4PA4A

Structure of navms in complex with channel blocking compound
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa4A00
3IGAC 1XL4A 2WLLA 4PA6A 4X88A 4MVRA 3F7VC 3K0DA 3SPCA 3IFXA 2QKSA 3LDDA 3K04A 5E1AC 1LNQA 4MW8A 1OCZC 1JVMA 4R6ZA 4XDJA 3T2MA 1KKDA 1K4DC 3K0GA 2K1EA 4JTCB 2YEVA 3AG3C 3K06A 3AG2C 3OUFA 3R65A 4MW3A 2EILC 2EINC 4R50A 4WFFA 4MVSA 3E8FA 3JYCA 4MVOA 4JTDB 4HZ3A 2P7TC 4MSWC 3ZJZA 3RVZA 3SYOA 1R3IC 2WLKA 3E8HA 4WFGA 2R9RB 4PA4A 1R3LC 4GX2A 4HYOA 5EC1C 2X6CA 5J9PC 4PA3A 2HG5C 5EC2C 2X6BA 2WLMA 2AHYA 2H8PC 2ZXWC 3SJQC 2KB1A 3SPGA 3T4DA 5EBLC 4MTOA 1K4CC 4MVQA 5EK0A 3LNMB 1BL8A 2NLJC 3OR6C 1ZWIC 4MVUA 3SPIA 3STLC 3GB7C 1V54C 3PJSK 2ITDC 5B3SC 2WLLB 2HVKC 4JTAB 3K08A 4PA9A 4WFHA 3SYPA 5EBWC 3SYCA 2HFEC 2AHZA 1XL6A 3E83A 3OGCC 3WG7C 3BEHA 4PDMA 5CBGA 3LUTB 5B1BC 3E8GA 3LDCA 2QTOA 3OUSA 3K03A 4MS2A 1J95A 4R8CA 4RAIA 4PDLA 3T1CA 4XDKA 4LBEC 4GX1A 1ORQC 2DYSC 2Y69C 4EKWA 5IY5C 3FB8C 4UUJC 4H37A 3UM7A 4X89A 4X8AA 3FB6C 3ABKC 2Q67A 5KUMA 4H33A 1R3KC 2HJFC 3SPJA 4RUEA 3T4ZA 3ABLC 2WLIA 4BW5A 2BOBC 2EIMC 2A79B 4R7CA 2W0FC 5B1AC 3VOUA 1P7BA 2DWEC 2IH3C 1OCCC 1OCOC 1M56C 2DYRC 3E86A 4GX5A 3RBZA 3FB7C 2Q68A 4MVMA 2IH1C 4RUFA 5EBMC 1M57C 4OXSA 1V55C 4J9ZB 3OR7C 1G4YB 4J9YB 3ZRSA 3SPHA 4DXWA 4WFEA 4LCUC 3UKMA 2A0LA 3HPLC 4CBCA 2ZD9A 4PDRA 4QE7A 4MTGA 2EIKC 2Q6AA 4P30A 3RVYA 2Q69A 3ABMC 4PA7A 3EFFK 4P9OA 2JK5C 4F4LA 4TWKA 3F5WC 3FB5C 3TCUA 4MVZA 3SYAA 3F7YC 3KG2A 2OCCC 4I9WA 3AG4C 1S5HC 4RO2A 4P9PA 4QNHB 2A9HA 3E8BA 4XDLA 2ITCC 2BOCC 1OCRC 2DWDC 4PDVA 4QE9A 3STZC 4G28B 2WLHA 3TETA 3LDEA 3AG1C 5CBHA 2WLJA 2WLIB 2HVJC 4MTFA 3SYQA 3ASOC 5KUKA 2X6AA 2ATKC 4KFMA 2EIJC 4P2ZA 1QLEC 1R3JC 3ASNC 4ZBMA 3RW0A 2WLNA 3E89A 4LP8A 5BZBA 3X2QC 4GX0A 5CBFA 4G27B
chains in the Genus database with same CATH superfamily
3HKDA 1XL4A 5GTIZ 1S76D 4NVPA 3A0BZ 5IYBO 1MMMA 1OCZC 3MAQA 4B3RO 1K4DC 3K5NA 1VQOV 2EILC 1MG1A 4TQDA 5JVDB 5KHKA 2BTQA 5KLVH 1EFRG 5HFLA 3JARB 1HP8A 1L0NH 4PA4A 4KXRA 2A3QA 3G67A 1NH2D 5LMUO 1F4NA 5H6QA 3I5DA 2ZNJA 3AK1A 4GUNA 2FL4A 2OCHA 2WLLB 1Q6UA 4LFBB 3AK3A 2UXNA 3WG7C 5CA0B 1SC5B 3LDCA 2QTOA 4D6TH 4X1IA 4LF5B 3RYCB 4YHHB 5IY5C 1S3JA 1GM9A 4GKJO 3ETEA 3FB6C 1ZUQA 3ABTA 4LFCB 1SETA 4BW5A 1KD1W 1RSOB 1VQNV 1AI6A 1M56C 1A32A 3VBBA 1GKFA 3K58A 4CS2A 2UUCO 4JI1O 1H2LA 1IXBA 1JOYA 1G4YB 4DR1O 2NN4A 3ZHVA 2P06A 1DF5A 4CBCA 4MTGA 3RVYA 4UCTA 1YI2V 4U3FH 2RJZA 5LBQA 1IBLB 4YJ3A 4DW0A 3H1LH 3F7YC 2CTWA 4FFKA 1CEZA 4PJ0Z 3UT5A 5LHIA 3J81N 1K97A 3L75H 1EBOA 3T1HO 1EM1A 3DC6A 1YCIA 1YHQV 5KUKA 4FM0A 2ZCEA 3K5OA 4IYIA 5KA6A 4KFMA 3THOA 2QE7G 1FS0G 3MHSC 3ZRXA 3E89A 2EBOA 4B3SO 4MTXA 3IAYA 4JI2B 4FLTA 3F7VC 4LNUB 4JAVA 1SRYA 4TV9B 3AG1B 4JGSA 4DR7O 3RT3C 2JDIG 5KX5B 4MT8A 2XAQA 1F23A 3OUFA 4ZOLB 1WPBA 3U10A 2N05A 1TAEA 4JTDB 1AP6A 1IBMO 1KKCA 2Q7GA 5KHJA 5LA6B 1P49A 4NXMB 4J7JA 1NT2B 1XDCA 4TUYB 1OZ0A 5CMUA 1TUBA 2AHYA 5H2FZ 3ZMUA 1QR9A 3LNMB 1BS3A 3GB7C 3JATA 4J80A 5B3SC 3HKDB 3CCMV 2XAHA 3ICXA 3JASA 2AHZA 2E3CA 3WU2Z 4HBNA 1YF2A 3LUTB 3CMAV 4X20A 4MS2A 1QU7A 2G38A 1HR0O 4JI5B 4I7ZB 3IC7A 3CP1A 3FB8C 4DR2O 1JX9A 2HLDG 4UUJC 2BTQB 1BT8A 4JF3A 3E35A 4FVMA 2YUAA 4GT1A 3OMIB 4GX5A 1M9NA 2RCVA 1M57C 4OXSA 4TT3G 3LSSA 3KCXA 2NR5A 4WFEA 3FX7A 5IYCO 5FPOA 2LP7A 2P6JA 1G8MA 4QJFB 2EIMB 3SYAA 4X1IB 2OCCC 1BCCH 3AG4C 3RYFA 4L87A 1P84F 3UCSC 3ZN0A 1M93A 3Q4HA 1N34O 2GHYA 1JCHA 2R72A 2UU9O 4LF7O 4DV2O 2K9PA 3ABMB 2YIBD 1AILA 1BMFG 2VQFB 1FXKA 1WNSA 1X59A 3L9DA 5KAIZ 4KHPB 4DV4O 2Y48A 3CCLV 1S77D 2F23A 4UCSA 2PYJA 4Z1MG 2L35A 4JI0B 1PL4A 4B3RB 4YJ3B 4I50A 2JS5A 4LH7A 3AG2C 5L3DA 1BGYH 3UT5B 1XNRB 3JD3A 4N23A 3JD0A 3BY6A 4UB6Z 3T1YO 1YJNV 1VQKV 4DRXA 1W0JG 1PNKA 1MABG 2YSUB 3ETQA 3ML0A 1OV9A 3TJTA 4DK0A 4OX9B 1XBLA 3ETDA 3SYPA 5EBWC 4ABMA 2F66C 1EZJA 1Q8IA 3L71H 3SR2C 3GWOA 1K73W 1H2KA 3B40A 2F4VO 4GKJB 4EKWA 5BMVA 2P67A 4X66O 3H1IH 1EZVH 1YZBA 4X1KA 3J7AU 3O65A 4DUZO 1K5QA 2CUGA 1AR5A 3OTOB 2UXDO 2N04A 1AVMA 1TUBB 1Q90D 1K34A 2JEXA 3FB7C 4DR1B 3JATB 3DXRA 5DM6V 4LF4O 3SPHA 2X0LA 2A0LA 4Z2WA 4WCEV 3JASB 4JI7O 2CH7A 4DYLA 4TWKA 4X20B 3CCSV 5ITZA 5B1AB 2ARHA 3CC4V 3W7UA 1OCRC 2DWDC 3T1HB 3C3TA 3ZRWA 5JWPA 1L8DA 1Z5WA 3ZEDA 2UUBO 1GRJA 3ZS8C 4B3MO 2QA4V 1YXBA 2E5LO 4B3SB 1QLEC 3ASNC 4ZBMA 3RW0A 1ENVA 1S72V 4DR3O 3IFXA 2EILB 3G4SV 2PGGA 1KECA 2N74A 2BE3A 5H6RA 3ASOB 4GCZA 4I5SA 2XHBA 1RPRA 3BA8A 2B1GA 1IBMB 3RYFB 2UXCB 4LFAO 4WBNA 2ADQB 3Q4HB 2UUAO 2ZKOA 3BA9A 3LSUA 1NKDA 3SYOA 5E79Z 2XAFA 4WFGA 2ZIMA 3CCRV 1XUQA 2QM4A 3K79A 2Q7HA 5LXTA 1NTZH 5JH7A 1FXKB 2OTJV 1N0JA 2E74B 1BHBA 5EK0A 3HR0A 4LF8B 1FFTB 1AR4A 1Q6HA 4BAYA 3TK1A 2CK3G 2M6YA 2A06H 1XL6A 5IJ9A 3SJAC 4I50B 4DR2B 4XDKA 4LBEC 4CH5A 1BHAA 2DYSC 3P30A 2EZPA 1Q43A 3FFQA 1M56B 2Y0IA 4DRXB 4X1YA 1SQPH 2A79B 4ZHQA 3VOUA 2GV9A 1NVPB 1URFA 3RN4A 2XTAA 3WB0A 1KP3A 2OIEA 4H13B 3ZRSA 4FLXA 1M4UA 4IYHA 4LCUC 4EFBA 2Q6AA 3EFFK 3FAVA 4ZKIA 4GZRB 2GBOA 1DLBA 5D5QA 5BMVB 1N34B 4WFBV 2HR3A 1P7GA 4X1KB 2UU9B 4LF7B 4X64B 4DV2B 4CC6A 3CHXA 1N32B 1PM9A 3MD0A 2E75B 4TV8A 4FLZA 3G6BA 3FD9A 2CE4A 1WPXA 4JI6B 4I9QA 1Y76A 4UB8Z 2RN9A 2ATKC 4DV4B 4J7KA 1NJIW 1GN3A 3CMEV 3DXRB 4NXNB 1DF4A 2IBZH 4JYAO 4JI4O 2CH7B 2C2AA 3OMNB 2FTKA 5E1AC 5ITZB 1XHZA 1YTFD 3ABUA 4MVSA 2R9AA 3T1YB 3ZRWB 4NTXA 2GTSA 1L1FA 5EC2C 1I5YA 3H9VA 5B3SB 1EN6A 5IT9N 3T4DA 4U7OA 3H1KH 1EN5A 4IHJA 3QO5A 2NNUA 5EZYA 4DR5O 1SZXA 4PDMA 2F4VB 1Z2GA 4DR4O 4BWAA 4WBNB 4E4EA 1VIBA 2UXDB 1FJGO 4FLWA 3M99B 1FXHA 3OD4A 3EVKA 5LXTB 4FLYA 5JH7B 4X65B 2W6JG 5KHIA 1Y66A 3E86A 1H2NA 4JPRA 4LF4B 2Q68A 1LR1A 3OGIB 4E2LA 4JI7B 1XEQA 2QKAA 3E2EA 1AP5A 2OCCB 3KKYA 3ZHTA 3OEEG 3AG4B 5IJ9B 4NKGB 1O9HA 5L3EA 3H1JH 4WF9V 3BFRA 4PI0A 4K0KB 2LQTA 3K9AA 2RQ6A 3VQYA 2A9HA 4UVBA 1VQ5V 2P4KA 1D5AA 2UUBB 4B3MB 4X1YB 4LR3A 4ZHQB 2QEXV 2YIAA 3B4SA 2X6AA 3QO8A 1RM1B 4JYYA 4J41A 5L3FA 3WB1A 4FLUA 3X2QC 1VEWA 3CRMA 4DR3B 4K8XA 1XNQB 5K1PA 3SDLA 2XNDG 4MVRA 4X62O 3A0RA 3AG2B 1PV0A 5FLXN 4ICGA 3FAVB 2VQEB 4FZ1A 1S0VA 2KKWA 4LF9B 2JRIA 3K0GA 4TOIA 4LFAB 3K06A 3ETGA 3R65A 3MHHC 3CCJV 4JV5B 1QBZA 1B3QA 4TV8B 4NTWA 1WN7A 4JI3O 1Y76B 2EULA 2GSMB 5KA5A 4PD4F 2P4VA 3DSQA 1VMGA 4K35A 5B1BC 3TXSA 4PDLA 4YJ2A 1R6KA 4FJCC 3CRRA 2AZ2A 4H37A 1V54B 1FAFA 3HKBA 1BE3H 2HJFC 1H8HG 2ADPA 5LHGA 1KU9A 1YJ9V 5F2VO 5DN6G 3ZHQA 4U7NA 4IHJB 1KBHA 3RYHA 3DTUB 4O4JA 5EZYB 3QO7A 2RNBA 3ABKB 2LW7A 1RP3B 2IU3A 2DQ3A 1OCRB 5LGTA 3TGUH 1PNMA 3JD1A 4P9PA 4NR1A 3W7WA 3BABA 1V55B 3CXCU 2HVJC 3ASNB 2FKXA 4FM2A 5C93A 1VQPV 1D2DA 4JZGA 4JYAB 4JI4B 1FPOA 3CRQA 4HNAA 3ZBHA 4DV6O 4EEQA 1NH2B 4KL1A 3CJHA 4OPHA 4A5UB 4UCUA 5LP6A 2DJVA 1B6QA 1VQ8V 4BW9A 1JPXA 1DTOA 3PN1A 3QG5A 5L3BA 1VQ7V 1SS3A 1KMIZ 3OFNG 4OPAA 4YY3O 4GX2A 2L6LA 3HB3B 2YI8A 4DV7O 4QPKA 4U3JA 5LGNA 4DV3O 4MVUA 2QWQB 3OR6C 2EINB 4DR5B 3PJSK 3JSLA 4IT5A 1YSCA 2YIBA 4DR4B 1M1KW 4GX1A 2CAZC 4UCRA 2QKCA 1FJGB 3CWBH 3UM7A 1JFFA 4X89A 1N33B 1LUVA 3UO3A 4KP4A 1YITV 2BOBC 5KHGA 4FM1A 2VWJA 4QGPA 4DV0O 3CD6V 1W2BU 2IJKA 4MVMA 5EBMC 4J9ZB 4DR6B 3TXQA 5LHHA 4PDRA 1IBKO 4QE7A 4P9OA 2V4DA 1WB7A 4YJ2B 2QWOB 1W0KG 4RQFA 2IJIA 1S5HC 1VF6C 5GONA 2ZE6A 2AGAA 2ZDIA 3HKBB 3EXAA 3BAAA 4B7KA 1AROP 3KCYA 1GN4A 1XMOB 2LW1A 3B8NA 2CTRA 3RYHB 4GX0A 4O4JB 5B1NA 2PF4E 3IGAC 4PA6A 1MSWD 5CA3A 2MW2B 2QGNA 3BVOA 3L70H 1NTMH 4NTYA 2PUSA 1AI5A 2QWNB 1I0HA 1KKDA 4DW1A 3CEIA 1VQ6V 2QWPB 3ZMSA 1NS1A 1PNLA 4AHCA 4HYOA 1SQBH 1FKAO 3C90A 2IU0A 2OWOA 3SPGA 5EBLC 1K4CC 3FKSG 3D3IA 1VQLV 5J2TA 1ZWIC 1HNWO 4HNAB 2JGDA 2HVKC 1NBMG 3P3NA 3CJHB 5CBGA 5LP6B 3BEHA 2YDEA 3CS5A 3E8GA 5JJJB 1SQGA 2PI4A 3GWKC 2Y0PA 2EJRA 2ZXWB 5LMUB 4LC1A 2Y4TA 2FYUH 4LWSA 4H33A 1NQTA 1PL0A 4IL6Z 2DMXA 3O9OA 4R7CA 1RFYA 3ZMVA 4U3JB 2DYRC 1K92A 1SZTA 5C8YA 3LSQA 4WFAV 4UV9A 2Y69B 3QNEA 4Q20A 1B04A 1US6A 1XMQO 1Q3EA 2ZD9A 2EIKC 4UFZA 2V1DA 1NR7A 5JJEB 2Z3YA 3FB5C 4DV1O 4RO2A 5LMNO 3VQXA 2ZM6O 2EJ7A 1G6UA 2BSKA 3L73H 1JFFB 5HFMA 1W59A 3ZRVA 1FD9A 1XOUA 4DV5O 1MA1A 2WLHA 4JI1B 3TETA 2UUCB 1K7DA 1RPOA 3G80A 1IDSA 1XQ8A 1VQ4V 3SYQA 4LF6O 2HKOA 3CRAA 3X2QB 1E79G 5LOVA 3CCEV 4PV1B 1S5LZ 5CBFA 5EIBC 1M5IA 1BZKA 3RYIA 1K3EA 1DGSA 1NI8A 3AG3C 1BQZA 5GONB 2ETNA 3K59A 4I0XA 4NYKA 3ZHUA 2WPDG 5CN0A 2JJ2G 1SQVH 1R3IC 4BIUA 1R3LC 1D5NA 4DV3B 1OCZB 1N36O 1VARA 4DR7B 2NLJC 5B1BB 3H1HH 3K08A 2GDSA 4CH4A 1VQ9V 1HNXO 1GK9A 2XAGA 1U97A 4AI8A 1X4TA 1J5EO 4H0LB 2CGNA 5JQGA 3CC7V 1JQ0A 2R9IA 2F95B 4DV0B 2HHHO 3WG7B 1GM8A 2IH3C 1OCCC 1OCOC 2QWRB 1XHXA 1WJZA 1VF5B 2LFSA 5J2TB 3K57A 3K5LA 5IY5B 3H01A 4XBFA 1Y4MA 2JGDB 1HR0B 4CH6A 3HPLC 4J42A 3WB2A 1FYJA 4MVZA 1JR9A 5JCOC 1ZAUA 3KG2A 2WA3A 4QNHB 1K33A 3E8BA 4LWSB 4J11A 4PDVA 2R70A 4CZZA 5CBHA 3AG1C 2Q7EA 1CXZB 5C8YB 3K9SA 2UXBO 5BZBA 1SQFA 2ZIOA 1LUWA 2QTSA 3ZX6A 3W7XA 3DGEA 1ZX3A 2ZE8A 3T2MA 3B2EE 1VQMV 2BSKB 3CCQV 1Q86W 2LJ2A 4UCVA 1WP7A 3U0ZA 3N2KA 5EC1C 5J9PC 4O4LA 5LOVB 2WLMA 1HNWB 4MTOA 3UQ8A 1YVWA 4LFCO 1I94O 4UXNA 4FPPA 2HFEC 1R6TA 3RYIB 4RAIA 4R8CA 3OAAG 4N21A 1FXVA 2P5OA 3M8AA 1YIJV 4I0XB 1I7FA 2ZNIA 1G1XB 4FK5C 4ZIBA 3VQWA 2ZE5A 2EIMC 5FNVA 1IVSA 1QVGU 1EN4A 2HJDA 2ZR3A 3RBZA 3JD4A 4RUFA 3QVNA 1XMQB 5EYPA 4J9YB 5JJNB 2FB5A 4NB5A 4X66B 3ABMC 3JSNA 2JK5C 1ZLZA 3F5WC 1WA8A 5L3CA 4DUZB 2LFRA 5LMNB 1H38A 1AJPA 1WB8A 2BOCC 1M57B 4QE9A 2QSAA 5JQGB 2W6IG 1YTFB 4AQYO 4TSFG 5LGUA 3G71V 1PPJH 4NXMO 2ZT9B 2YXHA 3K5MA 4EFEA 1KP2A 2Q8VA 3JCZA 1LNQA 1K8AW 2P22C 1K9MW 1HW7A 2YIDA 4OGQB 2DE0X 2X7RB 3B8MA 2E5LB 1H8EG 3APOA 3ZHRA 2DQ0A 3CCUV 4PI2A 2P90A 2GUZA 2YC0A 3A0HZ 2KB1A 3SJQC 1JA8A 1U96A 1HNXB 2ITDC 3HKEA 4I4TA 3NR7A 5JCOA 2EX3A 2UUAB 1WP8A 2FMLA 5EIBD 3T1CA 3ZMZA 2QM8A 3G6EV 3CSXA 4B08A 4IGGA 1UFIA 3M7MX 4W4KA 5AG2A 2Y4UA 2DYRB 3SPJA 2B9ZA 3ABLC 3N2KB 3P3PA 5B1AC 4O4LB 3VQVA 5IJ0A 2CTPA 1Q82W 2EIKB 2DOSA 4JASA 3UKMA 5CA1A 3OE7G 4PA7A 4F4LA 1QHTA 1KC8W 4QIWF 1YDXA 2OIGA 4JI0O 3CXHF 2H94A 2PYLA 2W0XA 2AXTZ 1O9GA 5FNVB 1XNRO 3ASOC 5DECA 1YEWA 1MOFA 1VP7A 2UXBB 4P2ZA 3UO2A 5EYPB 1Y67A 1MZFA 1QNMA 1CP9A 4L8JA 4X88A 3AG3B 1WA8B 1FXKC 1IZ3A 4UV8A 4OX9O 1KYOF 1QLEB 2A7WA 4HZ3A 3ZJZA 2EZOA 2WLKA 4RWUA 3CB2A 3CRCA 3U11A 5IWAO 1I94B 3SPIA 3JAKB 3OTOO 1Q81W 2PTMA 1BSMA 3QTCA 3W7TA 3ZHSA 1B06A 3OUSA 3K03A 3CX5F 1GM7A 2OYQA 2PZSA 5BY1A 4UVCA 2WAMA 3E22A 2Q4PA 2YI9A 4X8AA 2QR4A 3JCUZ 1OCCB 1OCOB 2ILMA 3T4ZA 4JZ2A 1MSDA 2WWWA 2DWEC 2GUZB 1TVKB 3L72H 2DYSB 2XASA 3SJCC 1E1RG 3CCVV 3HKEB 4I4TB 2ZE7A 1HDJA 3TCUA 4JI8O 4C7UA 2B5UA 1GO3F 4RQEA 4O2BA 4G28B 1KB9F 2YXLA 5D5PA 4UCOA 3CE2A 4GKKO 1H2GA 5A9GA 4AQYB 4CS3A 2M7WA 1UJWB 2UXCO 1K5SA 5IJ0B 3IJ4A 1BQ0A 1SQQH 5CA1B 3CPWU 1F4MA 3K04A 1XREA 4IIJA 3OT7A 4LF8O 2Q0AA 3ZCCA 3J80N 2DN9A 3C3SA 1AR1B 2YEVA 3RFRA 1QLNA 4MW3A 5BXZA 4F6RA 3E8HA 1XILA 2R9RB 4QPJA 4X62B 4B3TO 3JAWA 5DEDA 3W7SA 1SA0A 4ZI7A 1Q7YW 2PY5A 1JMKC 4PA9A 4WFHA 3SYCA 2ZINA 2AW9A 3RWRD 2CGOA 3E83A 4EB6A 3B77A 1TA8A 4CH3A 4JI3B 2B1IA 2LO1A 2ZR2A 4O4HA 5IYDO 1R3KC 4RUEA 2WLIA 3K3WA 3QF7A 2Z5UA 3NXSA 2BCCH 2GTAA 4X64O 1N32O 2E76B 2YS8A 1Q6IA 3OR7C 4JI6O 2JEUA 1Y74A 1I5XA 1RM1C 3OW2U 1FFXA 1N0NA 4YIOA 2UXXA 4B7EA 1ZL8A 4NXNO 1AI7A 4O2AA 4I9WA 3A2FA 3E22B 4FLVA 1SQXH 4GYCB 4LH6A 4XDLA 3D36C 3ZN1A 1Q5OA 2MK3A 2Z0AA 2PI5A 3DC5A 3N27A 2EIJC 3A8TA 4LP8A 5FPRA 4Z1VA 1H2MA 2ZQMA 4JAUA 4O4IA 1HNZO 3CC2V 1NZ6A 4F6EA 2Q9LA 1OJHA 1TGOA 4JTCB 5CB4A 4DUYO 5J2UA 3BPZA 4WFFA 4O2BB 2CDYA 1T5EA 4BIOA 4D7SA 5IWAB 1WLEA 4PELA 3CYOA 1F7YA 1H2SB 5LYJA 1WAZA 3RGBA 4DV6B 2IW5A 1JJ2U 4MVQA 1BL8A 1NTKH 1V54C 1F51A 1QCEA 4JTAB 4X65O 3S3WA 4Q6GA 4TQFA 4IIJB 1PKXA 1NR1A 1J95A 4FFBA 3N2GA 1NU1H 2YEVB 4YY3B 4AILC 3I55V 3R66A 4YXWG 5KMGA 3ABLB 4JYBA 4DV7B 3ABKC 1IXMA 2Q67A 3WFVA 4F6RB 4JAAA 1YJWV 4K0KO 1GAXA 2W0FC 4FMTA 3B09A 3S3XA 4JYCA 5KHHA 3JAWB 3JAMN 4ASUG 3GVMA 4BR6A 2KQXA 1SA0B 1UPGA 1V55C 1VF6A 2V7QG 4ZI7B 1N4CA 5B1OA 1ZSPA 2Q69A 4JI8B 1KQSU 4EB6B 1HWYA 2XOKG 5BR8O 4K8ZA 5B66Z 1PP9H 4UVAA 1XNQO 1NVPD 2WSSG 1AB3A 5L3GA 4GKKB 4O4HB 3APQA 5FL7G 2VQEO 2F93B 4LF9O 4G2KA 2WLIB 4KUMA 4J7ZA 3MDSA 1COWG 4JV5O 1IBKB 3FYIB 4X9QA 3OEHG 2VRZA 1R3JC 1AI4A 2WLNA 3BRCA 1Y74B 3SPCA 2F43G 5IYZA 2QKSA 4FIPC 2DW4A 2OTLV 1FFXB 4MW8A 1JVMA 4R6ZA 4XDJA 1ZL8B 2K1EA 4O2AB 2RDCA 4R50A 2F1MA 2EINC 2Q5ZA 3JYCA 2BTOA 2QJ1A 1ROPA 2P7TC 1SKVA 1CPYA 3AK2A 1XI1A 2O57A 2YICA 2ODMA 4B3TB 2HG5C 1THZA 4YIPA 2X6BA 2H8PC 1Z5VA 1JJOA 1N8RW 3STLC 5TISZ 1QVFU 5IDJA 4O4IB 4PHZA 5KAFZ 4LFBO 2QM7A 3BHPA 3L74H 5CB4B 3OMAB 3D36A 3JALA 5J2UB 5B5EZ 4H44B 3OM3B 4I55A 4LF5O 4BIZA 4YHHO 3EHBB 4J10A 1GH6A 5GW7A 1VF7A 5LYJB 3BCCH 3HKCA 2CTQA 2KG7A 1SERA 4DO2A 4DXWA 2QDOA 1S5JA 2XAJA 1R73A 4FFBB 3N2GB 1SESA 1IBLO 5KMGB 2VS0A 2Q0OC 3I56V 5JVDA 3STZC 2LGWA 2RMKB 3LDEA 3JARA 2D3OW 4MTFA 3SGIA 3D8CA 4DV1B 3LNNA 1HNZB 2OT5A 2WLLA 3K0DA 2ZM6B 1E1QG 3LDDA 4JI2O 3FYEB 5CA0A 4DUYB 4DV5B 2Q73A 4K3AA 3ZMTA 3RYCA 4LF6B 1OHHG 1V9PA 2HP8A 1QR8A 2WA4A 3E8FA 1GN2A 4MVOA 1AJNA 4MSWC 3RVZA 5LP6C 2X6CA 1DK1A 4PA3A 3SJBC 3JAKA 1KUQA 2JVDA 3P32A 1RSOA 2ZXWC 1ZTEA 3JD2A 2YXYA 1N33O 5LL6Y 1MZEA 1Y6XA 2IJHA 1TUEB 3D3QA 5IYZB 5H9CA 3OGCC 2HEPA 3IC9A 4CC5A 2JS3A 4DR6O 1MNGA 1ORQC 2Y69C 1GMGA 1GTOA 2XT9A 4JI5O 5A2QN 1N36B 3ZIAG 2KSDA 2IM9A 5KUMA 5H5NA 1P4RA 1SF9A 1TVKA 1P7BA 2XUMA 1L0LH 2JIZG 2IH1C 4FZ0A 2AZ0A 2D2CB 1PD3A 5IE9A 1XMOO 4HAMA 3AEIA 2JJ1G 3F5TA 1I08A 4LNUA 4P30A 5BR8B 1J5EB 4TV9A 1IX9A 1R6NA 2H3OA 2JGUA 3JALB 5KX5A 3OTFA 2VWKA 2HHHB 4I55B 2LGQA 4ZOLA 3KZIZ 2ITCC 2IJJA 4D7TA 5K1XA 2EIJB 3AG7A 1QQCA 2WLJA 1AJQA 4CS4A 5LA6A 4W4LA 4DK1A 4TUYA 5GTHZ 3HKCB 4GLXA 1M90W 2KG7B 1GN6A 2ZDIC 2VQFO 1IURA 1R1BA 4KHPO 4G27B
chains in the Genus database with same CATH topology
1XL4A 1S76D 3CPWU 1F4MA 2C2AA 3K04A 3OMNB 2FTKA 5E1AC 5IYBO 1K3EA 3ZCCA 1OCZC 1AR1B 1K4DC 2YEVA 3AG3C 1VQOV 1QLNA 4MW3A 2EILC 1YTFD 3ABUA 1MG1A 4MVSA 2WPDG 5CN0A 3ZRWB 2JJ2G 1EFRG 5HFLA 1R3IC 3E8HA 4BIUA 2R9RB 4PA4A 1R3LC 4QPJA 1L1FA 5EC2C 1I5YA 5B3SB 1NH2D 1F4NA 1OCZB 3T4DA 5H6QA 4U7OA 2NLJC 3W7SA 5B1BB 3QO5A 1Q7YW 2WLLB 3K08A 4PA9A 4WFHA 2NNUA 3SYCA 1VQ9V 2UXNA 1GK9A 3E83A 3WG7C 2XAGA 4PDMA 3B77A 3LDCA 2QTOA 2B1IA 5IY5C 1S3JA 1GM9A 3ETEA 2ZR2A 3FB6C 3ABTA 5IYDO 1R3KC 1SETA 3M99B 1FXHA 1JQ0A 2R9IA 3CC7V 4RUEA 2WLIA 3K3WA 4BW5A 1KD1W 3WG7B 1GM8A 2W6JG 2Z5UA 2IH3C 1OCCC 1OCOC 1AI6A 1M56C 1Y66A 3E86A 3NXSA 4JPRA 1VQNV 3VBBA 1GKFA 2Q68A 2LFSA 4E2LA 1JOYA 5IY5B 3H01A 1G4YB 3OR7C 1Y4MA 4XBFA 3HPLC 2JEUA 4CBCA 1DF5A 3E2EA 2OCCB 4MTGA 3RVYA 3OEEG 3AG4B 1I5XA 1YI2V 5LBQA 1RM1C 4MVZA 5L3EA 3OW2U 3F7YC 2UXXA 3KG2A 4WF9V 1AI7A 4I9WA 3K9AA 4QNHB 1CEZA 1K33A 5LHIA 2A9HA 4UVBA 3E8BA 4XDLA 1K97A 3ZN1A 4PDVA 4CZZA 1VQ5V 2MK3A 1EBOA 5CBHA 3AG1C 2PI5A 2QEXV 1YHQV 5KUKA 2X6AA 3QO8A 1RM1B 5KA6A 4KFMA 2EIJC 2QE7G 1FS0G 3MHSC 3ZRXA 5L3FA 5BZBA 3E89A 4LP8A 3X2QC 2EBOA 4MTXA 2ZQMA 2XNDG 4MVRA 3F7VC 4JAUA 4JAVA 3CC2V 3A0RA 3AG2B 3W7XA 1SRYA 3DGEA 3AG1B 4JGSA 1S0VA 3T2MA 2JDIG 4MT8A 3K0GA 4JTCB 2XAQA 3K06A 1F23A 3ETGA 3OUFA 3R65A 4WFFA 3MHHC 1VQMV 3CCJV 1QBZA 3CCQV 4JTDB 1Q86W 1WLEA 4PELA 3CYOA 5EC1C 5J9PC 1OZ0A 2GSMB 5CMUA 5KA5A 2WLMA 2AHYA 2IW5A 1JJ2U 3ZMUA 4MTOA 4MVQA 1QR9A 1BL8A 3LNMB 3GB7C 1V54C 5B3SC 4UXNA 1F51A 3CCMV 1QCEA 2XAHA 4JTAB 4FPPA 2HFEC 2AHZA 1PKXA 1NR1A 3LUTB 5B1BC 3CMAV 4MS2A 1J95A 3OAAG 4N21A 1FXVA 4PDLA 2YEVB 4R8CA 4RAIA 1YIJV 3I55V 1R6KA 4YXWG 3IC7A 3CP1A 3FB8C 3ABLB 1JX9A 4FJCC 4JYBA 2HLDG 4UUJC 4H37A 1V54B 3ABKC 4FK5C 1IXMA 2Q67A 3WFVA 2HJFC 1H8HG 4JF3A 1YJWV 2EIMC 5LHGA 2W0FC 4FMTA 3E35A 1QVGU 4GT1A 2ZR3A 4JYCA 3JD4A 3RBZA 5DN6G 1YJ9V 3OMIB 4GX5A 1M9NA 4ASUG 4U7NA 4RUFA 1M57C 4OXSA 1V55C 4TT3G 2V7QG 3LSSA 4J9YB 3DTUB 4WFEA 5B1OA 3QO7A 5IYCO 3ABKB 2IU3A 2Q69A 3ABMC 1KQSU 2JK5C 1HWYA 2LP7A 2P6JA 2DQ3A 1G8MA 2XOKG 3F5WC 5L3CA 4QJFB 2EIMB 3SYAA 2LFRA 1OCRB 5LGTA 2OCCC 1H38A 4UVAA 1PNMA 3AG4C 3JD1A 4P9PA 1NVPD 1AJPA 3W7WA 2WSSG 5L3GA 4L87A 3ZN0A 2BOCC 1M57B 2GHYA 1V55B 4QE9A 5FL7G 1JCHA 3CXCU 2W6IG 4G2KA 2WLIB 2HVJC 3ASNB 3ABMB 4KUMA 1COWG 1YTFB 3FYIB 1BMFG 4TSFG 5C93A 1FXKA 1VQPV 5LGUA 3OEHG 3G71V 1R3JC 1AI4A 2WLNA 2Y48A 3CCLV 1S77D 4Z1MG 3SPCA 2F43G 1NH2B 2QKSA 1KP2A 3JCZA 4FIPC 2DW4A 1LNQA 1K8AW 2OTLV 4MW8A 4R6ZA 1JVMA 4XDJA 1K9MW 2K1EA 1B6QA 1VQ8V 1JPXA 1DTOA 3AG2C 4R50A 5L3DA 2EINC 5L3BA 3JD3A 3JYCA 4N23A 1VQ7V 3JD0A 1ROPA 2X7RB 3B8MA 3BY6A 2P7TC 1YJNV 3OFNG 1H8EG 1CPYA 1VQKV 4GX2A 1W0JG 1PNKA 2DQ0A 3HB3B 2HG5C 1THZA 3CCUV 1MABG 2P90A 2X6BA 4QPKA 2YSUB 2H8PC 3SJQC 2KB1A 5LGNA 3ML0A 1N8RW 4MVUA 3OR6C 3STLC 2EINB 1QVFU 5IDJA 3PJSK 2ITDC 3ETDA 3SYPA 1YSCA 5EBWC 1EZJA 2QM7A 3GWOA 1K73W 1M1KW 3T1CA 3ZMZA 3OMAB 2QM8A 3D36A 3G6EV 4GX1A 4EKWA 3OM3B 2P67A 4BIZA 3UM7A 3EHBB 4X89A 2DYRB 1K5QA 5GW7A 3SPJA 3ABLC 4KP4A 1YITV 2BOBC 5B1AC 3CD6V 1W2BU 1K34A 2JEXA 1Q82W 2EIKB 2IJKA 3FB7C 4MVMA 5EBMC 1SERA 4DO2A 4J9ZB 5DM6V 4DXWA 3SPHA 2X0LA 4JASA 5LHHA 3UKMA 2A0LA 4WCEV 4PDRA 4QE7A 3OE7G 4PA7A 4F4LA 4P9OA 4TWKA 2XAJA 3CCSV 1R73A 1KC8W 4QIWF 1SESA 5B1AB 1W0KG 4RQFA 2IJIA 3CC4V 1S5HC 2ZDIA 3W7UA 3I56V 1OCRC 2DWDC 2H94A 3STZC 3ZRWA 3LDEA 2D3OW 4MTFA 1AROP 3ASOC 2QA4V 1MOFA 4P2ZA 1QLEC 3ASNC 4ZBMA 3RW0A 3B8NA 1ENVA 1S72V 4GX0A 1CP9A 5B1NA 2OT5A 3IGAC 2WLLA 4X88A 4PA6A 3K0DA 3AG3B 1E1QG 3IFXA 1MSWD 5CA3A 3LDDA 2EILB 3G4SV 3FYEB 1KECA 1FXKC 4UV8A 1AI5A 5H6RA 1KKDA 3ASOB 4GCZA 4I5SA 3ZMTA 1RPRA 2B1GA 1VQ6V 1OHHG 1QR8A 3E8FA 4MVOA 1QLEB 1AJNA 4HZ3A 4MSWC 3ZJZA 3RVZA 1NKDA 2EZOA 3SYOA 3ZMSA 2WLKA 2XAFA 1PNLA 4WFGA 3CCRV 4HYOA 3K79A 2X6CA 4PA3A 1FXKB 3P32A 2IU0A 2OTJV 2ZXWC 3JD2A 3SPGA 5EBLC 1BHBA 1K4CC 5EK0A 3FKSG 1FFTB 3D3IA 1VQLV 3SPIA 1ZWIC 1Q81W 4BAYA 2HVKC 1NBMG 2IJHA 1TUEB 2CK3G 3TK1A 5H9CA 1XL6A 3W7TA 3OGCC 5CBGA 3BEHA 3E8GA 3OUSA 3K03A 1GM7A 4XDKA 4LBEC 2PI4A 1BHAA 1ORQC 2DYSC 2EJRA 2Y69C 1GMGA 2WAMA 1GTOA 2ZXWB 3P30A 4UVCA 4LC1A 3ZIAG 2EZPA 4X8AA 5KUMA 1OCCB 1OCOB 1M56B 1NQTA 4H33A 1PL0A 3T4ZA 1P4RA 2WWWA 2A79B 4R7CA 3ZMVA 3VOUA 1P7BA 2DWEC 1NVPB 2DYRC 1K92A 1SZTA 3LSQA 2JIZG 4WFAV 2IH1C 2DYSB 2XASA 2Y69B 1E1RG 3QNEA 4UV9A 1KP3A 4Q20A 1PD3A 3ZRSA 3CCVV 4LCUC 4HAMA 2ZD9A 2JJ1G 3AEIA 2EIKC 2Q6AA 2V1DA 4P30A 1NR7A 3EFFK 2Z3YA 3FB5C 3TCUA 1R6NA 4ZKIA 2B5UA 1DLBA 4RO2A 1GO3F 4WFBV 2HR3A 4RQEA 5HFMA 2ITCC 2IJJA 3ZRVA 4G28B 2WLHA 3TETA 3MD0A 2EIJB 1K7DA 1H2GA 1RPOA 2WLJA 1AJQA 2M7WA 1WPXA 1VQ4V 3SYQA 1UJWB 2HKOA 3X2QB 1K5SA 2ATKC 1M90W 1E79G 3CCEV 1NJIW 2ZDIC 3CMEV 1DF4A 5CBFA 4G27B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGA C;  1XL4 A;  2WLL A;  4PA6 A;  4X88 A;  4MVR A;  3F7V C;  3K0D A;  3SPC A;  3IFX A;  2QKS A;  3LDD A;  3K04 A;  5E1A C;  1LNQ A;  4MW8 A;  1OCZ C;  1JVM A;  4R6Z A;  4XDJ A;  3T2M A;  1KKD A;  1K4D C;  3K0G A;  2K1E A;  4JTC B;  2YEV A;  3AG3 C;  3K06 A;  3AG2 C;  3OUF A;  3R65 A;  4MW3 A;  2EIL C;  2EIN C;  4R50 A;  4WFF A;  4MVS A;  3E8F A;  3JYC A;  4MVO A;  4JTD B;  4HZ3 A;  2P7T C;  4MSW C;  3ZJZ A;  3RVZ A;  3SYO A;  1R3I C;  2WLK A;  3E8H A;  4WFG A;  2R9R B;  4PA4 A;  1R3L C;  4GX2 A;  4HYO A;  5EC1 C;  2X6C A;  5J9P C;  4PA3 A;  2HG5 C;  5EC2 C;  2X6B A;  2WLM A;  2AHY A;  2H8P C;  2ZXW C;  3SJQ C;  2KB1 A;  3SPG A;  3T4D A;  5EBL C;  4MTO A;  1K4C C;  4MVQ A;  5EK0 A;  3LNM B;  1BL8 A;  2NLJ C;  3OR6 C;  1ZWI C;  4MVU A;  3SPI A;  3STL C;  3GB7 C;  1V54 C;  3PJS K;  2ITD C;  5B3S C;  2WLL B;  2HVK C;  4JTA B;  3K08 A;  4PA9 A;  4WFH A;  3SYP A;  5EBW C;  3SYC A;  2HFE C;  2AHZ A;  1XL6 A;  3E83 A;  3OGC C;  3WG7 C;  3BEH A;  4PDM A;  5CBG A;  3LUT B;  5B1B C;  3E8G A;  3LDC A;  2QTO A;  3OUS A;  3K03 A;  4MS2 A;  1J95 A;  4R8C A;  4RAI A;  4PDL A;  3T1C A;  4XDK A;  4LBE C;  4GX1 A;  1ORQ C;  2DYS C;  2Y69 C;  4EKW A;  5IY5 C;  3FB8 C;  4UUJ C;  4H37 A;  3UM7 A;  4X89 A;  4X8A A;  3FB6 C;  3ABK C;  2Q67 A;  5KUM A;  4H33 A;  1R3K C;  2HJF C;  3SPJ A;  4RUE A;  3T4Z A;  3ABL C;  2WLI A;  4BW5 A;  2BOB C;  2EIM C;  2A79 B;  4R7C A;  2W0F C;  5B1A C;  3VOU A;  1P7B A;  2DWE C;  2IH3 C;  1OCC C;  1OCO C;  1M56 C;  2DYR C;  3E86 A;  4GX5 A;  3RBZ A;  3FB7 C;  2Q68 A;  4MVM A;  2IH1 C;  4RUF A;  5EBM C;  1M57 C;  4OXS A;  1V55 C;  4J9Z B;  3OR7 C;  1G4Y B;  4J9Y B;  3ZRS A;  3SPH A;  4DXW A;  4WFE A;  4LCU C;  3UKM A;  2A0L A;  3HPL C;  4CBC A;  2ZD9 A;  4PDR A;  4QE7 A;  4MTG A;  2EIK C;  2Q6A A;  4P30 A;  3RVY A;  2Q69 A;  3ABM C;  4PA7 A;  3EFF K;  4P9O A;  2JK5 C;  4F4L A;  4TWK A;  3F5W C;  3FB5 C;  3TCU A;  4MVZ A;  3SYA A;  3F7Y C;  3KG2 A;  2OCC C;  4I9W A;  3AG4 C;  1S5H C;  4RO2 A;  4P9P A;  4QNH B;  2A9H A;  3E8B A;  4XDL A;  2ITC C;  2BOC C;  1OCR C;  2DWD C;  4PDV A;  4QE9 A;  3STZ C;  4G28 B;  2WLH A;  3TET A;  3LDE A;  3AG1 C;  5CBH A;  2WLJ A;  2WLI B;  2HVJ C;  4MTF A;  3SYQ A;  3ASO C;  5KUK A;  2X6A A;  2ATK C;  4KFM A;  2EIJ C;  4P2Z A;  1QLE C;  1R3J C;  3ASN C;  4ZBM A;  3RW0 A;  2WLN A;  3E89 A;  4LP8 A;  5BZB A;  3X2Q C;  4GX0 A;  5CBF A;  4G27 B; 
#chains in the Genus database with same CATH topology
 3HKD A;  1XL4 A;  5GTI Z;  1S76 D;  4NVP A;  3A0B Z;  5IYB O;  1MMM A;  1OCZ C;  3MAQ A;  4B3R O;  1K4D C;  3K5N A;  1VQO V;  2EIL C;  1MG1 A;  4TQD A;  5JVD B;  5KHK A;  2BTQ A;  5KLV H;  1EFR G;  5HFL A;  3JAR B;  1HP8 A;  1L0N H;  4PA4 A;  4KXR A;  2A3Q A;  3G67 A;  1NH2 D;  5LMU O;  1F4N A;  5H6Q A;  3I5D A;  2ZNJ A;  3AK1 A;  4GUN A;  2FL4 A;  2OCH A;  2WLL B;  1Q6U A;  4LFB B;  3AK3 A;  2UXN A;  3WG7 C;  5CA0 B;  1SC5 B;  3LDC A;  2QTO A;  4D6T H;  4X1I A;  4LF5 B;  3RYC B;  4YHH B;  5IY5 C;  1S3J A;  1GM9 A;  4GKJ O;  3ETE A;  3FB6 C;  1ZUQ A;  3ABT A;  4LFC B;  1SET A;  4BW5 A;  1KD1 W;  1RSO B;  1VQN V;  1AI6 A;  1M56 C;  1A32 A;  3VBB A;  1GKF A;  3K58 A;  4CS2 A;  2UUC O;  4JI1 O;  1H2L A;  1IXB A;  1JOY A;  1G4Y B;  4DR1 O;  2NN4 A;  3ZHV A;  2P06 A;  1DF5 A;  4CBC A;  4MTG A;  3RVY A;  4UCT A;  1YI2 V;  4U3F H;  2RJZ A;  5LBQ A;  1IBL B;  4YJ3 A;  4DW0 A;  3H1L H;  3F7Y C;  2CTW A;  4FFK A;  1CEZ A;  4PJ0 Z;  3UT5 A;  5LHI A;  3J81 N;  1K97 A;  3L75 H;  1EBO A;  3T1H O;  1EM1 A;  3DC6 A;  1YCI A;  1YHQ V;  5KUK A;  4FM0 A;  2ZCE A;  3K5O A;  4IYI A;  5KA6 A;  4KFM A;  3THO A;  2QE7 G;  1FS0 G;  3MHS C;  3ZRX A;  3E89 A;  2EBO A;  4B3S O;  4MTX A;  3IAY A;  4JI2 B;  4FLT A;  3F7V C;  4LNU B;  4JAV A;  1SRY A;  4TV9 B;  3AG1 B;  4JGS A;  4DR7 O;  3RT3 C;  2JDI G;  5KX5 B;  4MT8 A;  2XAQ A;  1F23 A;  3OUF A;  4ZOL B;  1WPB A;  3U10 A;  2N05 A;  1TAE A;  4JTD B;  1AP6 A;  1IBM O;  1KKC A;  2Q7G A;  5KHJ A;  5LA6 B;  1P49 A;  4NXM B;  4J7J A;  1NT2 B;  1XDC A;  4TUY B;  1OZ0 A;  5CMU A;  1TUB A;  2AHY A;  5H2F Z;  3ZMU A;  1QR9 A;  3LNM B;  1BS3 A;  3GB7 C;  3JAT A;  4J80 A;  5B3S C;  3HKD B;  3CCM V;  2XAH A;  3ICX A;  3JAS A;  2AHZ A;  2E3C A;  3WU2 Z;  4HBN A;  1YF2 A;  3LUT B;  3CMA V;  4X20 A;  4MS2 A;  1QU7 A;  2G38 A;  1HR0 O;  4JI5 B;  4I7Z B;  3IC7 A;  3CP1 A;  3FB8 C;  4DR2 O;  1JX9 A;  2HLD G;  4UUJ C;  2BTQ B;  1BT8 A;  4JF3 A;  3E35 A;  4FVM A;  2YUA A;  4GT1 A;  3OMI B;  4GX5 A;  1M9N A;  2RCV A;  1M57 C;  4OXS A;  4TT3 G;  3LSS A;  3KCX A;  2NR5 A;  4WFE A;  3FX7 A;  5IYC O;  5FPO A;  2LP7 A;  2P6J A;  1G8M A;  4QJF B;  2EIM B;  3SYA A;  4X1I B;  2OCC C;  1BCC H;  3AG4 C;  3RYF A;  4L87 A;  1P84 F;  3UCS C;  3ZN0 A;  1M93 A;  3Q4H A;  1N34 O;  2GHY A;  1JCH A;  2R72 A;  2UU9 O;  4LF7 O;  4DV2 O;  2K9P A;  3ABM B;  2YIB D;  1AIL A;  1BMF G;  2VQF B;  1FXK A;  1WNS A;  1X59 A;  3L9D A;  5KAI Z;  4KHP B;  4DV4 O;  2Y48 A;  3CCL V;  1S77 D;  2F23 A;  4UCS A;  2PYJ A;  4Z1M G;  2L35 A;  4JI0 B;  1PL4 A;  4B3R B;  4YJ3 B;  4I50 A;  2JS5 A;  4LH7 A;  3AG2 C;  5L3D A;  1BGY H;  3UT5 B;  1XNR B;  3JD3 A;  4N23 A;  3JD0 A;  3BY6 A;  4UB6 Z;  3T1Y O;  1YJN V;  1VQK V;  4DRX A;  1W0J G;  1PNK A;  1MAB G;  2YSU B;  3ETQ A;  3ML0 A;  1OV9 A;  3TJT A;  4DK0 A;  4OX9 B;  1XBL A;  3ETD A;  3SYP A;  5EBW C;  4ABM A;  2F66 C;  1EZJ A;  1Q8I A;  3L71 H;  3SR2 C;  3GWO A;  1K73 W;  1H2K A;  3B40 A;  2F4V O;  4GKJ B;  4EKW A;  5BMV A;  2P67 A;  4X66 O;  3H1I H;  1EZV H;  1YZB A;  4X1K A;  3J7A U;  3O65 A;  4DUZ O;  1K5Q A;  2CUG A;  1AR5 A;  3OTO B;  2UXD O;  2N04 A;  1AVM A;  1TUB B;  1Q90 D;  1K34 A;  2JEX A;  3FB7 C;  4DR1 B;  3JAT B;  3DXR A;  5DM6 V;  4LF4 O;  3SPH A;  2X0L A;  2A0L A;  4Z2W A;  4WCE V;  3JAS B;  4JI7 O;  2CH7 A;  4DYL A;  4TWK A;  4X20 B;  3CCS V;  5ITZ A;  5B1A B;  2ARH A;  3CC4 V;  3W7U A;  1OCR C;  2DWD C;  3T1H B;  3C3T A;  3ZRW A;  5JWP A;  1L8D A;  1Z5W A;  3ZED A;  2UUB O;  1GRJ A;  3ZS8 C;  4B3M O;  2QA4 V;  1YXB A;  2E5L O;  4B3S B;  1QLE C;  3ASN C;  4ZBM A;  3RW0 A;  1ENV A;  1S72 V;  4DR3 O;  3IFX A;  2EIL B;  3G4S V;  2PGG A;  1KEC A;  2N74 A;  2BE3 A;  5H6R A;  3ASO B;  4GCZ A;  4I5S A;  2XHB A;  1RPR A;  3BA8 A;  2B1G A;  1IBM B;  3RYF B;  2UXC B;  4LFA O;  4WBN A;  2ADQ B;  3Q4H B;  2UUA O;  2ZKO A;  3BA9 A;  3LSU A;  1NKD A;  3SYO A;  5E79 Z;  2XAF A;  4WFG A;  2ZIM A;  3CCR V;  1XUQ A;  2QM4 A;  3K79 A;  2Q7H A;  5LXT A;  1NTZ H;  5JH7 A;  1FXK B;  2OTJ V;  1N0J A;  2E74 B;  1BHB A;  5EK0 A;  3HR0 A;  4LF8 B;  1FFT B;  1AR4 A;  1Q6H A;  4BAY A;  3TK1 A;  2CK3 G;  2M6Y A;  2A06 H;  1XL6 A;  5IJ9 A;  3SJA C;  4I50 B;  4DR2 B;  4XDK A;  4LBE C;  4CH5 A;  1BHA A;  2DYS C;  3P30 A;  2EZP A;  1Q43 A;  3FFQ A;  1M56 B;  2Y0I A;  4DRX B;  4X1Y A;  1SQP H;  2A79 B;  4ZHQ A;  3VOU A;  2GV9 A;  1NVP B;  1URF A;  3RN4 A;  2XTA A;  3WB0 A;  1KP3 A;  2OIE A;  4H13 B;  3ZRS A;  4FLX A;  1M4U A;  4IYH A;  4LCU C;  4EFB A;  2Q6A A;  3EFF K;  3FAV A;  4ZKI A;  4GZR B;  2GBO A;  1DLB A;  5D5Q A;  5BMV B;  1N34 B;  4WFB V;  2HR3 A;  1P7G A;  4X1K B;  2UU9 B;  4LF7 B;  4X64 B;  4DV2 B;  4CC6 A;  3CHX A;  1N32 B;  1PM9 A;  3MD0 A;  2E75 B;  4TV8 A;  4FLZ A;  3G6B A;  3FD9 A;  2CE4 A;  1WPX A;  4JI6 B;  4I9Q A;  1Y76 A;  4UB8 Z;  2RN9 A;  2ATK C;  4DV4 B;  4J7K A;  1NJI W;  1GN3 A;  3CME V;  3DXR B;  4NXN B;  1DF4 A;  2IBZ H;  4JYA O;  4JI4 O;  2CH7 B;  2C2A A;  3OMN B;  2FTK A;  5E1A C;  5ITZ B;  1XHZ A;  1YTF D;  3ABU A;  4MVS A;  2R9A A;  3T1Y B;  3ZRW B;  4NTX A;  2GTS A;  1L1F A;  5EC2 C;  1I5Y A;  3H9V A;  5B3S B;  1EN6 A;  5IT9 N;  3T4D A;  4U7O A;  3H1K H;  1EN5 A;  4IHJ A;  3QO5 A;  2NNU A;  5EZY A;  4DR5 O;  1SZX A;  4PDM A;  2F4V B;  1Z2G A;  4DR4 O;  4BWA A;  4WBN B;  4E4E A;  1VIB A;  2UXD B;  1FJG O;  4FLW A;  3M99 B;  1FXH A;  3OD4 A;  3EVK A;  5LXT B;  4FLY A;  5JH7 B;  4X65 B;  2W6J G;  5KHI A;  1Y66 A;  3E86 A;  1H2N A;  4JPR A;  4LF4 B;  2Q68 A;  1LR1 A;  3OGI B;  4E2L A;  4JI7 B;  1XEQ A;  2QKA A;  3E2E A;  1AP5 A;  2OCC B;  3KKY A;  3ZHT A;  3OEE G;  3AG4 B;  5IJ9 B;  4NKG B;  1O9H A;  5L3E A;  3H1J H;  4WF9 V;  3BFR A;  4PI0 A;  4K0K B;  2LQT A;  3K9A A;  2RQ6 A;  3VQY A;  2A9H A;  4UVB A;  1VQ5 V;  2P4K A;  1D5A A;  2UUB B;  4B3M B;  4X1Y B;  4LR3 A;  4ZHQ B;  2QEX V;  2YIA A;  3B4S A;  2X6A A;  3QO8 A;  1RM1 B;  4JYY A;  4J41 A;  5L3F A;  3WB1 A;  4FLU A;  3X2Q C;  1VEW A;  3CRM A;  4DR3 B;  4K8X A;  1XNQ B;  5K1P A;  3SDL A;  2XND G;  4MVR A;  4X62 O;  3A0R A;  3AG2 B;  1PV0 A;  5FLX N;  4ICG A;  3FAV B;  2VQE B;  4FZ1 A;  1S0V A;  2KKW A;  4LF9 B;  2JRI A;  3K0G A;  4TOI A;  4LFA B;  3K06 A;  3ETG A;  3R65 A;  3MHH C;  3CCJ V;  4JV5 B;  1QBZ A;  1B3Q A;  4TV8 B;  4NTW A;  1WN7 A;  4JI3 O;  1Y76 B;  2EUL A;  2GSM B;  5KA5 A;  4PD4 F;  2P4V A;  3DSQ A;  1VMG A;  4K35 A;  5B1B C;  3TXS A;  4PDL A;  4YJ2 A;  1R6K A;  4FJC C;  3CRR A;  2AZ2 A;  4H37 A;  1V54 B;  1FAF A;  3HKB A;  1BE3 H;  2HJF C;  1H8H G;  2ADP A;  5LHG A;  1KU9 A;  1YJ9 V;  5F2V O;  5DN6 G;  3ZHQ A;  4U7N A;  4IHJ B;  1KBH A;  3RYH A;  3DTU B;  4O4J A;  5EZY B;  3QO7 A;  2RNB A;  3ABK B;  2LW7 A;  1RP3 B;  2IU3 A;  2DQ3 A;  1OCR B;  5LGT A;  3TGU H;  1PNM A;  3JD1 A;  4P9P A;  4NR1 A;  3W7W A;  3BAB A;  1V55 B;  3CXC U;  2HVJ C;  3ASN B;  2FKX A;  4FM2 A;  5C93 A;  1VQP V;  1D2D A;  4JZG A;  4JYA B;  4JI4 B;  1FPO A;  3CRQ A;  4HNA A;  3ZBH A;  4DV6 O;  4EEQ A;  1NH2 B;  4KL1 A;  3CJH A;  4OPH A;  4A5U B;  4UCU A;  5LP6 A;  2DJV A;  1B6Q A;  1VQ8 V;  4BW9 A;  1JPX A;  1DTO A;  3PN1 A;  3QG5 A;  5L3B A;  1VQ7 V;  1SS3 A;  1KMI Z;  3OFN G;  4OPA A;  4YY3 O;  4GX2 A;  2L6L A;  3HB3 B;  2YI8 A;  4DV7 O;  4QPK A;  4U3J A;  5LGN A;  4DV3 O;  4MVU A;  2QWQ B;  3OR6 C;  2EIN B;  4DR5 B;  3PJS K;  3JSL A;  4IT5 A;  1YSC A;  2YIB A;  4DR4 B;  1M1K W;  4GX1 A;  2CAZ C;  4UCR A;  2QKC A;  1FJG B;  3CWB H;  3UM7 A;  1JFF A;  4X89 A;  1N33 B;  1LUV A;  3UO3 A;  4KP4 A;  1YIT V;  2BOB C;  5KHG A;  4FM1 A;  2VWJ A;  4QGP A;  4DV0 O;  3CD6 V;  1W2B U;  2IJK A;  4MVM A;  5EBM C;  4J9Z B;  4DR6 B;  3TXQ A;  5LHH A;  4PDR A;  1IBK O;  4QE7 A;  4P9O A;  2V4D A;  1WB7 A;  4YJ2 B;  2QWO B;  1W0K G;  4RQF A;  2IJI A;  1S5H C;  1VF6 C;  5GON A;  2ZE6 A;  2AGA A;  2ZDI A;  3HKB B;  3EXA A;  3BAA A;  4B7K A;  1ARO P;  3KCY A;  1GN4 A;  1XMO B;  2LW1 A;  3B8N A;  2CTR A;  3RYH B;  4GX0 A;  4O4J B;  5B1N A;  2PF4 E;  3IGA C;  4PA6 A;  1MSW D;  5CA3 A;  2MW2 B;  2QGN A;  3BVO A;  3L70 H;  1NTM H;  4NTY A;  2PUS A;  1AI5 A;  2QWN B;  1I0H A;  1KKD A;  4DW1 A;  3CEI A;  1VQ6 V;  2QWP B;  3ZMS A;  1NS1 A;  1PNL A;  4AHC A;  4HYO A;  1SQB H;  1FKA O;  3C90 A;  2IU0 A;  2OWO A;  3SPG A;  5EBL C;  1K4C C;  3FKS G;  3D3I A;  1VQL V;  5J2T A;  1ZWI C;  1HNW O;  4HNA B;  2JGD A;  2HVK C;  1NBM G;  3P3N A;  3CJH B;  5CBG A;  5LP6 B;  3BEH A;  2YDE A;  3CS5 A;  3E8G A;  5JJJ B;  1SQG A;  2PI4 A;  3GWK C;  2Y0P A;  2EJR A;  2ZXW B;  5LMU B;  4LC1 A;  2Y4T A;  2FYU H;  4LWS A;  4H33 A;  1NQT A;  1PL0 A;  4IL6 Z;  2DMX A;  3O9O A;  4R7C A;  1RFY A;  3ZMV A;  4U3J B;  2DYR C;  1K92 A;  1SZT A;  5C8Y A;  3LSQ A;  4WFA V;  4UV9 A;  2Y69 B;  3QNE A;  4Q20 A;  1B04 A;  1US6 A;  1XMQ O;  1Q3E A;  2ZD9 A;  2EIK C;  4UFZ A;  2V1D A;  1NR7 A;  5JJE B;  2Z3Y A;  3FB5 C;  4DV1 O;  4RO2 A;  5LMN O;  3VQX A;  2ZM6 O;  2EJ7 A;  1G6U A;  2BSK A;  3L73 H;  1JFF B;  5HFM A;  1W59 A;  3ZRV A;  1FD9 A;  1XOU A;  4DV5 O;  1MA1 A;  2WLH A;  4JI1 B;  3TET A;  2UUC B;  1K7D A;  1RPO A;  3G80 A;  1IDS A;  1XQ8 A;  1VQ4 V;  3SYQ A;  4LF6 O;  2HKO A;  3CRA A;  3X2Q B;  1E79 G;  5LOV A;  3CCE V;  4PV1 B;  1S5L Z;  5CBF A;  5EIB C;  1M5I A;  1BZK A;  3RYI A;  1K3E A;  1DGS A;  1NI8 A;  3AG3 C;  1BQZ A;  5GON B;  2ETN A;  3K59 A;  4I0X A;  4NYK A;  3ZHU A;  2WPD G;  5CN0 A;  2JJ2 G;  1SQV H;  1R3I C;  4BIU A;  1R3L C;  1D5N A;  4DV3 B;  1OCZ B;  1N36 O;  1VAR A;  4DR7 B;  2NLJ C;  5B1B B;  3H1H H;  3K08 A;  2GDS A;  4CH4 A;  1VQ9 V;  1HNX O;  1GK9 A;  2XAG A;  1U97 A;  4AI8 A;  1X4T A;  1J5E O;  4H0L B;  2CGN A;  5JQG A;  3CC7 V;  1JQ0 A;  2R9I A;  2F95 B;  4DV0 B;  2HHH O;  3WG7 B;  1GM8 A;  2IH3 C;  1OCC C;  1OCO C;  2QWR B;  1XHX A;  1WJZ A;  1VF5 B;  2LFS A;  5J2T B;  3K57 A;  3K5L A;  5IY5 B;  3H01 A;  4XBF A;  1Y4M A;  2JGD B;  1HR0 B;  4CH6 A;  3HPL C;  4J42 A;  3WB2 A;  1FYJ A;  4MVZ A;  1JR9 A;  5JCO C;  1ZAU A;  3KG2 A;  2WA3 A;  4QNH B;  1K33 A;  3E8B A;  4LWS B;  4J11 A;  4PDV A;  2R70 A;  4CZZ A;  5CBH A;  3AG1 C;  2Q7E A;  1CXZ B;  5C8Y B;  3K9S A;  2UXB O;  5BZB A;  1SQF A;  2ZIO A;  1LUW A;  2QTS A;  3ZX6 A;  3W7X A;  3DGE A;  1ZX3 A;  2ZE8 A;  3T2M A;  3B2E E;  1VQM V;  2BSK B;  3CCQ V;  1Q86 W;  2LJ2 A;  4UCV A;  1WP7 A;  3U0Z A;  3N2K A;  5EC1 C;  5J9P C;  4O4L A;  5LOV B;  2WLM A;  1HNW B;  4MTO A;  3UQ8 A;  1YVW A;  4LFC O;  1I94 O;  4UXN A;  4FPP A;  2HFE C;  1R6T A;  3RYI B;  4RAI A;  4R8C A;  3OAA G;  4N21 A;  1FXV A;  2P5O A;  3M8A A;  1YIJ V;  4I0X B;  1I7F A;  2ZNI A;  1G1X B;  4FK5 C;  4ZIB A;  3VQW A;  2ZE5 A;  2EIM C;  5FNV A;  1IVS A;  1QVG U;  1EN4 A;  2HJD A;  2ZR3 A;  3RBZ A;  3JD4 A;  4RUF A;  3QVN A;  1XMQ B;  5EYP A;  4J9Y B;  5JJN B;  2FB5 A;  4NB5 A;  4X66 B;  3ABM C;  3JSN A;  2JK5 C;  1ZLZ A;  3F5W C;  1WA8 A;  5L3C A;  4DUZ B;  2LFR A;  5LMN B;  1H38 A;  1AJP A;  1WB8 A;  2BOC C;  1M57 B;  4QE9 A;  2QSA A;  5JQG B;  2W6I G;  1YTF B;  4AQY O;  4TSF G;  5LGU A;  3G71 V;  1PPJ H;  4NXM O;  2ZT9 B;  2YXH A;  3K5M A;  4EFE A;  1KP2 A;  2Q8V A;  3JCZ A;  1LNQ A;  1K8A W;  2P22 C;  1K9M W;  1HW7 A;  2YID A;  4OGQ B;  2DE0 X;  2X7R B;  3B8M A;  2E5L B;  1H8E G;  3APO A;  3ZHR A;  2DQ0 A;  3CCU V;  4PI2 A;  2P90 A;  2GUZ A;  2YC0 A;  3A0H Z;  2KB1 A;  3SJQ C;  1JA8 A;  1U96 A;  1HNX B;  2ITD C;  3HKE A;  4I4T A;  3NR7 A;  5JCO A;  2EX3 A;  2UUA B;  1WP8 A;  2FML A;  5EIB D;  3T1C A;  3ZMZ A;  2QM8 A;  3G6E V;  3CSX A;  4B08 A;  4IGG A;  1UFI A;  3M7M X;  4W4K A;  5AG2 A;  2Y4U A;  2DYR B;  3SPJ A;  2B9Z A;  3ABL C;  3N2K B;  3P3P A;  5B1A C;  4O4L B;  3VQV A;  5IJ0 A;  2CTP A;  1Q82 W;  2EIK B;  2DOS A;  4JAS A;  3UKM A;  5CA1 A;  3OE7 G;  4PA7 A;  4F4L A;  1QHT A;  1KC8 W;  4QIW F;  1YDX A;  2OIG A;  4JI0 O;  3CXH F;  2H94 A;  2PYL A;  2W0X A;  2AXT Z;  1O9G A;  5FNV B;  1XNR O;  3ASO C;  5DEC A;  1YEW A;  1MOF A;  1VP7 A;  2UXB B;  4P2Z A;  3UO2 A;  5EYP B;  1Y67 A;  1MZF A;  1QNM A;  1CP9 A;  4L8J A;  4X88 A;  3AG3 B;  1WA8 B;  1FXK C;  1IZ3 A;  4UV8 A;  4OX9 O;  1KYO F;  1QLE B;  2A7W A;  4HZ3 A;  3ZJZ A;  2EZO A;  2WLK A;  4RWU A;  3CB2 A;  3CRC A;  3U11 A;  5IWA O;  1I94 B;  3SPI A;  3JAK B;  3OTO O;  1Q81 W;  2PTM A;  1BSM A;  3QTC A;  3W7T A;  3ZHS A;  1B06 A;  3OUS A;  3K03 A;  3CX5 F;  1GM7 A;  2OYQ A;  2PZS A;  5BY1 A;  4UVC A;  2WAM A;  3E22 A;  2Q4P A;  2YI9 A;  4X8A A;  2QR4 A;  3JCU Z;  1OCC B;  1OCO B;  2ILM A;  3T4Z A;  4JZ2 A;  1MSD A;  2WWW A;  2DWE C;  2GUZ B;  1TVK B;  3L72 H;  2DYS B;  2XAS A;  3SJC C;  1E1R G;  3CCV V;  3HKE B;  4I4T B;  2ZE7 A;  1HDJ A;  3TCU A;  4JI8 O;  4C7U A;  2B5U A;  1GO3 F;  4RQE A;  4O2B A;  4G28 B;  1KB9 F;  2YXL A;  5D5P A;  4UCO A;  3CE2 A;  4GKK O;  1H2G A;  5A9G A;  4AQY B;  4CS3 A;  2M7W A;  1UJW B;  2UXC O;  1K5S A;  5IJ0 B;  3IJ4 A;  1BQ0 A;  1SQQ H;  5CA1 B;  3CPW U;  1F4M A;  3K04 A;  1XRE A;  4IIJ A;  3OT7 A;  4LF8 O;  2Q0A A;  3ZCC A;  3J80 N;  2DN9 A;  3C3S A;  1AR1 B;  2YEV A;  3RFR A;  1QLN A;  4MW3 A;  5BXZ A;  4F6R A;  3E8H A;  1XIL A;  2R9R B;  4QPJ A;  4X62 B;  4B3T O;  3JAW A;  5DED A;  3W7S A;  1SA0 A;  4ZI7 A;  1Q7Y W;  2PY5 A;  1JMK C;  4PA9 A;  4WFH A;  3SYC A;  2ZIN A;  2AW9 A;  3RWR D;  2CGO A;  3E83 A;  4EB6 A;  3B77 A;  1TA8 A;  4CH3 A;  4JI3 B;  2B1I A;  2LO1 A;  2ZR2 A;  4O4H A;  5IYD O;  1R3K C;  4RUE A;  2WLI A;  3K3W A;  3QF7 A;  2Z5U A;  3NXS A;  2BCC H;  2GTA A;  4X64 O;  1N32 O;  2E76 B;  2YS8 A;  1Q6I A;  3OR7 C;  4JI6 O;  2JEU A;  1Y74 A;  1I5X A;  1RM1 C;  3OW2 U;  1FFX A;  1N0N A;  4YIO A;  2UXX A;  4B7E A;  1ZL8 A;  4NXN O;  1AI7 A;  4O2A A;  4I9W A;  3A2F A;  3E22 B;  4FLV A;  1SQX H;  4GYC B;  4LH6 A;  4XDL A;  3D36 C;  3ZN1 A;  1Q5O A;  2MK3 A;  2Z0A A;  2PI5 A;  3DC5 A;  3N27 A;  2EIJ C;  3A8T A;  4LP8 A;  5FPR A;  4Z1V A;  1H2M A;  2ZQM A;  4JAU A;  4O4I A;  1HNZ O;  3CC2 V;  1NZ6 A;  4F6E A;  2Q9L A;  1OJH A;  1TGO A;  4JTC B;  5CB4 A;  4DUY O;  5J2U A;  3BPZ A;  4WFF A;  4O2B B;  2CDY A;  1T5E A;  4BIO A;  4D7S A;  5IWA B;  1WLE A;  4PEL A;  3CYO A;  1F7Y A;  1H2S B;  5LYJ A;  1WAZ A;  3RGB A;  4DV6 B;  2IW5 A;  1JJ2 U;  4MVQ A;  1BL8 A;  1NTK H;  1V54 C;  1F51 A;  1QCE A;  4JTA B;  4X65 O;  3S3W A;  4Q6G A;  4TQF A;  4IIJ B;  1PKX A;  1NR1 A;  1J95 A;  4FFB A;  3N2G A;  1NU1 H;  2YEV B;  4YY3 B;  4AIL C;  3I55 V;  3R66 A;  4YXW G;  5KMG A;  3ABL B;  4JYB A;  4DV7 B;  3ABK C;  1IXM A;  2Q67 A;  3WFV A;  4F6R B;  4JAA A;  1YJW V;  4K0K O;  1GAX A;  2W0F C;  4FMT A;  3B09 A;  3S3X A;  4JYC A;  5KHH A;  3JAW B;  3JAM N;  4ASU G;  3GVM A;  4BR6 A;  2KQX A;  1SA0 B;  1UPG A;  1V55 C;  1VF6 A;  2V7Q G;  4ZI7 B;  1N4C A;  5B1O A;  1ZSP A;  2Q69 A;  4JI8 B;  1KQS U;  4EB6 B;  1HWY A;  2XOK G;  5BR8 O;  4K8Z A;  5B66 Z;  1PP9 H;  4UVA A;  1XNQ O;  1NVP D;  2WSS G;  1AB3 A;  5L3G A;  4GKK B;  4O4H B;  3APQ A;  5FL7 G;  2VQE O;  2F93 B;  4LF9 O;  4G2K A;  2WLI B;  4KUM A;  4J7Z A;  3MDS A;  1COW G;  4JV5 O;  1IBK B;  3FYI B;  4X9Q A;  3OEH G;  2VRZ A;  1R3J C;  1AI4 A;  2WLN A;  3BRC A;  1Y74 B;  3SPC A;  2F43 G;  5IYZ A;  2QKS A;  4FIP C;  2DW4 A;  2OTL V;  1FFX B;  4MW8 A;  1JVM A;  4R6Z A;  4XDJ A;  1ZL8 B;  2K1E A;  4O2A B;  2RDC A;  4R50 A;  2F1M A;  2EIN C;  2Q5Z A;  3JYC A;  2BTO A;  2QJ1 A;  1ROP A;  2P7T C;  1SKV A;  1CPY A;  3AK2 A;  1XI1 A;  2O57 A;  2YIC A;  2ODM A;  4B3T B;  2HG5 C;  1THZ A;  4YIP A;  2X6B A;  2H8P C;  1Z5V A;  1JJO A;  1N8R W;  3STL C;  5TIS Z;  1QVF U;  5IDJ A;  4O4I B;  4PHZ A;  5KAF Z;  4LFB O;  2QM7 A;  3BHP A;  3L74 H;  5CB4 B;  3OMA B;  3D36 A;  3JAL A;  5J2U B;  5B5E Z;  4H44 B;  3OM3 B;  4I55 A;  4LF5 O;  4BIZ A;  4YHH O;  3EHB B;  4J10 A;  1GH6 A;  5GW7 A;  1VF7 A;  5LYJ B;  3BCC H;  3HKC A;  2CTQ A;  2KG7 A;  1SER A;  4DO2 A;  4DXW A;  2QDO A;  1S5J A;  2XAJ A;  1R73 A;  4FFB B;  3N2G B;  1SES A;  1IBL O;  5KMG B;  2VS0 A;  2Q0O C;  3I56 V;  5JVD A;  3STZ C;  2LGW A;  2RMK B;  3LDE A;  3JAR A;  2D3O W;  4MTF A;  3SGI A;  3D8C A;  4DV1 B;  3LNN A;  1HNZ B;  2OT5 A;  2WLL A;  3K0D A;  2ZM6 B;  1E1Q G;  3LDD A;  4JI2 O;  3FYE B;  5CA0 A;  4DUY B;  4DV5 B;  2Q73 A;  4K3A A;  3ZMT A;  3RYC A;  4LF6 B;  1OHH G;  1V9P A;  2HP8 A;  1QR8 A;  2WA4 A;  3E8F A;  1GN2 A;  4MVO A;  1AJN A;  4MSW C;  3RVZ A;  5LP6 C;  2X6C A;  1DK1 A;  4PA3 A;  3SJB C;  3JAK A;  1KUQ A;  2JVD A;  3P32 A;  1RSO A;  2ZXW C;  1ZTE A;  3JD2 A;  2YXY A;  1N33 O;  5LL6 Y;  1MZE A;  1Y6X A;  2IJH A;  1TUE B;  3D3Q A;  5IYZ B;  5H9C A;  3OGC C;  2HEP A;  3IC9 A;  4CC5 A;  2JS3 A;  4DR6 O;  1MNG A;  1ORQ C;  2Y69 C;  1GMG A;  1GTO A;  2XT9 A;  4JI5 O;  5A2Q N;  1N36 B;  3ZIA G;  2KSD A;  2IM9 A;  5KUM A;  5H5N A;  1P4R A;  1SF9 A;  1TVK A;  1P7B A;  2XUM A;  1L0L H;  2JIZ G;  2IH1 C;  4FZ0 A;  2AZ0 A;  2D2C B;  1PD3 A;  5IE9 A;  1XMO O;  4HAM A;  3AEI A;  2JJ1 G;  3F5T A;  1I08 A;  4LNU A;  4P30 A;  5BR8 B;  1J5E B;  4TV9 A;  1IX9 A;  1R6N A;  2H3O A;  2JGU A;  3JAL B;  5KX5 A;  3OTF A;  2VWK A;  2HHH B;  4I55 B;  2LGQ A;  4ZOL A;  3KZI Z;  2ITC C;  2IJJ A;  4D7T A;  5K1X A;  2EIJ B;  3AG7 A;  1QQC A;  2WLJ A;  1AJQ A;  4CS4 A;  5LA6 A;  4W4L A;  4DK1 A;  4TUY A;  5GTH Z;  3HKC B;  4GLX A;  1M90 W;  2KG7 B;  1GN6 A;  2ZDI C;  2VQF O;  1IUR A;  1R1B A;  4KHP O;  4G27 B; 
#chains in the Genus database with same CATH homology
 1XL4 A;  1S76 D;  3CPW U;  1F4M A;  2C2A A;  3K04 A;  3OMN B;  2FTK A;  5E1A C;  5IYB O;  1K3E A;  3ZCC A;  1OCZ C;  1AR1 B;  1K4D C;  2YEV A;  3AG3 C;  1VQO V;  1QLN A;  4MW3 A;  2EIL C;  1YTF D;  3ABU A;  1MG1 A;  4MVS A;  2WPD G;  5CN0 A;  3ZRW B;  2JJ2 G;  1EFR G;  5HFL A;  1R3I C;  3E8H A;  4BIU A;  2R9R B;  4PA4 A;  1R3L C;  4QPJ A;  1L1F A;  5EC2 C;  1I5Y A;  5B3S B;  1NH2 D;  1F4N A;  1OCZ B;  3T4D A;  5H6Q A;  4U7O A;  2NLJ C;  3W7S A;  5B1B B;  3QO5 A;  1Q7Y W;  2WLL B;  3K08 A;  4PA9 A;  4WFH A;  2NNU A;  3SYC A;  1VQ9 V;  2UXN A;  1GK9 A;  3E83 A;  3WG7 C;  2XAG A;  4PDM A;  3B77 A;  3LDC A;  2QTO A;  2B1I A;  5IY5 C;  1S3J A;  1GM9 A;  3ETE A;  2ZR2 A;  3FB6 C;  3ABT A;  5IYD O;  1R3K C;  1SET A;  3M99 B;  1FXH A;  1JQ0 A;  2R9I A;  3CC7 V;  4RUE A;  2WLI A;  3K3W A;  4BW5 A;  1KD1 W;  3WG7 B;  1GM8 A;  2W6J G;  2Z5U A;  2IH3 C;  1OCC C;  1OCO C;  1AI6 A;  1M56 C;  1Y66 A;  3E86 A;  3NXS A;  4JPR A;  1VQN V;  3VBB A;  1GKF A;  2Q68 A;  2LFS A;  4E2L A;  1JOY A;  5IY5 B;  3H01 A;  1G4Y B;  3OR7 C;  1Y4M A;  4XBF A;  3HPL C;  2JEU A;  4CBC A;  1DF5 A;  3E2E A;  2OCC B;  4MTG A;  3RVY A;  3OEE G;  3AG4 B;  1I5X A;  1YI2 V;  5LBQ A;  1RM1 C;  4MVZ A;  5L3E A;  3OW2 U;  3F7Y C;  2UXX A;  3KG2 A;  4WF9 V;  1AI7 A;  4I9W A;  3K9A A;  4QNH B;  1CEZ A;  1K33 A;  5LHI A;  2A9H A;  4UVB A;  3E8B A;  4XDL A;  1K97 A;  3ZN1 A;  4PDV A;  4CZZ A;  1VQ5 V;  2MK3 A;  1EBO A;  5CBH A;  3AG1 C;  2PI5 A;  2QEX V;  1YHQ V;  5KUK A;  2X6A A;  3QO8 A;  1RM1 B;  5KA6 A;  4KFM A;  2EIJ C;  2QE7 G;  1FS0 G;  3MHS C;  3ZRX A;  5L3F A;  5BZB A;  3E89 A;  4LP8 A;  3X2Q C;  2EBO A;  4MTX A;  2ZQM A;  2XND G;  4MVR A;  3F7V C;  4JAU A;  4JAV A;  3CC2 V;  3A0R A;  3AG2 B;  3W7X A;  1SRY A;  3DGE A;  3AG1 B;  4JGS A;  1S0V A;  3T2M A;  2JDI G;  4MT8 A;  3K0G A;  4JTC B;  2XAQ A;  3K06 A;  1F23 A;  3ETG A;  3OUF A;  3R65 A;  4WFF A;  3MHH C;  1VQM V;  3CCJ V;  1QBZ A;  3CCQ V;  4JTD B;  1Q86 W;  1WLE A;  4PEL A;  3CYO A;  5EC1 C;  5J9P C;  1OZ0 A;  2GSM B;  5CMU A;  5KA5 A;  2WLM A;  2AHY A;  2IW5 A;  1JJ2 U;  3ZMU A;  4MTO A;  4MVQ A;  1QR9 A;  1BL8 A;  3LNM B;  3GB7 C;  1V54 C;  5B3S C;  4UXN A;  1F51 A;  3CCM V;  1QCE A;  2XAH A;  4JTA B;  4FPP A;  2HFE C;  2AHZ A;  1PKX A;  1NR1 A;  3LUT B;  5B1B C;  3CMA V;  4MS2 A;  1J95 A;  3OAA G;  4N21 A;  1FXV A;  4PDL A;  2YEV B;  4R8C A;  4RAI A;  1YIJ V;  3I55 V;  1R6K A;  4YXW G;  3IC7 A;  3CP1 A;  3FB8 C;  3ABL B;  1JX9 A;  4FJC C;  4JYB A;  2HLD G;  4UUJ C;  4H37 A;  1V54 B;  3ABK C;  4FK5 C;  1IXM A;  2Q67 A;  3WFV A;  2HJF C;  1H8H G;  4JF3 A;  1YJW V;  2EIM C;  5LHG A;  2W0F C;  4FMT A;  3E35 A;  1QVG U;  4GT1 A;  2ZR3 A;  4JYC A;  3JD4 A;  3RBZ A;  5DN6 G;  1YJ9 V;  3OMI B;  4GX5 A;  1M9N A;  4ASU G;  4U7N A;  4RUF A;  1M57 C;  4OXS A;  1V55 C;  4TT3 G;  2V7Q G;  3LSS A;  4J9Y B;  3DTU B;  4WFE A;  5B1O A;  3QO7 A;  5IYC O;  3ABK B;  2IU3 A;  2Q69 A;  3ABM C;  1KQS U;  2JK5 C;  1HWY A;  2LP7 A;  2P6J A;  2DQ3 A;  1G8M A;  2XOK G;  3F5W C;  5L3C A;  4QJF B;  2EIM B;  3SYA A;  2LFR A;  1OCR B;  5LGT A;  2OCC C;  1H38 A;  4UVA A;  1PNM A;  3AG4 C;  3JD1 A;  4P9P A;  1NVP D;  1AJP A;  3W7W A;  2WSS G;  5L3G A;  4L87 A;  3ZN0 A;  2BOC C;  1M57 B;  2GHY A;  1V55 B;  4QE9 A;  5FL7 G;  1JCH A;  3CXC U;  2W6I G;  4G2K A;  2WLI B;  2HVJ C;  3ASN B;  3ABM B;  4KUM A;  1COW G;  1YTF B;  3FYI B;  1BMF G;  4TSF G;  5C93 A;  1FXK A;  1VQP V;  5LGU A;  3OEH G;  3G71 V;  1R3J C;  1AI4 A;  2WLN A;  2Y48 A;  3CCL V;  1S77 D;  4Z1M G;  3SPC A;  2F43 G;  1NH2 B;  2QKS A;  1KP2 A;  3JCZ A;  4FIP C;  2DW4 A;  1LNQ A;  1K8A W;  2OTL V;  4MW8 A;  4R6Z A;  1JVM A;  4XDJ A;  1K9M W;  2K1E A;  1B6Q A;  1VQ8 V;  1JPX A;  1DTO A;  3AG2 C;  4R50 A;  5L3D A;  2EIN C;  5L3B A;  3JD3 A;  3JYC A;  4N23 A;  1VQ7 V;  3JD0 A;  1ROP A;  2X7R B;  3B8M A;  3BY6 A;  2P7T C;  1YJN V;  3OFN G;  1H8E G;  1CPY A;  1VQK V;  4GX2 A;  1W0J G;  1PNK A;  2DQ0 A;  3HB3 B;  2HG5 C;  1THZ A;  3CCU V;  1MAB G;  2P90 A;  2X6B A;  4QPK A;  2YSU B;  2H8P C;  3SJQ C;  2KB1 A;  5LGN A;  3ML0 A;  1N8R W;  4MVU A;  3OR6 C;  3STL C;  2EIN B;  1QVF U;  5IDJ A;  3PJS K;  2ITD C;  3ETD A;  3SYP A;  1YSC A;  5EBW C;  1EZJ A;  2QM7 A;  3GWO A;  1K73 W;  1M1K W;  3T1C A;  3ZMZ A;  3OMA B;  2QM8 A;  3D36 A;  3G6E V;  4GX1 A;  4EKW A;  3OM3 B;  2P67 A;  4BIZ A;  3UM7 A;  3EHB B;  4X89 A;  2DYR B;  1K5Q A;  5GW7 A;  3SPJ A;  3ABL C;  4KP4 A;  1YIT V;  2BOB C;  5B1A C;  3CD6 V;  1W2B U;  1K34 A;  2JEX A;  1Q82 W;  2EIK B;  2IJK A;  3FB7 C;  4MVM A;  5EBM C;  1SER A;  4DO2 A;  4J9Z B;  5DM6 V;  4DXW A;  3SPH A;  2X0L A;  4JAS A;  5LHH A;  3UKM A;  2A0L A;  4WCE V;  4PDR A;  4QE7 A;  3OE7 G;  4PA7 A;  4F4L A;  4P9O A;  4TWK A;  2XAJ A;  3CCS V;  1R73 A;  1KC8 W;  4QIW F;  1SES A;  5B1A B;  1W0K G;  4RQF A;  2IJI A;  3CC4 V;  1S5H C;  2ZDI A;  3W7U A;  3I56 V;  1OCR C;  2DWD C;  2H94 A;  3STZ C;  3ZRW A;  3LDE A;  2D3O W;  4MTF A;  1ARO P;  3ASO C;  2QA4 V;  1MOF A;  4P2Z A;  1QLE C;  3ASN C;  4ZBM A;  3RW0 A;  3B8N A;  1ENV A;  1S72 V;  4GX0 A;  1CP9 A;  5B1N A;  2OT5 A;  3IGA C;  2WLL A;  4X88 A;  4PA6 A;  3K0D A;  3AG3 B;  1E1Q G;  3IFX A;  1MSW D;  5CA3 A;  3LDD A;  2EIL B;  3G4S V;  3FYE B;  1KEC A;  1FXK C;  4UV8 A;  1AI5 A;  5H6R A;  1KKD A;  3ASO B;  4GCZ A;  4I5S A;  3ZMT A;  1RPR A;  2B1G A;  1VQ6 V;  1OHH G;  1QR8 A;  3E8F A;  4MVO A;  1QLE B;  1AJN A;  4HZ3 A;  4MSW C;  3ZJZ A;  3RVZ A;  1NKD A;  2EZO A;  3SYO A;  3ZMS A;  2WLK A;  2XAF A;  1PNL A;  4WFG A;  3CCR V;  4HYO A;  3K79 A;  2X6C A;  4PA3 A;  1FXK B;  3P32 A;  2IU0 A;  2OTJ V;  2ZXW C;  3JD2 A;  3SPG A;  5EBL C;  1BHB A;  1K4C C;  5EK0 A;  3FKS G;  1FFT B;  3D3I A;  1VQL V;  3SPI A;  1ZWI C;  1Q81 W;  4BAY A;  2HVK C;  1NBM G;  2IJH A;  1TUE B;  2CK3 G;  3TK1 A;  5H9C A;  1XL6 A;  3W7T A;  3OGC C;  5CBG A;  3BEH A;  3E8G A;  3OUS A;  3K03 A;  1GM7 A;  4XDK A;  4LBE C;  2PI4 A;  1BHA A;  1ORQ C;  2DYS C;  2EJR A;  2Y69 C;  1GMG A;  2WAM A;  1GTO A;  2ZXW B;  3P30 A;  4UVC A;  4LC1 A;  3ZIA G;  2EZP A;  4X8A A;  5KUM A;  1OCC B;  1OCO B;  1M56 B;  1NQT A;  4H33 A;  1PL0 A;  3T4Z A;  1P4R A;  2WWW A;  2A79 B;  4R7C A;  3ZMV A;  3VOU A;  1P7B A;  2DWE C;  1NVP B;  2DYR C;  1K92 A;  1SZT A;  3LSQ A;  2JIZ G;  4WFA V;  2IH1 C;  2DYS B;  2XAS A;  2Y69 B;  1E1R G;  3QNE A;  4UV9 A;  1KP3 A;  4Q20 A;  1PD3 A;  3ZRS A;  3CCV V;  4LCU C;  4HAM A;  2ZD9 A;  2JJ1 G;  3AEI A;  2EIK C;  2Q6A A;  2V1D A;  4P30 A;  1NR7 A;  3EFF K;  2Z3Y A;  3FB5 C;  3TCU A;  1R6N A;  4ZKI A;  2B5U A;  1DLB A;  4RO2 A;  1GO3 F;  4WFB V;  2HR3 A;  4RQE A;  5HFM A;  2ITC C;  2IJJ A;  3ZRV A;  4G28 B;  2WLH A;  3TET A;  3MD0 A;  2EIJ B;  1K7D A;  1H2G A;  1RPO A;  2WLJ A;  1AJQ A;  2M7W A;  1WPX A;  1VQ4 V;  3SYQ A;  1UJW B;  2HKO A;  3X2Q B;  1K5S A;  2ATK C;  1M90 W;  1E79 G;  3CCE V;  1NJI W;  2ZDI C;  3CME V;  1DF4 A;  5CBF A;  4G27 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...