4PA6A

Structure of navms pore and c-terminal domain crystallised in the presence of channel blocking compound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
molecule keywords Ion transport protein
molecule tags Transport protein
source organism Magnetococcus sp.
total genus 29
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa6A00
4X8AA 5EK0A 4MVSA 1J95A 1R3KC 1OCOC 3STLC 1LNQA 4P2ZA 4XDLA 1M57C 4PDRA 2IH3C 3T4ZA 1R3LC 4MW3A 3STZC 4JTDB 4LP8A 1BL8A 3KG2A 3R65A 3SYQA 4WFEA 2HVKC 2AHYA 3IFXA 4OXSA 4R6ZA 2X6BA 4P9OA 4PA9A 3SYOA 3SPIA 4PA3A 3RVZA 2YEVA 4HYOA 4I9WA 3SYAA 3LDEA 2AHZA 3T4DA 2BOBC 4PDVA 4EKWA 2P7TC 3OGCC 1OCZC 2WLIA 3AG1C 4J9YB 5EBLC 4CBCA 3OR6C 4WFHA 3LDDA 2QKSA 5BZBA 3K0GA 4GX1A 4KFMA 1V54C 5EBMC 3OUSA 2HG5C 1JVMA 4G28B 2KB1A 2DYSC 3IGAC 3AG4C 3SPCA 3E89A 4R8CA 2W0FC 2IH1C 3LNMB 1K4DC 2DYRC 4GX2A 1ORQC 2WLLB 3K0DA 2HJFC 3ABMC 1OCRC 4PA7A 4MVOA 3VOUA 4X88A 3TCUA 2EIMC 4MW8A 2EILC 4P30A 2WLKA 3F7VC 4F4LA 5E1AC 2EIJC 4R7CA 4MTOA 4JTAB 4WFFA 4TWKA 3K06A 2HFEC 5J9PC 4QNHB 4PDLA 4BW5A 4HZ3A 4LBEC 3FB7C 5EC1C 4MVRA 1OCCC 1R3IC 3ZJZA 4MVUA 3TETA 1M56C 1R3JC 4QE7A 4DXWA 3WG7C 4H37A 3F5WC 3GB7C 4MVZA 4RO2A 4RUFA 3ZRSA 4MSWC 3AG2C 3K04A 4JTCB 3LDCA 4PDMA 2K1EA 2R9RB 2JK5C 3OR7C 4MVQA 2X6AA 3SPGA 3FB5C 4PA4A 1XL6A 4WFGA 1V55C 4LCUC 4QE9A 5IY5C 2NLJC 2WLLA 5KUKA 4GX5A 3K03A 5KUMA 3UKMA 2OCCC 3PJSK 3E8BA 2WLNA 2Q69A 2WLMA 4GX0A 2QTOA 2EINC 3T2MA 3ASOC 3FB6C 3SJQC 2ITCC 2Q6AA 5B3SC 4XDJA 1ZWIC 2X6CA 2ZXWC 2A0LA 3EFFK 3HPLC 4MTGA 3RW0A 3E8GA 2ITDC 3SYCA 5CBHA 3E83A 2DWEC 3BEHA 2A9HA 3OUFA 3LUTB 2A79B 4PA6A 5EC2C 3RVYA 4ZBMA 4MTFA 4RUEA 4UUJC 2EIKC 3T1CA 5CBFA 3RBZA 3SPJA 4MS2A 3SYPA 1XL4A 4G27B 4J9ZB 5EBWC 1G4YB 5CBGA 3E8HA 1KKDA 1K4CC 3K08A 5B1AC 2DWDC 2WLHA 4R50A 5B1BC 3SPHA 4XDKA 4MVMA 3UM7A 2ZD9A 2BOCC 3E8FA 3F7YC 1S5HC 3ABKC 2Q67A 2ATKC 2WLIB 3ASNC 3X2QC 3ABLC 1P7BA 1QLEC 2HVJC 3FB8C 3E86A 2H8PC 3JYCA 4H33A 3AG3C 4P9PA 2Q68A 2WLJA 4X89A 2Y69C 4RAIA
chains in the Genus database with same CATH superfamily
3FX7A 1NR7A 3EVKA 1Y76B 4H13B 4LF9O 2ZNIA 4DR4O 3STZC 3QO7A 4JTDB 4WFEA 4FLWA 2QM7A 4JI7O 1P49A 4PA3A 3BABA 2F93B 1XMQO 1M90W 5JCOA 4LF6O 3LDEA 5E79Z 2Q7HA 3SGIA 5EBLC 5IE9A 5KA6A 1JVMA 5CA0A 2X0LA 4F6RA 1EBOA 5JQGA 5EIBC 4U3FH 1KU9A 3K0DA 1Y76A 2UUCB 3CXCU 3J80N 5LGNA 1YSCA 1JFFA 1Q7YW 4IGGA 4LH6A 1NT2B 4AI8A 2XAQA 1AP6A 4TWKA 3AG2B 2HFEC 2JEXA 1EN4A 4TUYA 5LA6B 1DGSA 5L3EA 1KKCA 3L72H 4PA4A 5LGUA 1VQ5V 3H1KH 2EZOA 1UFIA 2A3QA 2UUCO 3K5OA 2OIEA 3CP1A 3ASOC 2JJ1G 2Y0IA 3B09A 1VF6C 2GDSA 5B3SC 1F51A 2CGNA 1CP9A 1BHBA 2ZDIA 4UFZA 1FFTB 1NI8A 3K59A 5EC2C 5B1AB 1Y66A 2HJDA 4ZBMA 5B1BB 1PD3A 3VBBA 1VP7A 2PY5A 4X1YB 4Z2WA 3ZHVA 2BOCC 4CH6A 2FYUH 2Q67A 3JD2A 1P7BA 3RYHB 4B3TB 3AG3C 3SJBC 3MAQA 2VWKA 3T1YB 3ZMZA 1SA0A 2V1DA 2HKOA 1Q8IA 2CTQA 4L87A 4XDLA 1W0JG 2GBOA 3WFVA 2F4VB 1H2NA 3FKSG 4FPPA 4GLXA 4J11A 4CH4A 1HW7A 3VQWA 2PI5A 1HR0B 3JD1A 1JPXA 3UT5A 4I9QA 3OGCC 4CBCA 5LGTA 1KD1W 1QLNA 4AHCA 1VEWA 4LH7A 2HG5C 3IGAC 4FLYA 3T1YO 1Q5OA 3HKEB 2DYRC 2PZSA 2WLLB 1AI7A 1NH2D 2QR4A 2F4VO 1RM1C 3CJHB 3GWOA 4WBNA 2AZ0A 3SJCC 1I08A 1HR0O 1IXMA 3CX5F 3B4SA 3ETEA 4LBEC 3Q4HB 4MVRA 4ZOLA 2E74B 2Q8VA 4DXWA 1L8DA 1O9GA 2GTAA 4IIJB 1N33B 4JTCB 1M93A 2K1EA 2JK5C 2ZE6A 4DW1A 5B3SB 5IY5C 1PV0A 1Q3EA 2WLLA 4GX5A 2ZE5A 1M9NA 1R1BA 3H1HH 2OCHA 4LF5B 3SJQC 2X6CA 4UB6Z 3EHBB 4X20A 4BIZA 1SRYA 1SQGA 1F4MA 4J7KA 3SPJA 5DM6V 1VF5B 5B1NA 1YITV 4UCSA 1IBLO 1N33O 5EYPB 3AG3B 1VF6A 5KHIA 4XDKA 2X7RB 1FYJA 1TGOA 3AK3A 4ZI7B 2E75B 3HR0A 4JYBA 3LSUA 4E4EA 4LF5O 4RAIA 4DR1B 3WU2Z 4DK0A 2XOKG 4I4TB 1R3KC 1WB8A 2JS5A 3ABUA 5L3CA 2PTMA 1M57C 3K5NA 1PNLA 1GN3A 4DV7O 1HDJA 1U96A 4HYOA 1BQ0A 3CYOA 1NU1H 4ZI7A 2XT9A 3AG1C 5LOVA 2DYRB 4RWUA 1NZ6A 4NTWA 2RJZA 3E89A 4DR1O 5FNVA 2R9AA 2XAFA 2QWRB 3TGUH 4CH3A 3CMAV 2F1MA 1VMGA 2QJ1A 4U3JB 4HZ3A 2FL4A 1VQPV 5IJ9B 2H3OA 2GUZA 3CWBH 1GTOA 1NS1A 5IYDO 5KUMA 1N36B 2OCCC 3PJSK 3E8BA 2EINC 5LXTA 4IHJB 1S5LZ 1IVSA 3U11A 3C3SA 4CZZA 3CD6V 1IBKB 4Z1MG 1IXBA 1V9PA 4EFBA 1S0VA 5CBFA 5KAFZ 1CEZA 2LFRA 4FK5C 1QU7A 3E8HA 3K08A 3RYFB 1O9HA 3SPHA 2ZD9A 1U97A 4LR3A 1Z5WA 1N36O 5H5NA 3CE2A 3JAWB 2Y69C 2KQXA 3HKDB 1QR8A 3ZMVA 3A2FA 1IBKO 2N74A 1R3LC 2PYJA 1SQQH 4JAUA 3IFXA 4ICGA 4OXSA 4OGQB 1SZTA 3AG1B 4C7UA 1Q82W 5B5EZ 3N2GA 4JAAA 3ZMUA 3L9DA 2P06A 3A0RA 4I9WA 4D7TA 2WWWA 3BAAA 1TUBA 5CN0A 1EM1A 4D6TH 1AVMA 4UCTA 1WA8A 2GTSA 2UXNA 1JA8A 3SPCA 1COWG 5CMUA 5LP6B 1BQZA 5FPRA 1K73W 2HP8A 5GTHZ 1R6NA 4UV9A 2JGDB 4NR1A 2CTWA 3K79A 1WPBA 3UO2A 4B3SB 2BTOA 2ZT9B 4UVCA 5LMUB 1BHAA 2FTKA 1WN7A 4H37A 1GMGA 4FVMA 2OCCB 5FPOA 3WB2A 3W7UA 2EINB 2FB5A 3BCCH 4DV1B 2UXBB 4X65B 3OTFA 4YHHB 1M1KW 2YXLA 1FXKC 2QTOA 3LSSA 4QPJA 4U7NA 2PUSA 2JGDA 1MSDA 1PNKA 5D5QA 5DEDA 3P30A 2E5LB 4HNAB 2ZKOA 2W6IG 1MNGA 2WAMA 1WNSA 4B3SO 1V55B 4MTFA 5LMUO 1B3QA 2R70A 3RBZA 1RSOB 3G6BA 3CRRA 3JD0A 3VQYA 1SC5B 4R50A 4DV1O 2QKAA 2VS0A 1HNWB 1NTKH 2UXBO 3E8FA 4X65O 1AR4A 1S5HC 2Y69B 2IJHA 2XHBA 2EULA 3DC5A 4DK1A 2Z0AA 3F5TA 2ZCEA 1JOYA 4HNAA 2E76B 2E5LO 2LJ2A 5EK0A 2Q4PA 5HFMA 3WB0A 1Q43A 3G6EV 1SQXH 4P2ZA 5IYCO 2NR5A 1VQMV 5ITZB 5D5PA 4DUZB 1D5AA 3ETDA 1HNWO 3JARA 2ZM6B 1GM8A 4PDVA 1QVGU 2KG7B 4CS3A 3OR6C 3HKCA 3QG5A 1YEWA 1I7FA 2YIDA 2AZ2A 4LF4B 3RN4A 1OJHA 1G6UA 2P5OA 3K9SA 4JV5B 5ITZA 5KHKA 1PM9A 4DUYB 4DUZO 4FFBA 2Q0OC 2ZM6O 2KG7A 3H9VA 1IBMO 1T5EA 2EBOA 4IT5A 4FM0A 2HEPA 2OIGA 1FXKB 2XASA 1YHQV 1Y67A 4LF4O 2JRIA 3UKMA 4EFEA 1K33A 3RGBA 4O4HA 5IT9N 4JV5O 3KKYA 3RW0A 3E8GA 3BEHA 4UB8Z 4PI2A 4DUYO 1SETA 1PL4A 4PA6A 4DV0B 3T1CA 4ZHQB 1K8AW 2ZDIC 4UCRA 4K0KB 4A5UB 1FXKA 4LFCB 3JASA 1GKFA 2LGQA 2WLHA 4FZ0A 4X66B 2YEVB 5EZYB 3H1LH 3CRAA 3CCVV 1IURA 3FB8C 4H33A 4P9PA 3N2KA 3AEIA 4IL6Z 1AILA 3OMAB 3B77A 2IH3C 2VRZA 3G71V 1FPOA 3ABKB 3D3IA 3H1JH 4P9OA 4K0KO 1IZ3A 1GM7A 5IJ0A 2YEVA 4X66O 2XTAA 1JCHA 1KP3A 4CH5A 1N34B 3ETQA 5KHHA 1BZKA 1ZX3A 5CA0B 3OUSA 5JQGB 1JFFB 1SQPH 3JD3A 3CCRV 4K8ZA 2C2AA 1VIBA 3VOUA 3D3QA 4X88A 2EX3A 1IDSA 3M99B 3OM3B 2JIZG 1J5EB 2UUAB 4QPKA 4DV4B 4TUYB 2CTRA 1WLEA 3J7AU 4MVUA 3TETA 1R3JC 2LW1A 4QE7A 1N34O 4KL1A 2OTLV 4O2AA 2X6AA 1XL6A 1K5SA 4TOIA 1A32A 4JASA 3HB3B 4JZ2A 3K03A 3AK2A 1AI4A 5A2QN 2CK3G 4DW0A 5BY1A 4JF3A 1P4RA 3W7SA 4KUMA 2PF4E 1XILA 1NH2B 1J5EO 5GONA 2UUAO 4DV4O 3ML0A 4NTYA 2L6LA 3SYPA 4K8XA 1FJGB 2UUBB 3JALA 4JYYA 1OV9A 2ZINA 4MVMA 1OHHG 4O4LB 5H2FZ 3JYCA 2H8PC 4W4KA 3ZHQA 1SA0B 1ZAUA 4U7OA 2JEUA 2Q7EA 4X8AA 1FKAO 1NJIW 1OCOC 4LP8A 3KG2A 3QF7A 3ASNB 5KAIZ 4B3RB 3TXQA 3ZBHA 1FJGO 1E79G 4IYIA 2P4KA 3IC7A 1AJPA 3UT5B 2UUBO 4O4LA 4PJ0Z 3LDDA 1EZJA 1AJNA 2DYSC 4JI8B 2ARHA 3DGEA 1ORQC 1MMMA 2HJFC 4UVAA 1EFRG 2ZIMA 3BRCA 4WBNB 3OW2U 4JI4B 4B3RO 1VF7A 4OPHA 4DR3B 4JTAB 2Q7GA 4ZOLB 2ODMA 1DF5A 1W0KG 2AW9A 1E1RG 1M56C 4B3TO 4TV8A 3F5WC 1F4NA 5CA3A 3DXRA 1NR1A 4PDMA 3APQA 1NBMG 1SERA 2NLJC 2Q69A 4NYKA 5CA1A 3T2MA 3L71H 1THZA 4X20B 2KSDA 4BIUA 3CC4V 3HPLC 4DR6B 4JI4O 3TJTA 4DR3O 3THOA 2A79B 3E22A 4UUJC 2ZE7A 1VQOV 1QHTA 3ASOB 1JJOA 1PPJH 5J2TA 3K3WA 4N23A 3J81N 4GCZA 4B7KA 4WFBV 4X89A 1BS3A 3ABTA 4DR6O 2VQEB 3OGIB 2YXYA 1XBLA 3BA8A 1S72V 2NNUA 1B6QA 1RP3B 1R6TA 1LNQA 5CB4A 2FKXA 1HWYA 4JI2B 5LMNB 5GTIZ 4WF9V 4EB6A 3M8AA 4PHZA 2CAZC 1XDCA 4GKJB 2LFSA 5LOVB 4I55A 1ENVA 1V54C 3RWRD 3ZEDA 1NVPB 5KMGA 1NQTA 3C3TA 3JATB 1GN6A 2VQEO 1OZ0A 1YXBA 5FNVB 4YY3B 3D36A 4J80A 5B1OA 3MHHC 2YI9A 5A9GA 4JI2O 5LMNO 2XUMA 3RYCA 1GM9A 3U10A 1PNMA 1H8HG 4GKJO 3CCQV 4IYHA 1N0JA 5LYJA 2JVDA 1FFXB 3CPWU 2GUZB 2YDEA 2R9RB 3LNNA 1RM1B 3JATA 4J42A 4YJ2B 4DR7B 1E1QG 4YJ3A 5LXTB 4YY3O 5FLXN 3ZHUA 2YS8A 3L70H 1ZUQA 3EFFK 1UPGA 5J2UB 2YIAA 3IAYA 2BCCH 5L3FA 2P90A 2WSSG 5IY5B 3O9OA 2ZR3A 2QWQB 4I50A 5LBQA 2RMKB 4AQYB 4PD4F 4FJCC 1FFXA 1G4YB 4B3MB 1S76D 4BAYA 4YJ2A 3OEHG 4Z1VA 2H94A 1Q6UA 1XOUA 1Q6IA 1XEQA 4DR7O 3E86A 3O65A 2XAHA 4LNUB 4HBNA 4ZKIA 1YJNV 1H2KA 5J2UA 3H1IH 1AR5A 5JWPA 3CC2V 3N2GB 4AQYO 3N27A 2YIBD 4LWSA 2EZPA 1D2DA 3K9AA 4B3MO 1V54B 2CGOA 1TUBB 1OCZC 3K57A 1WA8B 3P3NA 2A06H 4LNUA 1M57B 4JYAB 2DE0X 1SZXA 1URFA 3KCYA 3CRQA 1YDXA 4CC6A 2HHHB 1D5NA 4GT1A 2EILC 1QCEA 2D2CB 1M4UA 4X1KA 1W2BU 4BW5A 3K5MA 2DW4A 1IX9A 3ZN1A 5FL7G 5KA5A 2B1GA 4JYAO 5JJNB 3FB5C 5C93A 4QE9A 1DTOA 2QTSA 3AG7A 4XBFA 3OAAG 1SQBH 3CCJV 1JX9A 2DQ0A 2RDCA 2Y0PA 3E83A 2CDYA 2P4VA 2ZR2A 3CS5A 3JAMN 4DV5B 4DRXA 3A0BZ 3NXSA 5EBWC 4NXNB 1CPYA 4O4IA 2NN4A 1ZL8A 2P6JA 2BTQB 4OX9B 3CMEV 2WLIB 2WPDG 2HR3A 1DK1A 5KLVH 1WAZA 1SF9A 4UV8A 2Q68A 1I5XA 4GYCB 4LFAB 5LHGA 1RPRA 1VQ4V 4HAMA 3VQVA 2BSKA 1KBHA 4DV5O 2QKCA 2MK3A 3T1HB 2QE7G 2HVKC 1OCZB 3SYOA 4NXNO 3JARB 3OEEG 1ROPA 4LF7B 1M5IA 4YHHO 3HKCB 2BTQA 2WLIA 4OX9O 1K5QA 1PP9H 1QNMA 1H2GA 4KFMA 1BSMA 3NR7A 3AG4C 4LFAO 3ZX6A 2RQ6A 4NTXA 2WA3A 3UQ8A 4QIWF 5LHIA 4MVOA 5KX5A 3T1HO 3E2EA 2G38A 5BXZA 1VQ9V 1YTFD 4JI0B 4MTOA 4DR2B 4FFBB 4B08A 1H38A 3P3PA 3G67A 5J9PC 1JMKC 4LF7O 3DSQA 1NKDA 1R3IC 2ILMA 5JJEB 4K35A 2QWPB 3LDCA 2QSAA 3SPGA 3ZHSA 1H2LA 3B40A 5HFLA 4O4HB 3P32A 1JQ0A 4G2KA 4UXNA 4NKGB 4I7ZB 4ZIBA 4J10A 1FAFA 2UXCB 3FYIB 2ZXWC 3C90A 4JI1B 2QA4V 2P67A 4JI0O 4DR2O 2A9HA 1WP8A 4I0XB 2K9PA 4KHPB 4JZGA 1KB9F 2IBZH 1P84F 1N32B 3CEIA 3JASB 5JVDA 1Q90D 4UCUA 3D8CA 2ZQMA 3FD9A 1AI6A 1FXHA 5JH7A 3RFRA 5F2VO 3E35A 3N2KB 1K92A 2ZIOA 2UXCO 4JI3B 4Q20A 1RFYA 2F95B 4J7JA 2JDIG 3SR2C 3B2EE 4I0XA 4BW9A 2M6YA 2YSUB 3BVOA 4KHPO 1N0NA 2DJVA 2PGGA 4R6ZA 1N32O 2GV9A 4FM1A 5IJ0B 2CH7A 1ZLZA 4CS2A 1AJQA 2OT5A 3SYAA 5LHHA 1VQ8V 3MHSC 3FAVA 5BZBA 2QEXV 3ZN0A 4KXRA 4JI3O 1HNZB 4DV6B 4DV0O 3ABMC 4GZRB 1KP2A 2EJRA 2R72A 1AI5A 3JAKA 2VWJA 4LFCO 4DV2B 1AB3A 3OMNB 1XHXA 5C8YA 1YI2V 3FB7C 2XAJA 4JAVA 5EC1C 4RQEA 3WG7C 4RUFA 1FD9A 2LQTA 4O2AB 3K04A 4JI7B 4DYLA 3B8NA 3BY6A 5BR8B 2ZXWB 3ZS8C 1HNZO 4DV6O 4TV9A 3QO5A 4MT8A 4WFAV 1L0NH 4O2BB 2A0LA 3CRCA 3GWKC 4DV2O 2Z5UA 5GONB 2YXHA 4JYCA 4X1IA 1G8MA 1X4TA 3ZIAG 1BGYH 1H2SB 2B5UA 4G27B 2Y4TA 5KHJA 1K4CC 3JALB 2OYQA 3EXAA 1TAEA 5BR8O 3ZMTA 3X2QC 1JR9A 1QBZA 1XNRB 1PKXA 2IU0A 4O2BA 2DQ3A 3STLC 1R6KA 3T4ZA 3TXSA 2LW7A 4PI0A 3G4SV 4D7SA 4J41A 1Y6XA 4DO2A 4JI5B 2HLDG 1AR1B 1K97A 1TA8A 5IWAB 1SESA 2QKSA 4TQFA 1XNRO 3ABMB 4QJFB 4G28B 2KB1A 5TISZ 4R8CA 4DR5B 2W0FC 1I0HA 1BMFG 1XHZA 2QWOB 2JJ2G 1ZTEA 2CE4A 2L35A 4H44B 2Y48A 5JJJB 4FM2A 2B9ZA 4MW8A 3D36C 3WG7B 1GAXA 4WFFA 4JI5O 1MA1A 5K1XA 4QNHB 4PDLA 1N4CA 1OCCC 3BA9A 4TV8B 4KP4A 3ZJZA 3DXRB 3U0ZA 4UCOA 5IWAO 4CS4A 5LA6A 1ZSPA 4DR5O 1LR1A 3ICXA 4LCUC 1EN6A 4X9QA 1I94B 1VQLV 5CA1B 5DECA 2VQFB 2WLNA 3APOA 4ABMA 4AILC 2Q6AA 5IDJA 3MDSA 3SYCA 3W7TA 3E22B 3ZCCA 5L3BA 1GH6A 3RVYA 2XAGA 1NTMH 1X59A 1S5JA 4JGSA 5L3GA 3X2QB 4JI8O 5J2TB 3KZIZ 1F23A 3ETGA 2N05A 1BCCH 4X1YA 1S77D 3ZRVA 3OE7G 1I94O 3ABLC 1EN5A 2VQFO 3ZMSA 3CCLV 2F66C 1AP5A 3RYHA 1XQ8A 2Q5ZA 2LO1A 2R9IA 3UCSC 4JPRA 4F6EA 1K3EA 1GN4A 1XUQA 4MVSA 5CB4B 3LSQA 2V7QG 4EB6B 3A8TA 1BL8A 2ZNJA 2DMXA 1UJWB 2RCVA 1SQFA 5IYBO 3JD4A 3L74H 1Y74B 4EKWA 4I55B 2AXTZ 2RNBA 1OCOB 3K0GA 4GX1A 5EBMC 5KMGB 2B1IA 2RN9A 2IJKA 1IBLB 3LNMB 2IU3A 3HKEA 5LL6Y 2GSMB 2D3OW 3RYCB 2GHYA 3QNEA 4NXMB 3S3WA 4UCVA 1OCCB 4F4LA 4EEQA 3CJHA 1L1FA 2DYSB 3K06A 3R66A 1CXZB 5LYJB 1SQVH 1Y74A 1DLBA 3Q4HA 1DF4A 4DV7B 4IIJA 1H2MA 2W6JG 1Q6HA 4YJ3B 2XNDG 2N04A 4FIPC 1BE3H 2YI8A 1SS3A 2PI4A 2CTPA 3I55V 2OWOA 1M56B 4NXMO 1B04A 2DWEC 4H0LB 3OUFA 2P22C 3CB2A 4GUNA 3LUTB 1YVWA 4RUEA 1K9MW 1KECA 4I50B 2LGWA 3SDLA 2YIBA 2A7WA 5EIBD 4X62B 4JI6B 1YJ9V 1F7YA 4MTXA 3ABLB 4LF8B 5GW7A 5EYPA 2ETNA 1QLEC 1KMIZ 1FXVA 1B06A 3QO8A 2WLJA 3OFNG 4PA7A 2UXDB 1QVFU 3RYIB 1LUVA 4I4TA 4PDRA 3CSXA 3SYQA 1GN2A 3RT3C 4LWSB 4FLVA 1FS0G 5LP6C 1YCIA 4LC1A 2LP7A 4X62O 4JI6O 3ZHTA 5H6QA 1YZBA 4LF8O 1US6A 4BIOA 3I56V 1HP8A 1SKVA 3A0HZ 2Y4UA 4QGPA 3CCSV 1MSWD 1Z2GA 2UU9B 3JCZA 3HKBB 3KCXA 1HNXB 5KHGA 3CCUV 1K4DC 2UXDO 4GX2A 3RYIA 2BE3A 2YC0A 1OCRC 3B8MA 2AGAA 3QTCA 2EIMC 3F7VC 2EIJC 4X1KB 4TSFG 1W59A 1KQSU 1QQCA 4B7EA 4U3JA 2QDOA 3FYEB 4BR6A 2F23A 2UU9O 1YF2A 3HKBA 1JJ2U 3PN1A 2QWNB 3WB1A 4MVQA 5IJ9A 1HNXO 2QGNA 4WFGA 1KYOF 1V55C 3BHPA 4PELA 5KUKA 1NVPD 3W7XA 4TT3G 2WLMA 4GX0A 1TVKB 4TQDA 3G80A 3CCEV 1YIJV 1K34A 3S3XA 2ITCC 1NTZH 4IHJA 2WA4A 3JSLA 5H6RA 5B66Z 2ITDC 5DN6G 2V4DA 4DRXB 2DN9A 4E2LA 1L0LH 1YTFB 4O4IB 1Q86W 1ZL8B 4CC5A 1QLEB 4FLXA 2DWDC 2IM9A 2F43G 1LUWA 1GO3F 3RYFA 4YXWG 1AROP 2ATKC 2HHHO 5H9CA 1TVKA 4I5SA 1VARA 4NVPA 3JAWA 3OD4A 1J95A 3HKDA 2BSKB 2YICA 5K1PA 4MW3A 3R65A 3K58A 2MW2B 1TUEB 1XMOB 2X6BA 4PA9A 4O4JB 5BMVB 3ZHRA 3RVZA 1KUQA 3MD0A 1MOFA 4FLZA 1WPXA 2P7TC 3TK1A 4J9YB 4FZ1A 2FMLA 4ASUG 3UO3A 1OCRB 5AG2A 4YIPA 2EIMB 4W4LA 5LP6A 2Q73A 2ADPA 2EIJB 5KX5B 3TCUA 3I5DA 1XMOO 2WLKA 4O4JA 5E1AC 5BMVA 1MZFA 1YJWV 3CHXA 4FLTA 4J7ZA 3OT7A 1XNQB 4MVZA 2IJJA 4MSWC 1N8RW 3CCMV 3OR7C 2EILB 2Q9LA 1RPOA 2UXXA 3L73H 1P7GA 2E3CA 1GK9A 2OTJV 3OMIB 4MTGA 4PV1B 2QM8A 5CBHA 3K5LA 1KC8W 2QM4A 1Y4MA 3CC7V 2KKWA 2EIKC 3VQXA 1PL0A 4MS2A 1XNQO 1XL4A 2YUAA 4NB5A 5JVDB 1MG1A 1RSOA 1KKDA 1Q81W 3CRMA 3UM7A 5JH7B 1BT8A 5IYZB 3H01A 3ABKC 3QVNA 3W7WA 1IBMB 1R73A 4OPAA 5JCOC 3SJAC 3AK1A 1MABG 4X64B 2Z3YA 4LFBB 2JS3A 3GVMA 1VQ7V 3IC9A 2AHYA 2CH7B 1WB7A 3OTOB 3SPIA 3DTUB 2AHZA 3T4DA 5IYZA 2BOBC 3ZRXA 3FAVB 1S3JA 1H8EG 4WFHA 1XREA 3ZRWB 2EJ7A 4UVBA 1GRJA 4JI1O 2W0XA 4DV3B 4X64O 2IH1C 2JGUA 4K3AA 4FLUA 4LFBO 3CXHF 2IJIA 3JAKB 2DOSA 4GKKB 3M7MX 4P30A 4R7CA 2ADQB 3OTOO 4BWAA 5C8YB 3AG4B 1K7DA 1XI1A 3IJ4A 2IW5A 3GB7C 3ZRWA 4RO2A 1MZEA 3ZRSA 3AG2C 1WJZA 4RQFA 4Q6GA 4L8JA 4DV3O 4TV9B 5L3DA 4YIOA 3BFRA 1EZVH 3FB6C 4XDJA 1ZWIC 2EIKB 4GKKO 2Q0AA 4WCEV 4X1IB 2PYLA 3DC6A 3FFQA 3L75H 4LF9B 4DR4B 1VQ6V 4ZHQA 4J9ZB 5CBGA 5B1AC 2CUGA 1XMQB 5B1BC 2ZE8A 1QR9A 3JSNA 4LF6B 5EZYA 1Z5VA 3F7YC 3BPZA 3JCUZ 4N21A 1VQNV 3ASNC 2HVJC 2O57A 1I5YA 2M7WA 1WP7A 1VQKV 4FFKA 4FMTA 4F6RB 1G1XB
chains in the Genus database with same CATH topology
5EK0A 4MVSA 5HFMA 1NR7A 3G6EV 3LSQA 4P2ZA 2V7QG 5IYCO 3STZC 3QO7A 3CC2V 4JTDB 1BL8A 1UJWB 4WFEA 1VQMV 2QM7A 2EZPA 3K9AA 4PA3A 1V54B 1M90W 5IYBO 3ETDA 3JD4A 3LDEA 1GM8A 4PDVA 4EKWA 5EBLC 1OCZC 1QVGU 1OCOB 3OR6C 3K0GA 4GX1A 1M57B 5EBMC 5KA6A 1JVMA 2B1IA 2X0LA 2IJKA 1EBOA 3LNMB 2IU3A 2GSMB 3K0DA 3CXCU 2D3OW 5LGNA 1YSCA 1Q7YW 4GT1A 2GHYA 3QNEA 2EILC 1QCEA 2XAQA 1OCCB 4F4LA 1L1FA 2DYSB 3K06A 4TWKA 3AG2B 1W2BU 2HFEC 4BW5A 2JEXA 2DW4A 1DLBA 3ZN1A 2EBOA 5FL7G 5KA5A 5L3EA 2B1GA 1DF4A 1FXKB 2XASA 2W6JG 3FB5C 4PA4A 5C93A 5LGUA 4QE9A 1DTOA 1YHQV 1VQ5V 2XNDG 3UKMA 1K33A 2EZOA 4FIPC 4XBFA 3CP1A 3ASOC 3OAAG 2PI4A 2JJ1G 3CCJV 1JX9A 3I55V 5B3SC 1M56B 2DQ0A 1F51A 3RW0A 3E8GA 1CP9A 3E83A 2DWEC 3BEHA 1BHBA 3OUFA 1SETA 2ZDIA 1FFTB 3LUTB 2ZR2A 4PA6A 5EC2C 5B1AB 1Y66A 4ZBMA 4RUEA 5B1BB 1K9MW 1KECA 3T1CA 1K8AW 1PD3A 2ZDIC 3VBBA 1YJ9V 3NXSA 4MTXA 5EBWC 1CPYA 1FXKA 3ABLB 1GKFA 5GW7A 2WLHA 2P6JA 2YEVB 2BOCC 2Q67A 3CMEV 2WLIB 2WPDG 3CCVV 2HR3A 3JD2A 1P7BA 1QLEC 3FB8C 4H33A 1FXVA 3AG3C 4P9PA 4UV8A 2Q68A 1I5XA 3QO8A 3ZMZA 2WLJA 3AEIA 3OFNG 2V1DA 4PA7A 5LHGA 2HKOA 1RPRA 1VQ4V 3OMAB 3B77A 4HAMA 1QVFU 4L87A 4XDLA 4PDRA 2IH3C 1W0JG 2MK3A 3WFVA 2QE7G 3SYQA 3FKSG 4FPPA 3ABKB 3G71V 2HVKC 1FS0G 3D3IA 1OCZB 2LP7A 4LC1A 4P9OA 3SYOA 5H6QA 1GM7A 2PI5A 2YEVA 3OEEG 3JD1A 1JPXA 1ROPA 1JCHA 3I56V 1KP3A 3CCSV 3OGCC 1MSWD 2WLIA 4CBCA 5LGTA 1KD1W 1K5QA 1QLNA 1H2GA 4KFMA 3OUSA 2HG5C 3JCZA 3IGAC 3AG4C 3CCUV 1K4DC 2DYRC 4GX2A 2WLLB 1AI7A 1OCRC 3JD3A 1NH2D 4QIWF 3B8MA 5LHIA 3CCRV 2C2AA 4MVOA 3VOUA 4X88A 2EIMC 3E2EA 1RM1C 3F7VC 3GWOA 3M99B 1VQ9V 1YTFD 2EIJC 4MTOA 3OM3B 4TSFG 2JIZG 1H38A 1KQSU 4QPKA 5J9PC 1IXMA 3ETEA 1WLEA 4LBEC 4MVRA 1NKDA 1R3IC 3FYEB 4MVUA 3TETA 1R3JC 4DXWA 4QE7A 2OTLV 4JTCB 1JJ2U 3LDCA 2K1EA 2JK5C 4MVQA 3SPGA 2X6AA 1XL6A 4WFGA 1K5SA 1V55C 5HFLA 4PELA 5B3SB 3HB3B 2WLLA 4JASA 4GX5A 3K03A 4TT3G 5IY5C 3P32A 5KUKA 3W7XA 1NVPD 1JQ0A 4G2KA 1M9NA 2WLMA 4UXNA 1AI4A 4GX0A 2CK3G 3CCEV 1YIJV 1K34A 4JF3A 3SJQC 1P4RA 2ITCC 3FYIB 2X6CA 2ZXWC 3EHBB 4BIZA 3W7SA 5H6RA 4KUMA 1SRYA 2ITDC 2QA4V 2P67A 2A9HA 5DN6G 1NH2B 1F4MA 3ML0A 4E2LA 3SPJA 5DM6V 5B1NA 3SYPA 1YITV 1YTFB 1Q86W 1QLEB 2DWDC 2F43G 3AG3B 4XDKA 1GO3F 4MVMA 2X7RB 1OHHG 2ZQMA 4YXWG 1AI6A 1AROP 1FXHA 2ATKC 5H9CA 3JYCA 2H8PC 3E35A 4JYBA 1K92A 4I5SA 4U7OA 2JEUA 4Q20A 4RAIA 2JDIG 4X8AA 2XOKG 1NJIW 1J95A 1R3KC 1OCOC 5L3CA 3ABUA 2YSUB 1M57C 1PNLA 4MW3A 4LP8A 3KG2A 3R65A 3ASNB 1TUEB 4R6ZA 2X6BA 4PA9A 1E79G 3IC7A 3RVZA 3MD0A 1AJPA 1AJQA 4HYOA 2OT5A 3SYAA 1MOFA 3CYOA 5LHHA 1WPXA 2P7TC 3TK1A 4J9YB 3AG1C 1VQ8V 3MHSC 2DYRB 3LDDA 5BZBA 1EZJA 4ASUG 2QEXV 1OCRB 3ZN0A 1AJNA 2DYSC 3E89A 2EIMB 3DGEA 1ORQC 2HJFC 3ABMC 2EIJB 4UVAA 1KP2A 1EFRG 2XAFA 2EJRA 3TCUA 1AI5A 3CMAV 3OW2U 2WLKA 5E1AC 4JTAB 1YJWV 3OMNB 4HZ3A 1YI2V 1DF5A 1W0KG 2XAJA 3FB7C 4JAVA 5EC1C 1E1RG 1M56C 1VQPV 4RQEA 3WG7C 3F5WC 2IJJA 1F4NA 4MVZA 4RUFA 5CA3A 4MSWC 1NR1A 3K04A 4PDMA 1N8RW 3CCMV 3OR7C 2EILB 3B8NA 1NBMG 3BY6A 1GTOA 1SERA 2NLJC 2ZXWB 5IYDO 5KUMA 1RPOA 2UXXA 2OCCC 3PJSK 3E8BA 2Q69A 3QO5A 2EINC 3T2MA 4MT8A 1THZA 4WFAV 1GK9A 4BIUA 2OTJV 2A0LA 4CZZA 3HPLC 3OMIB 4MTGA 3CC4V 2QM8A 5CBHA 2Z5UA 4JYCA 1KC8W 3CD6V 1G8MA 2A79B 1Y4MA 4Z1MG 3CC7V 4UUJC 2EIKC 3ZIAG 1S0VA 5CBFA 1VQOV 1PL0A 1CEZA 2LFRA 4FK5C 4MS2A 2B5UA 1XL4A 4G27B 3ASOB 3E8HA 1KKDA 1K4CC 1MG1A 3K08A 3SPHA 1Q81W 3UM7A 2ZD9A 3K3WA 4N23A 3H01A 3ZMTA 3ABKC 3X2QC 4GCZA 3W7WA 1QBZA 1R73A 1PKXA 2IU0A 2DQ3A 4X89A 4WFBV 2Y69C 1MABG 3ABTA 1S72V 1QR8A 1B6QA 2NNUA 1R6KA 2Z3YA 3STLC 3ZMVA 1LNQA 1HWYA 1VQ7V 3T4ZA 1R3LC 4JAUA 4WF9V 2AHYA 3IFXA 4OXSA 3G4SV 1SZTA 3AG1B 1Q82W 3SPIA 3ZMUA 4DO2A 2HLDG 3A0RA 4I9WA 3DTUB 2AHZA 3T4DA 2WWWA 2BOBC 2LFSA 3ZRXA 1AR1B 1K97A 1S3JA 1H8EG 4WFHA 1SESA 5CN0A 2QKSA 1ENVA 3ZRWB 1V54C 4UVBA 3ABMB 4QJFB 2UXNA 4G28B 2KB1A 1NVPB 3SPCA 4R8CA 1COWG 5CMUA 1NQTA 2W0FC 2IH1C 1BMFG 1OZ0A 2JJ2G 3D36A 1K73W 5B1OA 2Y48A 3MHHC 2IJIA 1R6NA 4UV9A 4MW8A 1GM9A 1PNMA 1H8HG 4P30A 4R7CA 3WG7B 3K79A 4WFFA 3AG4B 3CCQV 1K7DA 4UVCA 4QNHB 4PDLA 1OCCC 3ZJZA 1BHAA 4KP4A 2FTKA 2IW5A 4H37A 1GMGA 3GB7C 3ZRWA 4RO2A 2OCCB 3ZRSA 3AG2C 3CPWU 4RQFA 3W7UA 2EINB 2R9RB 1RM1B 4LCUC 1VQLV 5L3DA 1E1QG 2WLNA 1M1KW 1FXKC 2QTOA 3LSSA 4QPJA 4U7NA 3FB6C 1PNKA 2Q6AA 4XDJA 1ZWIC 2EIKB 5IDJA 3EFFK 3P30A 3SYCA 4WCEV 3W7TA 2W6IG 2WAMA 3ZCCA 5L3BA 3RVYA 5L3FA 2P90A 2WSSG 2XAGA 1V55B 4MTFA 5IY5B 2ZR3A 3RBZA 1VQ6V 5LBQA 4FJCC 4J9ZB 4JGSA 1G4YB 5L3GA 3X2QB 5CBGA 3JD0A 5B1AC 1F23A 3ETGA 4R50A 5B1BC 1S76D 1QR9A 4BAYA 3OEHG 1S77D 3E8FA 3ZRVA 2H94A 3F7YC 3OE7G 1S5HC 2Y69B 2IJHA 4N21A 1VQNV 3ASNC 3ABLC 2HVJC 3E86A 3ZMSA 2XAHA 3CCLV 1I5YA 2M7WA 2R9IA 1VQKV 4JPRA 1K3EA 4ZKIA 1YJNV 4FMTA 1JOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8A A;  5EK0 A;  4MVS A;  1J95 A;  1R3K C;  1OCO C;  3STL C;  1LNQ A;  4P2Z A;  4XDL A;  1M57 C;  4PDR A;  2IH3 C;  3T4Z A;  1R3L C;  4MW3 A;  3STZ C;  4JTD B;  4LP8 A;  1BL8 A;  3KG2 A;  3R65 A;  3SYQ A;  4WFE A;  2HVK C;  2AHY A;  3IFX A;  4OXS A;  4R6Z A;  2X6B A;  4P9O A;  4PA9 A;  3SYO A;  3SPI A;  4PA3 A;  3RVZ A;  2YEV A;  4HYO A;  4I9W A;  3SYA A;  3LDE A;  2AHZ A;  3T4D A;  2BOB C;  4PDV A;  4EKW A;  2P7T C;  3OGC C;  1OCZ C;  2WLI A;  3AG1 C;  4J9Y B;  5EBL C;  4CBC A;  3OR6 C;  4WFH A;  3LDD A;  2QKS A;  5BZB A;  3K0G A;  4GX1 A;  4KFM A;  1V54 C;  5EBM C;  3OUS A;  2HG5 C;  1JVM A;  4G28 B;  2KB1 A;  2DYS C;  3IGA C;  3AG4 C;  3SPC A;  3E89 A;  4R8C A;  2W0F C;  2IH1 C;  3LNM B;  1K4D C;  2DYR C;  4GX2 A;  1ORQ C;  2WLL B;  3K0D A;  2HJF C;  3ABM C;  1OCR C;  4PA7 A;  4MVO A;  3VOU A;  4X88 A;  3TCU A;  2EIM C;  4MW8 A;  2EIL C;  4P30 A;  2WLK A;  3F7V C;  4F4L A;  5E1A C;  2EIJ C;  4R7C A;  4MTO A;  4JTA B;  4WFF A;  4TWK A;  3K06 A;  2HFE C;  5J9P C;  4QNH B;  4PDL A;  4BW5 A;  4HZ3 A;  4LBE C;  3FB7 C;  5EC1 C;  4MVR A;  1OCC C;  1R3I C;  3ZJZ A;  4MVU A;  3TET A;  1M56 C;  1R3J C;  4QE7 A;  4DXW A;  3WG7 C;  4H37 A;  3F5W C;  3GB7 C;  4MVZ A;  4RO2 A;  4RUF A;  3ZRS A;  4MSW C;  3AG2 C;  3K04 A;  4JTC B;  3LDC A;  4PDM A;  2K1E A;  2R9R B;  2JK5 C;  3OR7 C;  4MVQ A;  2X6A A;  3SPG A;  3FB5 C;  4PA4 A;  1XL6 A;  4WFG A;  1V55 C;  4LCU C;  4QE9 A;  5IY5 C;  2NLJ C;  2WLL A;  5KUK A;  4GX5 A;  3K03 A;  5KUM A;  3UKM A;  2OCC C;  3PJS K;  3E8B A;  2WLN A;  2Q69 A;  2WLM A;  4GX0 A;  2QTO A;  2EIN C;  3T2M A;  3ASO C;  3FB6 C;  3SJQ C;  2ITC C;  2Q6A A;  5B3S C;  4XDJ A;  1ZWI C;  2X6C A;  2ZXW C;  2A0L A;  3EFF K;  3HPL C;  4MTG A;  3RW0 A;  3E8G A;  2ITD C;  3SYC A;  5CBH A;  3E83 A;  2DWE C;  3BEH A;  2A9H A;  3OUF A;  3LUT B;  2A79 B;  4PA6 A;  5EC2 C;  3RVY A;  4ZBM A;  4MTF A;  4RUE A;  4UUJ C;  2EIK C;  3T1C A;  5CBF A;  3RBZ A;  3SPJ A;  4MS2 A;  3SYP A;  1XL4 A;  4G27 B;  4J9Z B;  5EBW C;  1G4Y B;  5CBG A;  3E8H A;  1KKD A;  1K4C C;  3K08 A;  5B1A C;  2DWD C;  2WLH A;  4R50 A;  5B1B C;  3SPH A;  4XDK A;  4MVM A;  3UM7 A;  2ZD9 A;  2BOC C;  3E8F A;  3F7Y C;  1S5H C;  3ABK C;  2Q67 A;  2ATK C;  2WLI B;  3ASN C;  3X2Q C;  3ABL C;  1P7B A;  1QLE C;  2HVJ C;  3FB8 C;  3E86 A;  2H8P C;  3JYC A;  4H33 A;  3AG3 C;  4P9P A;  2Q68 A;  2WLJ A;  4X89 A;  2Y69 C;  4RAI A; 
#chains in the Genus database with same CATH topology
 3FX7 A;  1NR7 A;  3EVK A;  1Y76 B;  4H13 B;  4LF9 O;  2ZNI A;  4DR4 O;  3STZ C;  3QO7 A;  4JTD B;  4WFE A;  4FLW A;  2QM7 A;  4JI7 O;  1P49 A;  4PA3 A;  3BAB A;  2F93 B;  1XMQ O;  1M90 W;  5JCO A;  4LF6 O;  3LDE A;  5E79 Z;  2Q7H A;  3SGI A;  5EBL C;  5IE9 A;  5KA6 A;  1JVM A;  5CA0 A;  2X0L A;  4F6R A;  1EBO A;  5JQG A;  5EIB C;  4U3F H;  1KU9 A;  3K0D A;  1Y76 A;  2UUC B;  3CXC U;  3J80 N;  5LGN A;  1YSC A;  1JFF A;  1Q7Y W;  4IGG A;  4LH6 A;  1NT2 B;  4AI8 A;  2XAQ A;  1AP6 A;  4TWK A;  3AG2 B;  2HFE C;  2JEX A;  1EN4 A;  4TUY A;  5LA6 B;  1DGS A;  5L3E A;  1KKC A;  3L72 H;  4PA4 A;  5LGU A;  1VQ5 V;  3H1K H;  2EZO A;  1UFI A;  2A3Q A;  2UUC O;  3K5O A;  2OIE A;  3CP1 A;  3ASO C;  2JJ1 G;  2Y0I A;  3B09 A;  1VF6 C;  2GDS A;  5B3S C;  1F51 A;  2CGN A;  1CP9 A;  1BHB A;  2ZDI A;  4UFZ A;  1FFT B;  1NI8 A;  3K59 A;  5EC2 C;  5B1A B;  1Y66 A;  2HJD A;  4ZBM A;  5B1B B;  1PD3 A;  3VBB A;  1VP7 A;  2PY5 A;  4X1Y B;  4Z2W A;  3ZHV A;  2BOC C;  4CH6 A;  2FYU H;  2Q67 A;  3JD2 A;  1P7B A;  3RYH B;  4B3T B;  3AG3 C;  3SJB C;  3MAQ A;  2VWK A;  3T1Y B;  3ZMZ A;  1SA0 A;  2V1D A;  2HKO A;  1Q8I A;  2CTQ A;  4L87 A;  4XDL A;  1W0J G;  2GBO A;  3WFV A;  2F4V B;  1H2N A;  3FKS G;  4FPP A;  4GLX A;  4J11 A;  4CH4 A;  1HW7 A;  3VQW A;  2PI5 A;  1HR0 B;  3JD1 A;  1JPX A;  3UT5 A;  4I9Q A;  3OGC C;  4CBC A;  5LGT A;  1KD1 W;  1QLN A;  4AHC A;  1VEW A;  4LH7 A;  2HG5 C;  3IGA C;  4FLY A;  3T1Y O;  1Q5O A;  3HKE B;  2DYR C;  2PZS A;  2WLL B;  1AI7 A;  1NH2 D;  2QR4 A;  2F4V O;  1RM1 C;  3CJH B;  3GWO A;  4WBN A;  2AZ0 A;  3SJC C;  1I08 A;  1HR0 O;  1IXM A;  3CX5 F;  3B4S A;  3ETE A;  4LBE C;  3Q4H B;  4MVR A;  4ZOL A;  2E74 B;  2Q8V A;  4DXW A;  1L8D A;  1O9G A;  2GTA A;  4IIJ B;  1N33 B;  4JTC B;  1M93 A;  2K1E A;  2JK5 C;  2ZE6 A;  4DW1 A;  5B3S B;  5IY5 C;  1PV0 A;  1Q3E A;  2WLL A;  4GX5 A;  2ZE5 A;  1M9N A;  1R1B A;  3H1H H;  2OCH A;  4LF5 B;  3SJQ C;  2X6C A;  4UB6 Z;  3EHB B;  4X20 A;  4BIZ A;  1SRY A;  1SQG A;  1F4M A;  4J7K A;  3SPJ A;  5DM6 V;  1VF5 B;  5B1N A;  1YIT V;  4UCS A;  1IBL O;  1N33 O;  5EYP B;  3AG3 B;  1VF6 A;  5KHI A;  4XDK A;  2X7R B;  1FYJ A;  1TGO A;  3AK3 A;  4ZI7 B;  2E75 B;  3HR0 A;  4JYB A;  3LSU A;  4E4E A;  4LF5 O;  4RAI A;  4DR1 B;  3WU2 Z;  4DK0 A;  2XOK G;  4I4T B;  1R3K C;  1WB8 A;  2JS5 A;  3ABU A;  5L3C A;  2PTM A;  1M57 C;  3K5N A;  1PNL A;  1GN3 A;  4DV7 O;  1HDJ A;  1U96 A;  4HYO A;  1BQ0 A;  3CYO A;  1NU1 H;  4ZI7 A;  2XT9 A;  3AG1 C;  5LOV A;  2DYR B;  4RWU A;  1NZ6 A;  4NTW A;  2RJZ A;  3E89 A;  4DR1 O;  5FNV A;  2R9A A;  2XAF A;  2QWR B;  3TGU H;  4CH3 A;  3CMA V;  2F1M A;  1VMG A;  2QJ1 A;  4U3J B;  4HZ3 A;  2FL4 A;  1VQP V;  5IJ9 B;  2H3O A;  2GUZ A;  3CWB H;  1GTO A;  1NS1 A;  5IYD O;  5KUM A;  1N36 B;  2OCC C;  3PJS K;  3E8B A;  2EIN C;  5LXT A;  4IHJ B;  1S5L Z;  1IVS A;  3U11 A;  3C3S A;  4CZZ A;  3CD6 V;  1IBK B;  4Z1M G;  1IXB A;  1V9P A;  4EFB A;  1S0V A;  5CBF A;  5KAF Z;  1CEZ A;  2LFR A;  4FK5 C;  1QU7 A;  3E8H A;  3K08 A;  3RYF B;  1O9H A;  3SPH A;  2ZD9 A;  1U97 A;  4LR3 A;  1Z5W A;  1N36 O;  5H5N A;  3CE2 A;  3JAW B;  2Y69 C;  2KQX A;  3HKD B;  1QR8 A;  3ZMV A;  3A2F A;  1IBK O;  2N74 A;  1R3L C;  2PYJ A;  1SQQ H;  4JAU A;  3IFX A;  4ICG A;  4OXS A;  4OGQ B;  1SZT A;  3AG1 B;  4C7U A;  1Q82 W;  5B5E Z;  3N2G A;  4JAA A;  3ZMU A;  3L9D A;  2P06 A;  3A0R A;  4I9W A;  4D7T A;  2WWW A;  3BAA A;  1TUB A;  5CN0 A;  1EM1 A;  4D6T H;  1AVM A;  4UCT A;  1WA8 A;  2GTS A;  2UXN A;  1JA8 A;  3SPC A;  1COW G;  5CMU A;  5LP6 B;  1BQZ A;  5FPR A;  1K73 W;  2HP8 A;  5GTH Z;  1R6N A;  4UV9 A;  2JGD B;  4NR1 A;  2CTW A;  3K79 A;  1WPB A;  3UO2 A;  4B3S B;  2BTO A;  2ZT9 B;  4UVC A;  5LMU B;  1BHA A;  2FTK A;  1WN7 A;  4H37 A;  1GMG A;  4FVM A;  2OCC B;  5FPO A;  3WB2 A;  3W7U A;  2EIN B;  2FB5 A;  3BCC H;  4DV1 B;  2UXB B;  4X65 B;  3OTF A;  4YHH B;  1M1K W;  2YXL A;  1FXK C;  2QTO A;  3LSS A;  4QPJ A;  4U7N A;  2PUS A;  2JGD A;  1MSD A;  1PNK A;  5D5Q A;  5DED A;  3P30 A;  2E5L B;  4HNA B;  2ZKO A;  2W6I G;  1MNG A;  2WAM A;  1WNS A;  4B3S O;  1V55 B;  4MTF A;  5LMU O;  1B3Q A;  2R70 A;  3RBZ A;  1RSO B;  3G6B A;  3CRR A;  3JD0 A;  3VQY A;  1SC5 B;  4R50 A;  4DV1 O;  2QKA A;  2VS0 A;  1HNW B;  1NTK H;  2UXB O;  3E8F A;  4X65 O;  1AR4 A;  1S5H C;  2Y69 B;  2IJH A;  2XHB A;  2EUL A;  3DC5 A;  4DK1 A;  2Z0A A;  3F5T A;  2ZCE A;  1JOY A;  4HNA A;  2E76 B;  2E5L O;  2LJ2 A;  5EK0 A;  2Q4P A;  5HFM A;  3WB0 A;  1Q43 A;  3G6E V;  1SQX H;  4P2Z A;  5IYC O;  2NR5 A;  1VQM V;  5ITZ B;  5D5P A;  4DUZ B;  1D5A A;  3ETD A;  1HNW O;  3JAR A;  2ZM6 B;  1GM8 A;  4PDV A;  1QVG U;  2KG7 B;  4CS3 A;  3OR6 C;  3HKC A;  3QG5 A;  1YEW A;  1I7F A;  2YID A;  2AZ2 A;  4LF4 B;  3RN4 A;  1OJH A;  1G6U A;  2P5O A;  3K9S A;  4JV5 B;  5ITZ A;  5KHK A;  1PM9 A;  4DUY B;  4DUZ O;  4FFB A;  2Q0O C;  2ZM6 O;  2KG7 A;  3H9V A;  1IBM O;  1T5E A;  2EBO A;  4IT5 A;  4FM0 A;  2HEP A;  2OIG A;  1FXK B;  2XAS A;  1YHQ V;  1Y67 A;  4LF4 O;  2JRI A;  3UKM A;  4EFE A;  1K33 A;  3RGB A;  4O4H A;  5IT9 N;  4JV5 O;  3KKY A;  3RW0 A;  3E8G A;  3BEH A;  4UB8 Z;  4PI2 A;  4DUY O;  1SET A;  1PL4 A;  4PA6 A;  4DV0 B;  3T1C A;  4ZHQ B;  1K8A W;  2ZDI C;  4UCR A;  4K0K B;  4A5U B;  1FXK A;  4LFC B;  3JAS A;  1GKF A;  2LGQ A;  2WLH A;  4FZ0 A;  4X66 B;  2YEV B;  5EZY B;  3H1L H;  3CRA A;  3CCV V;  1IUR A;  3FB8 C;  4H33 A;  4P9P A;  3N2K A;  3AEI A;  4IL6 Z;  1AIL A;  3OMA B;  3B77 A;  2IH3 C;  2VRZ A;  3G71 V;  1FPO A;  3ABK B;  3D3I A;  3H1J H;  4P9O A;  4K0K O;  1IZ3 A;  1GM7 A;  5IJ0 A;  2YEV A;  4X66 O;  2XTA A;  1JCH A;  1KP3 A;  4CH5 A;  1N34 B;  3ETQ A;  5KHH A;  1BZK A;  1ZX3 A;  5CA0 B;  3OUS A;  5JQG B;  1JFF B;  1SQP H;  3JD3 A;  3CCR V;  4K8Z A;  2C2A A;  1VIB A;  3VOU A;  3D3Q A;  4X88 A;  2EX3 A;  1IDS A;  3M99 B;  3OM3 B;  2JIZ G;  1J5E B;  2UUA B;  4QPK A;  4DV4 B;  4TUY B;  2CTR A;  1WLE A;  3J7A U;  4MVU A;  3TET A;  1R3J C;  2LW1 A;  4QE7 A;  1N34 O;  4KL1 A;  2OTL V;  4O2A A;  2X6A A;  1XL6 A;  1K5S A;  4TOI A;  1A32 A;  4JAS A;  3HB3 B;  4JZ2 A;  3K03 A;  3AK2 A;  1AI4 A;  5A2Q N;  2CK3 G;  4DW0 A;  5BY1 A;  4JF3 A;  1P4R A;  3W7S A;  4KUM A;  2PF4 E;  1XIL A;  1NH2 B;  1J5E O;  5GON A;  2UUA O;  4DV4 O;  3ML0 A;  4NTY A;  2L6L A;  3SYP A;  4K8X A;  1FJG B;  2UUB B;  3JAL A;  4JYY A;  1OV9 A;  2ZIN A;  4MVM A;  1OHH G;  4O4L B;  5H2F Z;  3JYC A;  2H8P C;  4W4K A;  3ZHQ A;  1SA0 B;  1ZAU A;  4U7O A;  2JEU A;  2Q7E A;  4X8A A;  1FKA O;  1NJI W;  1OCO C;  4LP8 A;  3KG2 A;  3QF7 A;  3ASN B;  5KAI Z;  4B3R B;  3TXQ A;  3ZBH A;  1FJG O;  1E79 G;  4IYI A;  2P4K A;  3IC7 A;  1AJP A;  3UT5 B;  2UUB O;  4O4L A;  4PJ0 Z;  3LDD A;  1EZJ A;  1AJN A;  2DYS C;  4JI8 B;  2ARH A;  3DGE A;  1ORQ C;  1MMM A;  2HJF C;  4UVA A;  1EFR G;  2ZIM A;  3BRC A;  4WBN B;  3OW2 U;  4JI4 B;  4B3R O;  1VF7 A;  4OPH A;  4DR3 B;  4JTA B;  2Q7G A;  4ZOL B;  2ODM A;  1DF5 A;  1W0K G;  2AW9 A;  1E1R G;  1M56 C;  4B3T O;  4TV8 A;  3F5W C;  1F4N A;  5CA3 A;  3DXR A;  1NR1 A;  4PDM A;  3APQ A;  1NBM G;  1SER A;  2NLJ C;  2Q69 A;  4NYK A;  5CA1 A;  3T2M A;  3L71 H;  1THZ A;  4X20 B;  2KSD A;  4BIU A;  3CC4 V;  3HPL C;  4DR6 B;  4JI4 O;  3TJT A;  4DR3 O;  3THO A;  2A79 B;  3E22 A;  4UUJ C;  2ZE7 A;  1VQO V;  1QHT A;  3ASO B;  1JJO A;  1PPJ H;  5J2T A;  3K3W A;  4N23 A;  3J81 N;  4GCZ A;  4B7K A;  4WFB V;  4X89 A;  1BS3 A;  3ABT A;  4DR6 O;  2VQE B;  3OGI B;  2YXY A;  1XBL A;  3BA8 A;  1S72 V;  2NNU A;  1B6Q A;  1RP3 B;  1R6T A;  1LNQ A;  5CB4 A;  2FKX A;  1HWY A;  4JI2 B;  5LMN B;  5GTI Z;  4WF9 V;  4EB6 A;  3M8A A;  4PHZ A;  2CAZ C;  1XDC A;  4GKJ B;  2LFS A;  5LOV B;  4I55 A;  1ENV A;  1V54 C;  3RWR D;  3ZED A;  1NVP B;  5KMG A;  1NQT A;  3C3T A;  3JAT B;  1GN6 A;  2VQE O;  1OZ0 A;  1YXB A;  5FNV B;  4YY3 B;  3D36 A;  4J80 A;  5B1O A;  3MHH C;  2YI9 A;  5A9G A;  4JI2 O;  5LMN O;  2XUM A;  3RYC A;  1GM9 A;  3U10 A;  1PNM A;  1H8H G;  4GKJ O;  3CCQ V;  4IYH A;  1N0J A;  5LYJ A;  2JVD A;  1FFX B;  3CPW U;  2GUZ B;  2YDE A;  2R9R B;  3LNN A;  1RM1 B;  3JAT A;  4J42 A;  4YJ2 B;  4DR7 B;  1E1Q G;  4YJ3 A;  5LXT B;  4YY3 O;  5FLX N;  3ZHU A;  2YS8 A;  3L70 H;  1ZUQ A;  3EFF K;  1UPG A;  5J2U B;  2YIA A;  3IAY A;  2BCC H;  5L3F A;  2P90 A;  2WSS G;  5IY5 B;  3O9O A;  2ZR3 A;  2QWQ B;  4I50 A;  5LBQ A;  2RMK B;  4AQY B;  4PD4 F;  4FJC C;  1FFX A;  1G4Y B;  4B3M B;  1S76 D;  4BAY A;  4YJ2 A;  3OEH G;  4Z1V A;  2H94 A;  1Q6U A;  1XOU A;  1Q6I A;  1XEQ A;  4DR7 O;  3E86 A;  3O65 A;  2XAH A;  4LNU B;  4HBN A;  4ZKI A;  1YJN V;  1H2K A;  5J2U A;  3H1I H;  1AR5 A;  5JWP A;  3CC2 V;  3N2G B;  4AQY O;  3N27 A;  2YIB D;  4LWS A;  2EZP A;  1D2D A;  3K9A A;  4B3M O;  1V54 B;  2CGO A;  1TUB B;  1OCZ C;  3K57 A;  1WA8 B;  3P3N A;  2A06 H;  4LNU A;  1M57 B;  4JYA B;  2DE0 X;  1SZX A;  1URF A;  3KCY A;  3CRQ A;  1YDX A;  4CC6 A;  2HHH B;  1D5N A;  4GT1 A;  2EIL C;  1QCE A;  2D2C B;  1M4U A;  4X1K A;  1W2B U;  4BW5 A;  3K5M A;  2DW4 A;  1IX9 A;  3ZN1 A;  5FL7 G;  5KA5 A;  2B1G A;  4JYA O;  5JJN B;  3FB5 C;  5C93 A;  4QE9 A;  1DTO A;  2QTS A;  3AG7 A;  4XBF A;  3OAA G;  1SQB H;  3CCJ V;  1JX9 A;  2DQ0 A;  2RDC A;  2Y0P A;  3E83 A;  2CDY A;  2P4V A;  2ZR2 A;  3CS5 A;  3JAM N;  4DV5 B;  4DRX A;  3A0B Z;  3NXS A;  5EBW C;  4NXN B;  1CPY A;  4O4I A;  2NN4 A;  1ZL8 A;  2P6J A;  2BTQ B;  4OX9 B;  3CME V;  2WLI B;  2WPD G;  2HR3 A;  1DK1 A;  5KLV H;  1WAZ A;  1SF9 A;  4UV8 A;  2Q68 A;  1I5X A;  4GYC B;  4LFA B;  5LHG A;  1RPR A;  1VQ4 V;  4HAM A;  3VQV A;  2BSK A;  1KBH A;  4DV5 O;  2QKC A;  2MK3 A;  3T1H B;  2QE7 G;  2HVK C;  1OCZ B;  3SYO A;  4NXN O;  3JAR B;  3OEE G;  1ROP A;  4LF7 B;  1M5I A;  4YHH O;  3HKC B;  2BTQ A;  2WLI A;  4OX9 O;  1K5Q A;  1PP9 H;  1QNM A;  1H2G A;  4KFM A;  1BSM A;  3NR7 A;  3AG4 C;  4LFA O;  3ZX6 A;  2RQ6 A;  4NTX A;  2WA3 A;  3UQ8 A;  4QIW F;  5LHI A;  4MVO A;  5KX5 A;  3T1H O;  3E2E A;  2G38 A;  5BXZ A;  1VQ9 V;  1YTF D;  4JI0 B;  4MTO A;  4DR2 B;  4FFB B;  4B08 A;  1H38 A;  3P3P A;  3G67 A;  5J9P C;  1JMK C;  4LF7 O;  3DSQ A;  1NKD A;  1R3I C;  2ILM A;  5JJE B;  4K35 A;  2QWP B;  3LDC A;  2QSA A;  3SPG A;  3ZHS A;  1H2L A;  3B40 A;  5HFL A;  4O4H B;  3P32 A;  1JQ0 A;  4G2K A;  4UXN A;  4NKG B;  4I7Z B;  4ZIB A;  4J10 A;  1FAF A;  2UXC B;  3FYI B;  2ZXW C;  3C90 A;  4JI1 B;  2QA4 V;  2P67 A;  4JI0 O;  4DR2 O;  2A9H A;  1WP8 A;  4I0X B;  2K9P A;  4KHP B;  4JZG A;  1KB9 F;  2IBZ H;  1P84 F;  1N32 B;  3CEI A;  3JAS B;  5JVD A;  1Q90 D;  4UCU A;  3D8C A;  2ZQM A;  3FD9 A;  1AI6 A;  1FXH A;  5JH7 A;  3RFR A;  5F2V O;  3E35 A;  3N2K B;  1K92 A;  2ZIO A;  2UXC O;  4JI3 B;  4Q20 A;  1RFY A;  2F95 B;  4J7J A;  2JDI G;  3SR2 C;  3B2E E;  4I0X A;  4BW9 A;  2M6Y A;  2YSU B;  3BVO A;  4KHP O;  1N0N A;  2DJV A;  2PGG A;  4R6Z A;  1N32 O;  2GV9 A;  4FM1 A;  5IJ0 B;  2CH7 A;  1ZLZ A;  4CS2 A;  1AJQ A;  2OT5 A;  3SYA A;  5LHH A;  1VQ8 V;  3MHS C;  3FAV A;  5BZB A;  2QEX V;  3ZN0 A;  4KXR A;  4JI3 O;  1HNZ B;  4DV6 B;  4DV0 O;  3ABM C;  4GZR B;  1KP2 A;  2EJR A;  2R72 A;  1AI5 A;  3JAK A;  2VWJ A;  4LFC O;  4DV2 B;  1AB3 A;  3OMN B;  1XHX A;  5C8Y A;  1YI2 V;  3FB7 C;  2XAJ A;  4JAV A;  5EC1 C;  4RQE A;  3WG7 C;  4RUF A;  1FD9 A;  2LQT A;  4O2A B;  3K04 A;  4JI7 B;  4DYL A;  3B8N A;  3BY6 A;  5BR8 B;  2ZXW B;  3ZS8 C;  1HNZ O;  4DV6 O;  4TV9 A;  3QO5 A;  4MT8 A;  4WFA V;  1L0N H;  4O2B B;  2A0L A;  3CRC A;  3GWK C;  4DV2 O;  2Z5U A;  5GON B;  2YXH A;  4JYC A;  4X1I A;  1G8M A;  1X4T A;  3ZIA G;  1BGY H;  1H2S B;  2B5U A;  4G27 B;  2Y4T A;  5KHJ A;  1K4C C;  3JAL B;  2OYQ A;  3EXA A;  1TAE A;  5BR8 O;  3ZMT A;  3X2Q C;  1JR9 A;  1QBZ A;  1XNR B;  1PKX A;  2IU0 A;  4O2B A;  2DQ3 A;  3STL C;  1R6K A;  3T4Z A;  3TXS A;  2LW7 A;  4PI0 A;  3G4S V;  4D7S A;  4J41 A;  1Y6X A;  4DO2 A;  4JI5 B;  2HLD G;  1AR1 B;  1K97 A;  1TA8 A;  5IWA B;  1SES A;  2QKS A;  4TQF A;  1XNR O;  3ABM B;  4QJF B;  4G28 B;  2KB1 A;  5TIS Z;  4R8C A;  4DR5 B;  2W0F C;  1I0H A;  1BMF G;  1XHZ A;  2QWO B;  2JJ2 G;  1ZTE A;  2CE4 A;  2L35 A;  4H44 B;  2Y48 A;  5JJJ B;  4FM2 A;  2B9Z A;  4MW8 A;  3D36 C;  3WG7 B;  1GAX A;  4WFF A;  4JI5 O;  1MA1 A;  5K1X A;  4QNH B;  4PDL A;  1N4C A;  1OCC C;  3BA9 A;  4TV8 B;  4KP4 A;  3ZJZ A;  3DXR B;  3U0Z A;  4UCO A;  5IWA O;  4CS4 A;  5LA6 A;  1ZSP A;  4DR5 O;  1LR1 A;  3ICX A;  4LCU C;  1EN6 A;  4X9Q A;  1I94 B;  1VQL V;  5CA1 B;  5DEC A;  2VQF B;  2WLN A;  3APO A;  4ABM A;  4AIL C;  2Q6A A;  5IDJ A;  3MDS A;  3SYC A;  3W7T A;  3E22 B;  3ZCC A;  5L3B A;  1GH6 A;  3RVY A;  2XAG A;  1NTM H;  1X59 A;  1S5J A;  4JGS A;  5L3G A;  3X2Q B;  4JI8 O;  5J2T B;  3KZI Z;  1F23 A;  3ETG A;  2N05 A;  1BCC H;  4X1Y A;  1S77 D;  3ZRV A;  3OE7 G;  1I94 O;  3ABL C;  1EN5 A;  2VQF O;  3ZMS A;  3CCL V;  2F66 C;  1AP5 A;  3RYH A;  1XQ8 A;  2Q5Z A;  2LO1 A;  2R9I A;  3UCS C;  4JPR A;  4F6E A;  1K3E A;  1GN4 A;  1XUQ A;  4MVS A;  5CB4 B;  3LSQ A;  2V7Q G;  4EB6 B;  3A8T A;  1BL8 A;  2ZNJ A;  2DMX A;  1UJW B;  2RCV A;  1SQF A;  5IYB O;  3JD4 A;  3L74 H;  1Y74 B;  4EKW A;  4I55 B;  2AXT Z;  2RNB A;  1OCO B;  3K0G A;  4GX1 A;  5EBM C;  5KMG B;  2B1I A;  2RN9 A;  2IJK A;  1IBL B;  3LNM B;  2IU3 A;  3HKE A;  5LL6 Y;  2GSM B;  2D3O W;  3RYC B;  2GHY A;  3QNE A;  4NXM B;  3S3W A;  4UCV A;  1OCC B;  4F4L A;  4EEQ A;  3CJH A;  1L1F A;  2DYS B;  3K06 A;  3R66 A;  1CXZ B;  5LYJ B;  1SQV H;  1Y74 A;  1DLB A;  3Q4H A;  1DF4 A;  4DV7 B;  4IIJ A;  1H2M A;  2W6J G;  1Q6H A;  4YJ3 B;  2XND G;  2N04 A;  4FIP C;  1BE3 H;  2YI8 A;  1SS3 A;  2PI4 A;  2CTP A;  3I55 V;  2OWO A;  1M56 B;  4NXM O;  1B04 A;  2DWE C;  4H0L B;  3OUF A;  2P22 C;  3CB2 A;  4GUN A;  3LUT B;  1YVW A;  4RUE A;  1K9M W;  1KEC A;  4I50 B;  2LGW A;  3SDL A;  2YIB A;  2A7W A;  5EIB D;  4X62 B;  4JI6 B;  1YJ9 V;  1F7Y A;  4MTX A;  3ABL B;  4LF8 B;  5GW7 A;  5EYP A;  2ETN A;  1QLE C;  1KMI Z;  1FXV A;  1B06 A;  3QO8 A;  2WLJ A;  3OFN G;  4PA7 A;  2UXD B;  1QVF U;  3RYI B;  1LUV A;  4I4T A;  4PDR A;  3CSX A;  3SYQ A;  1GN2 A;  3RT3 C;  4LWS B;  4FLV A;  1FS0 G;  5LP6 C;  1YCI A;  4LC1 A;  2LP7 A;  4X62 O;  4JI6 O;  3ZHT A;  5H6Q A;  1YZB A;  4LF8 O;  1US6 A;  4BIO A;  3I56 V;  1HP8 A;  1SKV A;  3A0H Z;  2Y4U A;  4QGP A;  3CCS V;  1MSW D;  1Z2G A;  2UU9 B;  3JCZ A;  3HKB B;  3KCX A;  1HNX B;  5KHG A;  3CCU V;  1K4D C;  2UXD O;  4GX2 A;  3RYI A;  2BE3 A;  2YC0 A;  1OCR C;  3B8M A;  2AGA A;  3QTC A;  2EIM C;  3F7V C;  2EIJ C;  4X1K B;  4TSF G;  1W59 A;  1KQS U;  1QQC A;  4B7E A;  4U3J A;  2QDO A;  3FYE B;  4BR6 A;  2F23 A;  2UU9 O;  1YF2 A;  3HKB A;  1JJ2 U;  3PN1 A;  2QWN B;  3WB1 A;  4MVQ A;  5IJ9 A;  1HNX O;  2QGN A;  4WFG A;  1KYO F;  1V55 C;  3BHP A;  4PEL A;  5KUK A;  1NVP D;  3W7X A;  4TT3 G;  2WLM A;  4GX0 A;  1TVK B;  4TQD A;  3G80 A;  3CCE V;  1YIJ V;  1K34 A;  3S3X A;  2ITC C;  1NTZ H;  4IHJ A;  2WA4 A;  3JSL A;  5H6R A;  5B66 Z;  2ITD C;  5DN6 G;  2V4D A;  4DRX B;  2DN9 A;  4E2L A;  1L0L H;  1YTF B;  4O4I B;  1Q86 W;  1ZL8 B;  4CC5 A;  1QLE B;  4FLX A;  2DWD C;  2IM9 A;  2F43 G;  1LUW A;  1GO3 F;  3RYF A;  4YXW G;  1ARO P;  2ATK C;  2HHH O;  5H9C A;  1TVK A;  4I5S A;  1VAR A;  4NVP A;  3JAW A;  3OD4 A;  1J95 A;  3HKD A;  2BSK B;  2YIC A;  5K1P A;  4MW3 A;  3R65 A;  3K58 A;  2MW2 B;  1TUE B;  1XMO B;  2X6B A;  4PA9 A;  4O4J B;  5BMV B;  3ZHR A;  3RVZ A;  1KUQ A;  3MD0 A;  1MOF A;  4FLZ A;  1WPX A;  2P7T C;  3TK1 A;  4J9Y B;  4FZ1 A;  2FML A;  4ASU G;  3UO3 A;  1OCR B;  5AG2 A;  4YIP A;  2EIM B;  4W4L A;  5LP6 A;  2Q73 A;  2ADP A;  2EIJ B;  5KX5 B;  3TCU A;  3I5D A;  1XMO O;  2WLK A;  4O4J A;  5E1A C;  5BMV A;  1MZF A;  1YJW V;  3CHX A;  4FLT A;  4J7Z A;  3OT7 A;  1XNQ B;  4MVZ A;  2IJJ A;  4MSW C;  1N8R W;  3CCM V;  3OR7 C;  2EIL B;  2Q9L A;  1RPO A;  2UXX A;  3L73 H;  1P7G A;  2E3C A;  1GK9 A;  2OTJ V;  3OMI B;  4MTG A;  4PV1 B;  2QM8 A;  5CBH A;  3K5L A;  1KC8 W;  2QM4 A;  1Y4M A;  3CC7 V;  2KKW A;  2EIK C;  3VQX A;  1PL0 A;  4MS2 A;  1XNQ O;  1XL4 A;  2YUA A;  4NB5 A;  5JVD B;  1MG1 A;  1RSO A;  1KKD A;  1Q81 W;  3CRM A;  3UM7 A;  5JH7 B;  1BT8 A;  5IYZ B;  3H01 A;  3ABK C;  3QVN A;  3W7W A;  1IBM B;  1R73 A;  4OPA A;  5JCO C;  3SJA C;  3AK1 A;  1MAB G;  4X64 B;  2Z3Y A;  4LFB B;  2JS3 A;  3GVM A;  1VQ7 V;  3IC9 A;  2AHY A;  2CH7 B;  1WB7 A;  3OTO B;  3SPI A;  3DTU B;  2AHZ A;  3T4D A;  5IYZ A;  2BOB C;  3ZRX A;  3FAV B;  1S3J A;  1H8E G;  4WFH A;  1XRE A;  3ZRW B;  2EJ7 A;  4UVB A;  1GRJ A;  4JI1 O;  2W0X A;  4DV3 B;  4X64 O;  2IH1 C;  2JGU A;  4K3A A;  4FLU A;  4LFB O;  3CXH F;  2IJI A;  3JAK B;  2DOS A;  4GKK B;  3M7M X;  4P30 A;  4R7C A;  2ADQ B;  3OTO O;  4BWA A;  5C8Y B;  3AG4 B;  1K7D A;  1XI1 A;  3IJ4 A;  2IW5 A;  3GB7 C;  3ZRW A;  4RO2 A;  1MZE A;  3ZRS A;  3AG2 C;  1WJZ A;  4RQF A;  4Q6G A;  4L8J A;  4DV3 O;  4TV9 B;  5L3D A;  4YIO A;  3BFR A;  1EZV H;  3FB6 C;  4XDJ A;  1ZWI C;  2EIK B;  4GKK O;  2Q0A A;  4WCE V;  4X1I B;  2PYL A;  3DC6 A;  3FFQ A;  3L75 H;  4LF9 B;  4DR4 B;  1VQ6 V;  4ZHQ A;  4J9Z B;  5CBG A;  5B1A C;  2CUG A;  1XMQ B;  5B1B C;  2ZE8 A;  1QR9 A;  3JSN A;  4LF6 B;  5EZY A;  1Z5V A;  3F7Y C;  3BPZ A;  3JCU Z;  4N21 A;  1VQN V;  3ASN C;  2HVJ C;  2O57 A;  1I5Y A;  2M7W A;  1WP7 A;  1VQK V;  4FFK A;  4FMT A;  4F6R B;  1G1X B; 
#chains in the Genus database with same CATH homology
 5EK0 A;  4MVS A;  5HFM A;  1NR7 A;  3G6E V;  3LSQ A;  4P2Z A;  2V7Q G;  5IYC O;  3STZ C;  3QO7 A;  3CC2 V;  4JTD B;  1BL8 A;  1UJW B;  4WFE A;  1VQM V;  2QM7 A;  2EZP A;  3K9A A;  4PA3 A;  1V54 B;  1M90 W;  5IYB O;  3ETD A;  3JD4 A;  3LDE A;  1GM8 A;  4PDV A;  4EKW A;  5EBL C;  1OCZ C;  1QVG U;  1OCO B;  3OR6 C;  3K0G A;  4GX1 A;  1M57 B;  5EBM C;  5KA6 A;  1JVM A;  2B1I A;  2X0L A;  2IJK A;  1EBO A;  3LNM B;  2IU3 A;  2GSM B;  3K0D A;  3CXC U;  2D3O W;  5LGN A;  1YSC A;  1Q7Y W;  4GT1 A;  2GHY A;  3QNE A;  2EIL C;  1QCE A;  2XAQ A;  1OCC B;  4F4L A;  1L1F A;  2DYS B;  3K06 A;  4TWK A;  3AG2 B;  1W2B U;  2HFE C;  4BW5 A;  2JEX A;  2DW4 A;  1DLB A;  3ZN1 A;  2EBO A;  5FL7 G;  5KA5 A;  5L3E A;  2B1G A;  1DF4 A;  1FXK B;  2XAS A;  2W6J G;  3FB5 C;  4PA4 A;  5C93 A;  5LGU A;  4QE9 A;  1DTO A;  1YHQ V;  1VQ5 V;  2XND G;  3UKM A;  1K33 A;  2EZO A;  4FIP C;  4XBF A;  3CP1 A;  3ASO C;  3OAA G;  2PI4 A;  2JJ1 G;  3CCJ V;  1JX9 A;  3I55 V;  5B3S C;  1M56 B;  2DQ0 A;  1F51 A;  3RW0 A;  3E8G A;  1CP9 A;  3E83 A;  2DWE C;  3BEH A;  1BHB A;  3OUF A;  1SET A;  2ZDI A;  1FFT B;  3LUT B;  2ZR2 A;  4PA6 A;  5EC2 C;  5B1A B;  1Y66 A;  4ZBM A;  4RUE A;  5B1B B;  1K9M W;  1KEC A;  3T1C A;  1K8A W;  1PD3 A;  2ZDI C;  3VBB A;  1YJ9 V;  3NXS A;  4MTX A;  5EBW C;  1CPY A;  1FXK A;  3ABL B;  1GKF A;  5GW7 A;  2WLH A;  2P6J A;  2YEV B;  2BOC C;  2Q67 A;  3CME V;  2WLI B;  2WPD G;  3CCV V;  2HR3 A;  3JD2 A;  1P7B A;  1QLE C;  3FB8 C;  4H33 A;  1FXV A;  3AG3 C;  4P9P A;  4UV8 A;  2Q68 A;  1I5X A;  3QO8 A;  3ZMZ A;  2WLJ A;  3AEI A;  3OFN G;  2V1D A;  4PA7 A;  5LHG A;  2HKO A;  1RPR A;  1VQ4 V;  3OMA B;  3B77 A;  4HAM A;  1QVF U;  4L87 A;  4XDL A;  4PDR A;  2IH3 C;  1W0J G;  2MK3 A;  3WFV A;  2QE7 G;  3SYQ A;  3FKS G;  4FPP A;  3ABK B;  3G71 V;  2HVK C;  1FS0 G;  3D3I A;  1OCZ B;  2LP7 A;  4LC1 A;  4P9O A;  3SYO A;  5H6Q A;  1GM7 A;  2PI5 A;  2YEV A;  3OEE G;  3JD1 A;  1JPX A;  1ROP A;  1JCH A;  3I56 V;  1KP3 A;  3CCS V;  3OGC C;  1MSW D;  2WLI A;  4CBC A;  5LGT A;  1KD1 W;  1K5Q A;  1QLN A;  1H2G A;  4KFM A;  3OUS A;  2HG5 C;  3JCZ A;  3IGA C;  3AG4 C;  3CCU V;  1K4D C;  2DYR C;  4GX2 A;  2WLL B;  1AI7 A;  1OCR C;  3JD3 A;  1NH2 D;  4QIW F;  3B8M A;  5LHI A;  3CCR V;  2C2A A;  4MVO A;  3VOU A;  4X88 A;  2EIM C;  3E2E A;  1RM1 C;  3F7V C;  3GWO A;  3M99 B;  1VQ9 V;  1YTF D;  2EIJ C;  4MTO A;  3OM3 B;  4TSF G;  2JIZ G;  1H38 A;  1KQS U;  4QPK A;  5J9P C;  1IXM A;  3ETE A;  1WLE A;  4LBE C;  4MVR A;  1NKD A;  1R3I C;  3FYE B;  4MVU A;  3TET A;  1R3J C;  4DXW A;  4QE7 A;  2OTL V;  4JTC B;  1JJ2 U;  3LDC A;  2K1E A;  2JK5 C;  4MVQ A;  3SPG A;  2X6A A;  1XL6 A;  4WFG A;  1K5S A;  1V55 C;  5HFL A;  4PEL A;  5B3S B;  3HB3 B;  2WLL A;  4JAS A;  4GX5 A;  3K03 A;  4TT3 G;  5IY5 C;  3P32 A;  5KUK A;  3W7X A;  1NVP D;  1JQ0 A;  4G2K A;  1M9N A;  2WLM A;  4UXN A;  1AI4 A;  4GX0 A;  2CK3 G;  3CCE V;  1YIJ V;  1K34 A;  4JF3 A;  3SJQ C;  1P4R A;  2ITC C;  3FYI B;  2X6C A;  2ZXW C;  3EHB B;  4BIZ A;  3W7S A;  5H6R A;  4KUM A;  1SRY A;  2ITD C;  2QA4 V;  2P67 A;  2A9H A;  5DN6 G;  1NH2 B;  1F4M A;  3ML0 A;  4E2L A;  3SPJ A;  5DM6 V;  5B1N A;  3SYP A;  1YIT V;  1YTF B;  1Q86 W;  1QLE B;  2DWD C;  2F43 G;  3AG3 B;  4XDK A;  1GO3 F;  4MVM A;  2X7R B;  1OHH G;  2ZQM A;  4YXW G;  1AI6 A;  1ARO P;  1FXH A;  2ATK C;  5H9C A;  3JYC A;  2H8P C;  3E35 A;  4JYB A;  1K92 A;  4I5S A;  4U7O A;  2JEU A;  4Q20 A;  4RAI A;  2JDI G;  4X8A A;  2XOK G;  1NJI W;  1J95 A;  1R3K C;  1OCO C;  5L3C A;  3ABU A;  2YSU B;  1M57 C;  1PNL A;  4MW3 A;  4LP8 A;  3KG2 A;  3R65 A;  3ASN B;  1TUE B;  4R6Z A;  2X6B A;  4PA9 A;  1E79 G;  3IC7 A;  3RVZ A;  3MD0 A;  1AJP A;  1AJQ A;  4HYO A;  2OT5 A;  3SYA A;  1MOF A;  3CYO A;  5LHH A;  1WPX A;  2P7T C;  3TK1 A;  4J9Y B;  3AG1 C;  1VQ8 V;  3MHS C;  2DYR B;  3LDD A;  5BZB A;  1EZJ A;  4ASU G;  2QEX V;  1OCR B;  3ZN0 A;  1AJN A;  2DYS C;  3E89 A;  2EIM B;  3DGE A;  1ORQ C;  2HJF C;  3ABM C;  2EIJ B;  4UVA A;  1KP2 A;  1EFR G;  2XAF A;  2EJR A;  3TCU A;  1AI5 A;  3CMA V;  3OW2 U;  2WLK A;  5E1A C;  4JTA B;  1YJW V;  3OMN B;  4HZ3 A;  1YI2 V;  1DF5 A;  1W0K G;  2XAJ A;  3FB7 C;  4JAV A;  5EC1 C;  1E1R G;  1M56 C;  1VQP V;  4RQE A;  3WG7 C;  3F5W C;  2IJJ A;  1F4N A;  4MVZ A;  4RUF A;  5CA3 A;  4MSW C;  1NR1 A;  3K04 A;  4PDM A;  1N8R W;  3CCM V;  3OR7 C;  2EIL B;  3B8N A;  1NBM G;  3BY6 A;  1GTO A;  1SER A;  2NLJ C;  2ZXW B;  5IYD O;  5KUM A;  1RPO A;  2UXX A;  2OCC C;  3PJS K;  3E8B A;  2Q69 A;  3QO5 A;  2EIN C;  3T2M A;  4MT8 A;  1THZ A;  4WFA V;  1GK9 A;  4BIU A;  2OTJ V;  2A0L A;  4CZZ A;  3HPL C;  3OMI B;  4MTG A;  3CC4 V;  2QM8 A;  5CBH A;  2Z5U A;  4JYC A;  1KC8 W;  3CD6 V;  1G8M A;  2A79 B;  1Y4M A;  4Z1M G;  3CC7 V;  4UUJ C;  2EIK C;  3ZIA G;  1S0V A;  5CBF A;  1VQO V;  1PL0 A;  1CEZ A;  2LFR A;  4FK5 C;  4MS2 A;  2B5U A;  1XL4 A;  4G27 B;  3ASO B;  3E8H A;  1KKD A;  1K4C C;  1MG1 A;  3K08 A;  3SPH A;  1Q81 W;  3UM7 A;  2ZD9 A;  3K3W A;  4N23 A;  3H01 A;  3ZMT A;  3ABK C;  3X2Q C;  4GCZ A;  3W7W A;  1QBZ A;  1R73 A;  1PKX A;  2IU0 A;  2DQ3 A;  4X89 A;  4WFB V;  2Y69 C;  1MAB G;  3ABT A;  1S72 V;  1QR8 A;  1B6Q A;  2NNU A;  1R6K A;  2Z3Y A;  3STL C;  3ZMV A;  1LNQ A;  1HWY A;  1VQ7 V;  3T4Z A;  1R3L C;  4JAU A;  4WF9 V;  2AHY A;  3IFX A;  4OXS A;  3G4S V;  1SZT A;  3AG1 B;  1Q82 W;  3SPI A;  3ZMU A;  4DO2 A;  2HLD G;  3A0R A;  4I9W A;  3DTU B;  2AHZ A;  3T4D A;  2WWW A;  2BOB C;  2LFS A;  3ZRX A;  1AR1 B;  1K97 A;  1S3J A;  1H8E G;  4WFH A;  1SES A;  5CN0 A;  2QKS A;  1ENV A;  3ZRW B;  1V54 C;  4UVB A;  3ABM B;  4QJF B;  2UXN A;  4G28 B;  2KB1 A;  1NVP B;  3SPC A;  4R8C A;  1COW G;  5CMU A;  1NQT A;  2W0F C;  2IH1 C;  1BMF G;  1OZ0 A;  2JJ2 G;  3D36 A;  1K73 W;  5B1O A;  2Y48 A;  3MHH C;  2IJI A;  1R6N A;  4UV9 A;  4MW8 A;  1GM9 A;  1PNM A;  1H8H G;  4P30 A;  4R7C A;  3WG7 B;  3K79 A;  4WFF A;  3AG4 B;  3CCQ V;  1K7D A;  4UVC A;  4QNH B;  4PDL A;  1OCC C;  3ZJZ A;  1BHA A;  4KP4 A;  2FTK A;  2IW5 A;  4H37 A;  1GMG A;  3GB7 C;  3ZRW A;  4RO2 A;  2OCC B;  3ZRS A;  3AG2 C;  3CPW U;  4RQF A;  3W7U A;  2EIN B;  2R9R B;  1RM1 B;  4LCU C;  1VQL V;  5L3D A;  1E1Q G;  2WLN A;  1M1K W;  1FXK C;  2QTO A;  3LSS A;  4QPJ A;  4U7N A;  3FB6 C;  1PNK A;  2Q6A A;  4XDJ A;  1ZWI C;  2EIK B;  5IDJ A;  3EFF K;  3P30 A;  3SYC A;  4WCE V;  3W7T A;  2W6I G;  2WAM A;  3ZCC A;  5L3B A;  3RVY A;  5L3F A;  2P90 A;  2WSS G;  2XAG A;  1V55 B;  4MTF A;  5IY5 B;  2ZR3 A;  3RBZ A;  1VQ6 V;  5LBQ A;  4FJC C;  4J9Z B;  4JGS A;  1G4Y B;  5L3G A;  3X2Q B;  5CBG A;  3JD0 A;  5B1A C;  1F23 A;  3ETG A;  4R50 A;  5B1B C;  1S76 D;  1QR9 A;  4BAY A;  3OEH G;  1S77 D;  3E8F A;  3ZRV A;  2H94 A;  3F7Y C;  3OE7 G;  1S5H C;  2Y69 B;  2IJH A;  4N21 A;  1VQN V;  3ASN C;  3ABL C;  2HVJ C;  3E86 A;  3ZMS A;  2XAH A;  3CCL V;  1I5Y A;  2M7W A;  2R9I A;  1VQK V;  4JPR A;  1K3E A;  4ZKI A;  1YJN V;  4FMT A;  1JOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...