4PA4A

Structure of navms in complex with channel blocking compound
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa4A00
2DWDC 3E8HA 4PDLA 4P9PA 3RBZA 3ZRSA 3LDDA 4MVQA 4PA3A 2DWEC 3UKMA 3ZJZA 2EIMC 3WG7C 3SYPA 4LP8A 4MVRA 2WLMA 4KFMA 4LBEC 4P9OA 4OXSA 3STLC 1G4YB 1R3KC 2BOCC 3AG1C 3RVZA 3ABLC 4P2ZA 2HG5C 4CBCA 3SYOA 4MVZA 4MSWC 3E89A 3FB8C 5EC1C 3LUTB 4MS2A 2ITCC 3SYCA 2ZD9A 4MVUA 4X8AA 1K4DC 2AHZA 3LNMB 4R50A 4QE9A 2DYSC 3E8BA 5CBHA 1ORQC 3ASNC 2EILC 3FB7C 3IGAC 4GX2A 4F4LA 4XDKA 2HVJC 5E1AC 3T4DA 3OUSA 2EIJC 4HYOA 1R3IC 3K0DA 4P30A 4XDJA 1V54C 3F7VC 4HZ3A 1J95A 5B1BC 4JTCB 4PDRA 3X2QC 2Q68A 1V55C 2Q6AA 4WFGA 4EKWA 1S5HC 2K1EA 4RUEA 3E8GA 3SPGA 4X89A 3IFXA 2BOBC 2R9RB 2WLKA 2WLLA 2WLLB 2HFEC 3K08A 4PA7A 4PDMA 1KKDA 1P7BA 2QTOA 4UUJC 1ZWIC 2IH1C 3FB6C 5CBFA 1JVMA 5EBLC 2W0FC 3OUFA 2X6BA 2A0LA 4ZBMA 4WFEA 2H8PC 2ITDC 2EIKC 2QKSA 2WLIA 4GX5A 2HVKC 4R6ZA 4RO2A 3SPCA 3SPIA 4MTFA 3SYQA 5KUKA 2A9HA 1OCOC 5EK0A 1R3LC 3UM7A 3PJSK 3LDCA 3ABKC 4JTDB 3F5WC 1BL8A 3GB7C 5CBGA 3STZC 2Y69C 3ASOC 4MW8A 4GX1A 3TETA 4MVOA 2NLJC 4LCUC 2JK5C 2Q69A 3OR6C 3F7YC 3LDEA 4J9ZB 2DYRC 2X6AA 3E83A 3RVYA 4XDLA 3SPHA 3JYCA 4RAIA 3AG4C 3T4ZA 2WLIB 4MTGA 4PDVA 4R7CA 1R3JC 1OCZC 4R8CA 4GX0A 5BZBA 3FB5C 2OCCC 1M56C 3K03A 4TWKA 3T2MA 5IY5C 4G28B 4MTOA 4RUFA 3VOUA 3AG3C 2A79B 3SYAA 3RW0A 3BEHA 2Q67A 4X88A 4G27B 1QLEC 3HPLC 3SPJA 2EINC 2WLHA 4PA9A 2X6CA 4QNHB 1K4CC 4H37A 4MVSA 1LNQA 4PA6A 4WFFA 1XL4A 2HJFC 2KB1A 2YEVA 3K04A 4JTAB 2WLNA 4MVMA 5EBMC 3T1CA 3ABMC 1OCRC 4MW3A 1M57C 3TCUA 3AG2C 3KG2A 4BW5A 1XL6A 2ZXWC 4PA4A 2ATKC 3R65A 4WFHA 2AHYA 3EFFK 3OGCC 4I9WA 4QE7A 5KUMA 5B3SC 3E8FA 4H33A 2P7TC 3OR7C 1OCCC 5B1AC 3SJQC 2WLJA 5EBWC 4DXWA 2IH3C 3E86A 3K06A 5J9PC 5EC2C 3K0GA 4J9YB
chains in the Genus database with same CATH superfamily
3JARB 4XBFA 1OCZB 1B04A 3SJBC 4PELA 2PI5A 2OT5A 5BY1A 3RYIB 1Q6UA 2ZQMA 2V7QG 5J2UA 3H1HH 2E5LB 5CA1A 4K0KB 2JGDB 2DYSC 1OCOB 4J42A 1EN5A 2EILC 4GX2A 4LNUB 3X2QB 2R9AA 5E1AC 1I0HA 3BRCA 3F7VC 2Q68A 3ABUA 3L9DA 4LH7A 4JI7O 4DR2O 2Q9LA 4FZ0A 4NTYA 4LFAB 2UUAO 1WA8B 2QM4A 2KKWA 1Y74A 2EIJB 3IC7A 2ZE5A 2Z5UA 2GDSA 1PD3A 4JI8B 4B7EA 3H1KH 1K3EA 5CA0A 1LR1A 3OW2U 2CUGA 3M8AA 3OTFA 3CS5A 3AG4C 3A0RA 2YXLA 2HKOA 3AG2B 2PF4E 1S5JA 2JGDA 1GN3A 4BR6A 4JI1B 1WLEA 4X88A 1M93A 3HKCB 3HKDA 1H2GA 4JI8O 2LP7A 1FXVA 1M57C 4BIOA 3VQYA 3WG7C 2Y0IA 1QLEB 3QO5A 2EULA 4PDLA 3N2KA 3Q4HA 3RBZA 1K9MW 4JASA 2DWEC 1ZLZA 3DSQA 1M56B 3CRQA 4MVRA 4LBEC 2IJHA 4U3JB 1S72V 2ZIMA 5LMUB 2B1GA 4GLXA 2XAJA 4JI3O 3FB8C 4I55A 1U96A 1SESA 3ETEA 1JFFB 3FAVA 1VQ7V 3CWBH 4JI6B 2FB5A 1R3IC 5JQGB 2BTOA 3CPWU 4L8JA 1PP9H 2OYQA 1XOUA 3CCRV 1N0NA 3UO2A 3K08A 4E2LA 4WF9V 2Q8VA 4RQEA 4X1YB 2IH1C 2N05A 2GUZA 3ABLB 3BCCH 2Q0AA 1BZKA 3CMAV 1EN6A 1YTFD 2CTPA 2VQFB 5BMVB 3JATA 3J80N 3ABKC 1JX9A 4JTDB 2ZNIA 1FXHA 3W7UA 2ADPA 4GX1A 3E22B 4K35A 2RNBA 1YXBA 4FM1A 1BHAA 1GAXA 3JYCA 2LFRA 1NBMG 4TV8B 3JALB 4UV8A 1E79G 1AROP 3TXSA 1XHZA 1G6UA 4TV9B 1Z5WA 3OGIB 1WAZA 2UXCB 3E22A 1JPXA 5FLXN 3JD3A 2HJFC 2KB1A 3K04A 2WLNA 4JI4O 5TISZ 2YI8A 2YI9A 5LBQA 4CH6A 2E75B 4F6RB 4Q6GA 5LMNO 4DR6B 5JH7A 2AHYA 4O4LA 3ZMVA 4DV2O 2GUZB 3W7XA 2XHBA 4J10A 1IVSA 4YJ2A 4P9PA 1TGOA 1H2LA 2EIMC 1K5SA 3B8NA 3A0HZ 1R3KC 3JSNA 1HP8A 4DYLA 3HKEB 5IYZB 2AZ2A 2DYRB 4O4IB 4LF9O 2HG5C 4QPJA 3LUTB 5IT9N 5AG2A 2VWJA 2XOKG 2GHYA 4B3MB 3IGAC 1AR5A 4DR4B 2HVJC 2QWNB 5IYZA 3ZJZA 4FFBB 1QCEA 2CTRA 2QSAA 4L87A 1Z5VA 4ZIBA 1WP7A 4RUEA 2ZR2A 1YCIA 1F4NA 2Z3YA 5LHGA 2HFEC 3H1LH 1HW7A 4IIJA 3UO3A 3LSQA 2UXDO 1JJ2U 2DOSA 1WNSA 5LHIA 1D5AA 4DV7B 5LA6A 1K73W 4FZ1A 1JJOA 3A0BZ 4RQFA 5KUKA 5EK0A 1Q8IA 2IU0A 5KHGA 1BT8A 3STZC 2LO1A 1VF6A 2Y69C 3LDEA 2DN9A 4NYKA 4K3AA 4MTGA 2FMLA 4F6RA 4ZOLB 3CCMV 3DGEA 2CH7B 3SYAA 3RYFA 4X64B 4B3SB 1PNKA 1DF5A 3T1CA 1FFTB 2BTQB 5KX5A 2CK3G 2ZXWC 1GK9A 1EM1A 4QE7A 4H33A 3MHHC 3E2EA 2RJZA 2IH3C 2IJKA 5B1OA 1P84F 4PJ0Z 5LOVA 3WB2A 5IE9A 1AI4A 2LQTA 3OTOO 3K57A 2WAMA 4DR6O 2RDCA 3G71V 4JYAB 3RFRA 2JEUA 4JI3B 4LFCO 4UXNA 5KHHA 2IM9A 5GONB 4KUMA 2HHHO 3QTCA 1XMQO 2PGGA 4YHHO 1L8DA 1FXKC 2Q7GA 4YY3B 2BOBC 2R9RB 1YVWA 3CRMA 2EZPA 2OTLV 1UPGA 1KP3A 3OE7G 4X9QA 1WP8A 2ITDC 2YUAA 3CHXA 5EZYA 1TUEB 2LGWA 1YJNV 1J5EO 2EJRA 4U7NA 2IU3A 2HHHB 3B2EE 2QWQB 1VQ5V 1XUQA 2F4VO 4MW8A 1Q3EA 1WB8A 4JI0O 2UUBO 4K8ZA 1I5YA 4X62O 1R73A 3G80A 2UUCO 3UT5A 3AG1B 2ZM6B 5JVDA 1VQKV 3CRCA 1JQ0A 4JAAA 5IY5C 2JVDA 3T2MA 2L35A 5JJEB 4ICGA 3RW0A 2N74A 3OMAB 1NS1A 4LF8O 3SDLA 2X6CA 2OIEA 1OCCB 1XL4A 4PI0A 5B3SB 3ABMC 1Q86W 5CMUA 1BMFG 1GN6A 4J7KA 3RN4A 3I56V 4DW0A 3CX5F 3ZHQA 3OR7C 1TUBA 5FPRA 4DV2B 3ZMZA 1W0JG 2JJ2G 4X64O 2JIZG 4EEQA 1R1BA 4W4LA 2WLMA 1TUBB 4DV7O 4P9OA 4FMTA 4QGPA 1DK1A 1YIJV 3RVZA 1BSMA 4CC6A 4HNAB 1MABG 3E89A 4YY3O 3CXCU 4JYBA 4CZZA 3T1HO 4OX9O 4D7TA 3HR0A 5LXTA 2JDIG 2IW5A 2Y0PA 1FXKB 2ADQB 5DN6G 1N36B 1QQCA 4CC5A 4FFKA 2PYJA 5H5NA 4B3SO 3RGBA 3JASB 1ZWIC 3FB6C 5CBFA 3THOA 5FL7G 2X6BA 4ZBMA 4WFEA 3GWKC 1H2KA 3QNEA 2XAFA 1NQTA 2FKXA 4ZI7A 4IGGA 5EIBC 1VF5B 5JJJB 1XQ8A 5DECA 4LF8B 1H8EG 3ZHRA 4JZGA 3OR6C 2VS0A 1OJHA 1IXBA 3RVYA 2YDEA 4XDLA 2EBOA 3SPHA 1MG1A 2ZXWB 3CSXA 4LF5O 3PN1A 3CC4V 3U11A 3CYOA 3ETGA 4G27B 3WU2Z 4WFBV 2PTMA 1D5NA 4J7JA 2YIAA 3OEEG 1VQMV 1PL0A 3D3IA 2B1IA 2ZNJA 2NN4A 2X0LA 3K0GA 3P30A 4WFAV 4DR5O 1XNQO 3UKMA 3DXRB 4KHPO 2ZDIA 4LF9B 1SERA 4Z1MG 1SQVH 1J5EB 2W6IG 4PI2A 5KHIA 5L3CA 1JMKC 1S5LZ 5LYJB 1KB9F 5KX5B 1OV9A 2ZD9A 1PNLA 4JYAO 1N8RW 2UU9O 1ORQC 2YC0A 1BE3H 3QO8A 4AQYB 5IJ0B 4TV9A 1GM7A 2A3QA 1YI2V 3K0DA 4B3MO 4GKJO 2JRIA 2QWRB 3L70H 5D5QA 4N23A 2QDOA 1YEWA 2K1EA 1H8HG 2Z0AA 3DC5A 3SPGA 5J2UB 2IJJA 2AGAA 1I08A 1BS3A 1M5IA 3RYIA 1V54B 4DW1A 1KP2A 3OUFA 1B3QA 5IJ9B 3L74H 3BABA 4CS4A 5KHKA 2RQ6A 4RO2A 3SPCA 4YXWG 3QF7A 3FYIB 2YEVB 4DR2B 4JV5O 3MHSC 1UFIA 4B08A 2CTQA 2YICA 3F7YC 1FFXA 3U10A 3G6BA 1XBLA 2F1MA 1Y6XA 5BZBA 2R9IA 2XAHA 1W2BU 1HNZB 5B66Z 5L3EA 1NH2B 2G38A 2HJDA 2OWOA 2B9ZA 4GCZA 3DTUB 4X1KA 3WFVA 3E8FA 3H9VA 1XMOO 4IT5A 5C8YA 3QG5A 1M9NA 1CP9A 3F5TA 5EC2C 1N33O 3ZRSA 1L0NH 3JD2A 1R6NA 4A5UB 3NXSA 2QGNA 1W0KG 1QLNA 2IBZH 1XI1A 2OIGA 3ABTA 1T5EA 1R6KA 4I0XB 3ZN0A 2Y48A 1GRJA 3ABLC 4CBCA 1I94O 2WA4A 5J2TB 4MS2A 1AR4A 2JS5A 5LOVB 4GUNA 4R50A 4O4HB 3HKDB 3T1HB 3FD9A 3FB7C 2QR4A 4NR1A 2Q7EA 2CAZC 4ASUG 1GN2A 4WFGA 2QM8A 5K1XA 4FM2A 1H38A 3RYFB 2F4VB 1JOYA 1P4RA 5JWPA 2Q73A 5GONA 5DEDA 4JI5O 5BMVA 4LFBO 3VQVA 3UM7A 2PZSA 3GB7C 2LW1A 5KAIZ 3ASOC 1I94B 1Y74B 3E35A 5BR8O 4JPRA 2NNUA 4QJFB 4DV5B 4R7CA 5JCOA 3VQWA 3FB5C 5FNVA 4G28B 4TUYA 2A79B 3HPLC 1P49A 4J7ZA 4H37A 5KA5A 4WFFA 4MVMA 2BTQA 1OCRC 1SF9A 2P6JA 3P3PA 3AG2C 3IJ4A 3AG4B 5JJNB 1OCRB 1QNMA 2R72A 4U7OA 2E5LO 2ODMA 4DV4B 2DWDC 3Q4HB 1S3JA 4UCTA 4LF7B 2RMKB 1SQGA 4DR7B 3HKEA 2QKAA 3ZX6A 3FX7A 4LF4B 1SC5B 5JCOC 3OEHG 5J2TA 5KAFZ 4X62B 3ASOB 4I9QA 3SYCA 1ZTEA 4TSFG 3D36A 4KL1A 3E8BA 4EFEA 5CBHA 2UXXA 4D6TH 3H1IH 2F23A 4HBNA 4HYOA 4LFBB 1VQ9V 1J95A 2YXYA 4KHPB 3X2QC 1VIBA 1IX9A 2DYSB 3K5LA 2GTSA 3ZHTA 4LWSB 2DE0X 2WLLA 1FKAO 4PHZA 4JI2B 2YIBA 1RFYA 4KP4A 1JVMA 4JYCA 5CA0B 3UCSC 1N32B 1N34O 1VQNV 3PJSK 2F95B 4RWUA 1F51A 1BL8A 2QEXV 1GKFA 4X1IA 4OPAA 2WSSG 2Q69A 1XHXA 4PV1B 3D36C 5EYPB 1TVKA 3RYCB 4DRXB 1R3JC 1M90W 4AQYO 3K03A 5IYDO 3CE2A 1GTOA 1E1RG 3BA8A 1AI5A 1Z2GA 1K4CC 1NI8A 3KCXA 1Q7YW 2W6JG 1AI7A 1SKVA 5LMUO 1VP7A 3A2FA 3R65A 3ZHUA 4TT3G 4NXMB 4DR1O 2CTWA 5LXTB 4LFAO 4UVBA 3OM3B 4AHCA 5J9PC 3RYHA 4W4KA 2QA4V 2HLDG 3SR2C 4JV5B 5IJ0A 1XMQB 3K5NA 1S77D 1SZXA 1SQBH 2FYUH 4JAVA 1L1FA 4MVZA 1FYJA 4FPPA 3TK1A 2XASA 1KYOF 4DV4O 4MVUA 4QE9A 3R66A 1JA8A 3CRAA 4HAMA 1VQ8V 1ENVA 2DMXA 1Y76B 1VQLV 5E79Z 4IL6Z 1V54C 5B1BC 4CS3A 1BQZA 5IWAO 4UCVA 4TOIA 2GTAA 5C8YB 3G6EV 2WWWA 3B4SA 2B5UA 2UXNA 2WLLB 4CH3A 2HP8A 2QJ1A 5GW7A 2QTOA 1SA0A 2E3CA 4X20B 2A0LA 2P90A 2E74B 2HVKC 4R6ZA 4F6EA 4J41A 3TGUH 4DR4O 4JYYA 1FPOA 1I5XA 1HNWO 1LUVA 2JGUA 4LCUC 3C3TA 4B3TB 5LP6C 1L0LH 4EB6B 3N2KB 1JR9A 1N0JA 4DV1B 3MDSA 2OCCC 1MMMA 1RM1B 3BEHA 2Q67A 1GH6A 2EINB 4FLXA 4PA9A 4K8XA 1N33B 4AI8A 4PA6A 1S76D 1CEZA 3AG3B 4BAYA 4MW3A 3T1YO 4BW5A 2ATKC 2MK3A 1SZTA 3EFFK 3W7WA 5CN0A 4LNUA 4H13B 4AILC 3OAAG 3CB2A 5EBWC 4DXWA 3K06A 3FFQA 4DV6B 4FLVA 3H01A 4TUYB 4LP8A 5FNVB 2VQFO 3STLC 1G4YB 3ML0A 3BHPA 5ITZA 2O57A 4LF5B 2P5OA 4P2ZA 1NTMH 4YIPA 4YJ3A 5LYJA 1Y67A 1NR7A 2ITCC 2BE3A 1NVPB 2DW4A 2QWPB 2ZINA 2XNDG 1IZ3A 1QVFU 4NTWA 4BIUA 4EB6A 4DRXA 1VARA 3B8MA 1V9PA 4HZ3A 3JCUZ 2F66C 3DC6A 2AXTZ 4I7ZB 1M1KW 1VF6C 1EZJA 1P7BA 3D3QA 1IBMO 4CH4A 3BVOA 2AZ0A 1IBLO 2ZE8A 3J81N 5CA1B 3HKBB 4FVMA 4FJCC 4O2BB 2MW2B 2XUMA 1CXZB 4DR7O 3N2GB 1DGSA 4WCEV 1H2SB 4DUYB 4UCSA 1NR1A 4I4TA 1Q6HA 1U97A 1G1XB 2P4KA 2BSKB 1ZUQA 3ZRWA 3FYEB 1AJQA 3L71H 3ZIAG 3T1YB 5JVDB 1HWYA 4RAIA 1NZ6A 1UJWB 3MAQA 2D2CB 4R8CA 1HDJA 4O4LB 5CB4A 3APQA 3S3WA 1MSWD 3JD0A 3K9SA 2E76B 1ZX3A 1SRYA 2K9PA 1QR9A 3RT3C 3JAWA 2Y4UA 1XL6A 1VF7A 5KUMA 3ABMB 5B3SC 3B40A 2ZR3A 1OCCC 3E86A 3GWOA 5CA3A 2A7WA 3E8HA 1YZBA 5IY5B 4FLWA 4I50A 3AG1C 2LW7A 4GKJB 1FAFA 4N21A 4IYHA 3SYOA 5LHHA 4H44B 1KU9A 3L72H 1K97A 3JD1A 1FS0G 1S0VA 1TA8A 1K7DA 1AVMA 3RYCA 5F2VO 2BCCH 4P30A 4XDJA 5IJ9A 4BW9A 1N4CA 4X1IB 3KKYA 1MZFA 3D8CA 1IBKO 4OPHA 3A8TA 1CPYA 1YHQV 3JD4A 2XAGA 2RN9A 3ZHSA 4UUJC 1AB3A 1VEWA 3O9OA 3ZMSA 4TV8A 5LGNA 1EN4A 3EXAA 1QU7A 4GX5A 1RSOA 4ZHQA 3ZRVA 1Q82W 4UCUA 2A9HA 1AJNA 2UUBB 4JI0B 3CJHA 1TAEA 4MTXA 2PI4A 3SJAC 1OZ0A 3TETA 4X65B 2QE7G 1KC8W 2ETNA 3FKSG 2PUSA 4MTOA 3VOUA 3DXRA 3JAKA 3EHBB 3KCYA 3ZRWB 4QNHB 5KA6A 4D7SA 1YDXA 1H2NA 1F23A 4G2KA 4QPKA 5LGUA 4I9WA 5H6RA 3CMEV 4FM0A 3SJQC 1GN4A 4OX9B 4DR1B 4J9YB 2LGQA 1BHBA 1K34A 2YSUB 1GM9A 1GO3F 1WPXA 1ZAUA 2VQEO 3P3NA 2IJIA 3HKBA 4O2BA 4EFBA 2YS8A 5LMNB 1HNXB 4GKKO 4LH6A 1HR0B 2Y69B 2W0XA 2P67A 2Q0OC 4O4IA 3K5MA 2KSDA 1XILA 1V55B 1EZVH 2CGOA 1I7FA 2P06A 4XDKA 4YHHB 4DK1A 1KMIZ 1AR1B 4JTCB 1FFXB 1YTFB 1VQ4V 4NTXA 1BCCH 4QIWF 2EJ7A 3JSLA 2WLKA 2QTSA 3ETQA 4JI2O 3APOA 4IHJB 3RYHB 2M7WA 1N32O 1RP3B 3K9AA 3ICXA 2GV9A 4LF6B 1SQXH 3VQXA 2WLIA 1IBLB 3OMNB 5LL6Y 1FD9A 4JAUA 4NKGB 2CH7A 4E4EA 4NXNO 1NKDA 1URFA 1Y66A 4FK5C 4ZOLA 1XMOB 2ZKOA 5B1AB 4HNAA 5IYBO 4J9ZB 2DYRC 3CEIA 4H0LB 3AK2A 3BPZA 2JJ1G 1ROPA 1VQPV 2ILMA 4U3FH 4O4HA 2JEXA 2EIMB 3WB0A 1TVKB 3SGIA 2XT9A 1PV0A 3SJCC 2WLHA 1MSDA 4FIPC 3CD6V 1LNQA 3W7TA 4DUYO 3BA9A 5HFMA 5BR8B 3KG2A 4NXMO 2ZE7A 4PA4A 4IIJB 1XREA 4X20A 5B1AC 2WLJA 4FLZA 4O2AB 4I4TB 5FPOA 3K58A 1SQQH 3LDDA 4FFBA 3N2GA 3OD4A 1DF4A 2VRZA 2UUCB 1H2MA 1KD1W 5GTIZ 3FAVB 1SA0B 1BGYH 2R70A 4I55B 3L73H 2YIDA 4X65O 1XEQA 2AW9A 1YSCA 1YF2A 1RPOA 3ABKB 3ZMTA 2H94A 1AJPA 4F4LA 4DV0O 5EZYB 3OUSA 1N34B 1HNXO 4GKKB 1V55C 3LNNA 4B3TO 1AI6A 4B7KA 1G8MA 3ZCCA 4X89A 1IBMB 3IFXA 4JI7B 2F43G 2P22C 5JH7B 4NVPA 3CCQV 2H3OA 4DK0A 2W0FC 4X66O 2KG7A 1AP5A 3CJHB 2GSMB 1O9HA 1KQSU 4UV9A 3CRRA 4DUZO 1EBOA 1KKCA 4GYCB 1R3LC 1PNMA 1X59A 2L6LA 5LGTA 2V1DA 3JALA 4IHJA 3KZIZ 2X6AA 3AK1A 4YIOA 1FXKA 1NJIW 5KMGB 2ZCEA 3CXHF 1WPBA 1M56C 5EYPA 3CCJV 1M4UA 5A2QN 1NTKH 5H2FZ 3U0ZA 2Q4PA 4NXNB 1Q5OA 1QLEC 3M99B 4UCRA 1B06A 3K59A 4DUZB 3CP1A 2C2AA 1WJZA 3WG7B 2PYLA 5KLVH 2DQ0A 1M57B 1WA8A 3OGCC 1IURA 2LFSA 2UXBO 3HB3B 3RWRD 4DR5B 1XNQB 4Q20A 2Q5ZA 2ZE6A 5GTHZ 4C7UA 5JQGA 2F93B 3UQ8A 1MA1A 4JI1O 1RPRA 4KFMA 2ARHA 1OHHG 2GBOA 2BOCC 1NU1H 1JFFA 1O9GA 2EX3A 2YXHA 4MSWC 3G67A 4K0KO 4LC1A 4DR3O 2UU9B 4BIZA 1HR0O 1PKXA 5LP6A 2KG7B 2QWOB 1DLBA 3TJTA 3CCLV 3JAKB 1QBZA 2EZOA 5LA6B 2OCHA 5D5PA 2EIJC 1AILA 4UB6Z 3EVKA 3O65A 3JARA 4WBNA 2Q6AA 1LUWA 2NR5A 3K79A 3E8GA 3ZMUA 1MZEA 4BWAA 3ZEDA 1Q6IA 2WPDG 2ZIOA 1KKDA 2VWKA 2FTKA 1KUQA 4PD4F 5EIBD 1K33A 3B77A 1F4MA 3B09A 1VQ6V 4ZHQB 1JCHA 3JASA 4Z1VA 4LF6O 4MTFA 2EILB 1OCOC 3WB1A 1F7YA 3TXQA 4JF3A 3F5WC 3ZBHA 3I5DA 3CCSV 4LF4O 4J11A 4MVOA 3OMIB 1ZSPA 2JS3A 1VMGA 3MD0A 3ETDA 2WLIB 1VQOV 5IDJA 1OCZC 1XNRO 4RUFA 3C3SA 4DV3B 2M6YA 5L3BA 2XTAA 4YJ2B 3H1JH 2FL4A 4DV6O 4LR3A 3N27A 4MVSA 4JGSA 3VBBA 5H6QA 3TCUA 2XAQA 4YJ3B 2UXBB 3AEIA 1NH2D 4CH5A 1FJGO 3AK3A 4UCOA 3JCZA 1Q81W 1A32A 1ZL8B 4DR3B 3JAMN 4PA3A 4B3RB 3CCVV 3SYPA 5B1NA 4DV3O 3IAYA 4OXSA 1PPJH 1YITV 1W59A 4GZRB 2CGNA 1MOFA 4KXRA 2Q7HA 2ZT9B 4JI4B 1XDCA 3K3WA 1B6QA 3GVMA 5L3DA 3JAWB 2HR3A 3J7AU 5EC1C 4UVAA 2OTJV 1SQPH 4JZ2A 1K4DC 2AHZA 1ZL8A 4Z2WA 4ABMA 3ASNC 2PY5A 4DO2A 3JATB 5K1PA 5H9CA 1Q90D 3T4DA 2EIKB 3OTOB 4I0XA 4JI6O 5CB4B 3BY6A 3CC7V 4PDRA 4WBNB 4EKWA 1S5HC 3AG7A 4PA7A 2KQXA 4PDMA 2BSKA 3L75H 1PM9A 5EBLC 4TQFA 2Y4TA 4JI5B 4IYIA 2H8PC 2HEPA 2QKSA 3QVNA 5L3GA 2CE4A 3ZS8C 4UB8Z 3K5OA 1COWG 2NLJC 2DJVA 1QVGU 3NR7A 3E83A 3T4ZA 4PDVA 1GMGA 4UFZA 4DV5O 4GX0A 1AP6A 4FLYA 4TWKA 2A06H 2V4DA 3AG3C 3C90A 1KECA 2EINC 2DQ3A 4UVCA 1RM1C 2YEVA 2OCCB 3OT7A 5L3FA 5ITZB 4X66B 2UXDB 4WFHA 1BQ0A 2P7TC 5LP6B 1YJWV 4B3RO 3HKCA 1P7GA 1Q43A 1SS3A 4MVQA 4DV1O 1QR8A 3CCUV 2CDYA 1N36O 4I5SA 1US6A 4DV0B 1FJGB 4I50B 4LF7O 5IWAB 3ZHVA 4J80A 3BAAA 5BXZA 3BFRA 4O4JA 3W7SA 4O4JB 1IBKB 1WN7A 5C93A 1IDSA 1RSOB 4X8AA 3LNMB 1NT2B 3IC9A 4LFCB 5DM6V 4CS2A 1Y4MA 3ZRXA 1GM8A 1HNZO 3CCEV 1XNRB 5B1BB 5KHJA 2ZDIC 5A9GA 4X1YA 2N04A 1NVPD 1HNWB 2RCVA 2P4VA 3ZN1A 1K8AW 4GT1A 1X4TA 3CC2V 1SQFA 2LJ2A 1QHTA 5KMGA 1D2DA 5B5EZ 2EIKC 1EFRG 4ZKIA 3SYQA 3SPIA 3ASNB 4OGQB 2QM7A 1KBHA 3LDCA 5CBGA 3S3XA 2QKCA 1K5QA 4NB5A 2JK5C 4TQDA 2WA3A 4MT8A 1IXMA 3QO7A 4LWSA 2YIBD 4O2AA 4X1KB 2X7RB 3M7MX 4U3JA 2ZM6O 1R6TA 4FLTA 1K92A 1WB7A 1SETA 3UT5B 2UXCO 1Y76A 3SPJA 1MNGA 1E1QG 3LSSA 3I55V 4JTAB 5EBMC 3LSUA 3G4SV 2VQEB 1YJ9V 1PL4A 3OFNG 1NTZH 5HFLA 4ZI7B 2UUAB 4FLUA 1DTOA 1THZA 3P32A 2D3OW 5IYCO
chains in the Genus database with same CATH topology
2JIZG 2QA4V 3LDDA 2HLDG 4XBFA 2WLMA 4P9OA 1OCZB 1DF4A 4FMTA 4PELA 1YIJV 1KD1W 2OT5A 2PI5A 1S77D 3RVZA 4JAVA 1L1FA 4MVZA 1MABG 3E89A 3CXCU 4FPPA 3TK1A 2XASA 4JYBA 2ZQMA 4CZZA 2V7QG 4MVUA 1YSCA 3ABKB 1RPOA 3ZMTA 2H94A 4QE9A 2JDIG 2DYSC 1OCOB 4GX2A 2EILC 1AJPA 4HAMA 2IW5A 1VQ8V 1ENVA 4F4LA 1VQLV 3X2QB 1FXKB 5E1AC 5DN6G 3OUSA 1V54C 3F7VC 5B1BC 2Q68A 1V55C 3ABUA 1AI6A 3G6EV 1G8MA 3ZCCA 4X89A 2WWWA 3IFXA 2F43G 2B5UA 2UXNA 2WLLB 5IYCO 5GW7A 2QTOA 3CCQV 1ZWIC 3FB6C 5CBFA 2W0FC 5FL7G 2X6BA 2A0LA 2EIJB 4WFEA 2GSMB 2P90A 3IC7A 3QNEA 4ZBMA 2XAFA 1NQTA 2Z5UA 1KQSU 4UV9A 1PD3A 2HVKC 4R6ZA 1EBOA 1R3LC 1K3EA 1PNMA 3OW2U 5LGTA 1H8EG 1I5XA 2V1DA 4LCUC 3OR6C 3RVYA 2X6AA 4XDLA 2EBOA 3SPHA 1FXKA 1MG1A 2ZXWB 3A0RA 3AG4C 1NJIW 2HKOA 3CC4V 3AG2B 2OCCC 1M56C 3CCJV 3CYOA 3ETGA 1RM1B 3BEHA 1WLEA 2Q67A 4X88A 2EINB 1QLEC 4G27B 3M99B 4PA9A 4WFBV 1H2GA 4PA6A 1S76D 3OEEG 3CP1A 3AG3B 1VQMV 1CEZA 2C2AA 2LP7A 1FXVA 4BAYA 1PL0A 4MW3A 1M57C 3WG7B 4BW5A 2DQ0A 3WG7C 1M57B 2ATKC 2MK3A 1SZTA 3D3IA 3EFFK 3OGCC 3W7WA 5CN0A 2LFSA 2B1IA 3OAAG 5EBWC 4DXWA 2X0LA 3HB3B 3K06A 4Q20A 1QLEB 3K0GA 3QO5A 3P30A 4PDLA 3RBZA 4WFAV 1K9MW 4JASA 2DWEC 3UKMA 3H01A 1M56B 4LP8A 1RPRA 2ZDIA 4KFMA 4LBEC 4MVRA 2IJHA 1SERA 4Z1MG 3STLC 1G4YB 1OHHG 3ML0A 2BOCC 1S72V 2B1GA 2W6IG 4P2ZA 2XAJA 4MSWC 5L3CA 3FB8C 1NR7A 2ITCC 2ZD9A 4LC1A 1NVPB 2DW4A 1PNLA 1SESA 3ETEA 4BIZA 1PKXA 1VQ7V 1N8RW 2XNDG 1ORQC 1QVFU 3QO8A 1DLBA 3CCLV 4BIUA 1QBZA 2EZOA 1GM7A 2EIJC 3B8MA 1R3IC 3K0DA 1YI2V 3CPWU 4HZ3A 4N23A 2Q6AA 2K1EA 1H8HG 3K79A 3E8GA 3SPGA 3ZMUA 3CCRV 2IJJA 3K08A 4E2LA 1M1KW 4WF9V 2WPDG 1KKDA 1EZJA 4RQEA 1P7BA 2IH1C 2FTKA 3ABLB 1V54B 1KP2A 3OUFA 3CMAV 1K33A 3B77A 1YTFD 1F4MA 4FJCC 1VQ6V 1JCHA 4RO2A 3SPCA 4MTFA 2EILB 1OCOC 4YXWG 4WCEV 3FYIB 3ABKC 1JX9A 2YEVB 1NR1A 3F5WC 4JF3A 4JTDB 3MHSC 1FXHA 3W7UA 3CCSV 4GX1A 3ZRWA 4MVOA 3OMIB 3F7YC 3FYEB 1AJQA 3ZIAG 1BHAA 1HWYA 3MD0A 3JYCA 2LFRA 3ETDA 4RAIA 2WLIB 1NBMG 1UJWB 1VQOV 5IDJA 1OCZC 4R8CA 5BZBA 2R9IA 4UV8A 2XAHA 1E79G 1W2BU 1MSWD 1AROP 4RUFA 3JD0A 5L3EA 1NH2B 5L3BA 1SRYA 1JPXA 1QR9A 4MVSA 3JD3A 4JGSA 2HJFC 2KB1A 3K04A 2WLNA 3VBBA 5H6QA 3TCUA 2XAQA 5LBQA 4GCZA 3AEIA 1NH2D 3DTUB 1XL6A 2AHYA 5KUMA 3ABMB 3WFVA 5B3SC 3JCZA 3E8FA 1Q81W 3ZMVA 2ZR3A 1OCCC 3W7XA 3E86A 3GWOA 5CA3A 1M9NA 1CP9A 5EC2C 3E8HA 3ZRSA 4P9PA 4PA3A 3JD2A 2EIMC 1R6NA 3CCVV 3NXSA 3SYPA 5IY5B 5B1NA 1W0KG 1QLNA 1K5SA 3B8NA 4OXSA 1R3KC 3ABTA 1YITV 1R6KA 3AG1C 2DYRB 3ZN0A 1MOFA 2Y48A 4N21A 3ABLC 4CBCA 2HG5C 3K3WA 3SYOA 1B6QA 5L3DA 5LHHA 2HR3A 5EC1C 4QPJA 3LUTB 4MS2A 1K97A 4UVAA 3JD1A 2OTJV 1K4DC 2AHZA 4R50A 2XOKG 2GHYA 1FS0G 1S0VA 1K7DA 3ASNC 3FB7C 3IGAC 4DO2A 2HVJC 5H9CA 3T4DA 2EIKB 3ZJZA 1QCEA 4P30A 4XDJA 3BY6A 4L87A 3CC7V 4PDRA 4ASUG 4WFGA 2QM8A 4EKWA 1S5HC 4RUEA 2ZR2A 1F4NA 2Z3YA 5LHGA 1H38A 2HFEC 1CPYA 1YHQV 3JD4A 4PA7A 1JOYA 2XAGA 4PDMA 1P4RA 4UUJC 3LSQA 5EBLC 1JJ2U 3ZMSA 5LGNA 2H8PC 5LHIA 2QKSA 1K73W 4GX5A 3ZRVA 5L3GA 1Q82W 4RQFA 5KUKA 2A9HA 1AJNA 5EK0A 3UM7A 2IU0A 3GB7C 4MTXA 2PI4A 3STZC 2Y69C 3ASOC 1OZ0A 3TETA 1COWG 2NLJC 1QVGU 3E35A 3LDEA 2QE7G 3E83A 4JPRA 2NNUA 4QJFB 1KC8W 3T4ZA 4PDVA 4MTGA 1GMGA 4R7CA 3FKSG 4GX0A 3FB5C 4TWKA 4G28B 4MTOA 3CCMV 3VOUA 3AG3C 3DGEA 2A79B 3SYAA 3EHBB 1KECA 3HPLC 3ZRWB 2EINC 2DQ3A 4QNHB 4H37A 5KA5A 4UVCA 4WFFA 1RM1C 2YEVA 1PNKA 5KA6A 1DF5A 4MVMA 3T1CA 1FFTB 1OCRC 2OCCB 2P6JA 1F23A 3AG2C 4G2KA 2CK3G 2ZXWC 3AG4B 1GK9A 4QPKA 5L3FA 4WFHA 5LGUA 4I9WA 1OCRB 4QE7A 5H6RA 4H33A 3CMEV 2P7TC 3MHHC 4U7OA 3E2EA 3SJQC 2IH3C 1YJWV 2IJKA 5B1OA 4J9YB 2DWDC 1BHBA 1S3JA 1K34A 4MVQA 2YSUB 1GM9A 1GO3F 1WPXA 1AI4A 1QR8A 3CCUV 4I5SA 2IJIA 2WAMA 3G71V 3W7SA 3OEHG 5J9PC 2Y69B 2JEUA 3ASOB 3SYCA 5C93A 4X8AA 2P67A 3LNMB 3D36A 4TSFG 4UXNA 3E8BA 5DM6V 5CBHA 4KUMA 1Y4MA 1V55B 2UXXA 3ZRXA 1GM8A 4XDKA 3CCEV 5B1BB 4HYOA 1VQ9V 2ZDIC 1J95A 1FXKC 4JTCB 1AR1B 3X2QC 1YTFB 1VQ4V 2DYSB 1NVPD 4QIWF 2BOBC 2R9RB 2WLKA 2WLLA 3ZN1A 1K8AW 4GT1A 2M7WA 2EZPA 2OTLV 3CC2V 4KP4A 1JVMA 1KP3A 3OE7G 4JYCA 3K9AA 2ITDC 2EIKC 1EFRG 2WLIA 4ZKIA 1TUEB 3SYQA 1YJNV 3OMNB 3SPIA 2EJRA 3ASNB 4U7NA 1VQNV 2QM7A 4JAUA 3PJSK 2IU3A 3LDCA 1F51A 1BL8A 5CBGA 2QEXV 1GKFA 1VQ5V 4MW8A 1NKDA 1K5QA 1Y66A 4FK5C 2JK5C 2WSSG 2Q69A 5B1AB 4MT8A 1I5YA 1R73A 5IYBO 4J9ZB 1IXMA 2DYRC 3QO7A 3AG1B 2X7RB 2JJ1G 1ROPA 1VQPV 1VQKV 1R3JC 1M90W 1JQ0A 1K92A 3K03A 2JEXA 5IY5C 5IYDO 1GTOA 3T2MA 1SETA 2EIMB 3RW0A 1E1RG 3OMAB 3SPJA 2WLHA 1E1QG 1AI5A 2X6CA 3LSSA 1K4CC 4FIPC 3I55V 1LNQA 1OCCB 3CD6V 3W7TA 1XL4A 4JTAB 5EBMC 5B3SB 1Q7YW 2W6JG 3ABMC 1AI7A 3G4SV 1Q86W 1YJ9V 5HFMA 5CMUA 1BMFG 3OFNG 3KG2A 5HFLA 4PA4A 3R65A 3I56V 4TT3G 2D3OW 3OR7C 5B1AC 2WLJA 1DTOA 4UVBA 3OM3B 1THZA 3P32A 3ZMZA 1W0JG 2JJ2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWD C;  3E8H A;  4PDL A;  4P9P A;  3RBZ A;  3ZRS A;  3LDD A;  4MVQ A;  4PA3 A;  2DWE C;  3UKM A;  3ZJZ A;  2EIM C;  3WG7 C;  3SYP A;  4LP8 A;  4MVR A;  2WLM A;  4KFM A;  4LBE C;  4P9O A;  4OXS A;  3STL C;  1G4Y B;  1R3K C;  2BOC C;  3AG1 C;  3RVZ A;  3ABL C;  4P2Z A;  2HG5 C;  4CBC A;  3SYO A;  4MVZ A;  4MSW C;  3E89 A;  3FB8 C;  5EC1 C;  3LUT B;  4MS2 A;  2ITC C;  3SYC A;  2ZD9 A;  4MVU A;  4X8A A;  1K4D C;  2AHZ A;  3LNM B;  4R50 A;  4QE9 A;  2DYS C;  3E8B A;  5CBH A;  1ORQ C;  3ASN C;  2EIL C;  3FB7 C;  3IGA C;  4GX2 A;  4F4L A;  4XDK A;  2HVJ C;  5E1A C;  3T4D A;  3OUS A;  2EIJ C;  4HYO A;  1R3I C;  3K0D A;  4P30 A;  4XDJ A;  1V54 C;  3F7V C;  4HZ3 A;  1J95 A;  5B1B C;  4JTC B;  4PDR A;  3X2Q C;  2Q68 A;  1V55 C;  2Q6A A;  4WFG A;  4EKW A;  1S5H C;  2K1E A;  4RUE A;  3E8G A;  3SPG A;  4X89 A;  3IFX A;  2BOB C;  2R9R B;  2WLK A;  2WLL A;  2WLL B;  2HFE C;  3K08 A;  4PA7 A;  4PDM A;  1KKD A;  1P7B A;  2QTO A;  4UUJ C;  1ZWI C;  2IH1 C;  3FB6 C;  5CBF A;  1JVM A;  5EBL C;  2W0F C;  3OUF A;  2X6B A;  2A0L A;  4ZBM A;  4WFE A;  2H8P C;  2ITD C;  2EIK C;  2QKS A;  2WLI A;  4GX5 A;  2HVK C;  4R6Z A;  4RO2 A;  3SPC A;  3SPI A;  4MTF A;  3SYQ A;  5KUK A;  2A9H A;  1OCO C;  5EK0 A;  1R3L C;  3UM7 A;  3PJS K;  3LDC A;  3ABK C;  4JTD B;  3F5W C;  1BL8 A;  3GB7 C;  5CBG A;  3STZ C;  2Y69 C;  3ASO C;  4MW8 A;  4GX1 A;  3TET A;  4MVO A;  2NLJ C;  4LCU C;  2JK5 C;  2Q69 A;  3OR6 C;  3F7Y C;  3LDE A;  4J9Z B;  2DYR C;  2X6A A;  3E83 A;  3RVY A;  4XDL A;  3SPH A;  3JYC A;  4RAI A;  3AG4 C;  3T4Z A;  2WLI B;  4MTG A;  4PDV A;  4R7C A;  1R3J C;  1OCZ C;  4R8C A;  4GX0 A;  5BZB A;  3FB5 C;  2OCC C;  1M56 C;  3K03 A;  4TWK A;  3T2M A;  5IY5 C;  4G28 B;  4MTO A;  4RUF A;  3VOU A;  3AG3 C;  2A79 B;  3SYA A;  3RW0 A;  3BEH A;  2Q67 A;  4X88 A;  4G27 B;  1QLE C;  3HPL C;  3SPJ A;  2EIN C;  2WLH A;  4PA9 A;  2X6C A;  4QNH B;  1K4C C;  4H37 A;  4MVS A;  1LNQ A;  4PA6 A;  4WFF A;  1XL4 A;  2HJF C;  2KB1 A;  2YEV A;  3K04 A;  4JTA B;  2WLN A;  4MVM A;  5EBM C;  3T1C A;  3ABM C;  1OCR C;  4MW3 A;  1M57 C;  3TCU A;  3AG2 C;  3KG2 A;  4BW5 A;  1XL6 A;  2ZXW C;  4PA4 A;  2ATK C;  3R65 A;  4WFH A;  2AHY A;  3EFF K;  3OGC C;  4I9W A;  4QE7 A;  5KUM A;  5B3S C;  3E8F A;  4H33 A;  2P7T C;  3OR7 C;  1OCC C;  5B1A C;  3SJQ C;  2WLJ A;  5EBW C;  4DXW A;  2IH3 C;  3E86 A;  3K06 A;  5J9P C;  5EC2 C;  3K0G A;  4J9Y B; 
#chains in the Genus database with same CATH topology
 3JAR B;  4XBF A;  1OCZ B;  1B04 A;  3SJB C;  4PEL A;  2PI5 A;  2OT5 A;  5BY1 A;  3RYI B;  1Q6U A;  2ZQM A;  2V7Q G;  5J2U A;  3H1H H;  2E5L B;  5CA1 A;  4K0K B;  2JGD B;  2DYS C;  1OCO B;  4J42 A;  1EN5 A;  2EIL C;  4GX2 A;  4LNU B;  3X2Q B;  2R9A A;  5E1A C;  1I0H A;  3BRC A;  3F7V C;  2Q68 A;  3ABU A;  3L9D A;  4LH7 A;  4JI7 O;  4DR2 O;  2Q9L A;  4FZ0 A;  4NTY A;  4LFA B;  2UUA O;  1WA8 B;  2QM4 A;  2KKW A;  1Y74 A;  2EIJ B;  3IC7 A;  2ZE5 A;  2Z5U A;  2GDS A;  1PD3 A;  4JI8 B;  4B7E A;  3H1K H;  1K3E A;  5CA0 A;  1LR1 A;  3OW2 U;  2CUG A;  3M8A A;  3OTF A;  3CS5 A;  3AG4 C;  3A0R A;  2YXL A;  2HKO A;  3AG2 B;  2PF4 E;  1S5J A;  2JGD A;  1GN3 A;  4BR6 A;  4JI1 B;  1WLE A;  4X88 A;  1M93 A;  3HKC B;  3HKD A;  1H2G A;  4JI8 O;  2LP7 A;  1FXV A;  1M57 C;  4BIO A;  3VQY A;  3WG7 C;  2Y0I A;  1QLE B;  3QO5 A;  2EUL A;  4PDL A;  3N2K A;  3Q4H A;  3RBZ A;  1K9M W;  4JAS A;  2DWE C;  1ZLZ A;  3DSQ A;  1M56 B;  3CRQ A;  4MVR A;  4LBE C;  2IJH A;  4U3J B;  1S72 V;  2ZIM A;  5LMU B;  2B1G A;  4GLX A;  2XAJ A;  4JI3 O;  3FB8 C;  4I55 A;  1U96 A;  1SES A;  3ETE A;  1JFF B;  3FAV A;  1VQ7 V;  3CWB H;  4JI6 B;  2FB5 A;  1R3I C;  5JQG B;  2BTO A;  3CPW U;  4L8J A;  1PP9 H;  2OYQ A;  1XOU A;  3CCR V;  1N0N A;  3UO2 A;  3K08 A;  4E2L A;  4WF9 V;  2Q8V A;  4RQE A;  4X1Y B;  2IH1 C;  2N05 A;  2GUZ A;  3ABL B;  3BCC H;  2Q0A A;  1BZK A;  3CMA V;  1EN6 A;  1YTF D;  2CTP A;  2VQF B;  5BMV B;  3JAT A;  3J80 N;  3ABK C;  1JX9 A;  4JTD B;  2ZNI A;  1FXH A;  3W7U A;  2ADP A;  4GX1 A;  3E22 B;  4K35 A;  2RNB A;  1YXB A;  4FM1 A;  1BHA A;  1GAX A;  3JYC A;  2LFR A;  1NBM G;  4TV8 B;  3JAL B;  4UV8 A;  1E79 G;  1ARO P;  3TXS A;  1XHZ A;  1G6U A;  4TV9 B;  1Z5W A;  3OGI B;  1WAZ A;  2UXC B;  3E22 A;  1JPX A;  5FLX N;  3JD3 A;  2HJF C;  2KB1 A;  3K04 A;  2WLN A;  4JI4 O;  5TIS Z;  2YI8 A;  2YI9 A;  5LBQ A;  4CH6 A;  2E75 B;  4F6R B;  4Q6G A;  5LMN O;  4DR6 B;  5JH7 A;  2AHY A;  4O4L A;  3ZMV A;  4DV2 O;  2GUZ B;  3W7X A;  2XHB A;  4J10 A;  1IVS A;  4YJ2 A;  4P9P A;  1TGO A;  1H2L A;  2EIM C;  1K5S A;  3B8N A;  3A0H Z;  1R3K C;  3JSN A;  1HP8 A;  4DYL A;  3HKE B;  5IYZ B;  2AZ2 A;  2DYR B;  4O4I B;  4LF9 O;  2HG5 C;  4QPJ A;  3LUT B;  5IT9 N;  5AG2 A;  2VWJ A;  2XOK G;  2GHY A;  4B3M B;  3IGA C;  1AR5 A;  4DR4 B;  2HVJ C;  2QWN B;  5IYZ A;  3ZJZ A;  4FFB B;  1QCE A;  2CTR A;  2QSA A;  4L87 A;  1Z5V A;  4ZIB A;  1WP7 A;  4RUE A;  2ZR2 A;  1YCI A;  1F4N A;  2Z3Y A;  5LHG A;  2HFE C;  3H1L H;  1HW7 A;  4IIJ A;  3UO3 A;  3LSQ A;  2UXD O;  1JJ2 U;  2DOS A;  1WNS A;  5LHI A;  1D5A A;  4DV7 B;  5LA6 A;  1K73 W;  4FZ1 A;  1JJO A;  3A0B Z;  4RQF A;  5KUK A;  5EK0 A;  1Q8I A;  2IU0 A;  5KHG A;  1BT8 A;  3STZ C;  2LO1 A;  1VF6 A;  2Y69 C;  3LDE A;  2DN9 A;  4NYK A;  4K3A A;  4MTG A;  2FML A;  4F6R A;  4ZOL B;  3CCM V;  3DGE A;  2CH7 B;  3SYA A;  3RYF A;  4X64 B;  4B3S B;  1PNK A;  1DF5 A;  3T1C A;  1FFT B;  2BTQ B;  5KX5 A;  2CK3 G;  2ZXW C;  1GK9 A;  1EM1 A;  4QE7 A;  4H33 A;  3MHH C;  3E2E A;  2RJZ A;  2IH3 C;  2IJK A;  5B1O A;  1P84 F;  4PJ0 Z;  5LOV A;  3WB2 A;  5IE9 A;  1AI4 A;  2LQT A;  3OTO O;  3K57 A;  2WAM A;  4DR6 O;  2RDC A;  3G71 V;  4JYA B;  3RFR A;  2JEU A;  4JI3 B;  4LFC O;  4UXN A;  5KHH A;  2IM9 A;  5GON B;  4KUM A;  2HHH O;  3QTC A;  1XMQ O;  2PGG A;  4YHH O;  1L8D A;  1FXK C;  2Q7G A;  4YY3 B;  2BOB C;  2R9R B;  1YVW A;  3CRM A;  2EZP A;  2OTL V;  1UPG A;  1KP3 A;  3OE7 G;  4X9Q A;  1WP8 A;  2ITD C;  2YUA A;  3CHX A;  5EZY A;  1TUE B;  2LGW A;  1YJN V;  1J5E O;  2EJR A;  4U7N A;  2IU3 A;  2HHH B;  3B2E E;  2QWQ B;  1VQ5 V;  1XUQ A;  2F4V O;  4MW8 A;  1Q3E A;  1WB8 A;  4JI0 O;  2UUB O;  4K8Z A;  1I5Y A;  4X62 O;  1R73 A;  3G80 A;  2UUC O;  3UT5 A;  3AG1 B;  2ZM6 B;  5JVD A;  1VQK V;  3CRC A;  1JQ0 A;  4JAA A;  5IY5 C;  2JVD A;  3T2M A;  2L35 A;  5JJE B;  4ICG A;  3RW0 A;  2N74 A;  3OMA B;  1NS1 A;  4LF8 O;  3SDL A;  2X6C A;  2OIE A;  1OCC B;  1XL4 A;  4PI0 A;  5B3S B;  3ABM C;  1Q86 W;  5CMU A;  1BMF G;  1GN6 A;  4J7K A;  3RN4 A;  3I56 V;  4DW0 A;  3CX5 F;  3ZHQ A;  3OR7 C;  1TUB A;  5FPR A;  4DV2 B;  3ZMZ A;  1W0J G;  2JJ2 G;  4X64 O;  2JIZ G;  4EEQ A;  1R1B A;  4W4L A;  2WLM A;  1TUB B;  4DV7 O;  4P9O A;  4FMT A;  4QGP A;  1DK1 A;  1YIJ V;  3RVZ A;  1BSM A;  4CC6 A;  4HNA B;  1MAB G;  3E89 A;  4YY3 O;  3CXC U;  4JYB A;  4CZZ A;  3T1H O;  4OX9 O;  4D7T A;  3HR0 A;  5LXT A;  2JDI G;  2IW5 A;  2Y0P A;  1FXK B;  2ADQ B;  5DN6 G;  1N36 B;  1QQC A;  4CC5 A;  4FFK A;  2PYJ A;  5H5N A;  4B3S O;  3RGB A;  3JAS B;  1ZWI C;  3FB6 C;  5CBF A;  3THO A;  5FL7 G;  2X6B A;  4ZBM A;  4WFE A;  3GWK C;  1H2K A;  3QNE A;  2XAF A;  1NQT A;  2FKX A;  4ZI7 A;  4IGG A;  5EIB C;  1VF5 B;  5JJJ B;  1XQ8 A;  5DEC A;  4LF8 B;  1H8E G;  3ZHR A;  4JZG A;  3OR6 C;  2VS0 A;  1OJH A;  1IXB A;  3RVY A;  2YDE A;  4XDL A;  2EBO A;  3SPH A;  1MG1 A;  2ZXW B;  3CSX A;  4LF5 O;  3PN1 A;  3CC4 V;  3U11 A;  3CYO A;  3ETG A;  4G27 B;  3WU2 Z;  4WFB V;  2PTM A;  1D5N A;  4J7J A;  2YIA A;  3OEE G;  1VQM V;  1PL0 A;  3D3I A;  2B1I A;  2ZNJ A;  2NN4 A;  2X0L A;  3K0G A;  3P30 A;  4WFA V;  4DR5 O;  1XNQ O;  3UKM A;  3DXR B;  4KHP O;  2ZDI A;  4LF9 B;  1SER A;  4Z1M G;  1SQV H;  1J5E B;  2W6I G;  4PI2 A;  5KHI A;  5L3C A;  1JMK C;  1S5L Z;  5LYJ B;  1KB9 F;  5KX5 B;  1OV9 A;  2ZD9 A;  1PNL A;  4JYA O;  1N8R W;  2UU9 O;  1ORQ C;  2YC0 A;  1BE3 H;  3QO8 A;  4AQY B;  5IJ0 B;  4TV9 A;  1GM7 A;  2A3Q A;  1YI2 V;  3K0D A;  4B3M O;  4GKJ O;  2JRI A;  2QWR B;  3L70 H;  5D5Q A;  4N23 A;  2QDO A;  1YEW A;  2K1E A;  1H8H G;  2Z0A A;  3DC5 A;  3SPG A;  5J2U B;  2IJJ A;  2AGA A;  1I08 A;  1BS3 A;  1M5I A;  3RYI A;  1V54 B;  4DW1 A;  1KP2 A;  3OUF A;  1B3Q A;  5IJ9 B;  3L74 H;  3BAB A;  4CS4 A;  5KHK A;  2RQ6 A;  4RO2 A;  3SPC A;  4YXW G;  3QF7 A;  3FYI B;  2YEV B;  4DR2 B;  4JV5 O;  3MHS C;  1UFI A;  4B08 A;  2CTQ A;  2YIC A;  3F7Y C;  1FFX A;  3U10 A;  3G6B A;  1XBL A;  2F1M A;  1Y6X A;  5BZB A;  2R9I A;  2XAH A;  1W2B U;  1HNZ B;  5B66 Z;  5L3E A;  1NH2 B;  2G38 A;  2HJD A;  2OWO A;  2B9Z A;  4GCZ A;  3DTU B;  4X1K A;  3WFV A;  3E8F A;  3H9V A;  1XMO O;  4IT5 A;  5C8Y A;  3QG5 A;  1M9N A;  1CP9 A;  3F5T A;  5EC2 C;  1N33 O;  3ZRS A;  1L0N H;  3JD2 A;  1R6N A;  4A5U B;  3NXS A;  2QGN A;  1W0K G;  1QLN A;  2IBZ H;  1XI1 A;  2OIG A;  3ABT A;  1T5E A;  1R6K A;  4I0X B;  3ZN0 A;  2Y48 A;  1GRJ A;  3ABL C;  4CBC A;  1I94 O;  2WA4 A;  5J2T B;  4MS2 A;  1AR4 A;  2JS5 A;  5LOV B;  4GUN A;  4R50 A;  4O4H B;  3HKD B;  3T1H B;  3FD9 A;  3FB7 C;  2QR4 A;  4NR1 A;  2Q7E A;  2CAZ C;  4ASU G;  1GN2 A;  4WFG A;  2QM8 A;  5K1X A;  4FM2 A;  1H38 A;  3RYF B;  2F4V B;  1JOY A;  1P4R A;  5JWP A;  2Q73 A;  5GON A;  5DED A;  4JI5 O;  5BMV A;  4LFB O;  3VQV A;  3UM7 A;  2PZS A;  3GB7 C;  2LW1 A;  5KAI Z;  3ASO C;  1I94 B;  1Y74 B;  3E35 A;  5BR8 O;  4JPR A;  2NNU A;  4QJF B;  4DV5 B;  4R7C A;  5JCO A;  3VQW A;  3FB5 C;  5FNV A;  4G28 B;  4TUY A;  2A79 B;  3HPL C;  1P49 A;  4J7Z A;  4H37 A;  5KA5 A;  4WFF A;  4MVM A;  2BTQ A;  1OCR C;  1SF9 A;  2P6J A;  3P3P A;  3AG2 C;  3IJ4 A;  3AG4 B;  5JJN B;  1OCR B;  1QNM A;  2R72 A;  4U7O A;  2E5L O;  2ODM A;  4DV4 B;  2DWD C;  3Q4H B;  1S3J A;  4UCT A;  4LF7 B;  2RMK B;  1SQG A;  4DR7 B;  3HKE A;  2QKA A;  3ZX6 A;  3FX7 A;  4LF4 B;  1SC5 B;  5JCO C;  3OEH G;  5J2T A;  5KAF Z;  4X62 B;  3ASO B;  4I9Q A;  3SYC A;  1ZTE A;  4TSF G;  3D36 A;  4KL1 A;  3E8B A;  4EFE A;  5CBH A;  2UXX A;  4D6T H;  3H1I H;  2F23 A;  4HBN A;  4HYO A;  4LFB B;  1VQ9 V;  1J95 A;  2YXY A;  4KHP B;  3X2Q C;  1VIB A;  1IX9 A;  2DYS B;  3K5L A;  2GTS A;  3ZHT A;  4LWS B;  2DE0 X;  2WLL A;  1FKA O;  4PHZ A;  4JI2 B;  2YIB A;  1RFY A;  4KP4 A;  1JVM A;  4JYC A;  5CA0 B;  3UCS C;  1N32 B;  1N34 O;  1VQN V;  3PJS K;  2F95 B;  4RWU A;  1F51 A;  1BL8 A;  2QEX V;  1GKF A;  4X1I A;  4OPA A;  2WSS G;  2Q69 A;  1XHX A;  4PV1 B;  3D36 C;  5EYP B;  1TVK A;  3RYC B;  4DRX B;  1R3J C;  1M90 W;  4AQY O;  3K03 A;  5IYD O;  3CE2 A;  1GTO A;  1E1R G;  3BA8 A;  1AI5 A;  1Z2G A;  1K4C C;  1NI8 A;  3KCX A;  1Q7Y W;  2W6J G;  1AI7 A;  1SKV A;  5LMU O;  1VP7 A;  3A2F A;  3R65 A;  3ZHU A;  4TT3 G;  4NXM B;  4DR1 O;  2CTW A;  5LXT B;  4LFA O;  4UVB A;  3OM3 B;  4AHC A;  5J9P C;  3RYH A;  4W4K A;  2QA4 V;  2HLD G;  3SR2 C;  4JV5 B;  5IJ0 A;  1XMQ B;  3K5N A;  1S77 D;  1SZX A;  1SQB H;  2FYU H;  4JAV A;  1L1F A;  4MVZ A;  1FYJ A;  4FPP A;  3TK1 A;  2XAS A;  1KYO F;  4DV4 O;  4MVU A;  4QE9 A;  3R66 A;  1JA8 A;  3CRA A;  4HAM A;  1VQ8 V;  1ENV A;  2DMX A;  1Y76 B;  1VQL V;  5E79 Z;  4IL6 Z;  1V54 C;  5B1B C;  4CS3 A;  1BQZ A;  5IWA O;  4UCV A;  4TOI A;  2GTA A;  5C8Y B;  3G6E V;  2WWW A;  3B4S A;  2B5U A;  2UXN A;  2WLL B;  4CH3 A;  2HP8 A;  2QJ1 A;  5GW7 A;  2QTO A;  1SA0 A;  2E3C A;  4X20 B;  2A0L A;  2P90 A;  2E74 B;  2HVK C;  4R6Z A;  4F6E A;  4J41 A;  3TGU H;  4DR4 O;  4JYY A;  1FPO A;  1I5X A;  1HNW O;  1LUV A;  2JGU A;  4LCU C;  3C3T A;  4B3T B;  5LP6 C;  1L0L H;  4EB6 B;  3N2K B;  1JR9 A;  1N0J A;  4DV1 B;  3MDS A;  2OCC C;  1MMM A;  1RM1 B;  3BEH A;  2Q67 A;  1GH6 A;  2EIN B;  4FLX A;  4PA9 A;  4K8X A;  1N33 B;  4AI8 A;  4PA6 A;  1S76 D;  1CEZ A;  3AG3 B;  4BAY A;  4MW3 A;  3T1Y O;  4BW5 A;  2ATK C;  2MK3 A;  1SZT A;  3EFF K;  3W7W A;  5CN0 A;  4LNU A;  4H13 B;  4AIL C;  3OAA G;  3CB2 A;  5EBW C;  4DXW A;  3K06 A;  3FFQ A;  4DV6 B;  4FLV A;  3H01 A;  4TUY B;  4LP8 A;  5FNV B;  2VQF O;  3STL C;  1G4Y B;  3ML0 A;  3BHP A;  5ITZ A;  2O57 A;  4LF5 B;  2P5O A;  4P2Z A;  1NTM H;  4YIP A;  4YJ3 A;  5LYJ A;  1Y67 A;  1NR7 A;  2ITC C;  2BE3 A;  1NVP B;  2DW4 A;  2QWP B;  2ZIN A;  2XND G;  1IZ3 A;  1QVF U;  4NTW A;  4BIU A;  4EB6 A;  4DRX A;  1VAR A;  3B8M A;  1V9P A;  4HZ3 A;  3JCU Z;  2F66 C;  3DC6 A;  2AXT Z;  4I7Z B;  1M1K W;  1VF6 C;  1EZJ A;  1P7B A;  3D3Q A;  1IBM O;  4CH4 A;  3BVO A;  2AZ0 A;  1IBL O;  2ZE8 A;  3J81 N;  5CA1 B;  3HKB B;  4FVM A;  4FJC C;  4O2B B;  2MW2 B;  2XUM A;  1CXZ B;  4DR7 O;  3N2G B;  1DGS A;  4WCE V;  1H2S B;  4DUY B;  4UCS A;  1NR1 A;  4I4T A;  1Q6H A;  1U97 A;  1G1X B;  2P4K A;  2BSK B;  1ZUQ A;  3ZRW A;  3FYE B;  1AJQ A;  3L71 H;  3ZIA G;  3T1Y B;  5JVD B;  1HWY A;  4RAI A;  1NZ6 A;  1UJW B;  3MAQ A;  2D2C B;  4R8C A;  1HDJ A;  4O4L B;  5CB4 A;  3APQ A;  3S3W A;  1MSW D;  3JD0 A;  3K9S A;  2E76 B;  1ZX3 A;  1SRY A;  2K9P A;  1QR9 A;  3RT3 C;  3JAW A;  2Y4U A;  1XL6 A;  1VF7 A;  5KUM A;  3ABM B;  5B3S C;  3B40 A;  2ZR3 A;  1OCC C;  3E86 A;  3GWO A;  5CA3 A;  2A7W A;  3E8H A;  1YZB A;  5IY5 B;  4FLW A;  4I50 A;  3AG1 C;  2LW7 A;  4GKJ B;  1FAF A;  4N21 A;  4IYH A;  3SYO A;  5LHH A;  4H44 B;  1KU9 A;  3L72 H;  1K97 A;  3JD1 A;  1FS0 G;  1S0V A;  1TA8 A;  1K7D A;  1AVM A;  3RYC A;  5F2V O;  2BCC H;  4P30 A;  4XDJ A;  5IJ9 A;  4BW9 A;  1N4C A;  4X1I B;  3KKY A;  1MZF A;  3D8C A;  1IBK O;  4OPH A;  3A8T A;  1CPY A;  1YHQ V;  3JD4 A;  2XAG A;  2RN9 A;  3ZHS A;  4UUJ C;  1AB3 A;  1VEW A;  3O9O A;  3ZMS A;  4TV8 A;  5LGN A;  1EN4 A;  3EXA A;  1QU7 A;  4GX5 A;  1RSO A;  4ZHQ A;  3ZRV A;  1Q82 W;  4UCU A;  2A9H A;  1AJN A;  2UUB B;  4JI0 B;  3CJH A;  1TAE A;  4MTX A;  2PI4 A;  3SJA C;  1OZ0 A;  3TET A;  4X65 B;  2QE7 G;  1KC8 W;  2ETN A;  3FKS G;  2PUS A;  4MTO A;  3VOU A;  3DXR A;  3JAK A;  3EHB B;  3KCY A;  3ZRW B;  4QNH B;  5KA6 A;  4D7S A;  1YDX A;  1H2N A;  1F23 A;  4G2K A;  4QPK A;  5LGU A;  4I9W A;  5H6R A;  3CME V;  4FM0 A;  3SJQ C;  1GN4 A;  4OX9 B;  4DR1 B;  4J9Y B;  2LGQ A;  1BHB A;  1K34 A;  2YSU B;  1GM9 A;  1GO3 F;  1WPX A;  1ZAU A;  2VQE O;  3P3N A;  2IJI A;  3HKB A;  4O2B A;  4EFB A;  2YS8 A;  5LMN B;  1HNX B;  4GKK O;  4LH6 A;  1HR0 B;  2Y69 B;  2W0X A;  2P67 A;  2Q0O C;  4O4I A;  3K5M A;  2KSD A;  1XIL A;  1V55 B;  1EZV H;  2CGO A;  1I7F A;  2P06 A;  4XDK A;  4YHH B;  4DK1 A;  1KMI Z;  1AR1 B;  4JTC B;  1FFX B;  1YTF B;  1VQ4 V;  4NTX A;  1BCC H;  4QIW F;  2EJ7 A;  3JSL A;  2WLK A;  2QTS A;  3ETQ A;  4JI2 O;  3APO A;  4IHJ B;  3RYH B;  2M7W A;  1N32 O;  1RP3 B;  3K9A A;  3ICX A;  2GV9 A;  4LF6 B;  1SQX H;  3VQX A;  2WLI A;  1IBL B;  3OMN B;  5LL6 Y;  1FD9 A;  4JAU A;  4NKG B;  2CH7 A;  4E4E A;  4NXN O;  1NKD A;  1URF A;  1Y66 A;  4FK5 C;  4ZOL A;  1XMO B;  2ZKO A;  5B1A B;  4HNA A;  5IYB O;  4J9Z B;  2DYR C;  3CEI A;  4H0L B;  3AK2 A;  3BPZ A;  2JJ1 G;  1ROP A;  1VQP V;  2ILM A;  4U3F H;  4O4H A;  2JEX A;  2EIM B;  3WB0 A;  1TVK B;  3SGI A;  2XT9 A;  1PV0 A;  3SJC C;  2WLH A;  1MSD A;  4FIP C;  3CD6 V;  1LNQ A;  3W7T A;  4DUY O;  3BA9 A;  5HFM A;  5BR8 B;  3KG2 A;  4NXM O;  2ZE7 A;  4PA4 A;  4IIJ B;  1XRE A;  4X20 A;  5B1A C;  2WLJ A;  4FLZ A;  4O2A B;  4I4T B;  5FPO A;  3K58 A;  1SQQ H;  3LDD A;  4FFB A;  3N2G A;  3OD4 A;  1DF4 A;  2VRZ A;  2UUC B;  1H2M A;  1KD1 W;  5GTI Z;  3FAV B;  1SA0 B;  1BGY H;  2R70 A;  4I55 B;  3L73 H;  2YID A;  4X65 O;  1XEQ A;  2AW9 A;  1YSC A;  1YF2 A;  1RPO A;  3ABK B;  3ZMT A;  2H94 A;  1AJP A;  4F4L A;  4DV0 O;  5EZY B;  3OUS A;  1N34 B;  1HNX O;  4GKK B;  1V55 C;  3LNN A;  4B3T O;  1AI6 A;  4B7K A;  1G8M A;  3ZCC A;  4X89 A;  1IBM B;  3IFX A;  4JI7 B;  2F43 G;  2P22 C;  5JH7 B;  4NVP A;  3CCQ V;  2H3O A;  4DK0 A;  2W0F C;  4X66 O;  2KG7 A;  1AP5 A;  3CJH B;  2GSM B;  1O9H A;  1KQS U;  4UV9 A;  3CRR A;  4DUZ O;  1EBO A;  1KKC A;  4GYC B;  1R3L C;  1PNM A;  1X59 A;  2L6L A;  5LGT A;  2V1D A;  3JAL A;  4IHJ A;  3KZI Z;  2X6A A;  3AK1 A;  4YIO A;  1FXK A;  1NJI W;  5KMG B;  2ZCE A;  3CXH F;  1WPB A;  1M56 C;  5EYP A;  3CCJ V;  1M4U A;  5A2Q N;  1NTK H;  5H2F Z;  3U0Z A;  2Q4P A;  4NXN B;  1Q5O A;  1QLE C;  3M99 B;  4UCR A;  1B06 A;  3K59 A;  4DUZ B;  3CP1 A;  2C2A A;  1WJZ A;  3WG7 B;  2PYL A;  5KLV H;  2DQ0 A;  1M57 B;  1WA8 A;  3OGC C;  1IUR A;  2LFS A;  2UXB O;  3HB3 B;  3RWR D;  4DR5 B;  1XNQ B;  4Q20 A;  2Q5Z A;  2ZE6 A;  5GTH Z;  4C7U A;  5JQG A;  2F93 B;  3UQ8 A;  1MA1 A;  4JI1 O;  1RPR A;  4KFM A;  2ARH A;  1OHH G;  2GBO A;  2BOC C;  1NU1 H;  1JFF A;  1O9G A;  2EX3 A;  2YXH A;  4MSW C;  3G67 A;  4K0K O;  4LC1 A;  4DR3 O;  2UU9 B;  4BIZ A;  1HR0 O;  1PKX A;  5LP6 A;  2KG7 B;  2QWO B;  1DLB A;  3TJT A;  3CCL V;  3JAK B;  1QBZ A;  2EZO A;  5LA6 B;  2OCH A;  5D5P A;  2EIJ C;  1AIL A;  4UB6 Z;  3EVK A;  3O65 A;  3JAR A;  4WBN A;  2Q6A A;  1LUW A;  2NR5 A;  3K79 A;  3E8G A;  3ZMU A;  1MZE A;  4BWA A;  3ZED A;  1Q6I A;  2WPD G;  2ZIO A;  1KKD A;  2VWK A;  2FTK A;  1KUQ A;  4PD4 F;  5EIB D;  1K33 A;  3B77 A;  1F4M A;  3B09 A;  1VQ6 V;  4ZHQ B;  1JCH A;  3JAS A;  4Z1V A;  4LF6 O;  4MTF A;  2EIL B;  1OCO C;  3WB1 A;  1F7Y A;  3TXQ A;  4JF3 A;  3F5W C;  3ZBH A;  3I5D A;  3CCS V;  4LF4 O;  4J11 A;  4MVO A;  3OMI B;  1ZSP A;  2JS3 A;  1VMG A;  3MD0 A;  3ETD A;  2WLI B;  1VQO V;  5IDJ A;  1OCZ C;  1XNR O;  4RUF A;  3C3S A;  4DV3 B;  2M6Y A;  5L3B A;  2XTA A;  4YJ2 B;  3H1J H;  2FL4 A;  4DV6 O;  4LR3 A;  3N27 A;  4MVS A;  4JGS A;  3VBB A;  5H6Q A;  3TCU A;  2XAQ A;  4YJ3 B;  2UXB B;  3AEI A;  1NH2 D;  4CH5 A;  1FJG O;  3AK3 A;  4UCO A;  3JCZ A;  1Q81 W;  1A32 A;  1ZL8 B;  4DR3 B;  3JAM N;  4PA3 A;  4B3R B;  3CCV V;  3SYP A;  5B1N A;  4DV3 O;  3IAY A;  4OXS A;  1PPJ H;  1YIT V;  1W59 A;  4GZR B;  2CGN A;  1MOF A;  4KXR A;  2Q7H A;  2ZT9 B;  4JI4 B;  1XDC A;  3K3W A;  1B6Q A;  3GVM A;  5L3D A;  3JAW B;  2HR3 A;  3J7A U;  5EC1 C;  4UVA A;  2OTJ V;  1SQP H;  4JZ2 A;  1K4D C;  2AHZ A;  1ZL8 A;  4Z2W A;  4ABM A;  3ASN C;  2PY5 A;  4DO2 A;  3JAT B;  5K1P A;  5H9C A;  1Q90 D;  3T4D A;  2EIK B;  3OTO B;  4I0X A;  4JI6 O;  5CB4 B;  3BY6 A;  3CC7 V;  4PDR A;  4WBN B;  4EKW A;  1S5H C;  3AG7 A;  4PA7 A;  2KQX A;  4PDM A;  2BSK A;  3L75 H;  1PM9 A;  5EBL C;  4TQF A;  2Y4T A;  4JI5 B;  4IYI A;  2H8P C;  2HEP A;  2QKS A;  3QVN A;  5L3G A;  2CE4 A;  3ZS8 C;  4UB8 Z;  3K5O A;  1COW G;  2NLJ C;  2DJV A;  1QVG U;  3NR7 A;  3E83 A;  3T4Z A;  4PDV A;  1GMG A;  4UFZ A;  4DV5 O;  4GX0 A;  1AP6 A;  4FLY A;  4TWK A;  2A06 H;  2V4D A;  3AG3 C;  3C90 A;  1KEC A;  2EIN C;  2DQ3 A;  4UVC A;  1RM1 C;  2YEV A;  2OCC B;  3OT7 A;  5L3F A;  5ITZ B;  4X66 B;  2UXD B;  4WFH A;  1BQ0 A;  2P7T C;  5LP6 B;  1YJW V;  4B3R O;  3HKC A;  1P7G A;  1Q43 A;  1SS3 A;  4MVQ A;  4DV1 O;  1QR8 A;  3CCU V;  2CDY A;  1N36 O;  4I5S A;  1US6 A;  4DV0 B;  1FJG B;  4I50 B;  4LF7 O;  5IWA B;  3ZHV A;  4J80 A;  3BAA A;  5BXZ A;  3BFR A;  4O4J A;  3W7S A;  4O4J B;  1IBK B;  1WN7 A;  5C93 A;  1IDS A;  1RSO B;  4X8A A;  3LNM B;  1NT2 B;  3IC9 A;  4LFC B;  5DM6 V;  4CS2 A;  1Y4M A;  3ZRX A;  1GM8 A;  1HNZ O;  3CCE V;  1XNR B;  5B1B B;  5KHJ A;  2ZDI C;  5A9G A;  4X1Y A;  2N04 A;  1NVP D;  1HNW B;  2RCV A;  2P4V A;  3ZN1 A;  1K8A W;  4GT1 A;  1X4T A;  3CC2 V;  1SQF A;  2LJ2 A;  1QHT A;  5KMG A;  1D2D A;  5B5E Z;  2EIK C;  1EFR G;  4ZKI A;  3SYQ A;  3SPI A;  3ASN B;  4OGQ B;  2QM7 A;  1KBH A;  3LDC A;  5CBG A;  3S3X A;  2QKC A;  1K5Q A;  4NB5 A;  2JK5 C;  4TQD A;  2WA3 A;  4MT8 A;  1IXM A;  3QO7 A;  4LWS A;  2YIB D;  4O2A A;  4X1K B;  2X7R B;  3M7M X;  4U3J A;  2ZM6 O;  1R6T A;  4FLT A;  1K92 A;  1WB7 A;  1SET A;  3UT5 B;  2UXC O;  1Y76 A;  3SPJ A;  1MNG A;  1E1Q G;  3LSS A;  3I55 V;  4JTA B;  5EBM C;  3LSU A;  3G4S V;  2VQE B;  1YJ9 V;  1PL4 A;  3OFN G;  1NTZ H;  5HFL A;  4ZI7 B;  2UUA B;  4FLU A;  1DTO A;  1THZ A;  3P32 A;  2D3O W;  5IYC O; 
#chains in the Genus database with same CATH homology
 2JIZ G;  2QA4 V;  3LDD A;  2HLD G;  4XBF A;  2WLM A;  4P9O A;  1OCZ B;  1DF4 A;  4FMT A;  4PEL A;  1YIJ V;  1KD1 W;  2OT5 A;  2PI5 A;  1S77 D;  3RVZ A;  4JAV A;  1L1F A;  4MVZ A;  1MAB G;  3E89 A;  3CXC U;  4FPP A;  3TK1 A;  2XAS A;  4JYB A;  2ZQM A;  4CZZ A;  2V7Q G;  4MVU A;  1YSC A;  3ABK B;  1RPO A;  3ZMT A;  2H94 A;  4QE9 A;  2JDI G;  2DYS C;  1OCO B;  4GX2 A;  2EIL C;  1AJP A;  4HAM A;  2IW5 A;  1VQ8 V;  1ENV A;  4F4L A;  1VQL V;  3X2Q B;  1FXK B;  5E1A C;  5DN6 G;  3OUS A;  1V54 C;  3F7V C;  5B1B C;  2Q68 A;  1V55 C;  3ABU A;  1AI6 A;  3G6E V;  1G8M A;  3ZCC A;  4X89 A;  2WWW A;  3IFX A;  2F43 G;  2B5U A;  2UXN A;  2WLL B;  5IYC O;  5GW7 A;  2QTO A;  3CCQ V;  1ZWI C;  3FB6 C;  5CBF A;  2W0F C;  5FL7 G;  2X6B A;  2A0L A;  2EIJ B;  4WFE A;  2GSM B;  2P90 A;  3IC7 A;  3QNE A;  4ZBM A;  2XAF A;  1NQT A;  2Z5U A;  1KQS U;  4UV9 A;  1PD3 A;  2HVK C;  4R6Z A;  1EBO A;  1R3L C;  1K3E A;  1PNM A;  3OW2 U;  5LGT A;  1H8E G;  1I5X A;  2V1D A;  4LCU C;  3OR6 C;  3RVY A;  2X6A A;  4XDL A;  2EBO A;  3SPH A;  1FXK A;  1MG1 A;  2ZXW B;  3A0R A;  3AG4 C;  1NJI W;  2HKO A;  3CC4 V;  3AG2 B;  2OCC C;  1M56 C;  3CCJ V;  3CYO A;  3ETG A;  1RM1 B;  3BEH A;  1WLE A;  2Q67 A;  4X88 A;  2EIN B;  1QLE C;  4G27 B;  3M99 B;  4PA9 A;  4WFB V;  1H2G A;  4PA6 A;  1S76 D;  3OEE G;  3CP1 A;  3AG3 B;  1VQM V;  1CEZ A;  2C2A A;  2LP7 A;  1FXV A;  4BAY A;  1PL0 A;  4MW3 A;  1M57 C;  3WG7 B;  4BW5 A;  2DQ0 A;  3WG7 C;  1M57 B;  2ATK C;  2MK3 A;  1SZT A;  3D3I A;  3EFF K;  3OGC C;  3W7W A;  5CN0 A;  2LFS A;  2B1I A;  3OAA G;  5EBW C;  4DXW A;  2X0L A;  3HB3 B;  3K06 A;  4Q20 A;  1QLE B;  3K0G A;  3QO5 A;  3P30 A;  4PDL A;  3RBZ A;  4WFA V;  1K9M W;  4JAS A;  2DWE C;  3UKM A;  3H01 A;  1M56 B;  4LP8 A;  1RPR A;  2ZDI A;  4KFM A;  4LBE C;  4MVR A;  2IJH A;  1SER A;  4Z1M G;  3STL C;  1G4Y B;  1OHH G;  3ML0 A;  2BOC C;  1S72 V;  2B1G A;  2W6I G;  4P2Z A;  2XAJ A;  4MSW C;  5L3C A;  3FB8 C;  1NR7 A;  2ITC C;  2ZD9 A;  4LC1 A;  1NVP B;  2DW4 A;  1PNL A;  1SES A;  3ETE A;  4BIZ A;  1PKX A;  1VQ7 V;  1N8R W;  2XND G;  1ORQ C;  1QVF U;  3QO8 A;  1DLB A;  3CCL V;  4BIU A;  1QBZ A;  2EZO A;  1GM7 A;  2EIJ C;  3B8M A;  1R3I C;  3K0D A;  1YI2 V;  3CPW U;  4HZ3 A;  4N23 A;  2Q6A A;  2K1E A;  1H8H G;  3K79 A;  3E8G A;  3SPG A;  3ZMU A;  3CCR V;  2IJJ A;  3K08 A;  4E2L A;  1M1K W;  4WF9 V;  2WPD G;  1KKD A;  1EZJ A;  4RQE A;  1P7B A;  2IH1 C;  2FTK A;  3ABL B;  1V54 B;  1KP2 A;  3OUF A;  3CMA V;  1K33 A;  3B77 A;  1YTF D;  1F4M A;  4FJC C;  1VQ6 V;  1JCH A;  4RO2 A;  3SPC A;  4MTF A;  2EIL B;  1OCO C;  4YXW G;  4WCE V;  3FYI B;  3ABK C;  1JX9 A;  2YEV B;  1NR1 A;  3F5W C;  4JF3 A;  4JTD B;  3MHS C;  1FXH A;  3W7U A;  3CCS V;  4GX1 A;  3ZRW A;  4MVO A;  3OMI B;  3F7Y C;  3FYE B;  1AJQ A;  3ZIA G;  1BHA A;  1HWY A;  3MD0 A;  3JYC A;  2LFR A;  3ETD A;  4RAI A;  2WLI B;  1NBM G;  1UJW B;  1VQO V;  5IDJ A;  1OCZ C;  4R8C A;  5BZB A;  2R9I A;  4UV8 A;  2XAH A;  1E79 G;  1W2B U;  1MSW D;  1ARO P;  4RUF A;  3JD0 A;  5L3E A;  1NH2 B;  5L3B A;  1SRY A;  1JPX A;  1QR9 A;  4MVS A;  3JD3 A;  4JGS A;  2HJF C;  2KB1 A;  3K04 A;  2WLN A;  3VBB A;  5H6Q A;  3TCU A;  2XAQ A;  5LBQ A;  4GCZ A;  3AEI A;  1NH2 D;  3DTU B;  1XL6 A;  2AHY A;  5KUM A;  3ABM B;  3WFV A;  5B3S C;  3JCZ A;  3E8F A;  1Q81 W;  3ZMV A;  2ZR3 A;  1OCC C;  3W7X A;  3E86 A;  3GWO A;  5CA3 A;  1M9N A;  1CP9 A;  5EC2 C;  3E8H A;  3ZRS A;  4P9P A;  4PA3 A;  3JD2 A;  2EIM C;  1R6N A;  3CCV V;  3NXS A;  3SYP A;  5IY5 B;  5B1N A;  1W0K G;  1QLN A;  1K5S A;  3B8N A;  4OXS A;  1R3K C;  3ABT A;  1YIT V;  1R6K A;  3AG1 C;  2DYR B;  3ZN0 A;  1MOF A;  2Y48 A;  4N21 A;  3ABL C;  4CBC A;  2HG5 C;  3K3W A;  3SYO A;  1B6Q A;  5L3D A;  5LHH A;  2HR3 A;  5EC1 C;  4QPJ A;  3LUT B;  4MS2 A;  1K97 A;  4UVA A;  3JD1 A;  2OTJ V;  1K4D C;  2AHZ A;  4R50 A;  2XOK G;  2GHY A;  1FS0 G;  1S0V A;  1K7D A;  3ASN C;  3FB7 C;  3IGA C;  4DO2 A;  2HVJ C;  5H9C A;  3T4D A;  2EIK B;  3ZJZ A;  1QCE A;  4P30 A;  4XDJ A;  3BY6 A;  4L87 A;  3CC7 V;  4PDR A;  4ASU G;  4WFG A;  2QM8 A;  4EKW A;  1S5H C;  4RUE A;  2ZR2 A;  1F4N A;  2Z3Y A;  5LHG A;  1H38 A;  2HFE C;  1CPY A;  1YHQ V;  3JD4 A;  4PA7 A;  1JOY A;  2XAG A;  4PDM A;  1P4R A;  4UUJ C;  3LSQ A;  5EBL C;  1JJ2 U;  3ZMS A;  5LGN A;  2H8P C;  5LHI A;  2QKS A;  1K73 W;  4GX5 A;  3ZRV A;  5L3G A;  1Q82 W;  4RQF A;  5KUK A;  2A9H A;  1AJN A;  5EK0 A;  3UM7 A;  2IU0 A;  3GB7 C;  4MTX A;  2PI4 A;  3STZ C;  2Y69 C;  3ASO C;  1OZ0 A;  3TET A;  1COW G;  2NLJ C;  1QVG U;  3E35 A;  3LDE A;  2QE7 G;  3E83 A;  4JPR A;  2NNU A;  4QJF B;  1KC8 W;  3T4Z A;  4PDV A;  4MTG A;  1GMG A;  4R7C A;  3FKS G;  4GX0 A;  3FB5 C;  4TWK A;  4G28 B;  4MTO A;  3CCM V;  3VOU A;  3AG3 C;  3DGE A;  2A79 B;  3SYA A;  3EHB B;  1KEC A;  3HPL C;  3ZRW B;  2EIN C;  2DQ3 A;  4QNH B;  4H37 A;  5KA5 A;  4UVC A;  4WFF A;  1RM1 C;  2YEV A;  1PNK A;  5KA6 A;  1DF5 A;  4MVM A;  3T1C A;  1FFT B;  1OCR C;  2OCC B;  2P6J A;  1F23 A;  3AG2 C;  4G2K A;  2CK3 G;  2ZXW C;  3AG4 B;  1GK9 A;  4QPK A;  5L3F A;  4WFH A;  5LGU A;  4I9W A;  1OCR B;  4QE7 A;  5H6R A;  4H33 A;  3CME V;  2P7T C;  3MHH C;  4U7O A;  3E2E A;  3SJQ C;  2IH3 C;  1YJW V;  2IJK A;  5B1O A;  4J9Y B;  2DWD C;  1BHB A;  1S3J A;  1K34 A;  4MVQ A;  2YSU B;  1GM9 A;  1GO3 F;  1WPX A;  1AI4 A;  1QR8 A;  3CCU V;  4I5S A;  2IJI A;  2WAM A;  3G71 V;  3W7S A;  3OEH G;  5J9P C;  2Y69 B;  2JEU A;  3ASO B;  3SYC A;  5C93 A;  4X8A A;  2P67 A;  3LNM B;  3D36 A;  4TSF G;  4UXN A;  3E8B A;  5DM6 V;  5CBH A;  4KUM A;  1Y4M A;  1V55 B;  2UXX A;  3ZRX A;  1GM8 A;  4XDK A;  3CCE V;  5B1B B;  4HYO A;  1VQ9 V;  2ZDI C;  1J95 A;  1FXK C;  4JTC B;  1AR1 B;  3X2Q C;  1YTF B;  1VQ4 V;  2DYS B;  1NVP D;  4QIW F;  2BOB C;  2R9R B;  2WLK A;  2WLL A;  3ZN1 A;  1K8A W;  4GT1 A;  2M7W A;  2EZP A;  2OTL V;  3CC2 V;  4KP4 A;  1JVM A;  1KP3 A;  3OE7 G;  4JYC A;  3K9A A;  2ITD C;  2EIK C;  1EFR G;  2WLI A;  4ZKI A;  1TUE B;  3SYQ A;  1YJN V;  3OMN B;  3SPI A;  2EJR A;  3ASN B;  4U7N A;  1VQN V;  2QM7 A;  4JAU A;  3PJS K;  2IU3 A;  3LDC A;  1F51 A;  1BL8 A;  5CBG A;  2QEX V;  1GKF A;  1VQ5 V;  4MW8 A;  1NKD A;  1K5Q A;  1Y66 A;  4FK5 C;  2JK5 C;  2WSS G;  2Q69 A;  5B1A B;  4MT8 A;  1I5Y A;  1R73 A;  5IYB O;  4J9Z B;  1IXM A;  2DYR C;  3QO7 A;  3AG1 B;  2X7R B;  2JJ1 G;  1ROP A;  1VQP V;  1VQK V;  1R3J C;  1M90 W;  1JQ0 A;  1K92 A;  3K03 A;  2JEX A;  5IY5 C;  5IYD O;  1GTO A;  3T2M A;  1SET A;  2EIM B;  3RW0 A;  1E1R G;  3OMA B;  3SPJ A;  2WLH A;  1E1Q G;  1AI5 A;  2X6C A;  3LSS A;  1K4C C;  4FIP C;  3I55 V;  1LNQ A;  1OCC B;  3CD6 V;  3W7T A;  1XL4 A;  4JTA B;  5EBM C;  5B3S B;  1Q7Y W;  2W6J G;  3ABM C;  1AI7 A;  3G4S V;  1Q86 W;  1YJ9 V;  5HFM A;  5CMU A;  1BMF G;  3OFN G;  3KG2 A;  5HFL A;  4PA4 A;  3R65 A;  3I56 V;  4TT3 G;  2D3O W;  3OR7 C;  5B1A C;  2WLJ A;  1DTO A;  4UVB A;  3OM3 B;  1THZ A;  3P32 A;  3ZMZ A;  1W0J G;  2JJ2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...