4PA4A

Structure of navms in complex with channel blocking compound
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa4A00
2WLLB 2WLIA 3ASOC 5B1AC 3RBZA 3STLC 3OGCC 2X6BA 2A9HA 3LDCA 4R50A 3K0DA 3E86A 4G27B 3SYCA 2EIMC 4TWKA 1R3JC 2QKSA 4QE9A 3RW0A 4XDLA 3SYAA 3K04A 1R3LC 2H8PC 4P30A 1OCCC 4R6ZA 2WLNA 3OR7C 3T4ZA 1JVMA 2NLJC 2OCCC 4MW3A 3VOUA 2ITCC 4PA7A 5EBMC 3FB7C 3SPCA 4RAIA 2JK5C 1K4CC 3OR6C 5EK0A 3FB6C 4GX0A 4JTDB 2K1EA 4JTAB 4WFGA 1J95A 3ABMC 4RO2A 5EBWC 3TETA 4MVQA 4J9ZB 2X6AA 3IGAC 3JYCA 4WFHA 2QTOA 3SYQA 3FB8C 3K06A 1R3IC 5CBFA 3ABKC 3ZRSA 4LP8A 3KG2A 2DYRC 3OUSA 2P7TC 1V54C 2Q69A 4R8CA 2R9RB 3ZJZA 2BOCC 4MVSA 3T4DA 2BOBC 4GX2A 5B3SC 4RUFA 4XDKA 3AG1C 3K03A 3LDEA 5KUKA 5IY5C 1P7BA 3E83A 3SPJA 4MVUA 3E8GA 4P9OA 3E8BA 3E8FA 4MSWC 4I9WA 1M57C 2X6CA 3R65A 4PDVA 4MW8A 4ZBMA 2Q68A 4QE7A 4MTGA 2WLMA 2AHYA 3FB5C 2EIJC 4X88A 3OUFA 4MVRA 4PDLA 3F5WC 4PA9A 3SPHA 4OXSA 2ZXWC 4WFFA 3RVYA 1R3KC 3UM7A 3LDDA 2EILC 5EBLC 5E1AC 4R7CA 1OCOC 2A0LA 4PA4A 4DXWA 4JTCB 4CBCA 1OCZC 5CBHA 3K0GA 3PJSK 4GX1A 2ATKC 1ORQC 4LBEC 4MVOA 3T2MA 3E8HA 4BW5A 2WLKA 2IH3C 1BL8A 4PA3A 2HG5C 3HPLC 3SJQC 2YEVA 2A79B 3T1CA 2HJFC 4XDJA 4PA6A 4EKWA 3AG4C 5KUMA 4J9YB 3SPIA 3AG2C 4X89A 4UUJC 3UKMA 3WG7C 5BZBA 3ASNC 5J9PC 4MTFA 4GX5A 4H37A 4MVMA 4X8AA 5B1BC 1G4YB 2EINC 4RUEA 1OCRC 3SYPA 3F7YC 4LCUC 3STZC 3F7VC 4KFMA 2EIKC 5EC1C 4MVZA 2DWEC 3E89A 1K4DC 3RVZA 2WLLA 2HVJC 2DWDC 3AG3C 3IFXA 3BEHA 4MS2A 4PDRA 1XL6A 3K08A 2HVKC 2IH1C 3ABLC 2Y69C 3EFFK 3LUTB 4H33A 4PDMA 3SYOA 4HYOA 3TCUA 4MTOA 2ZD9A 1LNQA 1QLEC 3X2QC 2ITDC 4F4LA 2AHZA 2Q6AA 1V55C 3LNMB 2WLHA 2Q67A 3SPGA 4QNHB 5CBGA 1KKDA 1S5HC 2W0FC 4HZ3A 1XL4A 2DYSC 1ZWIC 2WLIB 4P9PA 4G28B 5EC2C 2WLJA 3GB7C 1M56C 2KB1A 4WFEA 2HFEC 4P2ZA
chains in the Genus database with same CATH superfamily
3OGCC 2RDCA 5JVDB 2CK3G 2N74A 1YJNV 1S3JA 5KX5A 2QR4A 3W7WA 4MW3A 3WFVA 4FFBB 4GKJB 4YY3O 1AJPA 1Y74B 1H2KA 4ZKIA 2C2AA 3JYCA 5KLVH 2IU0A 3MAQA 2P7TC 4DV5O 1Q6HA 4LWSA 4MVSA 4RUFA 4XDKA 5IY5C 5C8YA 1P7BA 4ZIBA 4MVUA 1F51A 4MSWC 2FMLA 4MT8A 3CCJV 4ASUG 1M57C 2UU9O 1JPXA 2YI8A 4PDLA 2FL4A 4YJ2A 1G8MA 1QNMA 2PGGA 1OCZC 3PJSK 2ZINA 1OV9A 2EX3A 5GTIZ 3T2MA 2JS5A 2F23A 2IH3C 1NTKH 5LXTB 3T1CA 3RT3C 4RQEA 4I4TB 5JJNB 1GM7A 1EM1A 3FFQA 4PV1B 1XOUA 4X1IA 5DECA 2FYUH 4I9QA 1K9MW 1VQMV 3AEIA 4DV6O 4FFKA 3JD4A 5IYDO 5LGNA 1NZ6A 3ZRWB 3W7UA 2DWDC 3BEHA 1XL6A 4QPJA 1ZTEA 3ABLC 1HNZO 1K33A 1LUWA 1LNQA 2YC0A 5BMVB 2AHZA 2CH7A 2Q6AA 2W0FC 2WLIB 3K57A 1V9PA 2K9PA 2RNBA 1FFXA 3GVMA 3T1HO 4P2ZA 4FLZA 2JIZG 2A9HA 5D5PA 1N0NA 2CTQA 2YI9A 3K04A 3IC7A 1MZFA 4FJCC 2NLJC 2OCCC 3D36C 4DV4B 2UUCO 3ABMB 4JI2O 4DR6B 4TOIA 4BW9A 2GTAA 1Q86W 4U3JB 2X6AA 3CRCA 1X59A 2QWRB 1EN4A 1K5SA 1KC8W 2E3CA 4R8CA 3L70H 1SA0B 3CRAA 2BOBC 2IJJA 5JQGB 5LP6A 2PYJA 3W7XA 4AQYB 4I5SA 2KSDA 2JVDA 4X65O 1P84F 1J5EB 4X9QA 4N23A 1K5QA 3H1LH 2A0LA 4JTCB 2YEVB 3BA9A 4DR3B 3VQVA 1JMKC 2L6LA 2WLKA 4PA3A 1BL8A 3SJQC 2HG5C 4YHHB 3AG7A 2P6JA 3RGBA 5DM6V 2UXBO 2GSMB 4WBNB 2DJVA 3OTOO 4NXMB 1H2GA 4PJ0Z 2Q7HA 2XASA 4LF8B 3RYFB 3HKEA 2AGAA 1RM1C 1I94O 2DWEC 4DR2O 1W59A 2E5LB 1PNKA 1VQ9V 3IC9A 2H3OA 3K08A 2IH1C 3ZJZA 2ILMA 2Y69C 5IWAB 1MG1A 3G71V 3LSQA 1EBOA 3T1YO 2ZE8A 1YTFD 3J7AU 2LW7A 4LR3A 1BS3A 3N2GA 2ZNIA 4O4LA 3WU2Z 1JR9A 1KYOF 1HNXB 3JAKA 2NN4A 3ZN1A 3STLC 4LF7B 3HB3B 1DGSA 3SYCA 4AI8A 3CCVV 3RYIB 3ABTA 3B8NA 3LSUA 3JATA 2XAQA 2YXHA 1MABG 4IHJB 3CCRV 3FB7C 1M5IA 2HEPA 4WFGA 2FB5A 1SETA 2R72A 3LSSA 2IJKA 1EN5A 5L3CA 2AZ2A 5J2UB 3FYEB 1FKAO 4PELA 2ZM6O 4FLVA 2PI5A 3H1JH 4GX2A 2EJ7A 2F4VO 2WSSG 4OPAA 4P9OA 4U3FH 3X2QB 4I9WA 3B77A 3D3QA 4DUYB 3OUFA 1SC5B 4WFFA 3RVYA 2RN9A 2UUAB 4GX1A 4DR5B 3CJHB 2FKXA 5IY5B 3OE7G 1VF6A 1WPBA 5H6RA 2IJHA 5DN6G 5KHGA 4MTFA 4K0KO 3HKBA 1OCZB 2CUGA 1TUBB 1PD3A 1TA8A 4Z2WA 1PKXA 3E89A 3JAWB 3IFXA 2DW4A 1YCIA 1OHHG 3O9OA 4H33A 4DR1B 1WP8A 1XNRO 1P7GA 1U97A 5K1XA 3ZMZA 1GN4A 1KKDA 3LNMB 5BR8O 5JJJB 3DXRB 5K1PA 4JZ2A 1RSOB 1DF5A 5B5EZ 1L0LH 3ABLB 2EIMC 4UCSA 3RW0A 4DV2O 2ZDIA 3H1KH 2VWKA 3OR7C 4JGSA 2UXCB 5IT9N 1EZVH 1MNGA 4IIJB 3L74H 1XHXA 4LH7A 3ETGA 5EBWC 4MVQA 4J9ZB 5IJ9B 2QTOA 5GTHZ 3CC2V 2LO1A 3JAMN 2AZ0A 4WCEV 2JGUA 5AG2A 4MW8A 3ZIAG 4GLXA 2UUBO 1VEWA 3OT7A 2EILC 4TV9B 4DV0B 1FAFA 5CA1B 5KMGA 2UXXA 5HFLA 1JFFB 3TK1A 1AROP 3CCLV 2Q9LA 2H94A 2QWPB 3BVOA 3P3PA 1BQ0A 2HJDA 4L8JA 1N34O 4EKWA 4LC1A 1BMFG 3CP1A 5KUMA 4OGQB 1VMGA 2EZPA 1I08A 1QCEA 2XUMA 5KHHA 5FPOA 1K97A 1NR7A 2GV9A 4NB5A 2V7QG 3N2KA 3SGIA 5ITZB 1G4YB 4JAUA 4YY3B 3OMIB 3STZC 2EIKC 3ZX6A 1K34A 4I50B 4I55B 4F6RA 4DV5B 2CGNA 3CCMV 2YICA 3FAVB 4BWAA 4B3TO 4F4LA 4X1KA 2UU9B 1T5EA 4JI6O 2DOSA 1FXKA 4FIPC 4MTXA 3BA8A 5B1AC 3VBBA 1XBLA 3DSQA 1R73A 2QM7A 2Y69B 3VQXA 3CCSV 2WLNA 1JVMA 1NI8A 3OR6C 4LFAO 4FVMA 1ZL8A 3A8TA 4O4JB 3ABMC 3CRRA 1G6UA 1NKDA 4FLWA 3K06A 3RFRA 3TGUH 4DV6B 1XDCA 4ZI7A 1WN7A 4J7JA 3RYCB 3DTUB 3UCSC 5L3GA 3E83A 2F95B 3E8GA 4FLTA 1AP5A 1HNZB 1JJ2U 4ZBMA 2JS3A 1YTFB 3BY6A 4TSFG 2XAFA 1NR1A 1NJIW 2M6YA 2CE4A 1VF7A 4ZHQA 3T1HB 1NH2B 4KXRA 4JASA 4X20B 5LA6A 3JD1A 1EN6A 4LF4O 4F6EA 1Y66A 2P22C 2WPDG 4DW1A 1O9HA 2UUCB 3GWKC 3TXSA 4JI2B 2KG7A 2YSUB 2ODMA 2Q7EA 4LCUC 2V4DA 4GKKO 3VQWA 1VARA 1H2NA 3P30A 4WFAV 3E22A 2QGNA 3CX5F 1UJWB 1GKFA 4LNUB 1IBLO 2E74B 4MTOA 2ZD9A 2ITDC 2JGDB 4QNHB 1TGOA 2LGQA 4HZ3A 4UV8A 3K5OA 2WA3A 2OCHA 4X65B 1JCHA 1AR4A 4FMTA 2IW5A 2WLLB 3RBZA 2F66C 4NTXA 5FNVB 3DC5A 1Q43A 1WAZA 3JSLA 1XMOO 1YXBA 3SJBC 3ZN0A 4QIWF 1B3QA 3CC4V 3F5TA 3WB2A 2FTKA 4J10A 2UXBB 4FK5C 4B7EA 3OTOB 3HR0A 1BE3H 3CYOA 1WB8A 5FPRA 1R6NA 2ADQB 4PD4F 4ZOLA 4L87A 4TV8A 3NR7A 4CH6A 2EIMB 1Z5VA 4J42A 5D5QA 1I94B 4DR2B 3C3TA 1YHQV 5B3SC 1XMQO 1KBHA 2ZCEA 2PY5A 2HR3A 3OEEG 4I4TA 4PDVA 4OX9O 1KB9F 3T1YB 3JD0A 3FB5C 5IYZA 3X2QC 2OT5A 1ZLZA 3SPHA 3W7SA 1GH6A 2HLDG 2Y4TA 2F43G 5L3FA 4B3MO 1ORQC 3U11A 2RJZA 1JQ0A 1YEWA 4QGPA 5LBQA 3ASNB 1THZA 4CC6A 3AG2C 1ZAUA 3L71H 2EILB 2X0LA 1SZTA 5B1BC 3D8CA 1PP9H 2BSKA 2DMXA 3H01A 4J41A 4DV3O 2CGOA 3FX7A 1VQPV 3RVZA 3OAAG 2ZM6B 1K92A 2QJ1A 2F4VB 4WFBV 3K5MA 4CC5A 2D3OW 2F93B 3G6BA 1FJGO 1ROPA 2EIKB 4G28B 2QKCA 2WLJA 3RYHA 1K73W 3IJ4A 2QM4A 4U3JA 3CS5A 5LHHA 1IVSA 1VQKV 3H9VA 3L73H 4UVCA 1XQ8A 5JH7B 4Z1MG 1SA0A 5GW7A 1S0VA 5JQGA 3ZHUA 1S5LZ 2VQEO 2JK5C 3FB6C 2LFRA 3ABKB 4TQDA 2R9IA 5B1AB 3UO2A 4RO2A 4EEQA 3TETA 4K0KB 1Q6IA 1AR1B 1QU7A 4LWSB 3SYQA 1N33O 4IYHA 3ZRSA 4LP8A 3KG2A 2CTRA 1SQFA 3KCXA 1VF6C 3FYIB 3CHXA 3CMAV 4LF6O 3W7TA 1XREA 4NXNO 1DF4A 1IX9A 1XNRB 2Q68A 4WBNA 5BR8B 3CXHF 5E1AC 1OCOC 1IURA 4UCTA 3RYFA 4YIOA 3G6EV 1VQOV 2B1GA 3E8HA 1NTMH 4BW5A 4E4EA 1BHBA 4JI0O 2BTOA 2HJFC 2W6IG 4DV2B 4EB6A 1F4MA 5J2TB 3AG4C 1Q8IA 4X1IB 1DTOA 4NVPA 2XNDG 2BE3A 2D2CB 4JI1O 1K7DA 5BZBA 1N8RW 1FD9A 3A0RA 1SESA 2YIAA 1H2MA 4C7UA 2XAJA 3AG3B 2LJ2A 4D7TA 4O4HA 4OPHA 1VP7A 5IJ0A 2ZDIC 3D3IA 3G80A 3N27A 1D2DA 3SYOA 2XTAA 5B1NA 4B3RO 3OGIB 2IM9A 3RYIA 5IYCO 2VWJA 4W4LA 1FFXB 5EC2C 2OTLV 3ETEA 2E76B 2YIBD 2QA4V 5FL7G 3OD4A 4IL6Z 2Q4PA 2L35A 3CPWU 5CMUA 3UT5B 2UUBB 3OMAB 2KB1A 1UPGA 3JALB 1CXZB 3ML0A 1L0NH 2X6BA 1NT2B 4R50A 5LOVB 3EVKA 5J2UA 4XDLA 3TJTA 4P30A 5IE9A 2W6JG 3SJAC 2DQ0A 5EBMC 5LGUA 1NBMG 3B8MA 4HBNA 4GX0A 1AJQA 1AR5A 1NH2D 3G67A 2LQTA 5C93A 1V54C 3AK2A 1I7FA 2BOCC 1WLEA 4XBFA 3CJHA 3LDEA 4B3TB 2ZE6A 1I0HA 3L75H 1FXHA 1R3KC 4JI6B 4KL1A 3LDDA 3UM7A 4KHPO 5CBHA 4NTWA 2R9AA 5B3SB 5BY1A 3ETQA 2P06A 3QNEA 1TUBA 2GBOA 2Y4UA 3ZMUA 2JJ2G 1N0JA 4PA6A 1F4NA 3WB1A 3OMNB 1SQVH 3QVNA 4NTYA 2VQFO 3HKEB 3JASA 4LFAB 4G2KA 1GM8A 4RUEA 3P3NA 3F7YC 2DQ3A 4TT3G 3JD3A 3DXRA 2ZIOA 1MSWD 1E1RG 4YJ3A 3QO8A 4DK1A 2B9ZA 5H6QA 1KQSU 3AG2B 4TUYB 4DK0A 5JCOA 1GK9A 1MSDA 1PNLA 2GDSA 1QLEC 5B1BB 4O4LB 2WLHA 3JAKB 1S5HC 4IIJA 1FS0G 1R1BA 4O2BA 1WA8B 4WFEA 2DE0X 5HFMA 5KAIZ 4J11A 2OWOA 5IJ9A 3JCUZ 4BAYA 1R3JC 4DYLA 1BZKA 1H2LA 2H8PC 1XUQA 4LF4B 3D36A 1MMMA 3K5NA 1Y4MA 2ITCC 3SDLA 1XI1A 3TXQA 1DK1A 1AB3A 4JTDB 1MA1A 5LYJA 3ZBHA 3H1HH 5CBFA 2Q8VA 4BR6A 2Q0AA 3OUSA 4GKKB 2G38A 4DV7O 4JI7O 1PL0A 1F23A 1PNMA 4B7KA 4TV9A 1AILA 5CA1A 3AG1C 1JJOA 5KA5A 1JFFA 1TVKB 3E8FA 3E8BA 1H2SB 1IBLB 1IBMO 1NS1A 3C90A 5LL6Y 2QWOB 1N4CA 2QSAA 5B66Z 4R7CA 1S77D 4JI8O 2QWNB 1PPJH 4U7OA 4DV1O 4O2AA 1R6TA 3Q4HA 3HPLC 1M93A 1XMOB 4XDJA 1QQCA 4I50A 2BCCH 3WG7B 3ZHVA 4HNAB 1D5AA 3HKBB 4X89A 4UUJC 3ASNC 3FAVA 1OCOB 1W2BU 1OJHA 4X8AA 1Y6XA 3CE2A 3O65A 1SRYA 5EZYA 4ICGA 2XOKG 2PYLA 2RCVA 3AG4B 1GN3A 1QBZA 4PDRA 4MS2A 1QHTA 1W0JG 1Z2GA 1XMQB 4HYOA 3B40A 2DYSB 4Z1VA 1LUVA 4OX9B 1MOFA 4D6TH 2Q5ZA 4UV9A 3M99B 1VQ7V 1GN2A 4O4JA 4FZ0A 2ADPA 3K9SA 4G27B 4B3MB 4LFBO 4TWKA 4JI4O 4QE9A 3HKDA 4O4IA 5CA0A 1SQPH 3E35A 3VOUA 3CWBH 1R6KA 4IYIA 4CS2A 1CP9A 3ZMSA 1WB7A 2YDEA 3U10A 4B3SO 4DUZO 4CH3A 3FB8C 5EYPB 1AI7A 3ABKC 1AI6A 3CRMA 4DV3B 4FM1A 3ETDA 2Y0IA 2ZQMA 4UCRA 1GO3F 3THOA 4X20A 3E2EA 5EIBD 5JJEB 3BABA 2GUZA 2X6CA 3JCZA 2ZIMA 1M1KW 2EIJC 1FJGB 1I5YA 2CTWA 1BHAA 4OXSA 4GT1A 1L1FA 3CSXA 1V54B 5LMNO 3APOA 5IDJA 1BSMA 4RQFA 1GAXA 3JARA 4X1YA 3DC6A 1Y76B 5GONB 2PI4A 2WA4A 4J9YB 3QG5A 2BTQA 1FYJA 3N2KB 3UQ8A 2R70A 3CC7V 2VQEB 2XAGA 1NVPB 4EFBA 2VS0A 2P67A 1RFYA 5EIBC 3SYPA 4AHCA 1XHZA 4F6RB 1N36O 5LHIA 1N33B 1K4DC 2WLLA 3AG3C 4JI5O 1G1XB 4D7SA 5FNVA 4X1KB 3EHBB 4LF6B 2OIGA 1FXVA 3RWRD 3J80N 1FXKB 4NXNB 5KAFZ 4QJFB 2X7RB 1V55C 4DRXB 1S72V 1ZSPA 3GWOA 4J7ZA 5A9GA 2ZE7A 1VQNV 3K79A 3LNNA 3ASOC 3MD0A 1BGYH 1LR1A 4FM0A 3A0HZ 2QKSA 2EULA 2YXLA 1QLEB 4JI0B 1E1QG 5JVDA 1Q81W 5CN0A 5L3EA 1GN6A 4LF5O 5EK0A 4JI1B 4YXWG 1IXBA 4DO2A 5KHJA 4JV5O 3K9AA 4FFBA 4NKGB 1SQQH 1Y74A 1H8HG 2DYRC 5H2FZ 2XT9A 4I7ZB 1QR8A 1RP3B 2Z0AA 1WJZA 5LP6C 5H9CA 3SPJA 2GHYA 4B3RB 3R65A 4DR7O 1GM9A 1VQ5V 2WLMA 4ZHQB 1ZX3A 2ZXWC 3CCEV 4K8XA 3ZHSA 4JYBA 1O9GA 2HHHO 1A32A 2OTJV 3K0GA 3AG1B 2MW2B 2UXDO 1KMIZ 1TUEB 1XNQO 1QR9A 3ZMVA 3FD9A 4LFCO 2Q7GA 5LXTA 2EINB 2E75B 4PI2A 2A06H 1OCRC 3E22B 4KFMA 1ENVA 4UFZA 5CB4B 4LH6A 1EFRG 1Q7YW 1KUQA 4J7KA 3CXCU 2AW9A 2KQXA 1FPOA 3CB2A 1IDSA 4JPRA 1VQ8V 2HVKC 3KZIZ 3ZRWA 5JH7A 4IGGA 5BXZA 4I0XB 1RPOA 5BMVA 1Q3EA 4W4KA 4KHPB 3IAYA 2WLIA 5DEDA 4LF9O 1SQGA 3EXAA 3I5DA 1WP7A 2M7WA 3HKCB 3L9DA 4R6ZA 4CZZA 4ZOLB 3H1IH 4TV8B 4RAIA 2VQFB 2LP7A 4NR1A 4JTAB 4H13B 4FZ1A 3ZHRA 4WFHA 4DR4O 5KA6A 5KX5B 4UCUA 1B6QA 2XHBA 4KP4A 4BIZA 4DW0A 4JYAO 1QVFU 1YF2A 3U0ZA 1YI2V 4CS4A 2IJIA 5IYZB 3CCUV 5J2TA 1URFA 5H5NA 2AHYA 3B4SA 4MVRA 1IBKO 2RQ6A 1HNWO 2Y48A 2P5OA 2N04A 3PN1A 3C3SA 4FM2A 1KU9A 5C8YB 1Q5OA 1XEQA 2YEVA 2A79B 4UXNA 5JCOC 1AI5A 2QWQB 1SQBH 1RPRA 2LGWA 2P4KA 4GCZA 4H0LB 2EIJB 1WNSA 3UKMA 3WG7C 2BSKB 4YJ2B 1SS3A 4X64O 1K3EA 1S76D 2RMKB 4MVZA 3ZRVA 3UT5A 1E79G 4DV7B 3APQA 3JALA 4JI7B 1GMGA 4X62O 2V1DA 3R66A 5LOVA 2MK3A 4YIPA 3L72H 3ZHTA 3BCCH 1HP8A 3RYHB 3SJCC 4P9PA 1XL4A 2DYSC 1IBMB 1GRJA 2N05A 4GYCB 3GB7C 3JSNA 4X66O 1M56C 2Y0PA 2HFEC 4JI8B 1HR0O 3E86A 4DV1B 1W0KG 1R3LC 3BAAA 3UO3A 2CH7B 1YITV 3T4ZA 1V55B 2EJRA 2ZR2A 5F2VO 3BRCA 4PA7A 1FFTB 2PTMA 3ASOB 5JWPA 4IHJA 4ABMA 2AXTZ 3IGAC 3B2EE 1R3IC 4JI3O 1N32O 2R9RB 5LMUO 2QKAA 1N34B 1JA8A 2W0XA 1NVPD 1AJNA 5A2QN 4MTGA 4PA9A 2DYRB 5EBLC 3KKYA 3J81N 4CBCA 3CD6V 5LP6B 4EB6B 4FPPA 3CMEV 3QTCA 2XAHA 4LFBB 4JI4B 1PM9A 1M90W 1K8AW 1KECA 3DGEA 4TUYA 2NR5A 3G4SV 2ZXWB 3CCQV 1VQ4V 3ABUA 4GUNA 4GKJO 5J9PC 2QTSA 4GX5A 1QLNA 4H37A 4O4HB 1XILA 5IJ0B 3MDSA 5EC1C 4B3SB 4DUZB 2CTPA 2JEXA 3CEIA 3K59A 2PF4E 1WA8A 3ZHQA 2P4VA 2CDYA 4A5UB 2PUSA 3FKSG 4TQFA 3JAWA 1SZXA 2HKOA 3SPGA 1OCRB 5CBGA 5IYBO 4JAVA 4Q6GA 1SQXH 1FXKC 3K03A 5LMNB 2ZT9B 5LGTA 1KP3A 1RSOA 1KP2A 2B5UA 1NU1H 1OCCC 3S3WA 3S3XA 2LFSA 5L3DA 3N2GB 3SPCA 2JEUA 1TVKA 1CEZA 1I5XA 5KHIA 4H44B 1N36B 5E79Z 2Q69A 4N21A 2Z5UA 4Q20A 3T4DA 2VRZA 3JATB 1M57B 3K58A 4JI5B 3P32A 1EZJA 3QO7A 4HNAA 2ZR3A 4K3AA 4U7NA 4HAMA 3NXSA 2ARHA 1KKCA 3ZMTA 2Q0OC 3I55V 1VQ6V 1PL4A 4IT5A 3I56V 4DV4O 3JASB 1CPYA 2GTSA 4B08A 4DR6O 3A0BZ 4LF5B 4E2LA 3ZRXA 2EINC 2YXYA 1HDJA 4K35A 2DN9A 4YJ3B 3F7VC 4FLUA 1TAEA 4JV5B 1Z5WA 1BT8A 5ITZA 4J80A 4QPKA 4AQYO 3RN4A 2QDOA 3LUTB 3TCUA 4I55A 1YDXA 4O2BB 4JF3A 4RWUA 5KHKA 1J5EO 4JYCA 4DR7B 1ZWIC 5CA3A 2EZOA 1BCCH 4FLYA 1HW7A 4DR3O 3OTFA 2HHHB 4BIOA 4UB8Z 1P4RA 2EBOA 3LDCA 4CH5A 4YHHO 2B1IA 2OCCB 4GZRB 5EYPA 2UXDB 4JAAA 1XNQB 1JOYA 1YVWA 1U96A 1L8DA 4NXMO 4LFCB 1AP6A 5LYJB 4LF8O 1K4CC 1GTOA 1M56B 3ZCCA 2K1EA 1H8EG 1YJWV 1J95A 3SR2C 2ETNA 2QE7G 3ZS8C 2HP8A 1P49A 2E5LO 1PV0A 5L3BA 2YIBA 1YJ9V 2Q73A 3BPZA 1YZBA 3K5LA 2YUAA 5IWAO 4K8ZA 2NNUA 4AILC 1Y76A 3RYCA 5GONA 1QVGU 3CRQA 3WB0A 2Z3YA 1HNXO 4O2AB 3M8AA 3QO5A 3KCYA 3Q4HB 4LF7O 4PA4A 1SKVA 1AVMA 3AK3A 1B04A 4LBEC 2WAMA 4MVOA 2WWWA 4LF9B 1US6A 2CAZC 3OFNG 1KD1W 4EFEA 1H38A 5EZYB 3VQYA 1RM1B 4UVBA 1ZUQA 3B09A 3ICXA 5KMGB 4DRXA 4PI0A 2LW1A 4UCVA 3M7MX 4JZGA 1HWYA 1X4TA 4DR4B 1DLBA 4JYAB 3EFFK 2JRIA 4PDMA 2ZE5A 4DUYO 4BIUA 2QM8A 4LNUA 2Q67A 1B06A 1VIBA 1IZ3A 4CH4A 1BQZA 1IBKB 3A2FA 2JGDA 2UUAO 1HNWB 4DR5O 3HKDB 4O4IB 5CA0B 4FLXA 3K0DA 2IBZH 1NQTA 4NYKA 2KKWA 2A7WA 3SYAA 1YSCA 2F1MA 4UB6Z 2JJ1G 3BHPA 1SF9A 3K3WA 5TISZ 1S5JA 2A3QA 4X64B 1D5NA 2ZNJA 4UCOA 3OM3B 1OCCB 1IXMA 2GUZB 4DR1O 5KUKA 5LHGA 4X62B 2O57A 3ZEDA 3OEHG 1ZL8B 2PZSA 4QE7A 4X88A 3F5WC 2P90A 2QEXV 1SERA 4DXWA 1UFIA 3JARB 4X1YB 4ZI7B 4X66B 1M4UA 1OZ0A 2ATKC 1HR0B 5CB4A 2BTQB 3JD2A 4PHZA 2UXCO 5FLXN 3SPIA 2OIEA 1AI4A 4CS3A 1VF5B 2YIDA 2JDIG 1WPXA 3QF7A 4MVMA 2YS8A 1MZEA 1F7YA 4JYYA 4I0XA 5B1OA 3OW2U 5LA6B 3MHSC 4UVAA 3AK1A 1VQLV 2OYQA 4JI3B 1N32B 2HVJC 1Q6UA 1YIJV 5LMUB 2IU3A 4WF9V 3HKCA 2KG7B 1Y67A 1NTZH 1Q90D 1COWG 1JX9A 2UXNA 3BFRA 2ZKOA 3MHHC 1M9NA 4DV0O 4KUMA 1Q82W
chains in the Genus database with same CATH topology
5B1AC 5HFMA 3VBBA 3OGCC 3E86A 1R73A 2CK3G 2QM7A 2Y69B 1R3JC 4BAYA 1YJNV 3CCSV 1W0KG 1R3LC 1S3JA 2H8PC 1YITV 3T4ZA 1V55B 2WLNA 3W7WA 1JVMA 2EJRA 2ZR2A 3D36A 4MW3A 3WFVA 1Y4MA 2ITCC 4PA7A 3OR6C 1FFTB 4JTDB 1AJPA 3ASOB 3ABMC 3IGAC 1NKDA 4ZKIA 2C2AA 3JYCA 2IU0A 3K06A 1R3IC 5CBFA 3OUSA 2P7TC 1PL0A 1F23A 1PNMA 2R9RB 4MVSA 4RUFA 4XDKA 3AG1C 3DTUB 5KA5A 5IY5C 1P7BA 5L3GA 3E83A 4MVUA 3E8GA 1F51A 3E8BA 3E8FA 4MSWC 4MT8A 3CCJV 4ASUG 1NVPD 1M57C 1AJNA 1JJ2U 4ZBMA 4MTGA 1JPXA 4PDLA 4PA9A 1YTFB 2DYRB 3BY6A 5EBLC 1G8MA 4TSFG 4R7CA 1S77D 2XAFA 1NR1A 4CBCA 1NJIW 1OCZC 3CD6V 3PJSK 4U7OA 1NH2B 4FPPA 4JASA 3CMEV 3T2MA 3JD1A 2IH3C 2XAHA 3HPLC 3T1CA 4RQEA 4XDJA 3WG7B 1M90W 1GM7A 1K8AW 1Y66A 2WPDG 4X89A 1KECA 4UUJC 3DGEA 3G4SV 2ZXWB 3CCQV 1VQ4V 3ABUA 3ASNC 5J9PC 4GX5A 1OCOB 1W2BU 1QLNA 4H37A 2YSUB 4X8AA 4LCUC 1K9MW 5EC1C 1VQMV 3AEIA 1SRYA 2JEXA 2XOKG 3JD4A 5IYDO 5LGNA 3P30A 4WFAV 3AG4B 1QBZA 3ZRWB 4PDRA 2DWDC 4MS2A 3W7UA 3BEHA 1UJWB 1GKFA 1XL6A 4QPJA 3FKSG 1W0JG 3ABLC 1K33A 4HYOA 2DYSB 4MTOA 2ZD9A 1LNQA 2ITDC 2AHZA 2HKOA 2Q6AA 1OCRB 3SPGA 5CBGA 4QNHB 5IYBO 4JAVA 1MOFA 2W0FC 4HZ3A 4UV8A 2WLIB 1FXKC 1JCHA 4UV9A 3K03A 3M99B 1VQ7V 4FMTA 2IW5A 4P2ZA 2WLLB 2JIZG 3RBZA 2A9HA 5LGTA 1KP3A 4G27B 4TWKA 4QE9A 3ZN0A 3K04A 1KP2A 4QIWF 2B5UA 3CC4V 1OCCC 3IC7A 4FJCC 2NLJC 2OCCC 2FTKA 2LFSA 3E35A 3ABMB 5L3DA 3VOUA 3SPCA 4FK5C 1R6KA 2JEUA 1CP9A 3CYOA 1CEZA 1I5XA 1R6NA 3ZMSA 1Q86W 4L87A 2X6AA 2EIMB 3FB8C 1AI7A 1KC8W 1K5SA 3ABKC 1AI6A 2Q69A 4N21A 4R8CA 2Z5UA 4Q20A 3T4DA 2BOBC 2IJJA 3ETDA 1YHQV 5B3SC 2ZQMA 1GO3F 1M57B 3P32A 3W7XA 3E2EA 4I5SA 2HR3A 3OEEG 1EZJA 3QO7A 2X6CA 4PDVA 2ZR3A 3JCZA 4U7NA 1M1KW 3JD0A 3FB5C 2EIJC 3X2QC 2OT5A 1I5YA 4HAMA 3NXSA 4OXSA 4GT1A 3SPHA 3W7SA 1L1FA 1BHAA 2HLDG 1V54B 4N23A 1K5QA 2A0LA 2F43G 4JTCB 5L3FA 2YEVB 1ORQC 5IDJA 3ZMTA 4RQFA 2WLKA 4PA3A 1BL8A 3SJQC 2HG5C 1JQ0A 3I55V 2P6JA 1VQ6V 5LBQA 3I56V 3ASNB 2PI4A 5DM6V 1THZA 1CPYA 4J9YB 2GSMB 3AG2C 1H2GA 4E2LA 2XASA 2EILB 2X0LA 3CC7V 2XAGA 1NVPB 1SZTA 5B1BC 3ZRXA 2EINC 2P67A 3SYPA 3F7VC 5LHIA 1RM1C 3H01A 2DWEC 1VQPV 1K4DC 3RVZA 3OAAG 1K92A 1PNKA 2WLLA 3AG3C 1VQ9V 4QPKA 3K08A 3EHBB 2IH1C 3LUTB 3ZJZA 2Y69C 4WFBV 3TCUA 1MG1A 3G71V 2D3OW 1FXVA 1FXKB 3LSQA 4QJFB 1EBOA 2X7RB 4JF3A 1YTFD 1V55C 1S72V 3GWOA 1ROPA 4JYCA 2EIKB 1ZWIC 4G28B 5CA3A 2WLJA 1VQNV 3K79A 2EZOA 1K73W 3ZN1A 3ASOC 3MD0A 3STLC 1P4RA 2EBOA 3LDCA 5LHHA 3HB3B 3SYCA 2B1IA 1VQKV 2OCCB 2QKSA 4UVCA 4Z1MG 1QLEB 3CCVV 1JOYA 3ABTA 3B8NA 1E1QG 1Q81W 5CN0A 5GW7A 5L3EA 1S0VA 2XAQA 1MABG 3CCRV 3FB7C 2JK5C 1K4CC 5EK0A 3FB6C 1GTOA 1M56B 4YXWG 2LFRA 3ZCCA 4DO2A 3ABKB 2K1EA 1H8EG 2R9IA 1J95A 4RO2A 4WFGA 4WFEA 5B1AB 3TETA 1SETA 1YJWV 3LSSA 1AR1B 2QE7G 2IJKA 5L3CA 3SYQA 3K9AA 3FYEB 3ZRSA 4LP8A 1H8HG 2DYRC 3KG2A 4PELA 5L3BA 2PI5A 3FYIB 1YJ9V 1QR8A 4GX2A 3CMAV 3W7TA 5H9CA 2WSSG 3SPJA 1DF4A 2NNUA 4P9OA 3X2QB 4I9WA 2GHYA 3B77A 1QVGU 3R65A 1GM9A 2Q68A 1VQ5V 2WLMA 3OUFA 2Z3YA 4WFFA 2ZXWC 3RVYA 3CCEV 4JYBA 3QO5A 5E1AC 1OCOC 4PA4A 2OTJV 3K0GA 3G6EV 4GX1A 3AG1B 4LBEC 2WAMA 4MVOA 1VQOV 2B1GA 5IY5B 3OE7G 1TUEB 3E8HA 4BW5A 2WWWA 1BHBA 2HJFC 1QR9A 2W6IG 3ZMVA 1F4MA 3AG4C 5H6RA 3OFNG 1KD1W 1DTOA 2IJHA 2EINB 5DN6G 2XNDG 1K7DA 5BZBA 1H38A 4MTFA 1RM1B 4UVBA 1N8RW 3A0RA 1OCZB 1SESA 1OCRC 2XAJA 1PD3A 4KFMA 3AG3B 1ENVA 1EFRG 1Q7YW 1PKXA 3E89A 1HWYA 3CXCU 2ZDIC 3D3IA 3IFXA 2DW4A 1DLBA 4JPRA 1OHHG 1VQ8V 2HVKC 4H33A 3EFFK 4PDMA 3SYOA 5B1NA 3ZRWA 3ZMZA 5IYCO 4BIUA 2QM8A 1KKDA 3LNMB 2Q67A 5EC2C 1RPOA 3ETEA 2QA4V 2OTLV 5FL7G 3CPWU 5CMUA 3OMAB 2KB1A 3ML0A 1DF5A 2WLIA 2X6BA 4R50A 3K0DA 3ABLB 1NQTA 2EIMC 3RW0A 2M7WA 4XDLA 3SYAA 2ZDIA 1YSCA 4P30A 2JJ1G 4R6ZA 3OR7C 4JGSA 4CZZA 3K3WA 2W6JG 2DQ0A 5EBMC 5LGUA 4RAIA 1NBMG 3B8MA 2LP7A 4GX0A 3ETGA 1AJQA 4JTAB 5EBWC 4MVQA 4J9ZB 1NH2D 4WFHA 2QTOA 3CC2V 3OM3B 5C93A 1V54C 5KA6A 1OCCB 2BOCC 1IXMA 1WLEA 1B6QA 4XBFA 4KP4A 4BIZA 4WCEV 3LDEA 5KUKA 5LHGA 1QVFU 1YI2V 2IJIA 3OEHG 3CCUV 4MW8A 3ZIAG 4QE7A 2AHYA 4X88A 4MVRA 3F5WC 1FXHA 2P90A 1R3KC 3UM7A 2QEXV 3LDDA 1SERA 2EILC 2Y48A 4DXWA 5CBHA 5B3SB 1OZ0A 2ATKC 2UXXA 3QNEA 5HFLA 3TK1A 1AROP 3CCLV 2H94A 3JD2A 3ZMUA 2YEVA 2A79B 4UXNA 2JJ2G 4PA6A 4EKWA 4LC1A 1BMFG 1AI5A 3CP1A 5KUMA 1F4NA 1RPRA 3OMNB 2EZPA 4GCZA 3SPIA 2EIJB 1AI4A 3UKMA 3WG7C 1QCEA 1K97A 1NR7A 2JDIG 1K3EA 1S76D 2V7QG 1WPXA 4G2KA 4MVMA 1GM8A 1G4YB 4JAUA 4RUEA 3F7YC 3OMIB 3STZC 5B1OA 2EIKC 3OW2U 4MVZA 2DQ3A 3MHSC 4TT3G 4UVAA 3ZRVA 3JD3A 1MSWD 1E79G 1E1RG 1K34A 1VQLV 3QO8A 2HVJC 1YIJV 5H6QA 1GMGA 1KQSU 2V1DA 3AG2B 2IU3A 3CCMV 1GK9A 4WF9V 2MK3A 1PNLA 1QLEC 4F4LA 5B1BB 1COWG 1JX9A 2UXNA 2WLHA 1S5HC 1FS0G 1XL4A 2DYSC 4P9PA 1FXKA 4FIPC 3MHHC 3GB7C 4MTXA 1M9NA 1M56C 4KUMA 2HFEC 1Q82W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLL B;  2WLI A;  3ASO C;  5B1A C;  3RBZ A;  3STL C;  3OGC C;  2X6B A;  2A9H A;  3LDC A;  4R50 A;  3K0D A;  3E86 A;  4G27 B;  3SYC A;  2EIM C;  4TWK A;  1R3J C;  2QKS A;  4QE9 A;  3RW0 A;  4XDL A;  3SYA A;  3K04 A;  1R3L C;  2H8P C;  4P30 A;  1OCC C;  4R6Z A;  2WLN A;  3OR7 C;  3T4Z A;  1JVM A;  2NLJ C;  2OCC C;  4MW3 A;  3VOU A;  2ITC C;  4PA7 A;  5EBM C;  3FB7 C;  3SPC A;  4RAI A;  2JK5 C;  1K4C C;  3OR6 C;  5EK0 A;  3FB6 C;  4GX0 A;  4JTD B;  2K1E A;  4JTA B;  4WFG A;  1J95 A;  3ABM C;  4RO2 A;  5EBW C;  3TET A;  4MVQ A;  4J9Z B;  2X6A A;  3IGA C;  3JYC A;  4WFH A;  2QTO A;  3SYQ A;  3FB8 C;  3K06 A;  1R3I C;  5CBF A;  3ABK C;  3ZRS A;  4LP8 A;  3KG2 A;  2DYR C;  3OUS A;  2P7T C;  1V54 C;  2Q69 A;  4R8C A;  2R9R B;  3ZJZ A;  2BOC C;  4MVS A;  3T4D A;  2BOB C;  4GX2 A;  5B3S C;  4RUF A;  4XDK A;  3AG1 C;  3K03 A;  3LDE A;  5KUK A;  5IY5 C;  1P7B A;  3E83 A;  3SPJ A;  4MVU A;  3E8G A;  4P9O A;  3E8B A;  3E8F A;  4MSW C;  4I9W A;  1M57 C;  2X6C A;  3R65 A;  4PDV A;  4MW8 A;  4ZBM A;  2Q68 A;  4QE7 A;  4MTG A;  2WLM A;  2AHY A;  3FB5 C;  2EIJ C;  4X88 A;  3OUF A;  4MVR A;  4PDL A;  3F5W C;  4PA9 A;  3SPH A;  4OXS A;  2ZXW C;  4WFF A;  3RVY A;  1R3K C;  3UM7 A;  3LDD A;  2EIL C;  5EBL C;  5E1A C;  4R7C A;  1OCO C;  2A0L A;  4PA4 A;  4DXW A;  4JTC B;  4CBC A;  1OCZ C;  5CBH A;  3K0G A;  3PJS K;  4GX1 A;  2ATK C;  1ORQ C;  4LBE C;  4MVO A;  3T2M A;  3E8H A;  4BW5 A;  2WLK A;  2IH3 C;  1BL8 A;  4PA3 A;  2HG5 C;  3HPL C;  3SJQ C;  2YEV A;  2A79 B;  3T1C A;  2HJF C;  4XDJ A;  4PA6 A;  4EKW A;  3AG4 C;  5KUM A;  4J9Y B;  3SPI A;  3AG2 C;  4X89 A;  4UUJ C;  3UKM A;  3WG7 C;  5BZB A;  3ASN C;  5J9P C;  4MTF A;  4GX5 A;  4H37 A;  4MVM A;  4X8A A;  5B1B C;  1G4Y B;  2EIN C;  4RUE A;  1OCR C;  3SYP A;  3F7Y C;  4LCU C;  3STZ C;  3F7V C;  4KFM A;  2EIK C;  5EC1 C;  4MVZ A;  2DWE C;  3E89 A;  1K4D C;  3RVZ A;  2WLL A;  2HVJ C;  2DWD C;  3AG3 C;  3IFX A;  3BEH A;  4MS2 A;  4PDR A;  1XL6 A;  3K08 A;  2HVK C;  2IH1 C;  3ABL C;  2Y69 C;  3EFF K;  3LUT B;  4H33 A;  4PDM A;  3SYO A;  4HYO A;  3TCU A;  4MTO A;  2ZD9 A;  1LNQ A;  1QLE C;  3X2Q C;  2ITD C;  4F4L A;  2AHZ A;  2Q6A A;  1V55 C;  3LNM B;  2WLH A;  2Q67 A;  3SPG A;  4QNH B;  5CBG A;  1KKD A;  1S5H C;  2W0F C;  4HZ3 A;  1XL4 A;  2DYS C;  1ZWI C;  2WLI B;  4P9P A;  4G28 B;  5EC2 C;  2WLJ A;  3GB7 C;  1M56 C;  2KB1 A;  4WFE A;  2HFE C;  4P2Z A; 
#chains in the Genus database with same CATH topology
 3OGC C;  2RDC A;  5JVD B;  2CK3 G;  2N74 A;  1YJN V;  1S3J A;  5KX5 A;  2QR4 A;  3W7W A;  4MW3 A;  3WFV A;  4FFB B;  4GKJ B;  4YY3 O;  1AJP A;  1Y74 B;  1H2K A;  4ZKI A;  2C2A A;  3JYC A;  5KLV H;  2IU0 A;  3MAQ A;  2P7T C;  4DV5 O;  1Q6H A;  4LWS A;  4MVS A;  4RUF A;  4XDK A;  5IY5 C;  5C8Y A;  1P7B A;  4ZIB A;  4MVU A;  1F51 A;  4MSW C;  2FML A;  4MT8 A;  3CCJ V;  4ASU G;  1M57 C;  2UU9 O;  1JPX A;  2YI8 A;  4PDL A;  2FL4 A;  4YJ2 A;  1G8M A;  1QNM A;  2PGG A;  1OCZ C;  3PJS K;  2ZIN A;  1OV9 A;  2EX3 A;  5GTI Z;  3T2M A;  2JS5 A;  2F23 A;  2IH3 C;  1NTK H;  5LXT B;  3T1C A;  3RT3 C;  4RQE A;  4I4T B;  5JJN B;  1GM7 A;  1EM1 A;  3FFQ A;  4PV1 B;  1XOU A;  4X1I A;  5DEC A;  2FYU H;  4I9Q A;  1K9M W;  1VQM V;  3AEI A;  4DV6 O;  4FFK A;  3JD4 A;  5IYD O;  5LGN A;  1NZ6 A;  3ZRW B;  3W7U A;  2DWD C;  3BEH A;  1XL6 A;  4QPJ A;  1ZTE A;  3ABL C;  1HNZ O;  1K33 A;  1LUW A;  1LNQ A;  2YC0 A;  5BMV B;  2AHZ A;  2CH7 A;  2Q6A A;  2W0F C;  2WLI B;  3K57 A;  1V9P A;  2K9P A;  2RNB A;  1FFX A;  3GVM A;  3T1H O;  4P2Z A;  4FLZ A;  2JIZ G;  2A9H A;  5D5P A;  1N0N A;  2CTQ A;  2YI9 A;  3K04 A;  3IC7 A;  1MZF A;  4FJC C;  2NLJ C;  2OCC C;  3D36 C;  4DV4 B;  2UUC O;  3ABM B;  4JI2 O;  4DR6 B;  4TOI A;  4BW9 A;  2GTA A;  1Q86 W;  4U3J B;  2X6A A;  3CRC A;  1X59 A;  2QWR B;  1EN4 A;  1K5S A;  1KC8 W;  2E3C A;  4R8C A;  3L70 H;  1SA0 B;  3CRA A;  2BOB C;  2IJJ A;  5JQG B;  5LP6 A;  2PYJ A;  3W7X A;  4AQY B;  4I5S A;  2KSD A;  2JVD A;  4X65 O;  1P84 F;  1J5E B;  4X9Q A;  4N23 A;  1K5Q A;  3H1L H;  2A0L A;  4JTC B;  2YEV B;  3BA9 A;  4DR3 B;  3VQV A;  1JMK C;  2L6L A;  2WLK A;  4PA3 A;  1BL8 A;  3SJQ C;  2HG5 C;  4YHH B;  3AG7 A;  2P6J A;  3RGB A;  5DM6 V;  2UXB O;  2GSM B;  4WBN B;  2DJV A;  3OTO O;  4NXM B;  1H2G A;  4PJ0 Z;  2Q7H A;  2XAS A;  4LF8 B;  3RYF B;  3HKE A;  2AGA A;  1RM1 C;  1I94 O;  2DWE C;  4DR2 O;  1W59 A;  2E5L B;  1PNK A;  1VQ9 V;  3IC9 A;  2H3O A;  3K08 A;  2IH1 C;  3ZJZ A;  2ILM A;  2Y69 C;  5IWA B;  1MG1 A;  3G71 V;  3LSQ A;  1EBO A;  3T1Y O;  2ZE8 A;  1YTF D;  3J7A U;  2LW7 A;  4LR3 A;  1BS3 A;  3N2G A;  2ZNI A;  4O4L A;  3WU2 Z;  1JR9 A;  1KYO F;  1HNX B;  3JAK A;  2NN4 A;  3ZN1 A;  3STL C;  4LF7 B;  3HB3 B;  1DGS A;  3SYC A;  4AI8 A;  3CCV V;  3RYI B;  3ABT A;  3B8N A;  3LSU A;  3JAT A;  2XAQ A;  2YXH A;  1MAB G;  4IHJ B;  3CCR V;  3FB7 C;  1M5I A;  2HEP A;  4WFG A;  2FB5 A;  1SET A;  2R72 A;  3LSS A;  2IJK A;  1EN5 A;  5L3C A;  2AZ2 A;  5J2U B;  3FYE B;  1FKA O;  4PEL A;  2ZM6 O;  4FLV A;  2PI5 A;  3H1J H;  4GX2 A;  2EJ7 A;  2F4V O;  2WSS G;  4OPA A;  4P9O A;  4U3F H;  3X2Q B;  4I9W A;  3B77 A;  3D3Q A;  4DUY B;  3OUF A;  1SC5 B;  4WFF A;  3RVY A;  2RN9 A;  2UUA B;  4GX1 A;  4DR5 B;  3CJH B;  2FKX A;  5IY5 B;  3OE7 G;  1VF6 A;  1WPB A;  5H6R A;  2IJH A;  5DN6 G;  5KHG A;  4MTF A;  4K0K O;  3HKB A;  1OCZ B;  2CUG A;  1TUB B;  1PD3 A;  1TA8 A;  4Z2W A;  1PKX A;  3E89 A;  3JAW B;  3IFX A;  2DW4 A;  1YCI A;  1OHH G;  3O9O A;  4H33 A;  4DR1 B;  1WP8 A;  1XNR O;  1P7G A;  1U97 A;  5K1X A;  3ZMZ A;  1GN4 A;  1KKD A;  3LNM B;  5BR8 O;  5JJJ B;  3DXR B;  5K1P A;  4JZ2 A;  1RSO B;  1DF5 A;  5B5E Z;  1L0L H;  3ABL B;  2EIM C;  4UCS A;  3RW0 A;  4DV2 O;  2ZDI A;  3H1K H;  2VWK A;  3OR7 C;  4JGS A;  2UXC B;  5IT9 N;  1EZV H;  1MNG A;  4IIJ B;  3L74 H;  1XHX A;  4LH7 A;  3ETG A;  5EBW C;  4MVQ A;  4J9Z B;  5IJ9 B;  2QTO A;  5GTH Z;  3CC2 V;  2LO1 A;  3JAM N;  2AZ0 A;  4WCE V;  2JGU A;  5AG2 A;  4MW8 A;  3ZIA G;  4GLX A;  2UUB O;  1VEW A;  3OT7 A;  2EIL C;  4TV9 B;  4DV0 B;  1FAF A;  5CA1 B;  5KMG A;  2UXX A;  5HFL A;  1JFF B;  3TK1 A;  1ARO P;  3CCL V;  2Q9L A;  2H94 A;  2QWP B;  3BVO A;  3P3P A;  1BQ0 A;  2HJD A;  4L8J A;  1N34 O;  4EKW A;  4LC1 A;  1BMF G;  3CP1 A;  5KUM A;  4OGQ B;  1VMG A;  2EZP A;  1I08 A;  1QCE A;  2XUM A;  5KHH A;  5FPO A;  1K97 A;  1NR7 A;  2GV9 A;  4NB5 A;  2V7Q G;  3N2K A;  3SGI A;  5ITZ B;  1G4Y B;  4JAU A;  4YY3 B;  3OMI B;  3STZ C;  2EIK C;  3ZX6 A;  1K34 A;  4I50 B;  4I55 B;  4F6R A;  4DV5 B;  2CGN A;  3CCM V;  2YIC A;  3FAV B;  4BWA A;  4B3T O;  4F4L A;  4X1K A;  2UU9 B;  1T5E A;  4JI6 O;  2DOS A;  1FXK A;  4FIP C;  4MTX A;  3BA8 A;  5B1A C;  3VBB A;  1XBL A;  3DSQ A;  1R73 A;  2QM7 A;  2Y69 B;  3VQX A;  3CCS V;  2WLN A;  1JVM A;  1NI8 A;  3OR6 C;  4LFA O;  4FVM A;  1ZL8 A;  3A8T A;  4O4J B;  3ABM C;  3CRR A;  1G6U A;  1NKD A;  4FLW A;  3K06 A;  3RFR A;  3TGU H;  4DV6 B;  1XDC A;  4ZI7 A;  1WN7 A;  4J7J A;  3RYC B;  3DTU B;  3UCS C;  5L3G A;  3E83 A;  2F95 B;  3E8G A;  4FLT A;  1AP5 A;  1HNZ B;  1JJ2 U;  4ZBM A;  2JS3 A;  1YTF B;  3BY6 A;  4TSF G;  2XAF A;  1NR1 A;  1NJI W;  2M6Y A;  2CE4 A;  1VF7 A;  4ZHQ A;  3T1H B;  1NH2 B;  4KXR A;  4JAS A;  4X20 B;  5LA6 A;  3JD1 A;  1EN6 A;  4LF4 O;  4F6E A;  1Y66 A;  2P22 C;  2WPD G;  4DW1 A;  1O9H A;  2UUC B;  3GWK C;  3TXS A;  4JI2 B;  2KG7 A;  2YSU B;  2ODM A;  2Q7E A;  4LCU C;  2V4D A;  4GKK O;  3VQW A;  1VAR A;  1H2N A;  3P30 A;  4WFA V;  3E22 A;  2QGN A;  3CX5 F;  1UJW B;  1GKF A;  4LNU B;  1IBL O;  2E74 B;  4MTO A;  2ZD9 A;  2ITD C;  2JGD B;  4QNH B;  1TGO A;  2LGQ A;  4HZ3 A;  4UV8 A;  3K5O A;  2WA3 A;  2OCH A;  4X65 B;  1JCH A;  1AR4 A;  4FMT A;  2IW5 A;  2WLL B;  3RBZ A;  2F66 C;  4NTX A;  5FNV B;  3DC5 A;  1Q43 A;  1WAZ A;  3JSL A;  1XMO O;  1YXB A;  3SJB C;  3ZN0 A;  4QIW F;  1B3Q A;  3CC4 V;  3F5T A;  3WB2 A;  2FTK A;  4J10 A;  2UXB B;  4FK5 C;  4B7E A;  3OTO B;  3HR0 A;  1BE3 H;  3CYO A;  1WB8 A;  5FPR A;  1R6N A;  2ADQ B;  4PD4 F;  4ZOL A;  4L87 A;  4TV8 A;  3NR7 A;  4CH6 A;  2EIM B;  1Z5V A;  4J42 A;  5D5Q A;  1I94 B;  4DR2 B;  3C3T A;  1YHQ V;  5B3S C;  1XMQ O;  1KBH A;  2ZCE A;  2PY5 A;  2HR3 A;  3OEE G;  4I4T A;  4PDV A;  4OX9 O;  1KB9 F;  3T1Y B;  3JD0 A;  3FB5 C;  5IYZ A;  3X2Q C;  2OT5 A;  1ZLZ A;  3SPH A;  3W7S A;  1GH6 A;  2HLD G;  2Y4T A;  2F43 G;  5L3F A;  4B3M O;  1ORQ C;  3U11 A;  2RJZ A;  1JQ0 A;  1YEW A;  4QGP A;  5LBQ A;  3ASN B;  1THZ A;  4CC6 A;  3AG2 C;  1ZAU A;  3L71 H;  2EIL B;  2X0L A;  1SZT A;  5B1B C;  3D8C A;  1PP9 H;  2BSK A;  2DMX A;  3H01 A;  4J41 A;  4DV3 O;  2CGO A;  3FX7 A;  1VQP V;  3RVZ A;  3OAA G;  2ZM6 B;  1K92 A;  2QJ1 A;  2F4V B;  4WFB V;  3K5M A;  4CC5 A;  2D3O W;  2F93 B;  3G6B A;  1FJG O;  1ROP A;  2EIK B;  4G28 B;  2QKC A;  2WLJ A;  3RYH A;  1K73 W;  3IJ4 A;  2QM4 A;  4U3J A;  3CS5 A;  5LHH A;  1IVS A;  1VQK V;  3H9V A;  3L73 H;  4UVC A;  1XQ8 A;  5JH7 B;  4Z1M G;  1SA0 A;  5GW7 A;  1S0V A;  5JQG A;  3ZHU A;  1S5L Z;  2VQE O;  2JK5 C;  3FB6 C;  2LFR A;  3ABK B;  4TQD A;  2R9I A;  5B1A B;  3UO2 A;  4RO2 A;  4EEQ A;  3TET A;  4K0K B;  1Q6I A;  1AR1 B;  1QU7 A;  4LWS B;  3SYQ A;  1N33 O;  4IYH A;  3ZRS A;  4LP8 A;  3KG2 A;  2CTR A;  1SQF A;  3KCX A;  1VF6 C;  3FYI B;  3CHX A;  3CMA V;  4LF6 O;  3W7T A;  1XRE A;  4NXN O;  1DF4 A;  1IX9 A;  1XNR B;  2Q68 A;  4WBN A;  5BR8 B;  3CXH F;  5E1A C;  1OCO C;  1IUR A;  4UCT A;  3RYF A;  4YIO A;  3G6E V;  1VQO V;  2B1G A;  3E8H A;  1NTM H;  4BW5 A;  4E4E A;  1BHB A;  4JI0 O;  2BTO A;  2HJF C;  2W6I G;  4DV2 B;  4EB6 A;  1F4M A;  5J2T B;  3AG4 C;  1Q8I A;  4X1I B;  1DTO A;  4NVP A;  2XND G;  2BE3 A;  2D2C B;  4JI1 O;  1K7D A;  5BZB A;  1N8R W;  1FD9 A;  3A0R A;  1SES A;  2YIA A;  1H2M A;  4C7U A;  2XAJ A;  3AG3 B;  2LJ2 A;  4D7T A;  4O4H A;  4OPH A;  1VP7 A;  5IJ0 A;  2ZDI C;  3D3I A;  3G80 A;  3N27 A;  1D2D A;  3SYO A;  2XTA A;  5B1N A;  4B3R O;  3OGI B;  2IM9 A;  3RYI A;  5IYC O;  2VWJ A;  4W4L A;  1FFX B;  5EC2 C;  2OTL V;  3ETE A;  2E76 B;  2YIB D;  2QA4 V;  5FL7 G;  3OD4 A;  4IL6 Z;  2Q4P A;  2L35 A;  3CPW U;  5CMU A;  3UT5 B;  2UUB B;  3OMA B;  2KB1 A;  1UPG A;  3JAL B;  1CXZ B;  3ML0 A;  1L0N H;  2X6B A;  1NT2 B;  4R50 A;  5LOV B;  3EVK A;  5J2U A;  4XDL A;  3TJT A;  4P30 A;  5IE9 A;  2W6J G;  3SJA C;  2DQ0 A;  5EBM C;  5LGU A;  1NBM G;  3B8M A;  4HBN A;  4GX0 A;  1AJQ A;  1AR5 A;  1NH2 D;  3G67 A;  2LQT A;  5C93 A;  1V54 C;  3AK2 A;  1I7F A;  2BOC C;  1WLE A;  4XBF A;  3CJH A;  3LDE A;  4B3T B;  2ZE6 A;  1I0H A;  3L75 H;  1FXH A;  1R3K C;  4JI6 B;  4KL1 A;  3LDD A;  3UM7 A;  4KHP O;  5CBH A;  4NTW A;  2R9A A;  5B3S B;  5BY1 A;  3ETQ A;  2P06 A;  3QNE A;  1TUB A;  2GBO A;  2Y4U A;  3ZMU A;  2JJ2 G;  1N0J A;  4PA6 A;  1F4N A;  3WB1 A;  3OMN B;  1SQV H;  3QVN A;  4NTY A;  2VQF O;  3HKE B;  3JAS A;  4LFA B;  4G2K A;  1GM8 A;  4RUE A;  3P3N A;  3F7Y C;  2DQ3 A;  4TT3 G;  3JD3 A;  3DXR A;  2ZIO A;  1MSW D;  1E1R G;  4YJ3 A;  3QO8 A;  4DK1 A;  2B9Z A;  5H6Q A;  1KQS U;  3AG2 B;  4TUY B;  4DK0 A;  5JCO A;  1GK9 A;  1MSD A;  1PNL A;  2GDS A;  1QLE C;  5B1B B;  4O4L B;  2WLH A;  3JAK B;  1S5H C;  4IIJ A;  1FS0 G;  1R1B A;  4O2B A;  1WA8 B;  4WFE A;  2DE0 X;  5HFM A;  5KAI Z;  4J11 A;  2OWO A;  5IJ9 A;  3JCU Z;  4BAY A;  1R3J C;  4DYL A;  1BZK A;  1H2L A;  2H8P C;  1XUQ A;  4LF4 B;  3D36 A;  1MMM A;  3K5N A;  1Y4M A;  2ITC C;  3SDL A;  1XI1 A;  3TXQ A;  1DK1 A;  1AB3 A;  4JTD B;  1MA1 A;  5LYJ A;  3ZBH A;  3H1H H;  5CBF A;  2Q8V A;  4BR6 A;  2Q0A A;  3OUS A;  4GKK B;  2G38 A;  4DV7 O;  4JI7 O;  1PL0 A;  1F23 A;  1PNM A;  4B7K A;  4TV9 A;  1AIL A;  5CA1 A;  3AG1 C;  1JJO A;  5KA5 A;  1JFF A;  1TVK B;  3E8F A;  3E8B A;  1H2S B;  1IBL B;  1IBM O;  1NS1 A;  3C90 A;  5LL6 Y;  2QWO B;  1N4C A;  2QSA A;  5B66 Z;  4R7C A;  1S77 D;  4JI8 O;  2QWN B;  1PPJ H;  4U7O A;  4DV1 O;  4O2A A;  1R6T A;  3Q4H A;  3HPL C;  1M93 A;  1XMO B;  4XDJ A;  1QQC A;  4I50 A;  2BCC H;  3WG7 B;  3ZHV A;  4HNA B;  1D5A A;  3HKB B;  4X89 A;  4UUJ C;  3ASN C;  3FAV A;  1OCO B;  1W2B U;  1OJH A;  4X8A A;  1Y6X A;  3CE2 A;  3O65 A;  1SRY A;  5EZY A;  4ICG A;  2XOK G;  2PYL A;  2RCV A;  3AG4 B;  1GN3 A;  1QBZ A;  4PDR A;  4MS2 A;  1QHT A;  1W0J G;  1Z2G A;  1XMQ B;  4HYO A;  3B40 A;  2DYS B;  4Z1V A;  1LUV A;  4OX9 B;  1MOF A;  4D6T H;  2Q5Z A;  4UV9 A;  3M99 B;  1VQ7 V;  1GN2 A;  4O4J A;  4FZ0 A;  2ADP A;  3K9S A;  4G27 B;  4B3M B;  4LFB O;  4TWK A;  4JI4 O;  4QE9 A;  3HKD A;  4O4I A;  5CA0 A;  1SQP H;  3E35 A;  3VOU A;  3CWB H;  1R6K A;  4IYI A;  4CS2 A;  1CP9 A;  3ZMS A;  1WB7 A;  2YDE A;  3U10 A;  4B3S O;  4DUZ O;  4CH3 A;  3FB8 C;  5EYP B;  1AI7 A;  3ABK C;  1AI6 A;  3CRM A;  4DV3 B;  4FM1 A;  3ETD A;  2Y0I A;  2ZQM A;  4UCR A;  1GO3 F;  3THO A;  4X20 A;  3E2E A;  5EIB D;  5JJE B;  3BAB A;  2GUZ A;  2X6C A;  3JCZ A;  2ZIM A;  1M1K W;  2EIJ C;  1FJG B;  1I5Y A;  2CTW A;  1BHA A;  4OXS A;  4GT1 A;  1L1F A;  3CSX A;  1V54 B;  5LMN O;  3APO A;  5IDJ A;  1BSM A;  4RQF A;  1GAX A;  3JAR A;  4X1Y A;  3DC6 A;  1Y76 B;  5GON B;  2PI4 A;  2WA4 A;  4J9Y B;  3QG5 A;  2BTQ A;  1FYJ A;  3N2K B;  3UQ8 A;  2R70 A;  3CC7 V;  2VQE B;  2XAG A;  1NVP B;  4EFB A;  2VS0 A;  2P67 A;  1RFY A;  5EIB C;  3SYP A;  4AHC A;  1XHZ A;  4F6R B;  1N36 O;  5LHI A;  1N33 B;  1K4D C;  2WLL A;  3AG3 C;  4JI5 O;  1G1X B;  4D7S A;  5FNV A;  4X1K B;  3EHB B;  4LF6 B;  2OIG A;  1FXV A;  3RWR D;  3J80 N;  1FXK B;  4NXN B;  5KAF Z;  4QJF B;  2X7R B;  1V55 C;  4DRX B;  1S72 V;  1ZSP A;  3GWO A;  4J7Z A;  5A9G A;  2ZE7 A;  1VQN V;  3K79 A;  3LNN A;  3ASO C;  3MD0 A;  1BGY H;  1LR1 A;  4FM0 A;  3A0H Z;  2QKS A;  2EUL A;  2YXL A;  1QLE B;  4JI0 B;  1E1Q G;  5JVD A;  1Q81 W;  5CN0 A;  5L3E A;  1GN6 A;  4LF5 O;  5EK0 A;  4JI1 B;  4YXW G;  1IXB A;  4DO2 A;  5KHJ A;  4JV5 O;  3K9A A;  4FFB A;  4NKG B;  1SQQ H;  1Y74 A;  1H8H G;  2DYR C;  5H2F Z;  2XT9 A;  4I7Z B;  1QR8 A;  1RP3 B;  2Z0A A;  1WJZ A;  5LP6 C;  5H9C A;  3SPJ A;  2GHY A;  4B3R B;  3R65 A;  4DR7 O;  1GM9 A;  1VQ5 V;  2WLM A;  4ZHQ B;  1ZX3 A;  2ZXW C;  3CCE V;  4K8X A;  3ZHS A;  4JYB A;  1O9G A;  2HHH O;  1A32 A;  2OTJ V;  3K0G A;  3AG1 B;  2MW2 B;  2UXD O;  1KMI Z;  1TUE B;  1XNQ O;  1QR9 A;  3ZMV A;  3FD9 A;  4LFC O;  2Q7G A;  5LXT A;  2EIN B;  2E75 B;  4PI2 A;  2A06 H;  1OCR C;  3E22 B;  4KFM A;  1ENV A;  4UFZ A;  5CB4 B;  4LH6 A;  1EFR G;  1Q7Y W;  1KUQ A;  4J7K A;  3CXC U;  2AW9 A;  2KQX A;  1FPO A;  3CB2 A;  1IDS A;  4JPR A;  1VQ8 V;  2HVK C;  3KZI Z;  3ZRW A;  5JH7 A;  4IGG A;  5BXZ A;  4I0X B;  1RPO A;  5BMV A;  1Q3E A;  4W4K A;  4KHP B;  3IAY A;  2WLI A;  5DED A;  4LF9 O;  1SQG A;  3EXA A;  3I5D A;  1WP7 A;  2M7W A;  3HKC B;  3L9D A;  4R6Z A;  4CZZ A;  4ZOL B;  3H1I H;  4TV8 B;  4RAI A;  2VQF B;  2LP7 A;  4NR1 A;  4JTA B;  4H13 B;  4FZ1 A;  3ZHR A;  4WFH A;  4DR4 O;  5KA6 A;  5KX5 B;  4UCU A;  1B6Q A;  2XHB A;  4KP4 A;  4BIZ A;  4DW0 A;  4JYA O;  1QVF U;  1YF2 A;  3U0Z A;  1YI2 V;  4CS4 A;  2IJI A;  5IYZ B;  3CCU V;  5J2T A;  1URF A;  5H5N A;  2AHY A;  3B4S A;  4MVR A;  1IBK O;  2RQ6 A;  1HNW O;  2Y48 A;  2P5O A;  2N04 A;  3PN1 A;  3C3S A;  4FM2 A;  1KU9 A;  5C8Y B;  1Q5O A;  1XEQ A;  2YEV A;  2A79 B;  4UXN A;  5JCO C;  1AI5 A;  2QWQ B;  1SQB H;  1RPR A;  2LGW A;  2P4K A;  4GCZ A;  4H0L B;  2EIJ B;  1WNS A;  3UKM A;  3WG7 C;  2BSK B;  4YJ2 B;  1SS3 A;  4X64 O;  1K3E A;  1S76 D;  2RMK B;  4MVZ A;  3ZRV A;  3UT5 A;  1E79 G;  4DV7 B;  3APQ A;  3JAL A;  4JI7 B;  1GMG A;  4X62 O;  2V1D A;  3R66 A;  5LOV A;  2MK3 A;  4YIP A;  3L72 H;  3ZHT A;  3BCC H;  1HP8 A;  3RYH B;  3SJC C;  4P9P A;  1XL4 A;  2DYS C;  1IBM B;  1GRJ A;  2N05 A;  4GYC B;  3GB7 C;  3JSN A;  4X66 O;  1M56 C;  2Y0P A;  2HFE C;  4JI8 B;  1HR0 O;  3E86 A;  4DV1 B;  1W0K G;  1R3L C;  3BAA A;  3UO3 A;  2CH7 B;  1YIT V;  3T4Z A;  1V55 B;  2EJR A;  2ZR2 A;  5F2V O;  3BRC A;  4PA7 A;  1FFT B;  2PTM A;  3ASO B;  5JWP A;  4IHJ A;  4ABM A;  2AXT Z;  3IGA C;  3B2E E;  1R3I C;  4JI3 O;  1N32 O;  2R9R B;  5LMU O;  2QKA A;  1N34 B;  1JA8 A;  2W0X A;  1NVP D;  1AJN A;  5A2Q N;  4MTG A;  4PA9 A;  2DYR B;  5EBL C;  3KKY A;  3J81 N;  4CBC A;  3CD6 V;  5LP6 B;  4EB6 B;  4FPP A;  3CME V;  3QTC A;  2XAH A;  4LFB B;  4JI4 B;  1PM9 A;  1M90 W;  1K8A W;  1KEC A;  3DGE A;  4TUY A;  2NR5 A;  3G4S V;  2ZXW B;  3CCQ V;  1VQ4 V;  3ABU A;  4GUN A;  4GKJ O;  5J9P C;  2QTS A;  4GX5 A;  1QLN A;  4H37 A;  4O4H B;  1XIL A;  5IJ0 B;  3MDS A;  5EC1 C;  4B3S B;  4DUZ B;  2CTP A;  2JEX A;  3CEI A;  3K59 A;  2PF4 E;  1WA8 A;  3ZHQ A;  2P4V A;  2CDY A;  4A5U B;  2PUS A;  3FKS G;  4TQF A;  3JAW A;  1SZX A;  2HKO A;  3SPG A;  1OCR B;  5CBG A;  5IYB O;  4JAV A;  4Q6G A;  1SQX H;  1FXK C;  3K03 A;  5LMN B;  2ZT9 B;  5LGT A;  1KP3 A;  1RSO A;  1KP2 A;  2B5U A;  1NU1 H;  1OCC C;  3S3W A;  3S3X A;  2LFS A;  5L3D A;  3N2G B;  3SPC A;  2JEU A;  1TVK A;  1CEZ A;  1I5X A;  5KHI A;  4H44 B;  1N36 B;  5E79 Z;  2Q69 A;  4N21 A;  2Z5U A;  4Q20 A;  3T4D A;  2VRZ A;  3JAT B;  1M57 B;  3K58 A;  4JI5 B;  3P32 A;  1EZJ A;  3QO7 A;  4HNA A;  2ZR3 A;  4K3A A;  4U7N A;  4HAM A;  3NXS A;  2ARH A;  1KKC A;  3ZMT A;  2Q0O C;  3I55 V;  1VQ6 V;  1PL4 A;  4IT5 A;  3I56 V;  4DV4 O;  3JAS B;  1CPY A;  2GTS A;  4B08 A;  4DR6 O;  3A0B Z;  4LF5 B;  4E2L A;  3ZRX A;  2EIN C;  2YXY A;  1HDJ A;  4K35 A;  2DN9 A;  4YJ3 B;  3F7V C;  4FLU A;  1TAE A;  4JV5 B;  1Z5W A;  1BT8 A;  5ITZ A;  4J80 A;  4QPK A;  4AQY O;  3RN4 A;  2QDO A;  3LUT B;  3TCU A;  4I55 A;  1YDX A;  4O2B B;  4JF3 A;  4RWU A;  5KHK A;  1J5E O;  4JYC A;  4DR7 B;  1ZWI C;  5CA3 A;  2EZO A;  1BCC H;  4FLY A;  1HW7 A;  4DR3 O;  3OTF A;  2HHH B;  4BIO A;  4UB8 Z;  1P4R A;  2EBO A;  3LDC A;  4CH5 A;  4YHH O;  2B1I A;  2OCC B;  4GZR B;  5EYP A;  2UXD B;  4JAA A;  1XNQ B;  1JOY A;  1YVW A;  1U96 A;  1L8D A;  4NXM O;  4LFC B;  1AP6 A;  5LYJ B;  4LF8 O;  1K4C C;  1GTO A;  1M56 B;  3ZCC A;  2K1E A;  1H8E G;  1YJW V;  1J95 A;  3SR2 C;  2ETN A;  2QE7 G;  3ZS8 C;  2HP8 A;  1P49 A;  2E5L O;  1PV0 A;  5L3B A;  2YIB A;  1YJ9 V;  2Q73 A;  3BPZ A;  1YZB A;  3K5L A;  2YUA A;  5IWA O;  4K8Z A;  2NNU A;  4AIL C;  1Y76 A;  3RYC A;  5GON A;  1QVG U;  3CRQ A;  3WB0 A;  2Z3Y A;  1HNX O;  4O2A B;  3M8A A;  3QO5 A;  3KCY A;  3Q4H B;  4LF7 O;  4PA4 A;  1SKV A;  1AVM A;  3AK3 A;  1B04 A;  4LBE C;  2WAM A;  4MVO A;  2WWW A;  4LF9 B;  1US6 A;  2CAZ C;  3OFN G;  1KD1 W;  4EFE A;  1H38 A;  5EZY B;  3VQY A;  1RM1 B;  4UVB A;  1ZUQ A;  3B09 A;  3ICX A;  5KMG B;  4DRX A;  4PI0 A;  2LW1 A;  4UCV A;  3M7M X;  4JZG A;  1HWY A;  1X4T A;  4DR4 B;  1DLB A;  4JYA B;  3EFF K;  2JRI A;  4PDM A;  2ZE5 A;  4DUY O;  4BIU A;  2QM8 A;  4LNU A;  2Q67 A;  1B06 A;  1VIB A;  1IZ3 A;  4CH4 A;  1BQZ A;  1IBK B;  3A2F A;  2JGD A;  2UUA O;  1HNW B;  4DR5 O;  3HKD B;  4O4I B;  5CA0 B;  4FLX A;  3K0D A;  2IBZ H;  1NQT A;  4NYK A;  2KKW A;  2A7W A;  3SYA A;  1YSC A;  2F1M A;  4UB6 Z;  2JJ1 G;  3BHP A;  1SF9 A;  3K3W A;  5TIS Z;  1S5J A;  2A3Q A;  4X64 B;  1D5N A;  2ZNJ A;  4UCO A;  3OM3 B;  1OCC B;  1IXM A;  2GUZ B;  4DR1 O;  5KUK A;  5LHG A;  4X62 B;  2O57 A;  3ZED A;  3OEH G;  1ZL8 B;  2PZS A;  4QE7 A;  4X88 A;  3F5W C;  2P90 A;  2QEX V;  1SER A;  4DXW A;  1UFI A;  3JAR B;  4X1Y B;  4ZI7 B;  4X66 B;  1M4U A;  1OZ0 A;  2ATK C;  1HR0 B;  5CB4 A;  2BTQ B;  3JD2 A;  4PHZ A;  2UXC O;  5FLX N;  3SPI A;  2OIE A;  1AI4 A;  4CS3 A;  1VF5 B;  2YID A;  2JDI G;  1WPX A;  3QF7 A;  4MVM A;  2YS8 A;  1MZE A;  1F7Y A;  4JYY A;  4I0X A;  5B1O A;  3OW2 U;  5LA6 B;  3MHS C;  4UVA A;  3AK1 A;  1VQL V;  2OYQ A;  4JI3 B;  1N32 B;  2HVJ C;  1Q6U A;  1YIJ V;  5LMU B;  2IU3 A;  4WF9 V;  3HKC A;  2KG7 B;  1Y67 A;  1NTZ H;  1Q90 D;  1COW G;  1JX9 A;  2UXN A;  3BFR A;  2ZKO A;  3MHH C;  1M9N A;  4DV0 O;  4KUM A;  1Q82 W; 
#chains in the Genus database with same CATH homology
 5B1A C;  5HFM A;  3VBB A;  3OGC C;  3E86 A;  1R73 A;  2CK3 G;  2QM7 A;  2Y69 B;  1R3J C;  4BAY A;  1YJN V;  3CCS V;  1W0K G;  1R3L C;  1S3J A;  2H8P C;  1YIT V;  3T4Z A;  1V55 B;  2WLN A;  3W7W A;  1JVM A;  2EJR A;  2ZR2 A;  3D36 A;  4MW3 A;  3WFV A;  1Y4M A;  2ITC C;  4PA7 A;  3OR6 C;  1FFT B;  4JTD B;  1AJP A;  3ASO B;  3ABM C;  3IGA C;  1NKD A;  4ZKI A;  2C2A A;  3JYC A;  2IU0 A;  3K06 A;  1R3I C;  5CBF A;  3OUS A;  2P7T C;  1PL0 A;  1F23 A;  1PNM A;  2R9R B;  4MVS A;  4RUF A;  4XDK A;  3AG1 C;  3DTU B;  5KA5 A;  5IY5 C;  1P7B A;  5L3G A;  3E83 A;  4MVU A;  3E8G A;  1F51 A;  3E8B A;  3E8F A;  4MSW C;  4MT8 A;  3CCJ V;  4ASU G;  1NVP D;  1M57 C;  1AJN A;  1JJ2 U;  4ZBM A;  4MTG A;  1JPX A;  4PDL A;  4PA9 A;  1YTF B;  2DYR B;  3BY6 A;  5EBL C;  1G8M A;  4TSF G;  4R7C A;  1S77 D;  2XAF A;  1NR1 A;  4CBC A;  1NJI W;  1OCZ C;  3CD6 V;  3PJS K;  4U7O A;  1NH2 B;  4FPP A;  4JAS A;  3CME V;  3T2M A;  3JD1 A;  2IH3 C;  2XAH A;  3HPL C;  3T1C A;  4RQE A;  4XDJ A;  3WG7 B;  1M90 W;  1GM7 A;  1K8A W;  1Y66 A;  2WPD G;  4X89 A;  1KEC A;  4UUJ C;  3DGE A;  3G4S V;  2ZXW B;  3CCQ V;  1VQ4 V;  3ABU A;  3ASN C;  5J9P C;  4GX5 A;  1OCO B;  1W2B U;  1QLN A;  4H37 A;  2YSU B;  4X8A A;  4LCU C;  1K9M W;  5EC1 C;  1VQM V;  3AEI A;  1SRY A;  2JEX A;  2XOK G;  3JD4 A;  5IYD O;  5LGN A;  3P30 A;  4WFA V;  3AG4 B;  1QBZ A;  3ZRW B;  4PDR A;  2DWD C;  4MS2 A;  3W7U A;  3BEH A;  1UJW B;  1GKF A;  1XL6 A;  4QPJ A;  3FKS G;  1W0J G;  3ABL C;  1K33 A;  4HYO A;  2DYS B;  4MTO A;  2ZD9 A;  1LNQ A;  2ITD C;  2AHZ A;  2HKO A;  2Q6A A;  1OCR B;  3SPG A;  5CBG A;  4QNH B;  5IYB O;  4JAV A;  1MOF A;  2W0F C;  4HZ3 A;  4UV8 A;  2WLI B;  1FXK C;  1JCH A;  4UV9 A;  3K03 A;  3M99 B;  1VQ7 V;  4FMT A;  2IW5 A;  4P2Z A;  2WLL B;  2JIZ G;  3RBZ A;  2A9H A;  5LGT A;  1KP3 A;  4G27 B;  4TWK A;  4QE9 A;  3ZN0 A;  3K04 A;  1KP2 A;  4QIW F;  2B5U A;  3CC4 V;  1OCC C;  3IC7 A;  4FJC C;  2NLJ C;  2OCC C;  2FTK A;  2LFS A;  3E35 A;  3ABM B;  5L3D A;  3VOU A;  3SPC A;  4FK5 C;  1R6K A;  2JEU A;  1CP9 A;  3CYO A;  1CEZ A;  1I5X A;  1R6N A;  3ZMS A;  1Q86 W;  4L87 A;  2X6A A;  2EIM B;  3FB8 C;  1AI7 A;  1KC8 W;  1K5S A;  3ABK C;  1AI6 A;  2Q69 A;  4N21 A;  4R8C A;  2Z5U A;  4Q20 A;  3T4D A;  2BOB C;  2IJJ A;  3ETD A;  1YHQ V;  5B3S C;  2ZQM A;  1GO3 F;  1M57 B;  3P32 A;  3W7X A;  3E2E A;  4I5S A;  2HR3 A;  3OEE G;  1EZJ A;  3QO7 A;  2X6C A;  4PDV A;  2ZR3 A;  3JCZ A;  4U7N A;  1M1K W;  3JD0 A;  3FB5 C;  2EIJ C;  3X2Q C;  2OT5 A;  1I5Y A;  4HAM A;  3NXS A;  4OXS A;  4GT1 A;  3SPH A;  3W7S A;  1L1F A;  1BHA A;  2HLD G;  1V54 B;  4N23 A;  1K5Q A;  2A0L A;  2F43 G;  4JTC B;  5L3F A;  2YEV B;  1ORQ C;  5IDJ A;  3ZMT A;  4RQF A;  2WLK A;  4PA3 A;  1BL8 A;  3SJQ C;  2HG5 C;  1JQ0 A;  3I55 V;  2P6J A;  1VQ6 V;  5LBQ A;  3I56 V;  3ASN B;  2PI4 A;  5DM6 V;  1THZ A;  1CPY A;  4J9Y B;  2GSM B;  3AG2 C;  1H2G A;  4E2L A;  2XAS A;  2EIL B;  2X0L A;  3CC7 V;  2XAG A;  1NVP B;  1SZT A;  5B1B C;  3ZRX A;  2EIN C;  2P67 A;  3SYP A;  3F7V C;  5LHI A;  1RM1 C;  3H01 A;  2DWE C;  1VQP V;  1K4D C;  3RVZ A;  3OAA G;  1K92 A;  1PNK A;  2WLL A;  3AG3 C;  1VQ9 V;  4QPK A;  3K08 A;  3EHB B;  2IH1 C;  3LUT B;  3ZJZ A;  2Y69 C;  4WFB V;  3TCU A;  1MG1 A;  3G71 V;  2D3O W;  1FXV A;  1FXK B;  3LSQ A;  4QJF B;  1EBO A;  2X7R B;  4JF3 A;  1YTF D;  1V55 C;  1S72 V;  3GWO A;  1ROP A;  4JYC A;  2EIK B;  1ZWI C;  4G28 B;  5CA3 A;  2WLJ A;  1VQN V;  3K79 A;  2EZO A;  1K73 W;  3ZN1 A;  3ASO C;  3MD0 A;  3STL C;  1P4R A;  2EBO A;  3LDC A;  5LHH A;  3HB3 B;  3SYC A;  2B1I A;  1VQK V;  2OCC B;  2QKS A;  4UVC A;  4Z1M G;  1QLE B;  3CCV V;  1JOY A;  3ABT A;  3B8N A;  1E1Q G;  1Q81 W;  5CN0 A;  5GW7 A;  5L3E A;  1S0V A;  2XAQ A;  1MAB G;  3CCR V;  3FB7 C;  2JK5 C;  1K4C C;  5EK0 A;  3FB6 C;  1GTO A;  1M56 B;  4YXW G;  2LFR A;  3ZCC A;  4DO2 A;  3ABK B;  2K1E A;  1H8E G;  2R9I A;  1J95 A;  4RO2 A;  4WFG A;  4WFE A;  5B1A B;  3TET A;  1SET A;  1YJW V;  3LSS A;  1AR1 B;  2QE7 G;  2IJK A;  5L3C A;  3SYQ A;  3K9A A;  3FYE B;  3ZRS A;  4LP8 A;  1H8H G;  2DYR C;  3KG2 A;  4PEL A;  5L3B A;  2PI5 A;  3FYI B;  1YJ9 V;  1QR8 A;  4GX2 A;  3CMA V;  3W7T A;  5H9C A;  2WSS G;  3SPJ A;  1DF4 A;  2NNU A;  4P9O A;  3X2Q B;  4I9W A;  2GHY A;  3B77 A;  1QVG U;  3R65 A;  1GM9 A;  2Q68 A;  1VQ5 V;  2WLM A;  3OUF A;  2Z3Y A;  4WFF A;  2ZXW C;  3RVY A;  3CCE V;  4JYB A;  3QO5 A;  5E1A C;  1OCO C;  4PA4 A;  2OTJ V;  3K0G A;  3G6E V;  4GX1 A;  3AG1 B;  4LBE C;  2WAM A;  4MVO A;  1VQO V;  2B1G A;  5IY5 B;  3OE7 G;  1TUE B;  3E8H A;  4BW5 A;  2WWW A;  1BHB A;  2HJF C;  1QR9 A;  2W6I G;  3ZMV A;  1F4M A;  3AG4 C;  5H6R A;  3OFN G;  1KD1 W;  1DTO A;  2IJH A;  2EIN B;  5DN6 G;  2XND G;  1K7D A;  5BZB A;  1H38 A;  4MTF A;  1RM1 B;  4UVB A;  1N8R W;  3A0R A;  1OCZ B;  1SES A;  1OCR C;  2XAJ A;  1PD3 A;  4KFM A;  3AG3 B;  1ENV A;  1EFR G;  1Q7Y W;  1PKX A;  3E89 A;  1HWY A;  3CXC U;  2ZDI C;  3D3I A;  3IFX A;  2DW4 A;  1DLB A;  4JPR A;  1OHH G;  1VQ8 V;  2HVK C;  4H33 A;  3EFF K;  4PDM A;  3SYO A;  5B1N A;  3ZRW A;  3ZMZ A;  5IYC O;  4BIU A;  2QM8 A;  1KKD A;  3LNM B;  2Q67 A;  5EC2 C;  1RPO A;  3ETE A;  2QA4 V;  2OTL V;  5FL7 G;  3CPW U;  5CMU A;  3OMA B;  2KB1 A;  3ML0 A;  1DF5 A;  2WLI A;  2X6B A;  4R50 A;  3K0D A;  3ABL B;  1NQT A;  2EIM C;  3RW0 A;  2M7W A;  4XDL A;  3SYA A;  2ZDI A;  1YSC A;  4P30 A;  2JJ1 G;  4R6Z A;  3OR7 C;  4JGS A;  4CZZ A;  3K3W A;  2W6J G;  2DQ0 A;  5EBM C;  5LGU A;  4RAI A;  1NBM G;  3B8M A;  2LP7 A;  4GX0 A;  3ETG A;  1AJQ A;  4JTA B;  5EBW C;  4MVQ A;  4J9Z B;  1NH2 D;  4WFH A;  2QTO A;  3CC2 V;  3OM3 B;  5C93 A;  1V54 C;  5KA6 A;  1OCC B;  2BOC C;  1IXM A;  1WLE A;  1B6Q A;  4XBF A;  4KP4 A;  4BIZ A;  4WCE V;  3LDE A;  5KUK A;  5LHG A;  1QVF U;  1YI2 V;  2IJI A;  3OEH G;  3CCU V;  4MW8 A;  3ZIA G;  4QE7 A;  2AHY A;  4X88 A;  4MVR A;  3F5W C;  1FXH A;  2P90 A;  1R3K C;  3UM7 A;  2QEX V;  3LDD A;  1SER A;  2EIL C;  2Y48 A;  4DXW A;  5CBH A;  5B3S B;  1OZ0 A;  2ATK C;  2UXX A;  3QNE A;  5HFL A;  3TK1 A;  1ARO P;  3CCL V;  2H94 A;  3JD2 A;  3ZMU A;  2YEV A;  2A79 B;  4UXN A;  2JJ2 G;  4PA6 A;  4EKW A;  4LC1 A;  1BMF G;  1AI5 A;  3CP1 A;  5KUM A;  1F4N A;  1RPR A;  3OMN B;  2EZP A;  4GCZ A;  3SPI A;  2EIJ B;  1AI4 A;  3UKM A;  3WG7 C;  1QCE A;  1K97 A;  1NR7 A;  2JDI G;  1K3E A;  1S76 D;  2V7Q G;  1WPX A;  4G2K A;  4MVM A;  1GM8 A;  1G4Y B;  4JAU A;  4RUE A;  3F7Y C;  3OMI B;  3STZ C;  5B1O A;  2EIK C;  3OW2 U;  4MVZ A;  2DQ3 A;  3MHS C;  4TT3 G;  4UVA A;  3ZRV A;  3JD3 A;  1MSW D;  1E79 G;  1E1R G;  1K34 A;  1VQL V;  3QO8 A;  2HVJ C;  1YIJ V;  5H6Q A;  1GMG A;  1KQS U;  2V1D A;  3AG2 B;  2IU3 A;  3CCM V;  1GK9 A;  4WF9 V;  2MK3 A;  1PNL A;  1QLE C;  4F4L A;  5B1B B;  1COW G;  1JX9 A;  2UXN A;  2WLH A;  1S5H C;  1FS0 G;  1XL4 A;  2DYS C;  4P9P A;  1FXK A;  4FIP C;  3MHH C;  3GB7 C;  4MTX A;  1M9N A;  1M56 C;  4KUM A;  2HFE C;  1Q82 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...