  1SQB H;  3ETE A;  3KCY A;  5CBG A;  1Q3E A;  3OUF A;  2Y4T A;  5EBW C;  3ML0 A;  4LF4 O;  4NTW A;  3W7U A;  2IJH A;  3LUT B;  4AI8 A;  3CB2 A;  1K73 W;  2WSS G;  1H2M A;  4FFB B;  2Q8V A;  2Y0I A;  4X1Y B;  4I0X B;  4MTF A;  4JYB A;  1D5A A;  1N8R W;  3FYI B;  3BRC A;  3ZIA G;  4FVM A;  1VAR A;  3Q4H A;  5LXT A;  1MOF A;  2AGA A;  3RT3 C;  4QE7 A;  2F1M A;  3I5D A;  4MTX A;  2EIN C;  5LMN B;  4UCR A;  4GCZ A;  4DR4 O;  1KP2 A;  3LDE A;  4DV6 B;  5FPR A;  1K92 A;  1R3L C;  2H8P C;  1W59 A;  1NTM H;  1FKA O;  4MW3 A;  1IUR A;  3OEH G;  2OIG A;  2P67 A;  5J2T A;  3WB1 A;  5CA1 A;  1GN3 A;  5IWA O;  3I55 V;  1N34 O;  1HNZ O;  2UU9 B;  1G1X B;  4DR7 O;  4PI0 A;  5BR8 O;  1QCE A;  3RYH B;  1HNX B;  1N0N A;  4PEL A;  4I50 A;  5L3F A;  2ATK C;  2E5L B;  3RYC B;  4BW9 A;  2KQX A;  4NR1 A;  2YIB A;  1BHB A;  1VF6 A;  3UO2 A;  3DXR A;  4CZZ A;  5KHK A;  4HNA B;  1UJW B;  4MTO A;  4DV2 O;  2UXD B;  4NXN B;  5LP6 B;  3BHP A;  3AEI A;  2RNB A;  2QWN B;  2WLN A;  5EK0 A;  1IDS A;  3UQ8 A;  2XAS A;  5IYZ A;  5GON B;  3E35 A;  1SER A;  5IYD O;  4NXM O;  1K33 A;  1DF5 A;  4I55 B;  1Z5V A;  2JS5 A;  2GUZ B;  1R6K A;  2LFR A;  1H2S B;  4IYH A;  1XIL A;  2FML A;  1E1R G;  3G6E V;  3RWR D;  1AP6 A;  1FPO A;  3OGI B;  3N2G B;  1XI1 A;  4LH7 A;  1HWY A;  4B3S O;  3IAY A;  3OW2 U;  2GSM B;  3K3W A;  3HKC A;  1WP7 A;  2WLI A;  1XEQ A;  2Q69 A;  2YDE A;  2ZR3 A;  3SPH A;  2F4V B;  1AVM A;  4I9W A;  3DC6 A;  4QJF B;  1XUQ A;  3JAS B;  3E8B A;  1PL4 A;  2FTK A;  4R8C A;  2KSD A;  2Z5U A;  3CC2 V;  4DR6 O;  3OTO B;  1EN5 A;  4F6E A;  1KBH A;  4DO2 A;  5DED A;  4LH6 A;  4LR3 A;  5AG2 A;  3RFR A;  2Q9L A;  3CJH B;  1KEC A;  1GK9 A;  4K3A A;  4EFE A;  2XAH A;  3JD0 A;  4PA4 A;  1L0N H;  1XOU A;  1N33 B;  3B4S A;  1M56 C;  2OYQ A;  4FFB A;  1KUQ A;  4I0X A;  4X1Y A;  4YHH B;  5B1B C;  4LFC B;  2ZNI A;  4U3J B;  1FXK C;  4LCU C;  5LMN O;  2QE7 G;  1S5L Z;  4YIP A;  4DV6 O;  4QIW F;  4JTD B;  3L70 H;  4OPA A;  1BMF G;  2FL4 A;  1SQG A;  2YI9 A;  1EFR G;  4MVQ A;  2JK5 C;  2QTS A;  4K8X A;  2ZXW B;  2IJK A;  3CXC U;  4R7C A;  5LBQ A;  3CC7 V;  1SQQ H;  2P22 C;  2UU9 O;  3HR0 A;  2JS3 A;  1TUE B;  2EIK B;  2Q0O C;  1NZ6 A;  5D5Q A;  1HNX O;  1Y4M A;  2E5L O;  1LUV A;  1VEW A;  3STZ C;  5C93 A;  3W7S A;  3GWO A;  3UT5 B;  3NR7 A;  5KA5 A;  1OZ0 A;  2EBO A;  3K79 A;  4JAS A;  5E79 Z;  2UXD O;  4KUM A;  2CGO A;  3RYH A;  4NXN O;  3FB7 C;  4HAM A;  3RYC A;  1KKC A;  4JI5 B;  1F4M A;  3UCS C;  1K5Q A;  1VQ6 V;  2WA3 A;  2CH7 B;  1EN6 A;  5K1P A;  5LP6 A;  1IBK B;  1WNS A;  3CD6 V;  1MAB G;  2LQT A;  4B3M B;  4MTG A;  4N21 A;  2JEU A;  3CPW U;  4FLY A;  5GON A;  4UCS A;  2DYS B;  2YSU B;  2P4V A;  2P06 A;  2DW4 A;  4XDL A;  3SYA A;  5CBH A;  2GUZ A;  1IBM B;  2O57 A;  2R72 A;  3I56 V;  4ZBM A;  2L35 A;  3HKD B;  5EC2 C;  1JCH A;  1EZJ A;  2BCC H;  2F4V O;  3HPL C;  4B3T B;  4PDM A;  4JV5 B;  5C8Y B;  2LJ2 A;  2KB1 A;  1Q8I A;  1FFX B;  3N2G A;  2UXB B;  3ZMT A;  4CH6 A;  2ZNJ A;  2ZDI C;  2YEV B;  4N23 A;  5KMG B;  5EBL C;  3OTO O;  4OGQ B;  4H37 A;  1RPO A;  4UCT A;  1JFF B;  2Q0A A;  4X89 A;  1M57 B;  1SQP H;  1NKD A;  3QVN A;  3JAS A;  1SZX A;  4QNH B;  1L0L H;  2YXH A;  3FFQ A;  3OMN B;  3J7A U;  3ZHS A;  1IXB A;  2PYL A;  3H1J H;  2K1E A;  4JI4 B;  2ZE7 A;  1N33 O;  2Z3Y A;  1SKV A;  5LYJ B;  1T5E A;  4YHH O;  4LFC O;  1BCC H;  5JJE B;  1X4T A;  2HFE C;  3A0B Z;  4YY3 B;  3CJH A;  4UUJ C;  3B77 A;  5J9P C;  1JX9 A;  1SQX H;  3SDL A;  3ZRS A;  1OCO B;  1X59 A;  2X6C A;  3HKE B;  1AI5 A;  5A2Q N;  4U3J A;  2MW2 B;  2BTQ B;  3AG4 C;  5JWP A;  4X1I B;  3H9V A;  2WLH A;  3M8A A;  2Q67 A;  2IJJ A;  4TUY B;  1O9G A;  2E75 B;  4DUZ B;  2FYU H;  4QPJ A;  1QLE B;  4LF9 B;  2F93 B;  1DLB A;  4CBC A;  1K97 A;  3H01 A;  5H5N A;  1QLN A;  2HLD G;  3CC4 V;  2KKW A;  3U11 A;  4I7Z B;  3DTU B;  4RAI A;  4XDK A;  4JYC A;  5BY1 A;  3UT5 A;  2P4K A;  4JI5 O;  1H8H G;  3ZN0 A;  4JZG A;  2WWW A;  1YIT V;  1ZX3 A;  5B1N A;  5LHG A;  2DYR C;  3EXA A;  2IU0 A;  5E1A C;  3ZBH A;  1WB7 A;  5DEC A;  3BFR A;  3SYQ A;  2NLJ C;  1IBK O;  1VQ7 V;  4EB6 B;  4B3M O;  3EVK A;  3BY6 A;  4JYY A;  3ABT A;  3CMA V;  2X0L A;  1FYJ A;  4GKJ B;  3CRQ A;  4J42 A;  3GWK C;  5GW7 A;  3F7Y C;  2CH7 A;  4PDR A;  3ICX A;  1V55 C;  5CA1 B;  2F23 A;  2WPD G;  1OCR C;  1RM1 C;  2EIL B;  3A2F A;  3BCC H;  1IBM O;  1OCZ C;  3K08 A;  3T4Z A;  1OV9 A;  5B1A B;  3IJ4 A;  4PA3 A;  4H44 B;  4B3T O;  4J7Z A;  3JD4 A;  4ZIB A;  4JV5 O;  3L72 H;  3P32 A;  2UUB B;  1PNK A;  3D36 A;  2UXB O;  2QM8 A;  1I94 B; 
#chains in the Genus database with same CATH homology
 2HR3 A;  2IU3 A;  2CK3 G;  3F5W C;  1AI6 A;  1K92 A;  1R3L C;  1WPX A;  4PDL A;  1VQK V;  1MSW D;  2H8P C;  1AJP A;  2X6A A;  1P4R A;  2W6I G;  1VQO V;  3JD1 A;  2EZO A;  2LP7 A;  2JIZ G;  2XAF A;  4MW3 A;  3OEH G;  1Q82 W;  1QVF U;  1CP9 A;  2P67 A;  1KP3 A;  3E8H A;  4MVS A;  4MVO A;  3OGC C;  3CCQ V;  3I55 V;  4WFE A;  1MG1 A;  3RVZ A;  3SPJ A;  2X7R B;  4UV9 A;  2YEV A;  4LBE C;  3E8F A;  4P30 A;  1GKF A;  2DYS C;  3K0D A;  5H6Q A;  1YJN V;  4WFG A;  1QCE A;  5KUK A;  4GX1 A;  1K3E A;  3LSS A;  4PEL A;  5L3F A;  2ATK C;  3AG1 B;  1AJQ A;  3M99 B;  4RQF A;  5LGN A;  2IW5 A;  4R6Z A;  1BHB A;  1L1F A;  2B5U A;  1W0J G;  3CYO A;  3LNM B;  4U7N A;  3UKM A;  2P7T C;  1YHQ V;  1AR1 B;  4CZZ A;  3STL C;  5IYB O;  3VBB A;  5IY5 B;  2OT5 A;  4MTO A;  2Q68 A;  1UJW B;  2IJI A;  1S5H C;  2QKS A;  3AEI A;  2OCC B;  2WLN A;  4MVU A;  5EK0 A;  5L3C A;  1F4N A;  2OTL V;  4L87 A;  2XAS A;  2OTJ V;  1NVP B;  1ARO P;  2XND G;  3E35 A;  2WLI B;  5CMU A;  4I5S A;  1JJ2 U;  2A0L A;  1AI7 A;  1SER A;  2GHY A;  3QO8 A;  4TSF G;  5IYD O;  1YSC A;  4G28 B;  4BAY A;  2EIM B;  1K33 A;  1DF5 A;  2EZP A;  1YI2 V;  1M57 C;  3ZJZ A;  3JCZ A;  1R3I C;  4GX2 A;  1R6K A;  2LFR A;  4FJC C;  1F23 A;  3E8G A;  4KP4 A;  5L3B A;  4DXW A;  1E1R G;  2R9R B;  3LSQ A;  3G6E V;  1NVP D;  2EIJ C;  3RBZ A;  3ASN C;  4WFH A;  2QM7 A;  1Q81 W;  1NH2 B;  4BIZ A;  3G4S V;  1K34 A;  3AG3 B;  3ZMS A;  3X2Q C;  5L3G A;  1OHH G;  5L3E A;  1COW G;  1HWY A;  3FB8 C;  3P30 A;  3NXS A;  3OW2 U;  2GSM B;  3K3W A;  3OR6 C;  2WLI A;  3CCL V;  3OM3 B;  2ITC C;  1JVM A;  2Q69 A;  3SJQ C;  2ZR3 A;  3SPH A;  3AG2 B;  4H33 A;  2WLJ A;  1OCO C;  3PJS K;  4I9W A;  4QJF B;  1G8M A;  1KQS U;  4JPR A;  2JJ1 G;  3E8B A;  2WAM A;  1E79 G;  4UVA A;  1RPR A;  5BZB A;  1VQL V;  2FTK A;  1S77 D;  4R8C A;  1NH2 D;  2B1G A;  4G2K A;  3LDC A;  1FXK A;  2Z5U A;  4UXN A;  3AG4 B;  4JAV A;  3CC2 V;  2DQ3 A;  3ETG A;  5B3S C;  4E2L A;  2P6J A;  2IH1 C;  1JPX A;  2ZD9 A;  4DO2 A;  3K06 A;  4JTA B;  3ABM C;  2HJF C;  4FPP A;  5LHI A;  3MD0 A;  1K8A W;  1K7D A;  3E89 A;  3SPI A;  1LNQ A;  2Q6A A;  1DTO A;  3TK1 A;  1KEC A;  1GK9 A;  2C2A A;  2XAH A;  3JD0 A;  4PA4 A;  3OEE G;  1M56 C;  2F43 G;  3CP1 A;  2BOC C;  1K5S A;  1THZ A;  5B1B C;  1YTF B;  1W0K G;  3K04 A;  5IDJ A;  3ABK B;  1FXK C;  4LCU C;  2WLL A;  4BW5 A;  3ZRW B;  2QE7 G;  4QIW F;  4JTD B;  1BMF G;  3ZMZ A;  4JAU A;  2DYR B;  2EIJ B;  1EFR G;  4MVQ A;  2JK5 C;  1ZWI C;  2X6B A;  4FK5 C;  4JF3 A;  2QEX V;  3SYP A;  1K4D C;  2ZXW B;  4J9Y B;  3T1C A;  3WFV A;  4MVM A;  1VQ4 V;  2IJK A;  5KA6 A;  5LHH A;  4R7C A;  3CXC U;  5LBQ A;  4KFM A;  3CC7 V;  1K9M W;  2DWD C;  1KC8 W;  1V54 C;  1JQ0 A;  3ABL C;  4G27 B;  1B6Q A;  3FB5 C;  1TUE B;  2EIK B;  3DGE A;  3OFN G;  4MVZ A;  1VQN V;  3CCV V;  5HFL A;  1GMG A;  2ITD C;  4RQE A;  1OCC C;  2A79 B;  3T4D A;  4TWK A;  5L3D A;  1Y4M A;  3IC7 A;  3T2M A;  4WFA V;  1V55 B;  3E83 A;  3STZ C;  5C93 A;  3GWO A;  3W7S A;  4HYO A;  2EIL C;  5KA5 A;  1OZ0 A;  1OCR B;  5DM6 V;  1RM1 B;  4JTC B;  3ZRW A;  1ROP A;  2IH3 C;  2DWE C;  4LP8 A;  2EBO A;  1BHA A;  1OCZ B;  3K79 A;  1GM8 A;  4JAS A;  5B1A C;  3IFX A;  1E1Q G;  2A9H A;  2Y69 C;  4YXW G;  1SZT A;  2XOK G;  4KUM A;  3F7V C;  3OMI B;  3FB7 C;  4BIU A;  4F4L A;  2AHY A;  1PL0 A;  1NR1 A;  3OAA G;  4UV8 A;  4HAM A;  1QR9 A;  3K03 A;  5CA3 A;  3EHB B;  2EIN B;  1F4M A;  1K5Q A;  1KKD A;  3K9A A;  1VQP V;  1VQ6 V;  3WG7 C;  1IXM A;  4MS2 A;  1GTO A;  2NNU A;  4P9O A;  4GX5 A;  1NR7 A;  1YJW V;  1S72 V;  3CD6 V;  1MAB G;  4MTG A;  5EBM C;  4N21 A;  4RUF A;  3ZMU A;  2JEU A;  3CPW U;  1EBO A;  1VQ5 V;  1SES A;  4U7O A;  3ZCC A;  3SPC A;  2ZDI A;  3R65 A;  1R3K C;  1K4C C;  1WLE A;  2AHZ A;  4Z1M G;  1PKX A;  2DYS B;  1DF4 A;  2YSU B;  1J95 A;  3ZRV A;  2DW4 A;  1Y66 A;  2HG5 C;  4ZKI A;  3AG1 C;  1Q86 W;  4XDL A;  5FL7 G;  3SYA A;  4UVC A;  4XBF A;  3KG2 A;  4FMT A;  2Y48 A;  1AI4 A;  5CBH A;  3OR7 C;  3I56 V;  1CPY A;  2UXX A;  4ZBM A;  3CCJ V;  3ABL B;  5IY5 C;  1JOY A;  5EC2 C;  1XL6 A;  4R50 A;  1JCH A;  1EZJ A;  1XL4 A;  3A0R A;  3CCU V;  3HPL C;  4PDM A;  2UXN A;  2V7Q G;  2OCC C;  2EJR A;  4HZ3 A;  4EKW A;  2KB1 A;  2W0F C;  4P2Z A;  3ZMT A;  3MHS C;  2JDI G;  2ZDI C;  2YEV B;  4N23 A;  4RO2 A;  1QLE C;  1SET A;  3VOU A;  3GB7 C;  2QA4 V;  1R6N A;  5EBL C;  1VQM V;  4H37 A;  1RPO A;  2R9I A;  5HFM A;  5DN6 G;  4PDV A;  1PD3 A;  3W7T A;  1M9N A;  2EIM C;  1VQ8 V;  1H2G A;  3EFF K;  1FFT B;  3ZRX A;  1CEZ A;  4GX0 A;  3K0G A;  4TT3 G;  4X89 A;  1M57 B;  4GT1 A;  1NKD A;  3ZMV A;  4MT8 A;  4QNH B;  2JEX A;  5LGT A;  3CCR V;  3TET A;  3RW0 A;  3OMN B;  4PA9 A;  1GM7 A;  2K1E A;  4JGS A;  3B8N A;  3JD3 A;  3E86 A;  3WG7 B;  4QE9 A;  3ASN B;  1I5Y A;  3AG3 C;  2Z3Y A;  2XAQ A;  3OUS A;  1AJN A;  1F51 A;  3X2Q B;  3ETD A;  2ZR2 A;  1QR8 A;  3BEH A;  2HFE C;  1G4Y B;  1H8E G;  4FIP C;  1FXH A;  1P7B A;  1BL8 A;  3W7X A;  3FYE B;  1YTF D;  3B8M A;  4UUJ C;  3B77 A;  4WFB V;  5J9P C;  1JX9 A;  3AG2 C;  1GO3 F;  3ASO C;  1I5X A;  3SYC A;  1S76 D;  4X88 A;  5LGU A;  2DQ0 A;  3CCM V;  4RUE A;  3SYO A;  3ZRS A;  1OCO B;  2HVK C;  4Q20 A;  1H38 A;  1VQ9 V;  2M7W A;  3QNE A;  1NBM G;  2XAJ A;  1Q7Y W;  2X6C A;  3CME V;  1AI5 A;  2H94 A;  5CN0 A;  3D3I A;  2W6J G;  1ENV A;  5H9C A;  4WF9 V;  3AG4 C;  4P9P A;  2V1D A;  1NJI W;  3G71 V;  4ASU G;  4PA7 A;  2WLH A;  5B3S B;  1QBZ A;  1KD1 W;  4WFF A;  2Q67 A;  2IJJ A;  3UM7 A;  2HKO A;  5EC1 C;  3ABM B;  3LDD A;  2B1I A;  4J9Z B;  2JJ2 G;  4OXS A;  3TCU A;  2D3O W;  1PNM A;  1SRY A;  4QPJ A;  5KUM A;  3SPG A;  3JYC A;  2ZQM A;  2WLK A;  5B1O A;  1QLE B;  3MHH C;  1DLB A;  4CBC A;  2LFS A;  1K97 A;  3H01 A;  1QLN A;  2HLD G;  3CC4 V;  1M56 B;  1W2B U;  2BOB C;  1PNL A;  4QPK A;  3DTU B;  4RAI A;  1NQT A;  2PI4 A;  3CCS V;  4XDK A;  3ABK C;  5B1B B;  2P90 A;  3JD2 A;  1S0V A;  4JYC A;  1FXK B;  3HB3 B;  1FXV A;  1H8H G;  1R73 A;  3ZN0 A;  3OMA B;  2WWW A;  1YIT V;  1GM9 A;  5B1N A;  3CCE V;  5LHG A;  1YIJ V;  4LC1 A;  2DYR C;  2IU0 A;  5E1A C;  3ETE A;  4UVB A;  2ZXW C;  5CBG A;  4MW8 A;  5H6R A;  2PI5 A;  4WCE V;  3QO7 A;  3OUF A;  2NLJ C;  3SYQ A;  4X8A A;  1VQ7 V;  5EBW C;  3BY6 A;  3ML0 A;  2MK3 A;  2XAG A;  1V54 B;  4MSW C;  3W7U A;  1QVG U;  2IJH A;  2EIK C;  3ABT A;  2X0L A;  3FB6 C;  3LUT B;  3RVY A;  3CMA V;  3OE7 G;  1K73 W;  2WSS G;  2HVJ C;  2WLM A;  3ABU A;  3F7Y C;  5GW7 A;  1OCC B;  4PDR A;  3ASO B;  4MTF A;  4JYB A;  1M1K W;  3W7W A;  3E2E A;  1ORQ C;  1V55 C;  2WLL B;  1R3J C;  1N8R W;  2WPD G;  3FYI B;  3ZN1 A;  1OCR C;  1RM1 C;  2EIL B;  5CBF A;  2QTO A;  1OCZ C;  3ZIA G;  3K08 A;  3T4Z A;  1M90 W;  4PA6 A;  5B1A B;  1S3J A;  2Y69 B;  4PA3 A;  3IGA C;  3JD4 A;  1MOF A;  4MVR A;  3P32 A;  3QO5 A;  4QE7 A;  4MTX A;  1PNK A;  3D36 A;  2EIN C;  1YJ9 V;  2QM8 A;  3FKS G;  1FS0 G;  4GCZ A;  1KP2 A;  4XDJ A;  5IYC O;  3LDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...