4PA6A

Structure of navms pore and c-terminal domain crystallised in the presence of channel blocking compound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 29
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa6A00
2DYSC 4PDLA 5B1AC 2KB1A 2ATKC 2X6CA 1LNQA 3UM7A 4ZBMA 5CBGA 3ASNC 5BZBA 2QTOA 2Q69A 4HZ3A 3K04A 5EBWC 4JTDB 4MSWC 4MTFA 3F5WC 4QE7A 4WFGA 3FB7C 4PDRA 4QE9A 3ABKC 3K0DA 3ABLC 3IFXA 4GX1A 4JTAB 4R6ZA 3OUSA 3FB5C 3ASOC 4J9YB 4UUJC 4DXWA 3SYOA 4J9ZB 2WLJA 4EKWA 3F7VC 2AHZA 3LDEA 3E8HA 2A79B 3R65A 3RBZA 3E89A 2OCCC 5J9PC 4MTOA 2ZXWC 4LP8A 3SYPA 3ZJZA 2Y69C 2Q68A 3SYCA 1BL8A 4GX5A 4JTCB 3T1CA 1OCOC 2DYRC 2WLNA 5EBMC 1KKDA 1J95A 5B1BC 1S5HC 1R3JC 3E86A 3GB7C 3SPCA 2EILC 2WLMA 1OCRC 2X6AA 4PA4A 2QKSA 3AG2C 3E83A 3RVYA 3HPLC 1M57C 4MTGA 4TWKA 1K4DC 3LDCA 5KUKA 4RO2A 2IH1C 2HFEC 4MVQA 4X89A 3ABMC 4H33A 3OUFA 1OCZC 1R3LC 3K08A 1R3IC 5CBHA 4XDJA 4G28B 1XL6A 4MVMA 1K4CC 3STLC 2HVJC 3SJQC 4F4LA 2WLIB 2DWEC 2BOBC 2WLLB 3E8FA 2HVKC 3SPGA 4RAIA 2X6BA 3SYQA 4GX2A 2EIMC 1P7BA 1R3KC 4G27B 2H8PC 2P7TC 4KFMA 4PA3A 4P2ZA 3VOUA 4MW8A 3FB6C 4WFHA 4RUFA 4BW5A 1ZWIC 3AG4C 3E8GA 4MW3A 3LUTB 5IY5C 1G4YB 3LNMB 1JVMA 4P9PA 3OGCC 3F7YC 2NLJC 3PJSK 3T2MA 5CBFA 4XDKA 5B3SC 3KG2A 4PA6A 3OR7C 3AG1C 3TETA 4MVRA 4XDLA 4LCUC 2ZD9A 4CBCA 4MVZA 5KUMA 2Q67A 4R7CA 5EC2C 4WFFA 4MVUA 1QLEC 3EFFK 3K0GA 3OR6C 4OXSA 3LDDA 4HYOA 1V55C 2YEVA 3ZRSA 2IH3C 3T4DA 3K06A 4PDVA 2WLLA 2WLIA 3SYAA 4PA7A 2HJFC 2WLKA 3WG7C 5E1AC 4MVSA 2AHYA 4R50A 5EBLC 2EIKC 2W0FC 4P9OA 5EC1C 5EK0A 1ORQC 3RVZA 3TCUA 1M56C 2K1EA 4H37A 4P30A 3E8BA 4GX0A 4I9WA 2ITDC 4WFEA 3SPIA 2R9RB 1V54C 2Q6AA 4R8CA 3SPJA 3UKMA 3X2QC 2HG5C 4LBEC 4RUEA 3AG3C 3K03A 2EIJC 4QNHB 2EINC 3IGAC 4PDMA 2A0LA 4MVOA 4X8AA 4PA9A 3SPHA 2DWDC 2JK5C 3RW0A 3BEHA 3JYCA 4X88A 2BOCC 2WLHA 3FB8C 3T4ZA 2ITCC 4MS2A 3STZC 1XL4A 2A9HA 1OCCC
chains in the Genus database with same CATH superfamily
2JGUA 3W7WA 5B1AC 2GTAA 1M5IA 4O2BA 3CEIA 2HEPA 2QKAA 2YSUB 3DTUB 2CGOA 2B9ZA 2LW1A 4WFGA 2JEXA 3HB3B 4R6ZA 5H6QA 3ZHQA 3RWRD 3LDEA 1Q81W 4TQDA 1EZVH 1SZTA 5B1AB 2HHHO 1BCCH 4TT3G 4LP8A 1YXBA 3T1CA 1ROPA 4DYLA 2P22C 5AG2A 4D7SA 5C93A 1UFIA 2P5OA 2BCCH 3RVYA 3TK1A 3CJHB 4DUZB 2EULA 3JAKB 3OM3B 3KKYA 3VQXA 4TUYA 1I7FA 1GN3A 2LGWA 4LF5B 4GX2A 3UO2A 3HKDB 1VQ9V 4LF7O 1QCEA 4FLUA 3O9OA 3OMNB 4JI0O 4P2ZA 2JS5A 1SC5B 3JARB 4X1YB 4FLWA 3ZIAG 4RQEA 2B5UA 3JSNA 1M4UA 3AG1C 2YXLA 4XDLA 3DGEA 3ZN0A 5KUMA 1OCOB 4GKJO 4BIUA 2JVDA 2YDEA 2EILB 5L3FA 4OX9B 4HYOA 4DUYB 4FM1A 5KX5B 3ETGA 2LW7A 1JX9A 3OE7G 3U0ZA 4UCVA 4YHHO 3CCJV 2F4VO 4X1IB 1Q5OA 3AG1B 5LYJA 2WLKA 2UUAO 1E79G 2EIKC 3KCYA 4TV9B 3MHHC 4GX0A 1GN4A 4CC6A 3GWKC 2GDSA 4X9QA 5CA0B 2A0LA 1FXKB 1VMGA 4JZ2A 3RW0A 1Q6HA 4AHCA 4DV7O 3B40A 4MW8A 1AILA 2CDYA 2XAGA 1RM1B 2L6LA 3K04A 5EBWC 1FJGO 2R9IA 1SRYA 4QE7A 3FB7C 1N33B 1SESA 4ZOLB 2H3OA 3THOA 4DV0B 4LFBO 3M99B 3CRQA 1FS0G 2DW4A 2YIDA 5LXTB 3W7UA 3Q4HA 4DV1O 1S5HC 2YUAA 1F51A 5A2QN 1V54B 1BMFG 2QKSA 1N4CA 4JPRA 4LC1A 3APQA 2ZM6B 3SJCC 4WFBV 3BRCA 2F43G 1QLNA 2HVJC 2QA4V 1TUBB 4JI4B 3RYHB 1HW7A 3WB1A 1QVFU 1Q86W 5LHIA 1US6A 2RJZA 2Y4UA 3LUTB 2DJVA 3M8AA 3ABUA 1GTOA 1W2BU 3CC4V 1EM1A 4O4JB 3TETA 5FLXN 4KL1A 1IBKO 1QHTA 1AROP 3ZRWB 3E22B 3OR6C 1XNQB 2N74A 4UV8A 2YEVA 2WAMA 3SJBC 2JGDA 4IIJA 3KZIZ 1M57B 5KAIZ 2OIEA 4JYYA 3JALA 3J7AU 3CMEV 3JASB 4DV4B 2YIBA 3WG7C 1OCZB 5EK0A 5EC1C 4LFCB 4AI8A 1K5SA 2E5LB 3E2EA 4R8CA 1OJHA 3X2QC 1KECA 1U96A 2IM9A 3JD0A 4JI8B 1VEWA 3AG3C 1RFYA 2EIMB 3BA8A 5EYPA 4YIOA 2ARHA 2WLHA 3K79A 4X65B 4DR7B 3X2QB 2KB1A 3BY6A 1WB7A 1VQ4V 4DUZO 2DE0X 4HNAA 3MDSA 3K0DA 5LL6Y 4O4LA 5C8YA 5CA1B 4BR6A 5JQGA 2ETNA 4GX5A 4LWSA 1QQCA 2QR4A 4JI5O 3K3WA 1VQOV 4L87A 2QWRB 2YICA 3B77A 1PL4A 3ABMC 3U11A 3K5MA 2XAFA 5IYZA 1VQMV 5A9GA 2OTLV 3R66A 2PI5A 1RSOB 2CGNA 3E8FA 3SR2C 2QDOA 2ZCEA 2Y0IA 3TXQA 2QJ1A 1AP5A 3WB0A 1D5NA 1SQPH 4WFHA 5KLVH 2V1DA 1Q3EA 3JSLA 2B1IA 2BSKB 1Q82W 1JVMA 4U3JB 2UUCB 3OGCC 1N32B 4O4HA 2CTRA 5LP6C 3ZS8C 2KQXA 2Q5ZA 4MVZA 1SA0B 4B3SB 4ZIBA 5CA3A 3MD0A 2IJKA 4DR3B 1I94B 1L0NH 3CCLV 3K06A 1HNZO 4DR6O 2WLLA 3I56V 1HNXO 2KKWA 5LP6B 4FIPC 2KSDA 1XNRO 1K8AW 1N33O 4YXWG 4WFEA 1OHHG 2JS3A 1IBLO 4DR2B 4DV0O 3U10A 4NB5A 1ZL8A 1Y74B 2M7WA 3BAAA 1YHQV 3BEHA 1KYOF 2VRZA 1KMIZ 3SDLA 1X4TA 4B3RO 2LP7A 2OIGA 1B06A 5CBGA 4KHPO 3CRCA 4ZKIA 3IC7A 3C3TA 4GX1A 4W4KA 1V55B 4QPJA 3SYOA 1FFXA 4C7UA 3UT5A 1W0KG 2A79B 4X62B 5J2TA 3HKCB 4I7ZB 4I4TB 2F93B 2WLNA 4Q20A 3GB7C 1NS1A 1XOUA 4A5UB 4JI1B 5IWAO 1BZKA 5IJ9B 4MTGA 1IXBA 2IH1C 1Y4MA 1B04A 5JJJB 3MHSC 1CP9A 2X7RB 4XDJA 4GZRB 4U7NA 4DV5B 2QEXV 1P4RA 5IYDO 1XNQO 4O2BB 3SYQA 3T1HO 3CCEV 4U3FH 1DTOA 4ASUG 2H8PC 4DV4O 1SKVA 2RMKB 4BWAA 1ZUQA 4DRXB 5GTIZ 4LFCO 4XBFA 1JR9A 3W7SA 1QVGU 5DN6G 3NXSA 5LOVA 2YXYA 3JAMN 3JCZA 1HWYA 1QLEC 3EFFK 1KUQA 1YJNV 4X65O 4DR7O 4FVMA 3RGBA 1CXZB 3VBBA 4IYIA 3TJTA 4EB6B 3H1HH 4TUYB 2W0FC 1O9GA 4B3MB 5EZYA 1PNKA 5D5QA 2HG5C 3A0HZ 5JH7B 4J7ZA 1YTFB 2ZIOA 3AG4B 2JRIA 5DM6V 3L70H 1GK9A 3STZC 3TGUH 2A9HA 2OCHA 2KG7A 4PDLA 2QGNA 3CRRA 4WFAV 4FLXA 1ENVA 1ZTEA 5BZBA 2Q69A 4JZGA 4B3TO 4UCUA 4LFAB 2UXXA 3OUSA 4FM0A 4NTYA 1YZBA 4HBNA 1VF7A 1PNMA 1YIJV 2M6YA 1IXMA 1G1XB 5LYJB 3CB2A 1X59A 2DOSA 5H5NA 4NXMO 2YC0A 3E83A 4CH5A 1KKCA 2UXBO 4FLYA 4TWKA 1XMQB 4JAAA 3OUFA 5CBHA 3L72H 1FXHA 1XL6A 1SF9A 4B3SO 3D36A 1YJWV 1Q7YW 5CB4A 1WPXA 4DR3O 1I94O 4LH7A 1YSCA 1K5QA 3BA9A 4EFBA 4B08A 1SERA 2CUGA 4KXRA 3ZRVA 3I5DA 3BHPA 2P7TC 4PA3A 3D3QA 1N0JA 3FB6C 1QR9A 2XAHA 4WCEV 2BE3A 3JD1A 4LF9B 2YI9A 3N2GA 3OD4A 3CPWU 2XTAA 3N2KA 4JV5O 3BCCH 4Z1VA 4X20B 4O4IB 3LDDA 5B1OA 5J2UA 1AR5A 4AILC 4PA7A 3O65A 3A8TA 3M7MX 5E1AC 2QM4A 3ZMTA 1GM8A 1SQVH 1M56C 2JEUA 1K3EA 5JJNB 3DXRA 1IURA 1GKFA 4X62O 2ZINA 3SPHA 4CC5A 4DV6B 1BS3A 1T5EA 2EZOA 1M56B 1YJ9V 1OCCC 1AP6A 4JI1O 4ZI7A 4K8XA 4HZ3A 1KD1W 1MG1A 5L3DA 1WPBA 1YEWA 3LNNA 1I5XA 5KMGA 1AI6A 4LH6A 1XI1A 3PN1A 1TGOA 2Z0AA 4J9ZB 3FAVA 1CEZA 1W59A 1V9PA 2Q73A 3CS5A 4TV8A 1GM7A 2P90A 1OCRC 3OFNG 1P84F 1TA8A 2EIJB 2XAJA 3JCUZ 5EYPB 3IAYA 3ZX6A 5FNVB 4BIOA 1QU7A 1AJQA 2CH7A 2FL4A 4HNAB 4FLTA 4K8ZA 5LGNA 4TOIA 3HKEB 4O4LB 3L71H 5C8YB 1NT2B 4IYHA 2YIAA 5B3SC 4YJ2A 2ZE7A 1BHBA 4MVRA 4UVCA 2XOKG 1YVWA 1VARA 2Q67A 4NR1A 1AB3A 2Q8VA 4WFFA 3EHBB 3B2EE 2RDCA 5KHJA 1KB9F 3SYAA 5B3SB 3B8NA 5IYZB 4JAVA 1KQSU 3G6BA 2QTSA 3K59A 2R9RB 2UXNA 3UKMA 1F7YA 2EINC 4I55A 2QM7A 4G2KA 2P6JA 3JYCA 3ZEDA 3RYFA 2AZ0A 3AG7A 5KAFZ 1KBHA 1P7GA 3K5NA 1LUVA 4UCTA 1K33A 5F2VO 2GBOA 4J7JA 1DK1A 4WBNA 2LFRA 4JTAB 1NZ6A 1BT8A 4ICGA 4UUJC 1MA1A 2LQTA 3OTOB 3H1LH 3VQVA 3L9DA 3FFQA 1MSDA 5IYCO 2E75B 4NTWA 1BL8A 2D2CB 2EIKB 2DQ3A 4QIWF 4UVAA 1NKDA 2UXDB 5B1BC 2ZR2A 3E86A 3SPCA 1OZ0A 3ZHTA 4DV2O 4LF9O 3IC9A 4J7KA 4NKGB 1ZL8B 2UXCB 1GM9A 2AW9A 4LNUA 4F4LA 4IHJA 4RAIA 4DR4B 1FAFA 4PHZA 1Y76B 5IDJA 2W0XA 4P9PA 1Q43A 3UT5B 4XDKA 2F1MA 1Q6UA 4N23A 3ABTA 4UVBA 1VQ6V 1VQLV 1M90W 3K5LA 5LMNB 2RN9A 3DC5A 4O2AA 4QPKA 2WLIA 2CTQA 2QE7G 1BQ0A 5LA6A 1K97A 3BPZA 1WNSA 3CE2A 4HAMA 2XNDG 1AR1B 1S3JA 1G6UA 3AK1A 4PDMA 4E2LA 4X8AA 3RFRA 1MABG 4K35A 3UO3A 1R1BA 1N36B 3DC6A 2ILMA 3BFRA 4YIPA 2N05A 5CMUA 2Q7EA 4Z2WA 3ABKC 4J80A 5L3EA 3J80N 3RBZA 4KP4A 2OCCC 1BSMA 3CCMV 3WG7B 2GHYA 3QTCA 3ZJZA 2PI4A 3OAAG 3JAWA 3SYCA 4EEQA 1S0VA 5KA6A 1NU1H 2AGAA 3ABKB 1QR8A 3AG3B 3QO8A 1K4DC 4FK5C 4DV3B 1WB8A 3CXHF 4W4LA 2CTPA 2PYJA 4PV1B 3K57A 5FPRA 4JYCA 1WLEA 3CCVV 1YITV 4LF5O 2UUBB 2ZDIA 4JI2B 2Q7GA 4J11A 4QJFB 1YF2A 5CN0A 3CJHA 3OT7A 4R7CA 2XT9A 3D36C 4OX9O 1PD3A 4DUYO 5GONA 1N34B 4YJ3B 3G80A 2WA3A 5BMVB 1MNGA 5JVDB 2DN9A 4X1KB 1H2SB 1KC8W 4FFBB 4CH6A 3ABMB 3G67A 1S5LZ 3OGIB 5LGTA 3NR7A 1B6QA 2R70A 3JATA 2Q4PA 5CB4B 3JARA 4RQFA 2QWNB 2IU0A 4X1YA 1ZLZA 3K03A 4QNHB 5LHGA 2Y48A 1SETA 2OWOA 5L3GA 2DWDC 1RPRA 2JK5C 2EZPA 2BOCC 2IBZH 4JI3B 2UXDO 4MS2A 1XL4A 2P4VA 3ASNC 4JASA 3N2KB 1PPJH 4GKKB 1NVPB 1NQTA 4X1IA 2Q0AA 1ZAUA 2WLJA 3WFVA 4EKWA 1IBMB 1SQQH 4DR4O 1MZFA 1AR4A 3CYOA 1Y67A 5CA0A 1FXKA 1I08A 5DEDA 1URFA 2DYRC 3OMIB 1K9MW 1JFFB 1H2KA 2WSSG 4BIZA 1YI2V 3DXRB 1RPOA 1EZJA 3AG2C 5ITZA 4H44B 4PI2A 3H1IH 4NYKA 1QBZA 2ZM6O 1NH2B 1OV9A 3SJQC 5LMNO 4LF8B 3HKBB 5JJEB 4JI4O 4JI7B 3SPGA 1K7DA 2EJRA 2X6BA 5LMUB 1KP3A 3D8CA 3H01A 3A0BZ 4BAYA 1AI5A 3VQWA 2RQ6A 1XBLA 4RUFA 3QF7A 2W6JG 3W7TA 3ETEA 5LXTA 1PM9A 3FAVB 5IT9N 2N04A 4PA6A 3OMAB 3B09A 2FMLA 1JJOA 4TV8B 5KA5A 3VQYA 2GUZA 3T4DA 1TUBA 2A06H 1GH6A 3A0RA 4R50A 1WAZA 3CRAA 1HP8A 4PELA 5BR8B 4FZ0A 2P4KA 1BQZA 1LR1A 2OYQA 2E5LO 1FD9A 3C90A 3SPJA 1H2MA 4JI8O 4RUEA 3SGIA 4NTXA 1D2DA 3CCRV 1WP8A 3OEEG 4O4JA 5E79Z 4PA9A 1BE3H 2ZE6A 1VF6A 1GRJA 3E22A 3CSXA 4LF4B 2IU3A 1DGSA 4YJ2B 1O9HA 3H1KH 4WF9V 4F6RA 1KP2A 3F5WC 3JASA 1QLEB 3IFXA 3F7VC 5J9PC 1SQXH 2ZXWC 3WB2A 2UUBO 1IVSA 3FYIB 1VQKV 2X6AA 4PA4A 2MW2B 4JF3A 3DSQA 5KUKA 1NJIW 4I0XA 1GAXA 2CAZC 3RYFB 2O57A 1ZX3A 2X0LA 1M93A 1L1FA 1N34O 1EN6A 2HVKC 1KU9A 4UCSA 4JGSA 5CA1A 3ZHVA 1R3KC 3ZMZA 4JI0B 4I9QA 3VOUA 2VQEB 4BW5A 1XHXA 1ZWIC 1YTFD 1GN2A 2E76B 4MTXA 1M9NA 4ZHQA 5KHGA 2UUCO 1N32O 3T2MA 4CS4A 3S3XA 4D6TH 1Q8IA 2CTWA 4GKJB 2G38A 4MVUA 4OXSA 5KHHA 3EVKA 1K73W 1GMGA 4U7OA 2XUMA 1N0NA 2F4VB 5HFLA 4MVSA 4FMTA 4CH3A 1F23A 4LF6B 3FD9A 1EFRG 4IHJB 5L3BA 4U3JA 4DR2O 3CCQV 5IJ0A 1IBMO 2QM8A 3FX7A 4JYAB 3Q4HB 4B7KA 5LHHA 3B8MA 5EIBD 2ZE5A 5EBMC 4FM2A 5IYBO 4ABMA 2DYSC 1S72V 2FB5A 1F4NA 1LNQA 2LO1A 4TQFA 1UPGA 5LBQA 4JTDB 1MZEA 2ZQMA 4UXNA 4K3AA 3FB5C 4O2AB 4JAUA 4X66B 3H1JH 3E8HA 4JI7O 1ZSPA 4LFBB 3E89A 2IJIA 3QNEA 2VWKA 4GYCB 5GTHZ 3GVMA 4OGQB 4DK1A 1DF5A 1KKDA 2BTQA 2E74B 2ADQB 1WJZA 3CRMA 3RYCA 2C2AA 3G6EV 2HFEC 4MVQA 1IDSA 5BY1A 5H9CA 1LUWA 2YEVB 4DV5O 2JGDB 4IIJB 1H2GA 3STLC 4D7TA 2Y0PA 1OCCB 2DMXA 3G71V 3JALB 1G8MA 1BGYH 2F66C 3HKCA 4BW9A 5IY5C 1TUEB 4CH4A 4UCOA 3ZMSA 1HR0B 2WPDG 2XAQA 5IJ9A 2D3OW 3K0GA 1OCRB 4QGPA 2VS0A 1XQ8A 4LF4O 2ZDIC 2UU9B 2YIBD 3APOA 4B3MO 3QG5A 3RVZA 3TCUA 1WA8A 5KHKA 3A2FA 4H37A 5TISZ 2A7WA 3ZHSA 2HP8A 4CS2A 4DRXA 1K34A 2F23A 3T1YB 2QWOB 5JQGB 4LWSB 1FPOA 4GCZA 2FTKA 1WN7A 1PP9H 1S77D 4GLXA 1A32A 3I55V 3K5OA 1EN4A 3H9VA 1VP7A 1YCIA 2WA4A 2P06A 3CC2V 2K9PA 1SZXA 3RYIA 1RP3B 4EB6A 4LFAO 5GONB 4UB8Z 4DXWA 1H8EG 4H0LB 1WP7A 5JH7A 2RCVA 1BHAA 2CK3G 4JTCB 1OCOC 1J95A 4JI5B 3RT3C 2VQEO 2ZE8A 3JATB 2EILC 4O4HB 2YXHA 2EINB 2R72A 2YI8A 1XMQO 1R6NA 1L8DA 3FYEB 1E1QG 4L8JA 1DLBA 4K0KB 2HLDG 1JPXA 4DR1B 3P3NA 2WLLB 2L35A 4PI0A 3FKSG 1EN5A 1FXKC 1H8HG 3IJ4A 3C3SA 1VQ5V 1PKXA 4AQYB 2HJDA 1AI7A 4LF6O 3PJSK 3AK3A 3KG2A 1XREA 1RM1C 3ZHRA 4IGGA 2CE4A 2QKCA 4JYAO 5B1BB 4FPPA 4FLZA 1JMKC 4NXNB 3S3WA 4PDVA 5ITZB 1HNZB 4DR6B 1NR7A 1HNXB 4EFEA 4PD4F 1XNRB 2Q7HA 1N8RW 1FFXB 2K1EA 2QWPB 3EXAA 4I9WA 3BABA 4PJ0Z 1TVKA 1V54C 5J2TB 4X66O 1IBLB 4LBEC 1S5JA 2GV9A 3WU2Z 1VQ8V 4MVOA 5D5PA 2ZNJA 4DV6O 3ZMUA 3P30A 1P49A 2PZSA 4X20A 3CWBH 1VIBA 4O4IA 4X89A 4FFKA 4B3RB 2ATKC 2X6CA 1AVMA 4KHPB 2QTOA 1W0JG 4QE9A 1JQ0A 3ABLC 1NTZH 3KCXA 2GUZB 3ASOC 3ETQA 3JD4A 3CCUV 1MMMA 4DR5B 2AHZA 3AEIA 2H94A 2FYUH 2PUSA 5DECA 3SYPA 2JDIG 2Y69C 5H2FZ 1VF6C 1XILA 4I50A 3ABLB 3ASOB 4DO2A 5IWAB 1M57C 1THZA 5LOVB 3UQ8A 1HR0O 4H33A 1OCZC 2PY5A 2Y69B 1MSWD 2DWEC 2BOBC 4DW1A 3F5TA 3T1HB 2EIMC 4F6RB 1MOFA 5JCOA 1Z2GA 2Q0OC 2UU9O 5EZYB 3E8GA 1COWG 3LNMB 3L75H 2B1GA 1Z5VA 2ZNIA 3F7YC 2OCCB 3OW2U 3T1YO 1GO3F 1E1RG 4CBCA 5B66Z 2E3CA 5IE9A 5HFMA 2KG7B 3ZRSA 5FNVA 1R6TA 4OPAA 1GN6A 1XMOB 4I0XB 2EBOA 2AHYA 3CD6V 3HKEA 2ITDC 1H38A 3JD3A 1SS3A 2QSAA 3JAKA 3TXSA 3P32A 2OTJV 4X88A 1XHZA 3T4ZA 4NVPA 3FB8C 4ZHQB 1DF4A 1D5AA 2NN4A 1IX9A 1H2LA 3HKDA 1NBMG 1I5YA 4PDRA 4B3TB 2PTMA 3ZN1A 1R6KA 4K0KO 3ZHUA 2Q9LA 4DR1O 2QWQB 3OTOO 1SQBH 1I0HA 2EX3A 3R65A 4J10A 2HKOA 3N27A 4FLVA 5FPOA 3J81N 4UB6Z 3K58A 4NXMB 3K9AA 4AQYO 3AK2A 3N2GB 5KX5A 1VQNV 3UCSC 3HPLC 2UXBB 5IJ0B 1PNLA 2FKXA 2UXCO 4FJCC 1R3LC 1AJNA 1R3IC 5J2UB 4TV9A 4MVMA 2YS8A 5B1NA 2GTSA 2VQFB 4NXNO 4UV9A 3ASNB 2IW5A 1P7BA 4F6EA 4G27B 4JI6B 1JA8A 2Z3YA 3OTFA 1G4YB 4OPHA 4E4EA 4X64B 4IL6Z 2Y4TA 4LCUC 1XEQA 4JV5B 3W7XA 2DYRB 1NVPD 2BTQB 3E35A 1XDCA 1S76D 3K9SA 4ZOLA 1V55C 2IH3C 2IJJA 3AG2B 4ZI7B 3QO5A 4H13B 1Z5WA 4I5SA 3ZMVA 4UCRA 5KHIA 3RYCB 1SQFA 2HJFC 4DK0A 1HNWB 5KMGB 4YY3B 4CZZA 1ORQC 1Y76A 3CMAV 3CHXA 2V4DA 2Q6AA 3RN4A 3ICXA 4DR5O 1Y66A 2DQ0A 1NH2D 2IJHA 4Z1MG 2JJ1G 1N36O 1YDXA 4J42A 3RYHA 1JCHA 3UM7A 4UFZA 4ZBMA 3B4SA 4MTFA 3MAQA 1J5EB 5FL7G 2CH7B 3CCSV 4FZ1A 4TSFG 1M1KW 4RWUA 1FXVA 4MTOA 4MT8A 1B3QA 3L73H 1XUQA 1NR1A 1WA8B 3ZRWA 1R3JC 4Q6GA 1FFTB 1Y6XA 3GWOA 4CS3A 3P3PA 1SQGA 3ZCCA 4DV3O 4RO2A 1NTMH 2ZR3A 4GUNA 1VQPV 1UJWB 4G28B 2ODMA 5K1XA 2HHHB 1U97A 1XMOO 3JD2A 4KFMA 1Q90D 4JI2O 4J41A 3RYIB 2HR3A 5GW7A 4LR3A 3AG4C 5L3CA 3OEHG 5CBFA 4I55B 3OR7C 2ZXWB 5EC2C 5JWPA 3CC7V 2MK3A 2OT5A 3ML0A 4LF7B 2XASA 2V7QG 4WBNB 1NTKH 4P9OA 1EBOA 5H6RA 3SPIA 1AJPA 3HR0A 1FKAO 3CP1A 3IGAC 4N21A 1NI8A 1JJ2U 2XHBA 5EIBC 4JI3O 3ETDA 2ITCC 1RSOA 4YHHB 2Z5UA 4YJ3A 2NNUA 2ZT9B 5BMVA 2RNBA 2UUAB 2R9AA 5JVDA 3ZRXA 4GKKO 4X1KA 4MSWC 4FFBA 4LNUB 2F95B 2BSKA 3L74H 4J9YB 2ZIMA 2VQFO 2JIZG 5B5EZ 2PF4E 1HDJA 2Q68A 3LSSA 1SA0A 4JI6O 1F4MA 4DV7B 2WLMA 2ZKOA 1TVKB 2NR5A 4X64O 2AXTZ 4DV2B 3LDCA 1FJGB 2A3QA 1H2NA 5LP6A 3K08A 1Q6IA 1K4CC 4LF8O 2WWWA 2WLIB 3CX5F 3LSUA 2DYSB 5LA6B 4KUMA 4JYBA 5LMUO 2GSMB 1Y74A 4IT5A 1HNWO 4YY3O 4DV1B 4MW3A 1FYJA 4DW0A 2PGGA 2ADPA 2NLJC 1JFFA 1IZ3A 2ZD9A 3BVOA 3LSQA 2JJ2G 3SJAC 5K1PA 3CXCU 2AZ2A 4I50B 3QVNA 1K92A 1PL0A 2LFSA 1AI4A 1R73A 5LGUA 3HKBA 1VQ7V 5JCOC 1VF5B 5EBLC 5BR8O 1L0LH 4I4TA 1J5EO 4P30A 4B7EA 3E8BA 5BXZA 2VWJA 4GT1A 2EJ7A 2P67A 1PV0A 1QNMA 2W6IG 2BTOA 1JOYA 2EIJC 3G4SV 3JAWB 3D3IA 2LJ2A 1IBKB 3ZBHA 3QO7A 1CPYA 2PYLA 5IY5B 1TAEA 2LGQA
chains in the Genus database with same CATH topology
3W7WA 4PDLA 5B1AC 2ATKC 2X6CA 4WFAV 2YSUB 1ENVA 3ASNC 2QTOA 2Q69A 1W0JG 4JASA 5BZBA 1NVPB 1NQTA 3DTUB 4WFGA 4QE9A 2JEXA 1JQ0A 3ABLC 3HB3B 4R6ZA 5H6QA 2UXXA 3OUSA 3ASOC 3JD4A 2WLJA 3CCUV 3WFVA 4EKWA 2AHZA 3LDEA 1PNMA 1Q81W 1YIJV 3AEIA 2H94A 1SZTA 1IXMA 5B1AB 4TT3G 4LP8A 3SYPA 2JDIG 2Y69C 3CYOA 1FXKA 3T1CA 2DYRC 1ROPA 3OMIB 1K9MW 3ABLB 1YI2V 4BIZA 2WSSG 5C93A 3ASOB 4DO2A 1RPOA 1EZJA 3AG2C 3E83A 3RVYA 3TK1A 1M57C 1THZA 4TWKA 1QBZA 1NH2B 4H33A 3OM3B 3OUFA 1OCZC 2Y69B 5CBHA 1FXHA 1XL6A 3D36A 1MSWD 3SJQC 1YJWV 2DWEC 2BOBC 1Q7YW 1WPXA 3SPGA 1K7DA 2EJRA 1YSCA 1K5QA 1SERA 2X6BA 4GX2A 2EIMC 1KP3A 3ZRVA 1MOFA 1QCEA 3H01A 4BAYA 1VQ9V 1AI5A 2P7TC 3OMNB 4PA3A 4P2ZA 3FB6C 4RUFA 1QR9A 2W6JG 3E8GA 3W7TA 3ETEA 1COWG 3LNMB 2B1GA 2XAHA 4WCEV 3JD1A 3F7YC 3ZIAG 4RQEA 2B5UA 2OCCB 4PA6A 3OW2U 3AG1C 1GO3F 3OMAB 3CPWU 1E1RG 4XDLA 4CBCA 3DGEA 3ZN0A 5KUMA 1OCOB 5KA5A 4BIUA 5HFMA 2EILB 5L3FA 3LDDA 4HYOA 5B1OA 3ZRSA 3ETGA 3OE7G 1JX9A 3T4DA 3CCJV 4PA7A 3AG1B 2EBOA 2WLKA 5E1AC 3A0RA 4R50A 2AHYA 4PELA 1E79G 2EIKC 3ZMTA 1GM8A 3CD6V 1M56C 3MHHC 4GX0A 2JEUA 2ITDC 1K3EA 1H38A 3JD3A 3SPJA 1GKFA 4RUEA 3CCRV 3OEEG 2A0LA 1FXKB 4PA9A 3SPHA 3RW0A 3P32A 2OTJV 4X88A 3T4ZA 3FB8C 2EZOA 1DF4A 1M56B 1YJ9V 2IU3A 1OCCC 4MW8A 2XAGA 1RM1B 4WF9V 4HZ3A 3K04A 5EBWC 1KP2A 1I5YA 1NBMG 2R9IA 1SRYA 3F5WC 1KD1W 1MG1A 4QE7A 5L3DA 3FB7C 4PDRA 1QLEB 1SESA 1I5XA 3IFXA 1AI6A 3ZN1A 1R6KA 4J9ZB 1CEZA 3F7VC 3R65A 5J9PC 3M99B 2ZXWC 1FS0G 2HKOA 2DW4A 1GM7A 3W7UA 1S5HC 2P90A 3K9AA 3FYIB 1F51A 1VQKV 1OCRC 2X6AA 1V54B 3OFNG 1BMFG 4PA4A 4JF3A 1VQNV 2QKSA 2EIJB 3HPLC 4JPRA 4LC1A 5KUKA 1PNLA 1NJIW 2XAJA 4FJCC 1R3LC 1AJNA 1R3IC 4WFBV 2F43G 2X0LA 4MVMA 1QLNA 2HVJC 2QA4V 5B1NA 1L1FA 1AJQA 2HVKC 4JGSA 1QVFU 4UV9A 3ASNB 2IW5A 1P7BA 1R3KC 4G27B 3ZMZA 1Q86W 3VOUA 5LHIA 5LGNA 4BW5A 1ZWIC 1YTFD 2Z3YA 3LUTB 4MTXA 1G4YB 1M9NA 3ABUA 1GTOA 3T2MA 1W2BU 3CC4V 5B3SC 3TETA 1BHBA 4MVRA 4UVCA 4LCUC 2XOKG 3W7XA 2Q67A 2DYRB 1NVPD 1AROP 4WFFA 3ZRWB 4MVUA 3EHBB 3E35A 3OR6C 4OXSA 4UV8A 1K73W 1S76D 1GMGA 1V55C 2YEVA 2WAMA 4U7OA 2IH3C 2IJJA 3AG2B 3QO5A 1M57B 4I5SA 3SYAA 3ZMVA 5B3SB 3B8NA 3CMEV 2HJFC 5HFLA 3WG7C 4MVSA 4FMTA 1OCZB 4JAVA 1KQSU 5EK0A 5EC1C 4CZZA 1F23A 1ORQC 1EFRG 1K5SA 3CMAV 3E2EA 2UXNA 2R9RB 2Q6AA 4R8CA 3UKMA 1KECA 3X2QC 5L3BA 3JD0A 3AG3C 1Y66A 2EIMB 2EINC 3CCQV 2QM8A 2DQ0A 2QM7A 4G2KA 5LHHA 2P6JA 1NH2D 2IJHA 3JYCA 3B8MA 4Z1MG 2WLHA 2JJ1G 3K79A 5EBMC 5IYBO 1S72V 2DYSC 3X2QB 2KB1A 1JCHA 3UM7A 1F4NA 1LNQA 3BY6A 4ZBMA 1VQ4V 1K33A 5LBQA 4JTDB 4MTFA 2ZQMA 2LFRA 3K0DA 4JTAB 4UXNA 5FL7G 3FB5C 4UUJC 4JAUA 3CCSV 1M1KW 4TSFG 3E8HA 3E89A 1FXVA 4MTOA 2IJIA 3QNEA 4MT8A 5IYCO 1BL8A 2EIKB 1DF5A 2DQ3A 4GX5A 4QIWF 4UVAA 1NKDA 1KKDA 1NR1A 5B1BC 2ZR2A 3ZRWA 1R3JC 3E86A 3SPCA 1FFTB 3K3WA 3GWOA 1VQOV 1OZ0A 4L87A 3ZCCA 4RO2A 2C2AA 3B77A 3G6EV 1GM9A 2HFEC 4MVQA 2ZR3A 3ABMC 2XAFA 1VQMV 5H9CA 1VQPV 1UJWB 2OTLV 2YEVB 4G28B 3STLC 2PI5A 1H2GA 4F4LA 1OCCB 3E8FA 3G71V 1G8MA 4RAIA 3JD2A 4KFMA 4WFHA 2HR3A 2V1DA 5GW7A 2B1IA 3AG4C 5IY5C 5IDJA 5L3CA 1Q82W 1TUEB 1JVMA 4P9PA 3OEHG 3OGCC 5CBFA 4XDKA 3ZMSA 3OR7C 2ZXWB 4N23A 2WPDG 3ABTA 4UVBA 2XAQA 4MVZA 1VQ6V 5EC2C 1VQLV 2D3OW 5CA3A 3MD0A 3CC7V 1M90W 2MK3A 3K0GA 2IJKA 1OCRB 4QPKA 2OT5A 3CCLV 3K06A 3ML0A 2WLLA 2WLIA 3I56V 2QE7G 2XASA 2V7QG 2ZDIC 1K97A 4P9OA 1EBOA 4FIPC 4HAMA 1K8AW 3RVZA 5H6RA 3TCUA 4H37A 4YXWG 2XNDG 1OHHG 4WFEA 3SPIA 1K34A 1S3JA 1AR1B 1AJPA 3CP1A 3IGAC 4PDMA 4N21A 4E2LA 4X8AA 1JJ2U 2M7WA 1MABG 4GCZA 2FTKA 1YHQV 3BEHA 1S77D 3ETDA 2ITCC 2Z5UA 3I55V 2LP7A 2NNUA 5CBGA 3CC2V 3ZRXA 5CMUA 4MSWC 4ZKIA 3IC7A 3ABKC 4GX1A 1V55B 4J9YB 4QPJA 4DXWA 3SYOA 1H8EG 5L3EA 1W0KG 3RBZA 2A79B 2JIZG 4KP4A 2OCCC 3CCMV 3WG7B 2GHYA 3ZJZA 2PI4A 2Q68A 3OAAG 3SYCA 1S0VA 3LSSA 5KA6A 1BHAA 2CK3G 4JTCB 1OCOC 1F4MA 2WLNA 1J95A 4Q20A 3GB7C 3ABKB 2EILC 2WLMA 1QR8A 3AG3B 4MTGA 2EINB 3QO8A 1K4DC 3LDCA 4FK5C 1R6NA 2IH1C 1Y4MA 3FYEB 1E1QG 3K08A 3MHSC 1CP9A 2X7RB 1DLBA 4XDJA 2HLDG 1JPXA 4JYCA 4U7NA 1K4CC 2QEXV 1WLEA 1P4RA 5IYDO 2WWWA 2WLIB 2WLLB 3CCVV 2DYSB 1YITV 4KUMA 4JYBA 3SYQA 3CCEV 3FKSG 1DTOA 4ASUG 2H8PC 1FXKC 1H8HG 2GSMB 2ZDIA 1VQ5V 1PKXA 4MW3A 1AI7A 2NLJC 3PJSK 4XBFA 4QJFB 3KG2A 3W7SA 1QVGU 5CN0A 1RM1C 2ZD9A 5DN6G 3NXSA 3LSQA 2JJ2G 4R7CA 3CXCU 3JCZA 5B1BB 1HWYA 1QLEC 3EFFK 4FPPA 1K92A 1PL0A 1PD3A 2LFSA 1AI4A 1R73A 5LGUA 1YJNV 4PDVA 1NR7A 1KC8W 1VQ7V 3VBBA 3ABMB 5EBLC 5LGTA 2W0FC 1B6QA 1N8RW 2K1EA 4P30A 3E8BA 4I9WA 1PNKA 4GT1A 1V54C 2IU0A 4RQFA 2P67A 2HG5C 4LBEC 2W6IG 3K03A 1JOYA 2EIJC 3G4SV 4QNHB 5LHGA 2Y48A 3D3IA 1VQ8V 1SETA 3QO7A 1CPYA 4MVOA 5L3GA 1YTFB 2DWDC 1RPRA 2JK5C 3AG4B 5IY5B 3ZMUA 2EZPA 3P30A 2BOCC 5DM6V 4MS2A 1GK9A 3STZC 1XL4A 2A9HA 4X89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYS C;  4PDL A;  5B1A C;  2KB1 A;  2ATK C;  2X6C A;  1LNQ A;  3UM7 A;  4ZBM A;  5CBG A;  3ASN C;  5BZB A;  2QTO A;  2Q69 A;  4HZ3 A;  3K04 A;  5EBW C;  4JTD B;  4MSW C;  4MTF A;  3F5W C;  4QE7 A;  4WFG A;  3FB7 C;  4PDR A;  4QE9 A;  3ABK C;  3K0D A;  3ABL C;  3IFX A;  4GX1 A;  4JTA B;  4R6Z A;  3OUS A;  3FB5 C;  3ASO C;  4J9Y B;  4UUJ C;  4DXW A;  3SYO A;  4J9Z B;  2WLJ A;  4EKW A;  3F7V C;  2AHZ A;  3LDE A;  3E8H A;  2A79 B;  3R65 A;  3RBZ A;  3E89 A;  2OCC C;  5J9P C;  4MTO A;  2ZXW C;  4LP8 A;  3SYP A;  3ZJZ A;  2Y69 C;  2Q68 A;  3SYC A;  1BL8 A;  4GX5 A;  4JTC B;  3T1C A;  1OCO C;  2DYR C;  2WLN A;  5EBM C;  1KKD A;  1J95 A;  5B1B C;  1S5H C;  1R3J C;  3E86 A;  3GB7 C;  3SPC A;  2EIL C;  2WLM A;  1OCR C;  2X6A A;  4PA4 A;  2QKS A;  3AG2 C;  3E83 A;  3RVY A;  3HPL C;  1M57 C;  4MTG A;  4TWK A;  1K4D C;  3LDC A;  5KUK A;  4RO2 A;  2IH1 C;  2HFE C;  4MVQ A;  4X89 A;  3ABM C;  4H33 A;  3OUF A;  1OCZ C;  1R3L C;  3K08 A;  1R3I C;  5CBH A;  4XDJ A;  4G28 B;  1XL6 A;  4MVM A;  1K4C C;  3STL C;  2HVJ C;  3SJQ C;  4F4L A;  2WLI B;  2DWE C;  2BOB C;  2WLL B;  3E8F A;  2HVK C;  3SPG A;  4RAI A;  2X6B A;  3SYQ A;  4GX2 A;  2EIM C;  1P7B A;  1R3K C;  4G27 B;  2H8P C;  2P7T C;  4KFM A;  4PA3 A;  4P2Z A;  3VOU A;  4MW8 A;  3FB6 C;  4WFH A;  4RUF A;  4BW5 A;  1ZWI C;  3AG4 C;  3E8G A;  4MW3 A;  3LUT B;  5IY5 C;  1G4Y B;  3LNM B;  1JVM A;  4P9P A;  3OGC C;  3F7Y C;  2NLJ C;  3PJS K;  3T2M A;  5CBF A;  4XDK A;  5B3S C;  3KG2 A;  4PA6 A;  3OR7 C;  3AG1 C;  3TET A;  4MVR A;  4XDL A;  4LCU C;  2ZD9 A;  4CBC A;  4MVZ A;  5KUM A;  2Q67 A;  4R7C A;  5EC2 C;  4WFF A;  4MVU A;  1QLE C;  3EFF K;  3K0G A;  3OR6 C;  4OXS A;  3LDD A;  4HYO A;  1V55 C;  2YEV A;  3ZRS A;  2IH3 C;  3T4D A;  3K06 A;  4PDV A;  2WLL A;  2WLI A;  3SYA A;  4PA7 A;  2HJF C;  2WLK A;  3WG7 C;  5E1A C;  4MVS A;  2AHY A;  4R50 A;  5EBL C;  2EIK C;  2W0F C;  4P9O A;  5EC1 C;  5EK0 A;  1ORQ C;  3RVZ A;  3TCU A;  1M56 C;  2K1E A;  4H37 A;  4P30 A;  3E8B A;  4GX0 A;  4I9W A;  2ITD C;  4WFE A;  3SPI A;  2R9R B;  1V54 C;  2Q6A A;  4R8C A;  3SPJ A;  3UKM A;  3X2Q C;  2HG5 C;  4LBE C;  4RUE A;  3AG3 C;  3K03 A;  2EIJ C;  4QNH B;  2EIN C;  3IGA C;  4PDM A;  2A0L A;  4MVO A;  4X8A A;  4PA9 A;  3SPH A;  2DWD C;  2JK5 C;  3RW0 A;  3BEH A;  3JYC A;  4X88 A;  2BOC C;  2WLH A;  3FB8 C;  3T4Z A;  2ITC C;  4MS2 A;  3STZ C;  1XL4 A;  2A9H A;  1OCC C; 
#chains in the Genus database with same CATH topology
 2JGU A;  3W7W A;  5B1A C;  2GTA A;  1M5I A;  4O2B A;  3CEI A;  2HEP A;  2QKA A;  2YSU B;  3DTU B;  2CGO A;  2B9Z A;  2LW1 A;  4WFG A;  2JEX A;  3HB3 B;  4R6Z A;  5H6Q A;  3ZHQ A;  3RWR D;  3LDE A;  1Q81 W;  4TQD A;  1EZV H;  1SZT A;  5B1A B;  2HHH O;  1BCC H;  4TT3 G;  4LP8 A;  1YXB A;  3T1C A;  1ROP A;  4DYL A;  2P22 C;  5AG2 A;  4D7S A;  5C93 A;  1UFI A;  2P5O A;  2BCC H;  3RVY A;  3TK1 A;  3CJH B;  4DUZ B;  2EUL A;  3JAK B;  3OM3 B;  3KKY A;  3VQX A;  4TUY A;  1I7F A;  1GN3 A;  2LGW A;  4LF5 B;  4GX2 A;  3UO2 A;  3HKD B;  1VQ9 V;  4LF7 O;  1QCE A;  4FLU A;  3O9O A;  3OMN B;  4JI0 O;  4P2Z A;  2JS5 A;  1SC5 B;  3JAR B;  4X1Y B;  4FLW A;  3ZIA G;  4RQE A;  2B5U A;  3JSN A;  1M4U A;  3AG1 C;  2YXL A;  4XDL A;  3DGE A;  3ZN0 A;  5KUM A;  1OCO B;  4GKJ O;  4BIU A;  2JVD A;  2YDE A;  2EIL B;  5L3F A;  4OX9 B;  4HYO A;  4DUY B;  4FM1 A;  5KX5 B;  3ETG A;  2LW7 A;  1JX9 A;  3OE7 G;  3U0Z A;  4UCV A;  4YHH O;  3CCJ V;  2F4V O;  4X1I B;  1Q5O A;  3AG1 B;  5LYJ A;  2WLK A;  2UUA O;  1E79 G;  2EIK C;  3KCY A;  4TV9 B;  3MHH C;  4GX0 A;  1GN4 A;  4CC6 A;  3GWK C;  2GDS A;  4X9Q A;  5CA0 B;  2A0L A;  1FXK B;  1VMG A;  4JZ2 A;  3RW0 A;  1Q6H A;  4AHC A;  4DV7 O;  3B40 A;  4MW8 A;  1AIL A;  2CDY A;  2XAG A;  1RM1 B;  2L6L A;  3K04 A;  5EBW C;  1FJG O;  2R9I A;  1SRY A;  4QE7 A;  3FB7 C;  1N33 B;  1SES A;  4ZOL B;  2H3O A;  3THO A;  4DV0 B;  4LFB O;  3M99 B;  3CRQ A;  1FS0 G;  2DW4 A;  2YID A;  5LXT B;  3W7U A;  3Q4H A;  4DV1 O;  1S5H C;  2YUA A;  1F51 A;  5A2Q N;  1V54 B;  1BMF G;  2QKS A;  1N4C A;  4JPR A;  4LC1 A;  3APQ A;  2ZM6 B;  3SJC C;  4WFB V;  3BRC A;  2F43 G;  1QLN A;  2HVJ C;  2QA4 V;  1TUB B;  4JI4 B;  3RYH B;  1HW7 A;  3WB1 A;  1QVF U;  1Q86 W;  5LHI A;  1US6 A;  2RJZ A;  2Y4U A;  3LUT B;  2DJV A;  3M8A A;  3ABU A;  1GTO A;  1W2B U;  3CC4 V;  1EM1 A;  4O4J B;  3TET A;  5FLX N;  4KL1 A;  1IBK O;  1QHT A;  1ARO P;  3ZRW B;  3E22 B;  3OR6 C;  1XNQ B;  2N74 A;  4UV8 A;  2YEV A;  2WAM A;  3SJB C;  2JGD A;  4IIJ A;  3KZI Z;  1M57 B;  5KAI Z;  2OIE A;  4JYY A;  3JAL A;  3J7A U;  3CME V;  3JAS B;  4DV4 B;  2YIB A;  3WG7 C;  1OCZ B;  5EK0 A;  5EC1 C;  4LFC B;  4AI8 A;  1K5S A;  2E5L B;  3E2E A;  4R8C A;  1OJH A;  3X2Q C;  1KEC A;  1U96 A;  2IM9 A;  3JD0 A;  4JI8 B;  1VEW A;  3AG3 C;  1RFY A;  2EIM B;  3BA8 A;  5EYP A;  4YIO A;  2ARH A;  2WLH A;  3K79 A;  4X65 B;  4DR7 B;  3X2Q B;  2KB1 A;  3BY6 A;  1WB7 A;  1VQ4 V;  4DUZ O;  2DE0 X;  4HNA A;  3MDS A;  3K0D A;  5LL6 Y;  4O4L A;  5C8Y A;  5CA1 B;  4BR6 A;  5JQG A;  2ETN A;  4GX5 A;  4LWS A;  1QQC A;  2QR4 A;  4JI5 O;  3K3W A;  1VQO V;  4L87 A;  2QWR B;  2YIC A;  3B77 A;  1PL4 A;  3ABM C;  3U11 A;  3K5M A;  2XAF A;  5IYZ A;  1VQM V;  5A9G A;  2OTL V;  3R66 A;  2PI5 A;  1RSO B;  2CGN A;  3E8F A;  3SR2 C;  2QDO A;  2ZCE A;  2Y0I A;  3TXQ A;  2QJ1 A;  1AP5 A;  3WB0 A;  1D5N A;  1SQP H;  4WFH A;  5KLV H;  2V1D A;  1Q3E A;  3JSL A;  2B1I A;  2BSK B;  1Q82 W;  1JVM A;  4U3J B;  2UUC B;  3OGC C;  1N32 B;  4O4H A;  2CTR A;  5LP6 C;  3ZS8 C;  2KQX A;  2Q5Z A;  4MVZ A;  1SA0 B;  4B3S B;  4ZIB A;  5CA3 A;  3MD0 A;  2IJK A;  4DR3 B;  1I94 B;  1L0N H;  3CCL V;  3K06 A;  1HNZ O;  4DR6 O;  2WLL A;  3I56 V;  1HNX O;  2KKW A;  5LP6 B;  4FIP C;  2KSD A;  1XNR O;  1K8A W;  1N33 O;  4YXW G;  4WFE A;  1OHH G;  2JS3 A;  1IBL O;  4DR2 B;  4DV0 O;  3U10 A;  4NB5 A;  1ZL8 A;  1Y74 B;  2M7W A;  3BAA A;  1YHQ V;  3BEH A;  1KYO F;  2VRZ A;  1KMI Z;  3SDL A;  1X4T A;  4B3R O;  2LP7 A;  2OIG A;  1B06 A;  5CBG A;  4KHP O;  3CRC A;  4ZKI A;  3IC7 A;  3C3T A;  4GX1 A;  4W4K A;  1V55 B;  4QPJ A;  3SYO A;  1FFX A;  4C7U A;  3UT5 A;  1W0K G;  2A79 B;  4X62 B;  5J2T A;  3HKC B;  4I7Z B;  4I4T B;  2F93 B;  2WLN A;  4Q20 A;  3GB7 C;  1NS1 A;  1XOU A;  4A5U B;  4JI1 B;  5IWA O;  1BZK A;  5IJ9 B;  4MTG A;  1IXB A;  2IH1 C;  1Y4M A;  1B04 A;  5JJJ B;  3MHS C;  1CP9 A;  2X7R B;  4XDJ A;  4GZR B;  4U7N A;  4DV5 B;  2QEX V;  1P4R A;  5IYD O;  1XNQ O;  4O2B B;  3SYQ A;  3T1H O;  3CCE V;  4U3F H;  1DTO A;  4ASU G;  2H8P C;  4DV4 O;  1SKV A;  2RMK B;  4BWA A;  1ZUQ A;  4DRX B;  5GTI Z;  4LFC O;  4XBF A;  1JR9 A;  3W7S A;  1QVG U;  5DN6 G;  3NXS A;  5LOV A;  2YXY A;  3JAM N;  3JCZ A;  1HWY A;  1QLE C;  3EFF K;  1KUQ A;  1YJN V;  4X65 O;  4DR7 O;  4FVM A;  3RGB A;  1CXZ B;  3VBB A;  4IYI A;  3TJT A;  4EB6 B;  3H1H H;  4TUY B;  2W0F C;  1O9G A;  4B3M B;  5EZY A;  1PNK A;  5D5Q A;  2HG5 C;  3A0H Z;  5JH7 B;  4J7Z A;  1YTF B;  2ZIO A;  3AG4 B;  2JRI A;  5DM6 V;  3L70 H;  1GK9 A;  3STZ C;  3TGU H;  2A9H A;  2OCH A;  2KG7 A;  4PDL A;  2QGN A;  3CRR A;  4WFA V;  4FLX A;  1ENV A;  1ZTE A;  5BZB A;  2Q69 A;  4JZG A;  4B3T O;  4UCU A;  4LFA B;  2UXX A;  3OUS A;  4FM0 A;  4NTY A;  1YZB A;  4HBN A;  1VF7 A;  1PNM A;  1YIJ V;  2M6Y A;  1IXM A;  1G1X B;  5LYJ B;  3CB2 A;  1X59 A;  2DOS A;  5H5N A;  4NXM O;  2YC0 A;  3E83 A;  4CH5 A;  1KKC A;  2UXB O;  4FLY A;  4TWK A;  1XMQ B;  4JAA A;  3OUF A;  5CBH A;  3L72 H;  1FXH A;  1XL6 A;  1SF9 A;  4B3S O;  3D36 A;  1YJW V;  1Q7Y W;  5CB4 A;  1WPX A;  4DR3 O;  1I94 O;  4LH7 A;  1YSC A;  1K5Q A;  3BA9 A;  4EFB A;  4B08 A;  1SER A;  2CUG A;  4KXR A;  3ZRV A;  3I5D A;  3BHP A;  2P7T C;  4PA3 A;  3D3Q A;  1N0J A;  3FB6 C;  1QR9 A;  2XAH A;  4WCE V;  2BE3 A;  3JD1 A;  4LF9 B;  2YI9 A;  3N2G A;  3OD4 A;  3CPW U;  2XTA A;  3N2K A;  4JV5 O;  3BCC H;  4Z1V A;  4X20 B;  4O4I B;  3LDD A;  5B1O A;  5J2U A;  1AR5 A;  4AIL C;  4PA7 A;  3O65 A;  3A8T A;  3M7M X;  5E1A C;  2QM4 A;  3ZMT A;  1GM8 A;  1SQV H;  1M56 C;  2JEU A;  1K3E A;  5JJN B;  3DXR A;  1IUR A;  1GKF A;  4X62 O;  2ZIN A;  3SPH A;  4CC5 A;  4DV6 B;  1BS3 A;  1T5E A;  2EZO A;  1M56 B;  1YJ9 V;  1OCC C;  1AP6 A;  4JI1 O;  4ZI7 A;  4K8X A;  4HZ3 A;  1KD1 W;  1MG1 A;  5L3D A;  1WPB A;  1YEW A;  3LNN A;  1I5X A;  5KMG A;  1AI6 A;  4LH6 A;  1XI1 A;  3PN1 A;  1TGO A;  2Z0A A;  4J9Z B;  3FAV A;  1CEZ A;  1W59 A;  1V9P A;  2Q73 A;  3CS5 A;  4TV8 A;  1GM7 A;  2P90 A;  1OCR C;  3OFN G;  1P84 F;  1TA8 A;  2EIJ B;  2XAJ A;  3JCU Z;  5EYP B;  3IAY A;  3ZX6 A;  5FNV B;  4BIO A;  1QU7 A;  1AJQ A;  2CH7 A;  2FL4 A;  4HNA B;  4FLT A;  4K8Z A;  5LGN A;  4TOI A;  3HKE B;  4O4L B;  3L71 H;  5C8Y B;  1NT2 B;  4IYH A;  2YIA A;  5B3S C;  4YJ2 A;  2ZE7 A;  1BHB A;  4MVR A;  4UVC A;  2XOK G;  1YVW A;  1VAR A;  2Q67 A;  4NR1 A;  1AB3 A;  2Q8V A;  4WFF A;  3EHB B;  3B2E E;  2RDC A;  5KHJ A;  1KB9 F;  3SYA A;  5B3S B;  3B8N A;  5IYZ B;  4JAV A;  1KQS U;  3G6B A;  2QTS A;  3K59 A;  2R9R B;  2UXN A;  3UKM A;  1F7Y A;  2EIN C;  4I55 A;  2QM7 A;  4G2K A;  2P6J A;  3JYC A;  3ZED A;  3RYF A;  2AZ0 A;  3AG7 A;  5KAF Z;  1KBH A;  1P7G A;  3K5N A;  1LUV A;  4UCT A;  1K33 A;  5F2V O;  2GBO A;  4J7J A;  1DK1 A;  4WBN A;  2LFR A;  4JTA B;  1NZ6 A;  1BT8 A;  4ICG A;  4UUJ C;  1MA1 A;  2LQT A;  3OTO B;  3H1L H;  3VQV A;  3L9D A;  3FFQ A;  1MSD A;  5IYC O;  2E75 B;  4NTW A;  1BL8 A;  2D2C B;  2EIK B;  2DQ3 A;  4QIW F;  4UVA A;  1NKD A;  2UXD B;  5B1B C;  2ZR2 A;  3E86 A;  3SPC A;  1OZ0 A;  3ZHT A;  4DV2 O;  4LF9 O;  3IC9 A;  4J7K A;  4NKG B;  1ZL8 B;  2UXC B;  1GM9 A;  2AW9 A;  4LNU A;  4F4L A;  4IHJ A;  4RAI A;  4DR4 B;  1FAF A;  4PHZ A;  1Y76 B;  5IDJ A;  2W0X A;  4P9P A;  1Q43 A;  3UT5 B;  4XDK A;  2F1M A;  1Q6U A;  4N23 A;  3ABT A;  4UVB A;  1VQ6 V;  1VQL V;  1M90 W;  3K5L A;  5LMN B;  2RN9 A;  3DC5 A;  4O2A A;  4QPK A;  2WLI A;  2CTQ A;  2QE7 G;  1BQ0 A;  5LA6 A;  1K97 A;  3BPZ A;  1WNS A;  3CE2 A;  4HAM A;  2XND G;  1AR1 B;  1S3J A;  1G6U A;  3AK1 A;  4PDM A;  4E2L A;  4X8A A;  3RFR A;  1MAB G;  4K35 A;  3UO3 A;  1R1B A;  1N36 B;  3DC6 A;  2ILM A;  3BFR A;  4YIP A;  2N05 A;  5CMU A;  2Q7E A;  4Z2W A;  3ABK C;  4J80 A;  5L3E A;  3J80 N;  3RBZ A;  4KP4 A;  2OCC C;  1BSM A;  3CCM V;  3WG7 B;  2GHY A;  3QTC A;  3ZJZ A;  2PI4 A;  3OAA G;  3JAW A;  3SYC A;  4EEQ A;  1S0V A;  5KA6 A;  1NU1 H;  2AGA A;  3ABK B;  1QR8 A;  3AG3 B;  3QO8 A;  1K4D C;  4FK5 C;  4DV3 B;  1WB8 A;  3CXH F;  4W4L A;  2CTP A;  2PYJ A;  4PV1 B;  3K57 A;  5FPR A;  4JYC A;  1WLE A;  3CCV V;  1YIT V;  4LF5 O;  2UUB B;  2ZDI A;  4JI2 B;  2Q7G A;  4J11 A;  4QJF B;  1YF2 A;  5CN0 A;  3CJH A;  3OT7 A;  4R7C A;  2XT9 A;  3D36 C;  4OX9 O;  1PD3 A;  4DUY O;  5GON A;  1N34 B;  4YJ3 B;  3G80 A;  2WA3 A;  5BMV B;  1MNG A;  5JVD B;  2DN9 A;  4X1K B;  1H2S B;  1KC8 W;  4FFB B;  4CH6 A;  3ABM B;  3G67 A;  1S5L Z;  3OGI B;  5LGT A;  3NR7 A;  1B6Q A;  2R70 A;  3JAT A;  2Q4P A;  5CB4 B;  3JAR A;  4RQF A;  2QWN B;  2IU0 A;  4X1Y A;  1ZLZ A;  3K03 A;  4QNH B;  5LHG A;  2Y48 A;  1SET A;  2OWO A;  5L3G A;  2DWD C;  1RPR A;  2JK5 C;  2EZP A;  2BOC C;  2IBZ H;  4JI3 B;  2UXD O;  4MS2 A;  1XL4 A;  2P4V A;  3ASN C;  4JAS A;  3N2K B;  1PPJ H;  4GKK B;  1NVP B;  1NQT A;  4X1I A;  2Q0A A;  1ZAU A;  2WLJ A;  3WFV A;  4EKW A;  1IBM B;  1SQQ H;  4DR4 O;  1MZF A;  1AR4 A;  3CYO A;  1Y67 A;  5CA0 A;  1FXK A;  1I08 A;  5DED A;  1URF A;  2DYR C;  3OMI B;  1K9M W;  1JFF B;  1H2K A;  2WSS G;  4BIZ A;  1YI2 V;  3DXR B;  1RPO A;  1EZJ A;  3AG2 C;  5ITZ A;  4H44 B;  4PI2 A;  3H1I H;  4NYK A;  1QBZ A;  2ZM6 O;  1NH2 B;  1OV9 A;  3SJQ C;  5LMN O;  4LF8 B;  3HKB B;  5JJE B;  4JI4 O;  4JI7 B;  3SPG A;  1K7D A;  2EJR A;  2X6B A;  5LMU B;  1KP3 A;  3D8C A;  3H01 A;  3A0B Z;  4BAY A;  1AI5 A;  3VQW A;  2RQ6 A;  1XBL A;  4RUF A;  3QF7 A;  2W6J G;  3W7T A;  3ETE A;  5LXT A;  1PM9 A;  3FAV B;  5IT9 N;  2N04 A;  4PA6 A;  3OMA B;  3B09 A;  2FML A;  1JJO A;  4TV8 B;  5KA5 A;  3VQY A;  2GUZ A;  3T4D A;  1TUB A;  2A06 H;  1GH6 A;  3A0R A;  4R50 A;  1WAZ A;  3CRA A;  1HP8 A;  4PEL A;  5BR8 B;  4FZ0 A;  2P4K A;  1BQZ A;  1LR1 A;  2OYQ A;  2E5L O;  1FD9 A;  3C90 A;  3SPJ A;  1H2M A;  4JI8 O;  4RUE A;  3SGI A;  4NTX A;  1D2D A;  3CCR V;  1WP8 A;  3OEE G;  4O4J A;  5E79 Z;  4PA9 A;  1BE3 H;  2ZE6 A;  1VF6 A;  1GRJ A;  3E22 A;  3CSX A;  4LF4 B;  2IU3 A;  1DGS A;  4YJ2 B;  1O9H A;  3H1K H;  4WF9 V;  4F6R A;  1KP2 A;  3F5W C;  3JAS A;  1QLE B;  3IFX A;  3F7V C;  5J9P C;  1SQX H;  2ZXW C;  3WB2 A;  2UUB O;  1IVS A;  3FYI B;  1VQK V;  2X6A A;  4PA4 A;  2MW2 B;  4JF3 A;  3DSQ A;  5KUK A;  1NJI W;  4I0X A;  1GAX A;  2CAZ C;  3RYF B;  2O57 A;  1ZX3 A;  2X0L A;  1M93 A;  1L1F A;  1N34 O;  1EN6 A;  2HVK C;  1KU9 A;  4UCS A;  4JGS A;  5CA1 A;  3ZHV A;  1R3K C;  3ZMZ A;  4JI0 B;  4I9Q A;  3VOU A;  2VQE B;  4BW5 A;  1XHX A;  1ZWI C;  1YTF D;  1GN2 A;  2E76 B;  4MTX A;  1M9N A;  4ZHQ A;  5KHG A;  2UUC O;  1N32 O;  3T2M A;  4CS4 A;  3S3X A;  4D6T H;  1Q8I A;  2CTW A;  4GKJ B;  2G38 A;  4MVU A;  4OXS A;  5KHH A;  3EVK A;  1K73 W;  1GMG A;  4U7O A;  2XUM A;  1N0N A;  2F4V B;  5HFL A;  4MVS A;  4FMT A;  4CH3 A;  1F23 A;  4LF6 B;  3FD9 A;  1EFR G;  4IHJ B;  5L3B A;  4U3J A;  4DR2 O;  3CCQ V;  5IJ0 A;  1IBM O;  2QM8 A;  3FX7 A;  4JYA B;  3Q4H B;  4B7K A;  5LHH A;  3B8M A;  5EIB D;  2ZE5 A;  5EBM C;  4FM2 A;  5IYB O;  4ABM A;  2DYS C;  1S72 V;  2FB5 A;  1F4N A;  1LNQ A;  2LO1 A;  4TQF A;  1UPG A;  5LBQ A;  4JTD B;  1MZE A;  2ZQM A;  4UXN A;  4K3A A;  3FB5 C;  4O2A B;  4JAU A;  4X66 B;  3H1J H;  3E8H A;  4JI7 O;  1ZSP A;  4LFB B;  3E89 A;  2IJI A;  3QNE A;  2VWK A;  4GYC B;  5GTH Z;  3GVM A;  4OGQ B;  4DK1 A;  1DF5 A;  1KKD A;  2BTQ A;  2E74 B;  2ADQ B;  1WJZ A;  3CRM A;  3RYC A;  2C2A A;  3G6E V;  2HFE C;  4MVQ A;  1IDS A;  5BY1 A;  5H9C A;  1LUW A;  2YEV B;  4DV5 O;  2JGD B;  4IIJ B;  1H2G A;  3STL C;  4D7T A;  2Y0P A;  1OCC B;  2DMX A;  3G71 V;  3JAL B;  1G8M A;  1BGY H;  2F66 C;  3HKC A;  4BW9 A;  5IY5 C;  1TUE B;  4CH4 A;  4UCO A;  3ZMS A;  1HR0 B;  2WPD G;  2XAQ A;  5IJ9 A;  2D3O W;  3K0G A;  1OCR B;  4QGP A;  2VS0 A;  1XQ8 A;  4LF4 O;  2ZDI C;  2UU9 B;  2YIB D;  3APO A;  4B3M O;  3QG5 A;  3RVZ A;  3TCU A;  1WA8 A;  5KHK A;  3A2F A;  4H37 A;  5TIS Z;  2A7W A;  3ZHS A;  2HP8 A;  4CS2 A;  4DRX A;  1K34 A;  2F23 A;  3T1Y B;  2QWO B;  5JQG B;  4LWS B;  1FPO A;  4GCZ A;  2FTK A;  1WN7 A;  1PP9 H;  1S77 D;  4GLX A;  1A32 A;  3I55 V;  3K5O A;  1EN4 A;  3H9V A;  1VP7 A;  1YCI A;  2WA4 A;  2P06 A;  3CC2 V;  2K9P A;  1SZX A;  3RYI A;  1RP3 B;  4EB6 A;  4LFA O;  5GON B;  4UB8 Z;  4DXW A;  1H8E G;  4H0L B;  1WP7 A;  5JH7 A;  2RCV A;  1BHA A;  2CK3 G;  4JTC B;  1OCO C;  1J95 A;  4JI5 B;  3RT3 C;  2VQE O;  2ZE8 A;  3JAT B;  2EIL C;  4O4H B;  2YXH A;  2EIN B;  2R72 A;  2YI8 A;  1XMQ O;  1R6N A;  1L8D A;  3FYE B;  1E1Q G;  4L8J A;  1DLB A;  4K0K B;  2HLD G;  1JPX A;  4DR1 B;  3P3N A;  2WLL B;  2L35 A;  4PI0 A;  3FKS G;  1EN5 A;  1FXK C;  1H8H G;  3IJ4 A;  3C3S A;  1VQ5 V;  1PKX A;  4AQY B;  2HJD A;  1AI7 A;  4LF6 O;  3PJS K;  3AK3 A;  3KG2 A;  1XRE A;  1RM1 C;  3ZHR A;  4IGG A;  2CE4 A;  2QKC A;  4JYA O;  5B1B B;  4FPP A;  4FLZ A;  1JMK C;  4NXN B;  3S3W A;  4PDV A;  5ITZ B;  1HNZ B;  4DR6 B;  1NR7 A;  1HNX B;  4EFE A;  4PD4 F;  1XNR B;  2Q7H A;  1N8R W;  1FFX B;  2K1E A;  2QWP B;  3EXA A;  4I9W A;  3BAB A;  4PJ0 Z;  1TVK A;  1V54 C;  5J2T B;  4X66 O;  1IBL B;  4LBE C;  1S5J A;  2GV9 A;  3WU2 Z;  1VQ8 V;  4MVO A;  5D5P A;  2ZNJ A;  4DV6 O;  3ZMU A;  3P30 A;  1P49 A;  2PZS A;  4X20 A;  3CWB H;  1VIB A;  4O4I A;  4X89 A;  4FFK A;  4B3R B;  2ATK C;  2X6C A;  1AVM A;  4KHP B;  2QTO A;  1W0J G;  4QE9 A;  1JQ0 A;  3ABL C;  1NTZ H;  3KCX A;  2GUZ B;  3ASO C;  3ETQ A;  3JD4 A;  3CCU V;  1MMM A;  4DR5 B;  2AHZ A;  3AEI A;  2H94 A;  2FYU H;  2PUS A;  5DEC A;  3SYP A;  2JDI G;  2Y69 C;  5H2F Z;  1VF6 C;  1XIL A;  4I50 A;  3ABL B;  3ASO B;  4DO2 A;  5IWA B;  1M57 C;  1THZ A;  5LOV B;  3UQ8 A;  1HR0 O;  4H33 A;  1OCZ C;  2PY5 A;  2Y69 B;  1MSW D;  2DWE C;  2BOB C;  4DW1 A;  3F5T A;  3T1H B;  2EIM C;  4F6R B;  1MOF A;  5JCO A;  1Z2G A;  2Q0O C;  2UU9 O;  5EZY B;  3E8G A;  1COW G;  3LNM B;  3L75 H;  2B1G A;  1Z5V A;  2ZNI A;  3F7Y C;  2OCC B;  3OW2 U;  3T1Y O;  1GO3 F;  1E1R G;  4CBC A;  5B66 Z;  2E3C A;  5IE9 A;  5HFM A;  2KG7 B;  3ZRS A;  5FNV A;  1R6T A;  4OPA A;  1GN6 A;  1XMO B;  4I0X B;  2EBO A;  2AHY A;  3CD6 V;  3HKE A;  2ITD C;  1H38 A;  3JD3 A;  1SS3 A;  2QSA A;  3JAK A;  3TXS A;  3P32 A;  2OTJ V;  4X88 A;  1XHZ A;  3T4Z A;  4NVP A;  3FB8 C;  4ZHQ B;  1DF4 A;  1D5A A;  2NN4 A;  1IX9 A;  1H2L A;  3HKD A;  1NBM G;  1I5Y A;  4PDR A;  4B3T B;  2PTM A;  3ZN1 A;  1R6K A;  4K0K O;  3ZHU A;  2Q9L A;  4DR1 O;  2QWQ B;  3OTO O;  1SQB H;  1I0H A;  2EX3 A;  3R65 A;  4J10 A;  2HKO A;  3N27 A;  4FLV A;  5FPO A;  3J81 N;  4UB6 Z;  3K58 A;  4NXM B;  3K9A A;  4AQY O;  3AK2 A;  3N2G B;  5KX5 A;  1VQN V;  3UCS C;  3HPL C;  2UXB B;  5IJ0 B;  1PNL A;  2FKX A;  2UXC O;  4FJC C;  1R3L C;  1AJN A;  1R3I C;  5J2U B;  4TV9 A;  4MVM A;  2YS8 A;  5B1N A;  2GTS A;  2VQF B;  4NXN O;  4UV9 A;  3ASN B;  2IW5 A;  1P7B A;  4F6E A;  4G27 B;  4JI6 B;  1JA8 A;  2Z3Y A;  3OTF A;  1G4Y B;  4OPH A;  4E4E A;  4X64 B;  4IL6 Z;  2Y4T A;  4LCU C;  1XEQ A;  4JV5 B;  3W7X A;  2DYR B;  1NVP D;  2BTQ B;  3E35 A;  1XDC A;  1S76 D;  3K9S A;  4ZOL A;  1V55 C;  2IH3 C;  2IJJ A;  3AG2 B;  4ZI7 B;  3QO5 A;  4H13 B;  1Z5W A;  4I5S A;  3ZMV A;  4UCR A;  5KHI A;  3RYC B;  1SQF A;  2HJF C;  4DK0 A;  1HNW B;  5KMG B;  4YY3 B;  4CZZ A;  1ORQ C;  1Y76 A;  3CMA V;  3CHX A;  2V4D A;  2Q6A A;  3RN4 A;  3ICX A;  4DR5 O;  1Y66 A;  2DQ0 A;  1NH2 D;  2IJH A;  4Z1M G;  2JJ1 G;  1N36 O;  1YDX A;  4J42 A;  3RYH A;  1JCH A;  3UM7 A;  4UFZ A;  4ZBM A;  3B4S A;  4MTF A;  3MAQ A;  1J5E B;  5FL7 G;  2CH7 B;  3CCS V;  4FZ1 A;  4TSF G;  1M1K W;  4RWU A;  1FXV A;  4MTO A;  4MT8 A;  1B3Q A;  3L73 H;  1XUQ A;  1NR1 A;  1WA8 B;  3ZRW A;  1R3J C;  4Q6G A;  1FFT B;  1Y6X A;  3GWO A;  4CS3 A;  3P3P A;  1SQG A;  3ZCC A;  4DV3 O;  4RO2 A;  1NTM H;  2ZR3 A;  4GUN A;  1VQP V;  1UJW B;  4G28 B;  2ODM A;  5K1X A;  2HHH B;  1U97 A;  1XMO O;  3JD2 A;  4KFM A;  1Q90 D;  4JI2 O;  4J41 A;  3RYI B;  2HR3 A;  5GW7 A;  4LR3 A;  3AG4 C;  5L3C A;  3OEH G;  5CBF A;  4I55 B;  3OR7 C;  2ZXW B;  5EC2 C;  5JWP A;  3CC7 V;  2MK3 A;  2OT5 A;  3ML0 A;  4LF7 B;  2XAS A;  2V7Q G;  4WBN B;  1NTK H;  4P9O A;  1EBO A;  5H6R A;  3SPI A;  1AJP A;  3HR0 A;  1FKA O;  3CP1 A;  3IGA C;  4N21 A;  1NI8 A;  1JJ2 U;  2XHB A;  5EIB C;  4JI3 O;  3ETD A;  2ITC C;  1RSO A;  4YHH B;  2Z5U A;  4YJ3 A;  2NNU A;  2ZT9 B;  5BMV A;  2RNB A;  2UUA B;  2R9A A;  5JVD A;  3ZRX A;  4GKK O;  4X1K A;  4MSW C;  4FFB A;  4LNU B;  2F95 B;  2BSK A;  3L74 H;  4J9Y B;  2ZIM A;  2VQF O;  2JIZ G;  5B5E Z;  2PF4 E;  1HDJ A;  2Q68 A;  3LSS A;  1SA0 A;  4JI6 O;  1F4M A;  4DV7 B;  2WLM A;  2ZKO A;  1TVK B;  2NR5 A;  4X64 O;  2AXT Z;  4DV2 B;  3LDC A;  1FJG B;  2A3Q A;  1H2N A;  5LP6 A;  3K08 A;  1Q6I A;  1K4C C;  4LF8 O;  2WWW A;  2WLI B;  3CX5 F;  3LSU A;  2DYS B;  5LA6 B;  4KUM A;  4JYB A;  5LMU O;  2GSM B;  1Y74 A;  4IT5 A;  1HNW O;  4YY3 O;  4DV1 B;  4MW3 A;  1FYJ A;  4DW0 A;  2PGG A;  2ADP A;  2NLJ C;  1JFF A;  1IZ3 A;  2ZD9 A;  3BVO A;  3LSQ A;  2JJ2 G;  3SJA C;  5K1P A;  3CXC U;  2AZ2 A;  4I50 B;  3QVN A;  1K92 A;  1PL0 A;  2LFS A;  1AI4 A;  1R73 A;  5LGU A;  3HKB A;  1VQ7 V;  5JCO C;  1VF5 B;  5EBL C;  5BR8 O;  1L0L H;  4I4T A;  1J5E O;  4P30 A;  4B7E A;  3E8B A;  5BXZ A;  2VWJ A;  4GT1 A;  2EJ7 A;  2P67 A;  1PV0 A;  1QNM A;  2W6I G;  2BTO A;  1JOY A;  2EIJ C;  3G4S V;  3JAW B;  3D3I A;  2LJ2 A;  1IBK B;  3ZBH A;  3QO7 A;  1CPY A;  2PYL A;  5IY5 B;  1TAE A;  2LGQ A; 
#chains in the Genus database with same CATH homology
 3W7W A;  4PDL A;  5B1A C;  2ATK C;  2X6C A;  4WFA V;  2YSU B;  1ENV A;  3ASN C;  2QTO A;  2Q69 A;  1W0J G;  4JAS A;  5BZB A;  1NVP B;  1NQT A;  3DTU B;  4WFG A;  4QE9 A;  2JEX A;  1JQ0 A;  3ABL C;  3HB3 B;  4R6Z A;  5H6Q A;  2UXX A;  3OUS A;  3ASO C;  3JD4 A;  2WLJ A;  3CCU V;  3WFV A;  4EKW A;  2AHZ A;  3LDE A;  1PNM A;  1Q81 W;  1YIJ V;  3AEI A;  2H94 A;  1SZT A;  1IXM A;  5B1A B;  4TT3 G;  4LP8 A;  3SYP A;  2JDI G;  2Y69 C;  3CYO A;  1FXK A;  3T1C A;  2DYR C;  1ROP A;  3OMI B;  1K9M W;  3ABL B;  1YI2 V;  4BIZ A;  2WSS G;  5C93 A;  3ASO B;  4DO2 A;  1RPO A;  1EZJ A;  3AG2 C;  3E83 A;  3RVY A;  3TK1 A;  1M57 C;  1THZ A;  4TWK A;  1QBZ A;  1NH2 B;  4H33 A;  3OM3 B;  3OUF A;  1OCZ C;  2Y69 B;  5CBH A;  1FXH A;  1XL6 A;  3D36 A;  1MSW D;  3SJQ C;  1YJW V;  2DWE C;  2BOB C;  1Q7Y W;  1WPX A;  3SPG A;  1K7D A;  2EJR A;  1YSC A;  1K5Q A;  1SER A;  2X6B A;  4GX2 A;  2EIM C;  1KP3 A;  3ZRV A;  1MOF A;  1QCE A;  3H01 A;  4BAY A;  1VQ9 V;  1AI5 A;  2P7T C;  3OMN B;  4PA3 A;  4P2Z A;  3FB6 C;  4RUF A;  1QR9 A;  2W6J G;  3E8G A;  3W7T A;  3ETE A;  1COW G;  3LNM B;  2B1G A;  2XAH A;  4WCE V;  3JD1 A;  3F7Y C;  3ZIA G;  4RQE A;  2B5U A;  2OCC B;  4PA6 A;  3OW2 U;  3AG1 C;  1GO3 F;  3OMA B;  3CPW U;  1E1R G;  4XDL A;  4CBC A;  3DGE A;  3ZN0 A;  5KUM A;  1OCO B;  5KA5 A;  4BIU A;  5HFM A;  2EIL B;  5L3F A;  3LDD A;  4HYO A;  5B1O A;  3ZRS A;  3ETG A;  3OE7 G;  1JX9 A;  3T4D A;  3CCJ V;  4PA7 A;  3AG1 B;  2EBO A;  2WLK A;  5E1A C;  3A0R A;  4R50 A;  2AHY A;  4PEL A;  1E79 G;  2EIK C;  3ZMT A;  1GM8 A;  3CD6 V;  1M56 C;  3MHH C;  4GX0 A;  2JEU A;  2ITD C;  1K3E A;  1H38 A;  3JD3 A;  3SPJ A;  1GKF A;  4RUE A;  3CCR V;  3OEE G;  2A0L A;  1FXK B;  4PA9 A;  3SPH A;  3RW0 A;  3P32 A;  2OTJ V;  4X88 A;  3T4Z A;  3FB8 C;  2EZO A;  1DF4 A;  1M56 B;  1YJ9 V;  2IU3 A;  1OCC C;  4MW8 A;  2XAG A;  1RM1 B;  4WF9 V;  4HZ3 A;  3K04 A;  5EBW C;  1KP2 A;  1I5Y A;  1NBM G;  2R9I A;  1SRY A;  3F5W C;  1KD1 W;  1MG1 A;  4QE7 A;  5L3D A;  3FB7 C;  4PDR A;  1QLE B;  1SES A;  1I5X A;  3IFX A;  1AI6 A;  3ZN1 A;  1R6K A;  4J9Z B;  1CEZ A;  3F7V C;  3R65 A;  5J9P C;  3M99 B;  2ZXW C;  1FS0 G;  2HKO A;  2DW4 A;  1GM7 A;  3W7U A;  1S5H C;  2P90 A;  3K9A A;  3FYI B;  1F51 A;  1VQK V;  1OCR C;  2X6A A;  1V54 B;  3OFN G;  1BMF G;  4PA4 A;  4JF3 A;  1VQN V;  2QKS A;  2EIJ B;  3HPL C;  4JPR A;  4LC1 A;  5KUK A;  1PNL A;  1NJI W;  2XAJ A;  4FJC C;  1R3L C;  1AJN A;  1R3I C;  4WFB V;  2F43 G;  2X0L A;  4MVM A;  1QLN A;  2HVJ C;  2QA4 V;  5B1N A;  1L1F A;  1AJQ A;  2HVK C;  4JGS A;  1QVF U;  4UV9 A;  3ASN B;  2IW5 A;  1P7B A;  1R3K C;  4G27 B;  3ZMZ A;  1Q86 W;  3VOU A;  5LHI A;  5LGN A;  4BW5 A;  1ZWI C;  1YTF D;  2Z3Y A;  3LUT B;  4MTX A;  1G4Y B;  1M9N A;  3ABU A;  1GTO A;  3T2M A;  1W2B U;  3CC4 V;  5B3S C;  3TET A;  1BHB A;  4MVR A;  4UVC A;  4LCU C;  2XOK G;  3W7X A;  2Q67 A;  2DYR B;  1NVP D;  1ARO P;  4WFF A;  3ZRW B;  4MVU A;  3EHB B;  3E35 A;  3OR6 C;  4OXS A;  4UV8 A;  1K73 W;  1S76 D;  1GMG A;  1V55 C;  2YEV A;  2WAM A;  4U7O A;  2IH3 C;  2IJJ A;  3AG2 B;  3QO5 A;  1M57 B;  4I5S A;  3SYA A;  3ZMV A;  5B3S B;  3B8N A;  3CME V;  2HJF C;  5HFL A;  3WG7 C;  4MVS A;  4FMT A;  1OCZ B;  4JAV A;  1KQS U;  5EK0 A;  5EC1 C;  4CZZ A;  1F23 A;  1ORQ C;  1EFR G;  1K5S A;  3CMA V;  3E2E A;  2UXN A;  2R9R B;  2Q6A A;  4R8C A;  3UKM A;  1KEC A;  3X2Q C;  5L3B A;  3JD0 A;  3AG3 C;  1Y66 A;  2EIM B;  2EIN C;  3CCQ V;  2QM8 A;  2DQ0 A;  2QM7 A;  4G2K A;  5LHH A;  2P6J A;  1NH2 D;  2IJH A;  3JYC A;  3B8M A;  4Z1M G;  2WLH A;  2JJ1 G;  3K79 A;  5EBM C;  5IYB O;  1S72 V;  2DYS C;  3X2Q B;  2KB1 A;  1JCH A;  3UM7 A;  1F4N A;  1LNQ A;  3BY6 A;  4ZBM A;  1VQ4 V;  1K33 A;  5LBQ A;  4JTD B;  4MTF A;  2ZQM A;  2LFR A;  3K0D A;  4JTA B;  4UXN A;  5FL7 G;  3FB5 C;  4UUJ C;  4JAU A;  3CCS V;  1M1K W;  4TSF G;  3E8H A;  3E89 A;  1FXV A;  4MTO A;  2IJI A;  3QNE A;  4MT8 A;  5IYC O;  1BL8 A;  2EIK B;  1DF5 A;  2DQ3 A;  4GX5 A;  4QIW F;  4UVA A;  1NKD A;  1KKD A;  1NR1 A;  5B1B C;  2ZR2 A;  3ZRW A;  1R3J C;  3E86 A;  3SPC A;  1FFT B;  3K3W A;  3GWO A;  1VQO V;  1OZ0 A;  4L87 A;  3ZCC A;  4RO2 A;  2C2A A;  3B77 A;  3G6E V;  1GM9 A;  2HFE C;  4MVQ A;  2ZR3 A;  3ABM C;  2XAF A;  1VQM V;  5H9C A;  1VQP V;  1UJW B;  2OTL V;  2YEV B;  4G28 B;  3STL C;  2PI5 A;  1H2G A;  4F4L A;  1OCC B;  3E8F A;  3G71 V;  1G8M A;  4RAI A;  3JD2 A;  4KFM A;  4WFH A;  2HR3 A;  2V1D A;  5GW7 A;  2B1I A;  3AG4 C;  5IY5 C;  5IDJ A;  5L3C A;  1Q82 W;  1TUE B;  1JVM A;  4P9P A;  3OEH G;  3OGC C;  5CBF A;  4XDK A;  3ZMS A;  3OR7 C;  2ZXW B;  4N23 A;  2WPD G;  3ABT A;  4UVB A;  2XAQ A;  4MVZ A;  1VQ6 V;  5EC2 C;  1VQL V;  2D3O W;  5CA3 A;  3MD0 A;  3CC7 V;  1M90 W;  2MK3 A;  3K0G A;  2IJK A;  1OCR B;  4QPK A;  2OT5 A;  3CCL V;  3K06 A;  3ML0 A;  2WLL A;  2WLI A;  3I56 V;  2QE7 G;  2XAS A;  2V7Q G;  2ZDI C;  1K97 A;  4P9O A;  1EBO A;  4FIP C;  4HAM A;  1K8A W;  3RVZ A;  5H6R A;  3TCU A;  4H37 A;  4YXW G;  2XND G;  1OHH G;  4WFE A;  3SPI A;  1K34 A;  1S3J A;  1AR1 B;  1AJP A;  3CP1 A;  3IGA C;  4PDM A;  4N21 A;  4E2L A;  4X8A A;  1JJ2 U;  2M7W A;  1MAB G;  4GCZ A;  2FTK A;  1YHQ V;  3BEH A;  1S77 D;  3ETD A;  2ITC C;  2Z5U A;  3I55 V;  2LP7 A;  2NNU A;  5CBG A;  3CC2 V;  3ZRX A;  5CMU A;  4MSW C;  4ZKI A;  3IC7 A;  3ABK C;  4GX1 A;  1V55 B;  4J9Y B;  4QPJ A;  4DXW A;  3SYO A;  1H8E G;  5L3E A;  1W0K G;  3RBZ A;  2A79 B;  2JIZ G;  4KP4 A;  2OCC C;  3CCM V;  3WG7 B;  2GHY A;  3ZJZ A;  2PI4 A;  2Q68 A;  3OAA G;  3SYC A;  1S0V A;  3LSS A;  5KA6 A;  1BHA A;  2CK3 G;  4JTC B;  1OCO C;  1F4M A;  2WLN A;  1J95 A;  4Q20 A;  3GB7 C;  3ABK B;  2EIL C;  2WLM A;  1QR8 A;  3AG3 B;  4MTG A;  2EIN B;  3QO8 A;  1K4D C;  3LDC A;  4FK5 C;  1R6N A;  2IH1 C;  1Y4M A;  3FYE B;  1E1Q G;  3K08 A;  3MHS C;  1CP9 A;  2X7R B;  1DLB A;  4XDJ A;  2HLD G;  1JPX A;  4JYC A;  4U7N A;  1K4C C;  2QEX V;  1WLE A;  1P4R A;  5IYD O;  2WWW A;  2WLI B;  2WLL B;  3CCV V;  2DYS B;  1YIT V;  4KUM A;  4JYB A;  3SYQ A;  3CCE V;  3FKS G;  1DTO A;  4ASU G;  2H8P C;  1FXK C;  1H8H G;  2GSM B;  2ZDI A;  1VQ5 V;  1PKX A;  4MW3 A;  1AI7 A;  2NLJ C;  3PJS K;  4XBF A;  4QJF B;  3KG2 A;  3W7S A;  1QVG U;  5CN0 A;  1RM1 C;  2ZD9 A;  5DN6 G;  3NXS A;  3LSQ A;  2JJ2 G;  4R7C A;  3CXC U;  3JCZ A;  5B1B B;  1HWY A;  1QLE C;  3EFF K;  4FPP A;  1K92 A;  1PL0 A;  1PD3 A;  2LFS A;  1AI4 A;  1R73 A;  5LGU A;  1YJN V;  4PDV A;  1NR7 A;  1KC8 W;  1VQ7 V;  3VBB A;  3ABM B;  5EBL C;  5LGT A;  2W0F C;  1B6Q A;  1N8R W;  2K1E A;  4P30 A;  3E8B A;  4I9W A;  1PNK A;  4GT1 A;  1V54 C;  2IU0 A;  4RQF A;  2P67 A;  2HG5 C;  4LBE C;  2W6I G;  3K03 A;  1JOY A;  2EIJ C;  3G4S V;  4QNH B;  5LHG A;  2Y48 A;  3D3I A;  1VQ8 V;  1SET A;  3QO7 A;  1CPY A;  4MVO A;  5L3G A;  1YTF B;  2DWD C;  1RPR A;  2JK5 C;  3AG4 B;  5IY5 B;  3ZMU A;  2EZP A;  3P30 A;  2BOC C;  5DM6 V;  4MS2 A;  1GK9 A;  3STZ C;  1XL4 A;  2A9H A;  4X89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...