4PA6A

Structure of navms pore and c-terminal domain crystallised in the presence of channel blocking compound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 29
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa6A00
4H33A 1XL6A 1V55C 4RAIA 4ZBMA 3E89A 1OCOC 4MW3A 4GX0A 3SYOA 4MW8A 2HFEC 3ABMC 3E8FA 4PA9A 3ABLC 1XL4A 2X6BA 1R3LC 4LP8A 3LNMB 4XDJA 3ASNC 1BL8A 2R9RB 4MVRA 5B1BC 3SYQA 3UM7A 3SPCA 3ABKC 1M57C 1R3JC 4MVZA 1R3KC 2HJFC 5B1AC 1OCRC 3E8GA 4R8CA 5CBHA 2WLJA 1OCZC 3SYCA 5B3SC 5KUKA 4LBEC 1M56C 2WLMA 4MS2A 3SPGA 2BOCC 4F4LA 5EC1C 4PA3A 2HVKC 3WG7C 3RVZA 2JK5C 3LDEA 2P7TC 4X88A 1S5HC 2DYSC 4P9PA 4MVSA 2YEVA 4R6ZA 4PDVA 1G4YB 3AG3C 4QE7A 1KKDA 2WLKA 4PDMA 3F5WC 3LDCA 2Q67A 4WFFA 4JTCB 4PA4A 4MSWC 4HZ3A 4MVUA 1JVMA 2DYRC 4GX2A 4I9WA 3K04A 2ATKC 3SYPA 3E8HA 1OCCC 4PDLA 3AG2C 2A0LA 2NLJC 4MTFA 4MVMA 3RW0A 2H8PC 3BEHA 3LUTB 3STLC 2Q69A 2EINC 4P9OA 4UUJC 3SPHA 3FB8C 5J9PC 3PJSK 5CBFA 2A9HA 5EK0A 4MVQA 2WLNA 1QLEC 3RBZA 4BW5A 3OUSA 3OR6C 5E1AC 3E8BA 3UKMA 2ZXWC 3K0GA 2OCCC 2AHYA 2Q6AA 3STZC 2IH1C 3X2QC 1ZWIC 5CBGA 4WFEA 3ZRSA 4R7CA 3ASOC 2WLIB 4PDRA 2K1EA 3F7YC 4WFHA 5BZBA 3K03A 4J9ZB 3AG4C 2WLIA 2BOBC 2WLLB 3K06A 3VOUA 3GB7C 4KFMA 5EBLC 2ITCC 5EC2C 2WLLA 3ZJZA 3SJQC 3T1CA 2KB1A 3HPLC 4OXSA 2EIMC 3SYAA 4LCUC 3T2MA 5IY5C 4RUFA 2AHZA 3AG1C 3FB5C 4R50A 4CBCA 2DWDC 1LNQA 2QKSA 4JTDB 5EBMC 4QNHB 3TCUA 3OR7C 4G28B 4RO2A 4GX1A 3JYCA 2EIJC 3F7VC 3FB6C 3R65A 4PA7A 1V54C 4H37A 3EFFK 3E83A 1ORQC 2X6CA 5EBWC 3SPIA 3T4ZA 5KUMA 3OUFA 4JTAB 4DXWA 4WFGA 1R3IC 4X8AA 2A79B 3FB7C 4MTOA 3IGAC 3KG2A 3RVYA 4EKWA 2IH3C 2ZD9A 1K4CC 3K08A 2HG5C 4G27B 4HYOA 4MTGA 4P30A 4TWKA 3TETA 3IFXA 4PA6A 2Y69C 3OGCC 4XDKA 3E86A 1P7BA 4XDLA 2QTOA 1J95A 4J9YB 2EIKC 1K4DC 3SPJA 4P2ZA 4RUEA 2Q68A 2W0FC 2DWEC 2EILC 3K0DA 4X89A 4MVOA 4QE9A 2HVJC 2WLHA 3LDDA 4GX5A 2X6AA 3T4DA 2ITDC
chains in the Genus database with same CATH superfamily
2HHHB 4NXNO 3CS5A 2UXCO 1N32O 2F93B 2E74B 2FB5A 2H94A 4JI3O 5IE9A 3AK1A 3E2EA 4J42A 4MVZA 4FLUA 5CBHA 4JYYA 1IZ3A 3MD0A 4OPHA 4JI6B 3HR0A 3T1YO 5B1AB 4X20B 1XMQO 3FYIB 3HKDB 1W0KG 2YEVB 1H2SB 1R6TA 2JGDA 5JVDA 4IHJB 2QWQB 1AI4A 4O2AB 1S77D 1I7FA 3ZHSA 1DK1A 5LBQA 1IBMO 1E1QG 1ZSPA 3PJSK 2YIDA 2Y0IA 4X1KB 3H01A 4O4LA 3FYEB 4W4KA 4FK5C 1X59A 2K1EA 1PP9H 2WLIA 2V1DA 4ABMA 5J2UA 5KAIZ 3HKCA 4JYBA 1D5NA 4LCUC 2L35A 1CP9A 5ITZA 3B8NA 3A0HZ 3QTCA 1T5EA 2UUAO 1Q82W 3SPIA 3A2FA 3C3TA 3HKBA 4MTOA 4CS3A 1IBKO 3IGAC 4B3MO 4NXMO 4HYOA 3S3WA 4O4IB 3NR7A 3IFXA 2Y69C 3G80A 5LYJA 3N2GA 1MSDA 2ODMA 2W0XA 1N33O 4I55A 1J95A 4FFBA 3APOA 2WLHA 1XDCA 3DC6A 4H33A 2ADPA 2F43G 1G1XB 3VQVA 4PA9A 1L1FA 4IL6Z 1WN7A 1KC8W 1QVFU 5JH7B 4U3FH 4RQFA 1M56C 1Z5WA 4BIUA 5KX5B 2CTWA 3OEHG 2UXBB 4K0KO 2JGUA 5IJ0B 5BXZA 1SERA 4K8ZA 1HR0O 5J2TB 4JTCB 2DYRC 4RWUA 4CC5A 2GV9A 2JJ2G 3D36C 3K04A 4E2LA 1I94O 2UU9B 3AG3B 5LMNO 4DV5B 2UUCO 2FYUH 4BIZA 2M7WA 2Q4PA 4FVMA 4CC6A 1QLEC 2JS5A 4FJCC 4IGGA 4JGSA 3EHBB 2XOKG 1QR9A 4JI1B 1N34B 1M5IA 4TSFG 2P22C 1V9PA 4I0XA 5JQGA 4QPKA 4L87A 2A06H 3S3XA 4I50A 4DK0A 4RQEA 2DQ0A 1VQLV 4OXSA 5FL7G 3T2MA 3ZEDA 4QNHB 4DR6O 3JYCA 2EIJC 2DMXA 2K9PA 5L3FA 1COWG 3VQWA 1ZL8A 2E75B 3ZCCA 4AI8A 4EKWA 1QBZA 1K4CC 2E5LB 2N04A 2VQEB 2OWOA 1P7BA 3A0RA 3K5LA 3OAAG 4Q20A 5B1BB 5LL6Y 1XUQA 1EN5A 1F23A 4LF6B 1U96A 4FLVA 3LDDA 4LFCB 3H1IH 1J5EB 1HWYA 2VS0A 4ZBMA 1YF2A 4MW3A 4GX0A 3K58A 3BAAA 3CE2A 3ABMC 2ZKOA 3CYOA 3K57A 1NH2D 1P84F 1HNWO 3SYQA 1BHBA 1HNZO 2B9ZA 4J80A 2Q5ZA 1BMFG 4OGQB 2HJDA 1FJGB 2Z3YA 4U3JA 2XAQA 1N0NA 5KHIA 3B09A 4TV9A 4LF4O 2UUBB 2ZE8A 1BCCH 1UPGA 4JYAO 5KLVH 1NH2B 1S5HC 4DV1B 1GRJA 3ABUA 3CB2A 1RM1B 1VQ5V 1AROP 2QWPB 4JPRA 5JVDB 4K8XA 3F5WC 4MSWC 1VQ8V 1XMOO 5IYBO 4UVCA 1OCCC 4FM1A 5LHIA 4IYHA 2DOSA 4O4LB 2Y4UA 2ZDIC 3AG2B 3DTUB 1W59A 2HR3A 4LFBB 2WWWA 2NNUA 1NZ6A 4DR4B 1K7DA 2WLIB 5LOVA 4LF8B 3W7TA 3FAVA 3CC4V 5IJ9A 5J2UB 4KFMA 1URFA 3HKCB 3ZJZA 3ZX6A 1AJPA 1I08A 5ITZB 1E79G 1BQ0A 3DXRA 5EBMC 4DV6O 2YIAA 3TCUA 4JYCA 3G4SV 4DV3B 1I0HA 3HKBB 3T4ZA 4WFGA 1NKDA 1R3IC 3QO5A 1B6QA 3K08A 3GWKC 3ZN0A 5LYJB 1L0LH 4I55B 1VEWA 3D8CA 4KUMA 1VQMV 4FFBB 2F66C 4KL1A 4CH6A 5CB4A 4WFAV 1TGOA 4RUEA 2Q68A 3RWRD 1TUBA 2Y48A 5KA5A 4XBFA 3VQYA 3H1KH 4J7ZA 3SYOA 4GKJO 4PV1B 4DR1B 5B1BC 4HBNA 3JD2A 3L72H 2XASA 3SJBC 1SQXH 4LF9O 2ZE5A 3VQXA 5IT9N 3U10A 3TXSA 4X64O 1K8AW 1NR7A 3W7WA 1BQZA 1NJIW 4HZ3A 2QWOB 2ZE7A 3SYPA 1JJOA 1IXMA 1S3JA 1XNQB 2Q69A 3ZRWB 2EINC 3JSLA 3D36A 3CCUV 2WLNA 4DV7O 5IWAO 3OUSA 1FFXA 3UKMA 4I0XB 5JQGB 3X2QC 2D2CB 5B5EZ 1ZWIC 3L9DA 4ZOLA 4WFEA 2LGWA 2P5OA 4I50B 2F4VO 1KECA 3GB7C 3L75H 3CEIA 5EBLC 5C8YA 4JAAA 3LSQA 3T1CA 4LWSA 4K35A 5IY5C 3MHSC 2Q7EA 1Z5VA 5LMUO 3A0BZ 1SQPH 3FB6C 2EIMB 3OTFA 5HFLA 1R73A 1ZL8B 2ZM6O 1I5XA 1YTFB 4UVAA 2YIBA 1FKAO 1JJ2U 4LF7O 1EZVH 2ZD9A 1OHHG 2F95B 2EBOA 2PYJA 4X1IA 3AG7A 2R9IA 5LGTA 5KHKA 4PELA 4NKGB 4MVOA 1IDSA 2HVJC 2XHBA 4J9ZB 2X6AA 4DV4O 1XNRB 4RAIA 1JA8A 2LW1A 1L8DA 4X65O 3FKSG 5BMVA 1QR8A 1BL8A 2R9RB 3AEIA 4OX9O 3K5MA 3SPCA 2P67A 4D7TA 4R8CA 3CRQA 4FM2A 4QJFB 4U3JB 5B3SC 4JI5O 4TV9B 4YIOA 4TT3G 1XREA 4YIPA 4ZIBA 3U0ZA 3P30A 2JK5C 2RJZA 2KSDA 3RN4A 1DF5A 2PUSA 3QO7A 3L73H 4PA4A 4UB8Z 4AQYO 1JR9A 2JEUA 3R66A 1CXZB 2H8PC 4HAMA 2EZOA 2KG7A 3PN1A 4UUJC 3SPHA 2JRIA 5CBFA 2VQFO 3KZIZ 3RBZA 1WA8A 4DV2O 2QTSA 2ZXWC 1FXKC 5LOVB 3L71H 3FAVB 2Q0AA 5IJ9B 5BZBA 3KCYA 2ZDIA 2UXNA 1BE3H 4UV8A 2CUGA 3FFQA 2KB1A 3AK2A 4YY3O 3DXRB 2AHZA 3N27A 4EEQA 1Y76A 4H13B 4JI4B 4GKKB 2QKSA 4WFBV 2XAFA 1IBLB 2X6CA 1P49A 3BY6A 2IM9A 5LGNA 1F51A 1FAFA 3KG2A 4FLZA 4O4JA 4X62O 1QNMA 3T1HO 2O57A 1DLBA 3TJTA 5CB4B 4X66B 1TUBB 2OTLV 2JIZG 2DQ3A 2Y69B 2EILC 2HHHO 4J41A 1O9HA 1E1RG 2ZNIA 2ZE6A 3RFRA 3RYCA 4F6EA 4NR1A 5LGUA 1HDJA 1XL4A 2G38A 4DK1A 2HEPA 3ABKC 3B2EE 1Y6XA 1R3KC 1OCRC 3E8GA 4JI6O 1SS3A 2BOCC 3JATA 2HVKC 3RVZA 2XNDG 4D6TH 1QQCA 4X88A 2JEXA 2CAZC 1M56B 1WAZA 2DYSC 2AZ0A 4PDVA 5KMGA 5D5QA 1JVMA 1Y67A 2R72A 1YCIA 2DYRB 1EM1A 4DUYB 5IYZA 1NT2B 2GBOA 3H1JH 1FFXB 1BZKA 4ZOLB 2IW5A 4J11A 2Q6AA 2HKOA 4PDRA 1QLEB 4WCEV 1MZEA 2CTQA 3AG4C 2EJRA 2YIBD 5C8YB 1W0JG 1RFYA 1FXVA 4B7KA 1Q3EA 2V4DA 4JI7B 4LWSB 1ROPA 4TUYA 2AGAA 4NB5A 2UXDO 2PI4A 3CX5F 3CXHF 2IJKA 1PL0A 2R9AA 1Q8IA 1VMGA 1XEQA 3E22A 1WB8A 2BE3A 3QG5A 1KB9F 2IU3A 1MG1A 2VWKA 4DXWA 4NXNB 2IJJA 1VQKV 2UXCB 2EIJB 1N32B 1ZX3A 4X1IB 2RQ6A 2OIGA 3BHPA 4X9QA 3OGCC 5JCOC 2NR5A 4AHCA 1OJHA 4FMTA 1FFTB 3CPWU 4FLXA 1AJNA 2QA4V 3T1YB 4IIJA 3T4DA 1VF5B 5LHHA 3DGEA 5BMVB 1Q90D 4DUZB 1M57C 4FPPA 5D5PA 3ABMB 2CDYA 3ZHQA 5KHGA 4LR3A 3CRCA 3GWOA 1IBMB 2WA3A 1K9MW 5JJEB 1SC5B 2P4KA 1RPRA 5GW7A 4DV5O 4JZGA 1R6KA 2KG7B 1M4UA 3BEHA 5TISZ 4DV0B 4P9OA 2GSMB 5LHGA 1OCCB 1S76D 1WA8B 4JI1O 1N34O 2WSSG 3ZHVA 3OR6C 4QGPA 1KKCA 5CBGA 1RPOA 1SF9A 3W7UA 2YXYA 1GKFA 3F7YC 3FX7A 3OEEG 2UUAB 2W6JG 1TUEB 4JI2O 4LNUA 1B06A 3F5TA 1FYJA 1FXKA 1PL4A 2JS3A 1Y76B 3ETDA 4U7OA 2GUZA 1N33B 3L70H 2C2AA 4NVPA 2P6JA 4G28B 1Q81W 3E83A 1PKXA 1NTKH 3MHHC 1XHZA 4ASUG 4KXRA 5KUMA 2VQEO 1OZ0A 2LO1A 2B5UA 2A3QA 4XDKA 5JJNB 2OCHA 4PA6A 4DR3B 3CCRV 4DRXA 3CCJV 4LF6O 2QSAA 4LFCO 2RNBA 4YHHB 1J5EO 4PD4F 3LSUA 3RYCB 1Q6HA 3KCXA 4UCOA 1JPXA 3E89A 2ILMA 2QEXV 1K34A 2MW2B 1HR0B 3CCLV 4KP4A 2Q7GA 3ASNC 2FMLA 1FJGO 4MTXA 3W7XA 3QO8A 1OCZC 5LMNB 4ICGA 3JATB 2UUBO 5EC1C 1PPJH 4DV1O 4DW0A 1NTZH 1M1KW 5KHJA 4UVBA 5KMGB 2Z5UA 1KKDA 2WLKA 3J81N 2Q67A 1TVKA 1VQNV 4CH3A 4CH4A 2E76B 5K1XA 3IC7A 3H1HH 5IYZB 1PNMA 2OIEA 1GM8A 1ZUQA 3FB8C 5J9PC 4KHPB 4LFBO 5E79Z 3SR2C 5C93A 4EB6A 2P06A 1Z2GA 2QWNB 4DR4O 2EINB 2OCCC 5CN0A 3MAQA 1H2MA 2JGDB 2M6YA 3ZRSA 1AR4A 4FIPC 4WFHA 4DR7B 1MSWD 3ZHRA 2BOBC 1SQFA 3X2QB 4J7KA 4TUYB 4DR2O 1JQ0A 4O2BA 3SJQC 1PNKA 1YJNV 1FXHA 3AG1C 2E3CA 3E22B 5H6QA 4DV3O 4EFBA 3NXSA 2JJ1G 5FPRA 2YICA 5IY5B 3APQA 3RYFA 1YSCA 2YC0A 1BHAA 1EFRG 4UCRA 1US6A 3KKYA 4HNAA 5IYCO 3O65A 2CK3G 2A79B 4ZHQA 1JCHA 1YZBA 1AILA 3BA8A 1D2DA 3TK1A 3BFRA 1MA1A 1MNGA 1FD9A 4P2ZA 3IAYA 2N74A 4IIJB 3AK3A 4QE9A 2QM8A 5JCOA 1B3QA 2LP7A 2ITDC 2YSUB 2YDEA 4JYAB 1ZTEA 5DN6G 3E8FA 4GUNA 1F4MA 3J7AU 4ZI7A 3OT7A 2PI5A 2CGOA 4DYLA 3N2GB 1Q7YW 3L74H 1AI5A 2AXTZ 5KUKA 4EFEA 1M93A 1PNLA 2ARHA 4LFAO 5EYPA 1RSOA 5B3SB 3M8AA 4MVSA 4B3RO 3RT3C 1SQBH 3ZMVA 1GN2A 4NYKA 1BGYH 1XNQO 2PYLA 4MVMA 2IBZH 1N36B 3LUTB 1YI2V 2F1MA 2V7QG 1H8HG 2A9HA 4WBNA 1NU1H 1GM7A 1VQ9V 2B1GA 1DF4A 1GM9A 2EULA 3STZC 1IX9A 1XQ8A 2ETNA 3ZIAG 4LNUB 4CS2A 3ZHTA 4QIWF 4PHZA 3VOUA 4Z1MG 2ZXWB 1FXKB 5B1NA 3CCSV 3K9AA 2WLLA 2GUZB 3TXQA 3ZN1A 1KBHA 4O4HA 3FB5C 1P7GA 4CS4A 3K5NA 2QKAA 3OR7C 3JSNA 4GX1A 3F7VC 3P3NA 3OFNG 2CH7A 3CRRA 2QM4A 2YXLA 4GKJB 4B3SB 1IURA 1K5QA 2OT5A 4I4TA 2B1IA 4FFKA 3B40A 2GHYA 4YJ3A 2PY5A 3SJCC 1SETA 3SPJA 1XOUA 1XNRO 3Q4HA 4JI0B 1K92A 3I5DA 4JTDB 2VRZA 1OCOC 3QF7A 2EILB 1NI8A 4MW8A 2HFEC 2R70A 3K3WA 5BR8B 1WLEA 1NTMH 5JJJB 3G67A 3D3IA 1R3JC 3BABA 4NTYA 2D3OW 1SQGA 2HJFC 4FZ1A 3CCEV 4F4LA 3ABKB 2P4VA 4PA3A 4X1KA 1OCRB 5DEDA 3LDEA 1LUWA 5B1OA 1TVKB 3WB0A 4I9WA 1AI6A 2DYSB 3E8HA 4NTXA 3RW0A 5FNVA 4JI8O 4H44B 3J80N 3JASA 2CTPA 3OM3B 5IYDO 3DC5A 1KYOF 2X7RB 1VIBA 2EJ7A 3K03A 2PZSA 4O2BB 4BWAA 1PV0A 1S0VA 1F4NA 1Y74A 1GH6A 2X0LA 1YIJV 3HKEA 4JI4O 4GKKO 3AG4B 3JAWA 1VQ7V 4UCVA 1NBMG 1IBLO 2HLDG 3I56V 1BS3A 1CPYA 4RO2A 1SZXA 3RYFB 1S5JA 1V54C 5BY1A 4HNAB 4DV4B 1QVGU 1P4RA 1ORQC 2GTAA 4ZHQB 3G6EV 4OPAA 3N2KA 1IVSA 1GTOA 1SRYA 1S5LZ 1PM9A 4P30A 3ICXA 1DGSA 3BRCA 1JFFA 4OX9B 1Y66A 1W2BU 4J9YB 1N0JA 4DW1A 1AVMA 5K1PA 2W0FC 1GMGA 3BPZA 4X89A 1QCEA 2F23A 1QU7A 4DR5O 4QE7A 1Q5OA 1HNXB 5LXTA 1V55C 1VF6C 1SKVA 1XBLA 4ZI7B 3OTOB 4G2KA 5LP6C 4LF5B 4JV5B 3WFVA 3CRAA 2YI9A 2LW7A 4B3TB 1JMKC 4JASA 4LH7A 2LGQA 2ZT9B 1SA0A 1M57B 5EYPB 1RSOB 1R1BA 3CCVV 3CSXA 4DV2B 5H2FZ 5CA3A 1K3EA 1WP8A 1VP7A 4N21A 1G8MA 5B66Z 3CP1A 3ZMSA 2A0LA 2ZR3A 1M9NA 4DUYO 4WBNB 1VF7A 1KP2A 4YY3B 1N8RW 1L0NH 5E1AC 3E8BA 2AHYA 3C3SA 2ADQB 3ASOC 3B8MA 1NVPD 4JI7O 4E4EA 2WLLB 3UQ8A 2WAMA 3CHXA 2NN4A 4O4HB 3T1HB 4FZ0A 3BA9A 1VARA 3ZRXA 3QNEA 4PA7A 1NVPB 1CEZA 1KP3A 3UCSC 5H9CA 2CH7B 1R6NA 2PF4E 3FB7C 1NR1A 1YDXA 4I4TB 4G27B 4GZRB 4YJ3B 1AB3A 1LUVA 4YXWG 2XUMA 3Q4HB 3UO3A 2CGNA 1GK9A 2DWEC 3B77A 4W4LA 3ZMUA 4Z2WA 1PD3A 4GX5A 2CE4A 1XL6A 4I5SA 3OMAB 5L3DA 1XHXA 1B04A 2QM7A 4DUZO 5EZYA 1KU9A 5KHHA 4JI3B 3UM7A 5GTIZ 1EN4A 1OV9A 3ASNB 2HP8A 1MOFA 3SPGA 2DW4A 3SDLA 3WG7C 4L8JA 1OCZB 5L3EA 1XMQB 3LDCA 2ZIOA 2RDCA 4WFFA 3UT5A 1VQOV 1Q6IA 3I55V 5FNVB 4DV0O 1U97A 2NLJC 3JASB 2ZNJA 3STLC 2UXDB 1RP3B 5EK0A 2ZINA 2UXBO 2OTJV 1XI1A 5DECA 1EBOA 1K97A 5IDJA 3G6BA 4FM0A 1UJWB 3K06A 1FS0G 2UU9O 1Y74B 2OCCB 3HKEB 5EC2C 3TGUH 3JAWB 2XAJA 2MK3A 4I7ZB 4RUFA 3DSQA 2VWJA 2EX3A 3AG1B 3BVOA 2JVDA 2YXHA 3N2KB 2GTSA 3OUFA 1HP8A 4IT5A 4DR3O 1AR1B 2IH3C 4J7JA 1ZAUA 5CMUA 1JFFB 4F6RA 2L6LA 4FLTA 1IBKB 4B3MB 4NXMB 1WB7A 2RCVA 1KMIZ 2EIKC 1H2GA 4YHHO 5H6RA 1KUQA 2Z0AA 3K0DA 2AW9A 5LXTB 4B7EA 5EIBC 4MVUA 3CC7V 4TQFA 2Q73A 4FLWA 3K59A 3WB1A 1QHTA 4TQDA 1K73W 2QR4A 1GN3A 2E5LO 2X6BA 2RN9A 1YXBA 4O4JB 3LNMB 4MVRA 4N23A 5CA0A 2OYQA 3IJ4A 3CJHA 3H9VA 3M99B 5B1AC 1VF6A 1GAXA 2WLJA 2UXXA 1SA0B 1VQ4V 3ZRWA 4MS2A 5LP6A 3RYHA 1D5AA 4A5UB 1ENVA 4K0KB 3CWBH 3JCZA 4ZKIA 1K33A 3EVKA 5CA1A 4JI2B 4Z1VA 1JX9A 4KHPO 3WB2A 1EZJA 1DTOA 1YJ9V 4Q6GA 1I94B 2W6IG 1G6UA 2UUCB 1TA8A 4UB6Z 2YS8A 4DR7O 2FKXA 3K0GA 1AR5A 1X4TA 2XAHA 3W7SA 4JAUA 2ZCEA 1MABG 5DM6V 4B08A 3OGIB 2QWRB 3ETGA 5GTHZ 4CBCA 1SQVH 4YJ2A 4UV9A 2BTOA 4X1YA 4H37A 4DR6B 1YVWA 4LF8O 5EBWC 3SJAC 3CMEV 3ZMTA 1KQSU 1SQQH 3M7MX 3JD3A 4XDLA 1JOYA 2BCCH 3K79A 2Q7HA 2A7WA 3JCUZ 1ZLZA 4TOIA 2XTAA 5KA6A 3OD4A 3RYIA 2LFRA 2KKWA 5EZYB 2RMKB 2PGGA 3JD0A 1YJWV 1R3LC 3EXAA 4LP8A 4UCUA 4XDJA 3OE7G 1OCOB 4UXNA 1HNWB 3K5OA 2LQTA 1HNZB 5GONA 1BT8A 3ML0A 2Q9LA 3JAKA 3JARA 3OW2U 2IU0A 4LF4B 4TV8A 4DR1O 3AG3C 3ABTA 4I9QA 3UT5B 3THOA 4K3AA 1N36O 2WPDG 1XMOB 4DR2B 3FD9A 3D3QA 5LA6A 1NQTA 1S72V 4MT8A 2ZIMA 3JAMN 2WA4A 4BW5A 1WPBA 1M90W 2IJHA 4IYIA 4PJ0Z 2ZR2A 3JALA 3G71V 5FLXN 1WP7A 1H2NA 4PI0A 3SYAA 1VQPV 4UCTA 3MDSA 4R50A 1LNQA 1F7YA 3CRMA 3BCCH 2QGNA 3R65A 2BTQA 4DV6B 5AG2A 4FLYA 2H3OA 3CXCU 4B3SO 3ETEA 4X8AA 4F6RB 3RVYA 1V54B 4JF3A 4MTGA 2BSKA 5L3BA 3HB3B 2XAGA 3E86A 3ABLB 3CCMV 2QJ1A 5FPOA 1KD1W 5A2QN 3JD4A 4JI0O 1IXBA 1THZA 2EZPA 2Y0PA 1MMMA 2DJVA 4LFAB 3JD1A 4BR6A 5BR8O 2QKCA 3UO2A 1HW7A 4B3RB 5CA0B 1V55B 3CJHB 4C7UA 2P90A 3O9OA 4DRXB 5LP6B 2WLMA 3RYHB 1RM1C 1AP5A 4LF9B 4X20A 1MZFA 4P9PA 3B4SA 3HKDA 2YEVA 4R6ZA 2QE7G 1G4YB 4PI2A 2DN9A 1H38A 4X64B 1A32A 5CA1B 4GX2A 2Q8VA 1YTFD 4IHJA 2ATKC 1Q43A 4O2AA 1EN6A 4PDLA 3AG2C 4D7SA 4UFZA 1WPXA 1Q86W 4MVQA 4NTWA 1GN6A 4DV7B 2N05A 5IWAB 1SESA 2IJIA 2DE0X 1FPOA 3CD6V 2ITCC 2F4VB 1NS1A 3ASOB 4JAVA 1TAEA 4LH6A 4AILC 1XILA 1YHQV 3OMNB 3OMIB 4YJ2B 1AJQA 4EB6B 5JWPA 2ZQMA 4X1YB 1BSMA 2Q0OC 5LMUB 3A8TA 4GLXA 3EFFK 4BIOA 2FTKA 4BAYA 1H2KA 4GYCB 1GN4A 1GO3F 2ZM6B 2HG5C 3CCQV 4LF7B 4GCZA 1YEWA 4WF9V 4O4IA 3C90A 3P3PA 5L3GA 3WU2Z 3H1LH 4DO2A 1VQ6V 1HNXO 4GT1A 2PTMA 3SGIA 5H5NA 2QDOA 3RYIB 3OTOO 5A9GA 1YITV 5F2VO 4H0LB 4CZZA 4LF5O 4JV5O 3ABLC 4JZ2A 4X65B 4B3TO 3ZS8C 4X66O 2AZ2A 5GONB 1H8EG 3SYCA 1WJZA 5JH7A 4LBEC 4JI8B 3JAKB 1H2LA 3JARB 4JI5B 3ZBHA 1UFIA 1Q6UA 4TV8B 3QVNA 2CTRA 5KX5A 3GVMA 2P7TC 3LNNA 3U11A 2XT9A 1O9GA 5HFMA 4PDMA 5IJ0A 3WG7B 5J2TA 4AQYB 4U7NA 4MTFA 3VBBA 5LA6B 5KAFZ 1LR1A 1SZTA 1AP6A 2Y4TA 2VQFB 4J10A 2IH1C 3ZMZA 4R7CA 1K5SA 3ZHUA 3RGBA 1QLNA 2GDSA 3IC9A 3JALB 2YI8A 1AI7A 1I5YA 2JDIG 2YUAA 3HPLC 2EIMC 3P32A 4BW9A 2DWDC 2LFSA 2BTQB 1WNSA 2FL4A 4QPJA 1Y4MA 2KQXA 4DR5B 3CC2V 5L3CA 4JTAB 2LJ2A 3E35A 3LSSA 2BSKB 3ZRVA 1N4CA 4TWKA 3TETA 4X62B 4UCSA 5EIBD 3CMAV 2QTOA 3ETQA 1K4DC 4LC1A 3K9SA 4CH5A 2EIKB
chains in the Genus database with same CATH topology
3CC7V 4RAIA 2YSUB 1K73W 5DN6G 3E8FA 2H94A 1F4MA 2X6BA 3FKSG 3LNMB 1QR8A 1BL8A 2R9RB 4MVRA 4N23A 3AEIA 2PI5A 3E2EA 3SPCA 1Q7YW 4MVZA 2P67A 3M99B 5B1AC 1AI5A 5CBHA 4R8CA 2WLJA 4QJFB 2UXXA 5B3SC 5KUKA 1VQ4V 3ZRWA 3MD0A 4MS2A 1PNLA 4TT3G 5B1AB 3P30A 2JK5C 3FYIB 1W0KG 2YEVB 5B3SB 1ENVA 4MVSA 1DF5A 3QO7A 3JCZA 4PA4A 4ZKIA 1AI4A 1K33A 3ZMVA 1S77D 2JEUA 1JX9A 4MVMA 1EZJA 2H8PC 3LUTB 1DTOA 4HAMA 2EZOA 1YJ9V 5LBQA 1YI2V 2W6IG 4UUJC 1E1QG 2V7QG 3SPHA 3PJSK 5CBFA 1H8HG 2A9HA 1GM7A 1VQ9V 3H01A 2B1GA 3RBZA 1DF4A 1GM9A 2ZXWC 1FXKC 3K0GA 3STZC 3FYEB 3ZIAG 4FK5C 5BZBA 2K1EA 3W7SA 2XAHA 4JAUA 4QIWF 2ZDIA 2UXNA 2WLIA 3VOUA 4Z1MG 2V1DA 2ZXWB 1FXKB 5B1NA 3CCSV 3K9AA 4UV8A 2WLLA 1MABG 4JYBA 5DM6V 2KB1A 3ZN1A 4LCUC 2AHZA 3FB5C 3ETGA 4CBCA 2QKSA 1CP9A 4WFBV 3OR7C 4GX1A 3B8NA 3F7VC 4UV9A 2XAFA 4H37A 3OFNG 2X6CA 1Q82W 5EBWC 3SPIA 3BY6A 5LGNA 1F51A 3CMEV 4MTOA 3ZMTA 3IGAC 3KG2A 1KQSU 4HYOA 1K5QA 3IFXA 2OT5A 2Y69C 3JD3A 4XDLA 1DLBA 1JOYA 2B1IA 3K79A 1J95A 2GHYA 1SETA 3SPJA 2OTLV 2JIZG 2Y69B 2DQ3A 2EILC 2WLHA 1K92A 4JTDB 5KA6A 1E1RG 4H33A 2F43G 2LFRA 5LGUA 1OCOC 2EILB 4MW8A 2HFEC 4PA9A 1L1FA 3JD0A 1XL4A 3K3WA 1R3LC 1YJWV 4LP8A 4XDJA 1WLEA 1KC8W 1QVFU 3OE7G 3D3IA 1OCOB 1R3JC 3ABKC 2D3OW 1R3KC 2HJFC 1OCRC 4UXNA 3E8GA 3CCEV 4RQFA 1M56C 3ML0A 2BOCC 4F4LA 3ABKB 4BIUA 4PA3A 2HVKC 1OCRB 3RVZA 3LDEA 3OEHG 2XNDG 3OW2U 2IU0A 4X88A 2JEXA 2DYSC 1M56B 4PDVA 3AG3C 1SERA 5B1OA 3ABTA 4JTCB 1JVMA 2DYRC 4I9WA 2JJ2G 1AI6A 3K04A 4E2LA 2DYSB 2WPDG 3E8HA 3AG3B 3RW0A 2DYRB 4BIZA 1NQTA 1S72V 4MT8A 2M7WA 1QLEC 4FJCC 3OM3B 4JGSA 3EHBB 4BW5A 2XOKG 2IW5A 1QR9A 5IYDO 2Q6AA 4TSFG 2HKOA 4QPKA 4PDRA 1M90W 1QLEB 2X7RB 4WCEV 2IJHA 3K03A 4J9ZB 4L87A 3AG4C 2EJRA 1W0JG 1FXVA 2ZR2A 1S0VA 1F4NA 1ROPA 3G71V 2X0LA 1YIJV 4RQEA 2DQ0A 1VQLV 4OXSA 3SYAA 1VQPV 2PI4A 5FL7G 3T2MA 3AG4B 4R50A 1VQ7V 2IJKA 1LNQA 1NBMG 1PL0A 4QNHB 2HLDG 3I56V 1CPYA 4RO2A 3JYCA 2EIJC 3R65A 1V54C 2IU3A 5L3FA 1COWG 1MG1A 1P4RA 1QVGU 1ORQC 3CXCU 4DXWA 3G6EV 3ETEA 2IJJA 4X8AA 3ZCCA 1VQKV 2EIJB 1GTOA 1SRYA 3RVYA 4EKWA 1V54B 1QBZA 1K4CC 4JF3A 4MTGA 4P30A 5L3BA 3HB3B 3OGCC 2XAGA 3E86A 1P7BA 3ABLB 3CCMV 1Y66A 3A0RA 3OAAG 1W2BU 4J9YB 1KD1W 4Q20A 5B1BB 3JD4A 1THZA 4FMTA 1FFTB 3CPWU 1F23A 2EZPA 2W0FC 1GMGA 4X89A 1QCEA 1AJNA 2QA4V 3LDDA 3T4DA 4QE7A 1V55C 1HWYA 5LHHA 4ZBMA 4MW3A 4GX0A 3DGEA 3JD1A 3ABMC 4G2KA 3CYOA 1NH2D 1V55B 3SYQA 1BHBA 2P90A 3WFVA 1M57C 4FPPA 1BMFG 3ABMB 4JASA 2Z3YA 2WLMA 1RM1C 2XAQA 3GWOA 1M57B 1K9MW 3CCVV 1NH2B 1S5HC 3ABUA 4P9PA 1RM1B 1VQ5V 2YEVA 4R6ZA 1AROP 2QE7G 1G4YB 4JPRA 1RPRA 3F5WC 5GW7A 5CA3A 1K3EA 1H38A 4MSWC 1VQ8V 4N21A 4GX2A 1G8MA 5IYBO 1YTFD 3CP1A 1R6KA 4UVCA 2ATKC 3ZMSA 1OCCC 4PDLA 3AG2C 2A0LA 2ZR3A 1M9NA 3BEHA 4P9OA 1WPXA 2GSMB 5LHGA 5LHIA 1KP2A 1Q86W 1OCCB 2ZDIC 3AG2B 3DTUB 4MVQA 1N8RW 1S76D 2HR3A 2WSSG 2WWWA 2NNUA 3OR6C 5E1AC 3E8BA 2AHYA 5CBGA 1RPOA 3ASOC 1K7DA 2WLIB 1GKFA 3B8MA 3F7YC 3OEEG 3W7TA 3W7UA 1SESA 2W6JG 1NVPD 3CC4V 1TUEB 2IJIA 2WLLB 3CD6V 2WAMA 4KFMA 2ITCC 3ZJZA 1FXKA 3ASOB 4JAVA 3ETDA 4U7OA 1AJPA 1E79G 2C2AA 1YHQV 3OMNB 3OMIB 5EBMC 1AJQA 2ZQMA 3TCUA 4JYCA 2P6JA 4G28B 3G4SV 3ZRXA 3QNEA 1Q81W 4PA7A 1NVPB 1CEZA 1KP3A 5H9CA 3EFFK 1R6NA 1PKXA 2FTKA 3E83A 3MHHC 4BAYA 4ASUG 3T4ZA 5KUMA 4WFGA 1NKDA 1R3IC 3QO5A 1OZ0A 3FB7C 1GO3F 1B6QA 1NR1A 2B5UA 3K08A 4XDKA 2HG5C 4G27B 3ZN0A 3CCQV 4PA6A 4GCZA 4KUMA 4WF9V 1VQMV 5L3GA 3CCRV 4YXWG 3CCJV 4DO2A 4WFAV 4RUEA 1VQ6V 2Q68A 1GK9A 2DWEC 2Y48A 3B77A 4GT1A 3ZMUA 1PD3A 4GX5A 5KA5A 4XBFA 1JPXA 1XL6A 4I5SA 3OMAB 5L3DA 1YITV 4CZZA 3E89A 3SYOA 2QEXV 2QM7A 3ABLC 1K34A 3CCLV 4KP4A 3ASNC 5B1BC 3UM7A 4MTXA 3JD2A 3W7XA 3QO8A 1OCZC 1H8EG 3SYCA 4LBEC 3ASNB 3SPGA 1MOFA 2XASA 5EC1C 2DW4A 3WG7C 1OCZB 2P7TC 1M1KW 4UVBA 1K8AW 1NR7A 2Z5UA 5L3EA 3W7WA 5HFMA 1KKDA 2WLKA 4PDMA 3LDCA 2Q67A 4WFFA 3WG7B 1NJIW 4HZ3A 4MVUA 1VQNV 1VQOV 3SYPA 3I55V 4U7NA 2NLJC 4MTFA 3VBBA 3IC7A 1IXMA 1S3JA 3STLC 1PNMA 2Q69A 3ZRWB 2EINC 1GM8A 3FB8C 5J9PC 5EK0A 5C93A 3D36A 3CCUV 2WLNA 1SZTA 2OTJV 1EBOA 3OUSA 2EINB 3UKMA 3X2QC 2OCCC 5CN0A 1K97A 2IH1C 3ZMZA 1ZWIC 4WFEA 3ZRSA 4R7CA 5IDJA 1K5SA 4FIPC 4WFHA 1MSWD 1QLNA 2BOBC 1UJWB 3K06A 1FS0G 1KECA 3GB7C 5EBLC 2OCCB 1AI7A 1I5YA 3X2QB 5EC2C 2JDIG 1JQ0A 3SJQC 1PNKA 3LSQA 1YJNV 3T1CA 1FXHA 3HPLC 2EIMC 2XAJA 2MK3A 5IY5C 4RUFA 3AG1C 3MHSC 3P32A 5H6QA 2DWDC 2LFSA 3NXSA 2JJ1G 4QPJA 3FB6C 2EIMB 5IY5B 3AG1B 5HFLA 1R73A 1Y4MA 1YSCA 1BHAA 3CC2V 1EFRG 5L3CA 1I5XA 1YTFB 4UVAA 3OUFA 4JTAB 5IYCO 2CK3G 3E35A 3LSSA 2A79B 3ZRVA 1JJ2U 1JCHA 1AR1B 2IH3C 2ZD9A 4TWKA 3TETA 1OHHG 2EBOA 5CMUA 3TK1A 2R9IA 3CMAV 2QTOA 5LGTA 2EIKC 1H2GA 1K4DC 4LC1A 5H6RA 4P2ZA 4PELA 3K0DA 4MVOA 4QE9A 2HVJC 2QM8A 2X6AA 2LP7A 2ITDC 2EIKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H33 A;  1XL6 A;  1V55 C;  4RAI A;  4ZBM A;  3E89 A;  1OCO C;  4MW3 A;  4GX0 A;  3SYO A;  4MW8 A;  2HFE C;  3ABM C;  3E8F A;  4PA9 A;  3ABL C;  1XL4 A;  2X6B A;  1R3L C;  4LP8 A;  3LNM B;  4XDJ A;  3ASN C;  1BL8 A;  2R9R B;  4MVR A;  5B1B C;  3SYQ A;  3UM7 A;  3SPC A;  3ABK C;  1M57 C;  1R3J C;  4MVZ A;  1R3K C;  2HJF C;  5B1A C;  1OCR C;  3E8G A;  4R8C A;  5CBH A;  2WLJ A;  1OCZ C;  3SYC A;  5B3S C;  5KUK A;  4LBE C;  1M56 C;  2WLM A;  4MS2 A;  3SPG A;  2BOC C;  4F4L A;  5EC1 C;  4PA3 A;  2HVK C;  3WG7 C;  3RVZ A;  2JK5 C;  3LDE A;  2P7T C;  4X88 A;  1S5H C;  2DYS C;  4P9P A;  4MVS A;  2YEV A;  4R6Z A;  4PDV A;  1G4Y B;  3AG3 C;  4QE7 A;  1KKD A;  2WLK A;  4PDM A;  3F5W C;  3LDC A;  2Q67 A;  4WFF A;  4JTC B;  4PA4 A;  4MSW C;  4HZ3 A;  4MVU A;  1JVM A;  2DYR C;  4GX2 A;  4I9W A;  3K04 A;  2ATK C;  3SYP A;  3E8H A;  1OCC C;  4PDL A;  3AG2 C;  2A0L A;  2NLJ C;  4MTF A;  4MVM A;  3RW0 A;  2H8P C;  3BEH A;  3LUT B;  3STL C;  2Q69 A;  2EIN C;  4P9O A;  4UUJ C;  3SPH A;  3FB8 C;  5J9P C;  3PJS K;  5CBF A;  2A9H A;  5EK0 A;  4MVQ A;  2WLN A;  1QLE C;  3RBZ A;  4BW5 A;  3OUS A;  3OR6 C;  5E1A C;  3E8B A;  3UKM A;  2ZXW C;  3K0G A;  2OCC C;  2AHY A;  2Q6A A;  3STZ C;  2IH1 C;  3X2Q C;  1ZWI C;  5CBG A;  4WFE A;  3ZRS A;  4R7C A;  3ASO C;  2WLI B;  4PDR A;  2K1E A;  3F7Y C;  4WFH A;  5BZB A;  3K03 A;  4J9Z B;  3AG4 C;  2WLI A;  2BOB C;  2WLL B;  3K06 A;  3VOU A;  3GB7 C;  4KFM A;  5EBL C;  2ITC C;  5EC2 C;  2WLL A;  3ZJZ A;  3SJQ C;  3T1C A;  2KB1 A;  3HPL C;  4OXS A;  2EIM C;  3SYA A;  4LCU C;  3T2M A;  5IY5 C;  4RUF A;  2AHZ A;  3AG1 C;  3FB5 C;  4R50 A;  4CBC A;  2DWD C;  1LNQ A;  2QKS A;  4JTD B;  5EBM C;  4QNH B;  3TCU A;  3OR7 C;  4G28 B;  4RO2 A;  4GX1 A;  3JYC A;  2EIJ C;  3F7V C;  3FB6 C;  3R65 A;  4PA7 A;  1V54 C;  4H37 A;  3EFF K;  3E83 A;  1ORQ C;  2X6C A;  5EBW C;  3SPI A;  3T4Z A;  5KUM A;  3OUF A;  4JTA B;  4DXW A;  4WFG A;  1R3I C;  4X8A A;  2A79 B;  3FB7 C;  4MTO A;  3IGA C;  3KG2 A;  3RVY A;  4EKW A;  2IH3 C;  2ZD9 A;  1K4C C;  3K08 A;  2HG5 C;  4G27 B;  4HYO A;  4MTG A;  4P30 A;  4TWK A;  3TET A;  3IFX A;  4PA6 A;  2Y69 C;  3OGC C;  4XDK A;  3E86 A;  1P7B A;  4XDL A;  2QTO A;  1J95 A;  4J9Y B;  2EIK C;  1K4D C;  3SPJ A;  4P2Z A;  4RUE A;  2Q68 A;  2W0F C;  2DWE C;  2EIL C;  3K0D A;  4X89 A;  4MVO A;  4QE9 A;  2HVJ C;  2WLH A;  3LDD A;  4GX5 A;  2X6A A;  3T4D A;  2ITD C; 
#chains in the Genus database with same CATH topology
 2HHH B;  4NXN O;  3CS5 A;  2UXC O;  1N32 O;  2F93 B;  2E74 B;  2FB5 A;  2H94 A;  4JI3 O;  5IE9 A;  3AK1 A;  3E2E A;  4J42 A;  4MVZ A;  4FLU A;  5CBH A;  4JYY A;  1IZ3 A;  3MD0 A;  4OPH A;  4JI6 B;  3HR0 A;  3T1Y O;  5B1A B;  4X20 B;  1XMQ O;  3FYI B;  3HKD B;  1W0K G;  2YEV B;  1H2S B;  1R6T A;  2JGD A;  5JVD A;  4IHJ B;  2QWQ B;  1AI4 A;  4O2A B;  1S77 D;  1I7F A;  3ZHS A;  1DK1 A;  5LBQ A;  1IBM O;  1E1Q G;  1ZSP A;  3PJS K;  2YID A;  2Y0I A;  4X1K B;  3H01 A;  4O4L A;  3FYE B;  4W4K A;  4FK5 C;  1X59 A;  2K1E A;  1PP9 H;  2WLI A;  2V1D A;  4ABM A;  5J2U A;  5KAI Z;  3HKC A;  4JYB A;  1D5N A;  4LCU C;  2L35 A;  1CP9 A;  5ITZ A;  3B8N A;  3A0H Z;  3QTC A;  1T5E A;  2UUA O;  1Q82 W;  3SPI A;  3A2F A;  3C3T A;  3HKB A;  4MTO A;  4CS3 A;  1IBK O;  3IGA C;  4B3M O;  4NXM O;  4HYO A;  3S3W A;  4O4I B;  3NR7 A;  3IFX A;  2Y69 C;  3G80 A;  5LYJ A;  3N2G A;  1MSD A;  2ODM A;  2W0X A;  1N33 O;  4I55 A;  1J95 A;  4FFB A;  3APO A;  2WLH A;  1XDC A;  3DC6 A;  4H33 A;  2ADP A;  2F43 G;  1G1X B;  3VQV A;  4PA9 A;  1L1F A;  4IL6 Z;  1WN7 A;  1KC8 W;  1QVF U;  5JH7 B;  4U3F H;  4RQF A;  1M56 C;  1Z5W A;  4BIU A;  5KX5 B;  2CTW A;  3OEH G;  2UXB B;  4K0K O;  2JGU A;  5IJ0 B;  5BXZ A;  1SER A;  4K8Z A;  1HR0 O;  5J2T B;  4JTC B;  2DYR C;  4RWU A;  4CC5 A;  2GV9 A;  2JJ2 G;  3D36 C;  3K04 A;  4E2L A;  1I94 O;  2UU9 B;  3AG3 B;  5LMN O;  4DV5 B;  2UUC O;  2FYU H;  4BIZ A;  2M7W A;  2Q4P A;  4FVM A;  4CC6 A;  1QLE C;  2JS5 A;  4FJC C;  4IGG A;  4JGS A;  3EHB B;  2XOK G;  1QR9 A;  4JI1 B;  1N34 B;  1M5I A;  4TSF G;  2P22 C;  1V9P A;  4I0X A;  5JQG A;  4QPK A;  4L87 A;  2A06 H;  3S3X A;  4I50 A;  4DK0 A;  4RQE A;  2DQ0 A;  1VQL V;  4OXS A;  5FL7 G;  3T2M A;  3ZED A;  4QNH B;  4DR6 O;  3JYC A;  2EIJ C;  2DMX A;  2K9P A;  5L3F A;  1COW G;  3VQW A;  1ZL8 A;  2E75 B;  3ZCC A;  4AI8 A;  4EKW A;  1QBZ A;  1K4C C;  2E5L B;  2N04 A;  2VQE B;  2OWO A;  1P7B A;  3A0R A;  3K5L A;  3OAA G;  4Q20 A;  5B1B B;  5LL6 Y;  1XUQ A;  1EN5 A;  1F23 A;  4LF6 B;  1U96 A;  4FLV A;  3LDD A;  4LFC B;  3H1I H;  1J5E B;  1HWY A;  2VS0 A;  4ZBM A;  1YF2 A;  4MW3 A;  4GX0 A;  3K58 A;  3BAA A;  3CE2 A;  3ABM C;  2ZKO A;  3CYO A;  3K57 A;  1NH2 D;  1P84 F;  1HNW O;  3SYQ A;  1BHB A;  1HNZ O;  2B9Z A;  4J80 A;  2Q5Z A;  1BMF G;  4OGQ B;  2HJD A;  1FJG B;  2Z3Y A;  4U3J A;  2XAQ A;  1N0N A;  5KHI A;  3B09 A;  4TV9 A;  4LF4 O;  2UUB B;  2ZE8 A;  1BCC H;  1UPG A;  4JYA O;  5KLV H;  1NH2 B;  1S5H C;  4DV1 B;  1GRJ A;  3ABU A;  3CB2 A;  1RM1 B;  1VQ5 V;  1ARO P;  2QWP B;  4JPR A;  5JVD B;  4K8X A;  3F5W C;  4MSW C;  1VQ8 V;  1XMO O;  5IYB O;  4UVC A;  1OCC C;  4FM1 A;  5LHI A;  4IYH A;  2DOS A;  4O4L B;  2Y4U A;  2ZDI C;  3AG2 B;  3DTU B;  1W59 A;  2HR3 A;  4LFB B;  2WWW A;  2NNU A;  1NZ6 A;  4DR4 B;  1K7D A;  2WLI B;  5LOV A;  4LF8 B;  3W7T A;  3FAV A;  3CC4 V;  5IJ9 A;  5J2U B;  4KFM A;  1URF A;  3HKC B;  3ZJZ A;  3ZX6 A;  1AJP A;  1I08 A;  5ITZ B;  1E79 G;  1BQ0 A;  3DXR A;  5EBM C;  4DV6 O;  2YIA A;  3TCU A;  4JYC A;  3G4S V;  4DV3 B;  1I0H A;  3HKB B;  3T4Z A;  4WFG A;  1NKD A;  1R3I C;  3QO5 A;  1B6Q A;  3K08 A;  3GWK C;  3ZN0 A;  5LYJ B;  1L0L H;  4I55 B;  1VEW A;  3D8C A;  4KUM A;  1VQM V;  4FFB B;  2F66 C;  4KL1 A;  4CH6 A;  5CB4 A;  4WFA V;  1TGO A;  4RUE A;  2Q68 A;  3RWR D;  1TUB A;  2Y48 A;  5KA5 A;  4XBF A;  3VQY A;  3H1K H;  4J7Z A;  3SYO A;  4GKJ O;  4PV1 B;  4DR1 B;  5B1B C;  4HBN A;  3JD2 A;  3L72 H;  2XAS A;  3SJB C;  1SQX H;  4LF9 O;  2ZE5 A;  3VQX A;  5IT9 N;  3U10 A;  3TXS A;  4X64 O;  1K8A W;  1NR7 A;  3W7W A;  1BQZ A;  1NJI W;  4HZ3 A;  2QWO B;  2ZE7 A;  3SYP A;  1JJO A;  1IXM A;  1S3J A;  1XNQ B;  2Q69 A;  3ZRW B;  2EIN C;  3JSL A;  3D36 A;  3CCU V;  2WLN A;  4DV7 O;  5IWA O;  3OUS A;  1FFX A;  3UKM A;  4I0X B;  5JQG B;  3X2Q C;  2D2C B;  5B5E Z;  1ZWI C;  3L9D A;  4ZOL A;  4WFE A;  2LGW A;  2P5O A;  4I50 B;  2F4V O;  1KEC A;  3GB7 C;  3L75 H;  3CEI A;  5EBL C;  5C8Y A;  4JAA A;  3LSQ A;  3T1C A;  4LWS A;  4K35 A;  5IY5 C;  3MHS C;  2Q7E A;  1Z5V A;  5LMU O;  3A0B Z;  1SQP H;  3FB6 C;  2EIM B;  3OTF A;  5HFL A;  1R73 A;  1ZL8 B;  2ZM6 O;  1I5X A;  1YTF B;  4UVA A;  2YIB A;  1FKA O;  1JJ2 U;  4LF7 O;  1EZV H;  2ZD9 A;  1OHH G;  2F95 B;  2EBO A;  2PYJ A;  4X1I A;  3AG7 A;  2R9I A;  5LGT A;  5KHK A;  4PEL A;  4NKG B;  4MVO A;  1IDS A;  2HVJ C;  2XHB A;  4J9Z B;  2X6A A;  4DV4 O;  1XNR B;  4RAI A;  1JA8 A;  2LW1 A;  1L8D A;  4X65 O;  3FKS G;  5BMV A;  1QR8 A;  1BL8 A;  2R9R B;  3AEI A;  4OX9 O;  3K5M A;  3SPC A;  2P67 A;  4D7T A;  4R8C A;  3CRQ A;  4FM2 A;  4QJF B;  4U3J B;  5B3S C;  4JI5 O;  4TV9 B;  4YIO A;  4TT3 G;  1XRE A;  4YIP A;  4ZIB A;  3U0Z A;  3P30 A;  2JK5 C;  2RJZ A;  2KSD A;  3RN4 A;  1DF5 A;  2PUS A;  3QO7 A;  3L73 H;  4PA4 A;  4UB8 Z;  4AQY O;  1JR9 A;  2JEU A;  3R66 A;  1CXZ B;  2H8P C;  4HAM A;  2EZO A;  2KG7 A;  3PN1 A;  4UUJ C;  3SPH A;  2JRI A;  5CBF A;  2VQF O;  3KZI Z;  3RBZ A;  1WA8 A;  4DV2 O;  2QTS A;  2ZXW C;  1FXK C;  5LOV B;  3L71 H;  3FAV B;  2Q0A A;  5IJ9 B;  5BZB A;  3KCY A;  2ZDI A;  2UXN A;  1BE3 H;  4UV8 A;  2CUG A;  3FFQ A;  2KB1 A;  3AK2 A;  4YY3 O;  3DXR B;  2AHZ A;  3N27 A;  4EEQ A;  1Y76 A;  4H13 B;  4JI4 B;  4GKK B;  2QKS A;  4WFB V;  2XAF A;  1IBL B;  2X6C A;  1P49 A;  3BY6 A;  2IM9 A;  5LGN A;  1F51 A;  1FAF A;  3KG2 A;  4FLZ A;  4O4J A;  4X62 O;  1QNM A;  3T1H O;  2O57 A;  1DLB A;  3TJT A;  5CB4 B;  4X66 B;  1TUB B;  2OTL V;  2JIZ G;  2DQ3 A;  2Y69 B;  2EIL C;  2HHH O;  4J41 A;  1O9H A;  1E1R G;  2ZNI A;  2ZE6 A;  3RFR A;  3RYC A;  4F6E A;  4NR1 A;  5LGU A;  1HDJ A;  1XL4 A;  2G38 A;  4DK1 A;  2HEP A;  3ABK C;  3B2E E;  1Y6X A;  1R3K C;  1OCR C;  3E8G A;  4JI6 O;  1SS3 A;  2BOC C;  3JAT A;  2HVK C;  3RVZ A;  2XND G;  4D6T H;  1QQC A;  4X88 A;  2JEX A;  2CAZ C;  1M56 B;  1WAZ A;  2DYS C;  2AZ0 A;  4PDV A;  5KMG A;  5D5Q A;  1JVM A;  1Y67 A;  2R72 A;  1YCI A;  2DYR B;  1EM1 A;  4DUY B;  5IYZ A;  1NT2 B;  2GBO A;  3H1J H;  1FFX B;  1BZK A;  4ZOL B;  2IW5 A;  4J11 A;  2Q6A A;  2HKO A;  4PDR A;  1QLE B;  4WCE V;  1MZE A;  2CTQ A;  3AG4 C;  2EJR A;  2YIB D;  5C8Y B;  1W0J G;  1RFY A;  1FXV A;  4B7K A;  1Q3E A;  2V4D A;  4JI7 B;  4LWS B;  1ROP A;  4TUY A;  2AGA A;  4NB5 A;  2UXD O;  2PI4 A;  3CX5 F;  3CXH F;  2IJK A;  1PL0 A;  2R9A A;  1Q8I A;  1VMG A;  1XEQ A;  3E22 A;  1WB8 A;  2BE3 A;  3QG5 A;  1KB9 F;  2IU3 A;  1MG1 A;  2VWK A;  4DXW A;  4NXN B;  2IJJ A;  1VQK V;  2UXC B;  2EIJ B;  1N32 B;  1ZX3 A;  4X1I B;  2RQ6 A;  2OIG A;  3BHP A;  4X9Q A;  3OGC C;  5JCO C;  2NR5 A;  4AHC A;  1OJH A;  4FMT A;  1FFT B;  3CPW U;  4FLX A;  1AJN A;  2QA4 V;  3T1Y B;  4IIJ A;  3T4D A;  1VF5 B;  5LHH A;  3DGE A;  5BMV B;  1Q90 D;  4DUZ B;  1M57 C;  4FPP A;  5D5P A;  3ABM B;  2CDY A;  3ZHQ A;  5KHG A;  4LR3 A;  3CRC A;  3GWO A;  1IBM B;  2WA3 A;  1K9M W;  5JJE B;  1SC5 B;  2P4K A;  1RPR A;  5GW7 A;  4DV5 O;  4JZG A;  1R6K A;  2KG7 B;  1M4U A;  3BEH A;  5TIS Z;  4DV0 B;  4P9O A;  2GSM B;  5LHG A;  1OCC B;  1S76 D;  1WA8 B;  4JI1 O;  1N34 O;  2WSS G;  3ZHV A;  3OR6 C;  4QGP A;  1KKC A;  5CBG A;  1RPO A;  1SF9 A;  3W7U A;  2YXY A;  1GKF A;  3F7Y C;  3FX7 A;  3OEE G;  2UUA B;  2W6J G;  1TUE B;  4JI2 O;  4LNU A;  1B06 A;  3F5T A;  1FYJ A;  1FXK A;  1PL4 A;  2JS3 A;  1Y76 B;  3ETD A;  4U7O A;  2GUZ A;  1N33 B;  3L70 H;  2C2A A;  4NVP A;  2P6J A;  4G28 B;  1Q81 W;  3E83 A;  1PKX A;  1NTK H;  3MHH C;  1XHZ A;  4ASU G;  4KXR A;  5KUM A;  2VQE O;  1OZ0 A;  2LO1 A;  2B5U A;  2A3Q A;  4XDK A;  5JJN B;  2OCH A;  4PA6 A;  4DR3 B;  3CCR V;  4DRX A;  3CCJ V;  4LF6 O;  2QSA A;  4LFC O;  2RNB A;  4YHH B;  1J5E O;  4PD4 F;  3LSU A;  3RYC B;  1Q6H A;  3KCX A;  4UCO A;  1JPX A;  3E89 A;  2ILM A;  2QEX V;  1K34 A;  2MW2 B;  1HR0 B;  3CCL V;  4KP4 A;  2Q7G A;  3ASN C;  2FML A;  1FJG O;  4MTX A;  3W7X A;  3QO8 A;  1OCZ C;  5LMN B;  4ICG A;  3JAT B;  2UUB O;  5EC1 C;  1PPJ H;  4DV1 O;  4DW0 A;  1NTZ H;  1M1K W;  5KHJ A;  4UVB A;  5KMG B;  2Z5U A;  1KKD A;  2WLK A;  3J81 N;  2Q67 A;  1TVK A;  1VQN V;  4CH3 A;  4CH4 A;  2E76 B;  5K1X A;  3IC7 A;  3H1H H;  5IYZ B;  1PNM A;  2OIE A;  1GM8 A;  1ZUQ A;  3FB8 C;  5J9P C;  4KHP B;  4LFB O;  5E79 Z;  3SR2 C;  5C93 A;  4EB6 A;  2P06 A;  1Z2G A;  2QWN B;  4DR4 O;  2EIN B;  2OCC C;  5CN0 A;  3MAQ A;  1H2M A;  2JGD B;  2M6Y A;  3ZRS A;  1AR4 A;  4FIP C;  4WFH A;  4DR7 B;  1MSW D;  3ZHR A;  2BOB C;  1SQF A;  3X2Q B;  4J7K A;  4TUY B;  4DR2 O;  1JQ0 A;  4O2B A;  3SJQ C;  1PNK A;  1YJN V;  1FXH A;  3AG1 C;  2E3C A;  3E22 B;  5H6Q A;  4DV3 O;  4EFB A;  3NXS A;  2JJ1 G;  5FPR A;  2YIC A;  5IY5 B;  3APQ A;  3RYF A;  1YSC A;  2YC0 A;  1BHA A;  1EFR G;  4UCR A;  1US6 A;  3KKY A;  4HNA A;  5IYC O;  3O65 A;  2CK3 G;  2A79 B;  4ZHQ A;  1JCH A;  1YZB A;  1AIL A;  3BA8 A;  1D2D A;  3TK1 A;  3BFR A;  1MA1 A;  1MNG A;  1FD9 A;  4P2Z A;  3IAY A;  2N74 A;  4IIJ B;  3AK3 A;  4QE9 A;  2QM8 A;  5JCO A;  1B3Q A;  2LP7 A;  2ITD C;  2YSU B;  2YDE A;  4JYA B;  1ZTE A;  5DN6 G;  3E8F A;  4GUN A;  1F4M A;  3J7A U;  4ZI7 A;  3OT7 A;  2PI5 A;  2CGO A;  4DYL A;  3N2G B;  1Q7Y W;  3L74 H;  1AI5 A;  2AXT Z;  5KUK A;  4EFE A;  1M93 A;  1PNL A;  2ARH A;  4LFA O;  5EYP A;  1RSO A;  5B3S B;  3M8A A;  4MVS A;  4B3R O;  3RT3 C;  1SQB H;  3ZMV A;  1GN2 A;  4NYK A;  1BGY H;  1XNQ O;  2PYL A;  4MVM A;  2IBZ H;  1N36 B;  3LUT B;  1YI2 V;  2F1M A;  2V7Q G;  1H8H G;  2A9H A;  4WBN A;  1NU1 H;  1GM7 A;  1VQ9 V;  2B1G A;  1DF4 A;  1GM9 A;  2EUL A;  3STZ C;  1IX9 A;  1XQ8 A;  2ETN A;  3ZIA G;  4LNU B;  4CS2 A;  3ZHT A;  4QIW F;  4PHZ A;  3VOU A;  4Z1M G;  2ZXW B;  1FXK B;  5B1N A;  3CCS V;  3K9A A;  2WLL A;  2GUZ B;  3TXQ A;  3ZN1 A;  1KBH A;  4O4H A;  3FB5 C;  1P7G A;  4CS4 A;  3K5N A;  2QKA A;  3OR7 C;  3JSN A;  4GX1 A;  3F7V C;  3P3N A;  3OFN G;  2CH7 A;  3CRR A;  2QM4 A;  2YXL A;  4GKJ B;  4B3S B;  1IUR A;  1K5Q A;  2OT5 A;  4I4T A;  2B1I A;  4FFK A;  3B40 A;  2GHY A;  4YJ3 A;  2PY5 A;  3SJC C;  1SET A;  3SPJ A;  1XOU A;  1XNR O;  3Q4H A;  4JI0 B;  1K92 A;  3I5D A;  4JTD B;  2VRZ A;  1OCO C;  3QF7 A;  2EIL B;  1NI8 A;  4MW8 A;  2HFE C;  2R70 A;  3K3W A;  5BR8 B;  1WLE A;  1NTM H;  5JJJ B;  3G67 A;  3D3I A;  1R3J C;  3BAB A;  4NTY A;  2D3O W;  1SQG A;  2HJF C;  4FZ1 A;  3CCE V;  4F4L A;  3ABK B;  2P4V A;  4PA3 A;  4X1K A;  1OCR B;  5DED A;  3LDE A;  1LUW A;  5B1O A;  1TVK B;  3WB0 A;  4I9W A;  1AI6 A;  2DYS B;  3E8H A;  4NTX A;  3RW0 A;  5FNV A;  4JI8 O;  4H44 B;  3J80 N;  3JAS A;  2CTP A;  3OM3 B;  5IYD O;  3DC5 A;  1KYO F;  2X7R B;  1VIB A;  2EJ7 A;  3K03 A;  2PZS A;  4O2B B;  4BWA A;  1PV0 A;  1S0V A;  1F4N A;  1Y74 A;  1GH6 A;  2X0L A;  1YIJ V;  3HKE A;  4JI4 O;  4GKK O;  3AG4 B;  3JAW A;  1VQ7 V;  4UCV A;  1NBM G;  1IBL O;  2HLD G;  3I56 V;  1BS3 A;  1CPY A;  4RO2 A;  1SZX A;  3RYF B;  1S5J A;  1V54 C;  5BY1 A;  4HNA B;  4DV4 B;  1QVG U;  1P4R A;  1ORQ C;  2GTA A;  4ZHQ B;  3G6E V;  4OPA A;  3N2K A;  1IVS A;  1GTO A;  1SRY A;  1S5L Z;  1PM9 A;  4P30 A;  3ICX A;  1DGS A;  3BRC A;  1JFF A;  4OX9 B;  1Y66 A;  1W2B U;  4J9Y B;  1N0J A;  4DW1 A;  1AVM A;  5K1P A;  2W0F C;  1GMG A;  3BPZ A;  4X89 A;  1QCE A;  2F23 A;  1QU7 A;  4DR5 O;  4QE7 A;  1Q5O A;  1HNX B;  5LXT A;  1V55 C;  1VF6 C;  1SKV A;  1XBL A;  4ZI7 B;  3OTO B;  4G2K A;  5LP6 C;  4LF5 B;  4JV5 B;  3WFV A;  3CRA A;  2YI9 A;  2LW7 A;  4B3T B;  1JMK C;  4JAS A;  4LH7 A;  2LGQ A;  2ZT9 B;  1SA0 A;  1M57 B;  5EYP B;  1RSO B;  1R1B A;  3CCV V;  3CSX A;  4DV2 B;  5H2F Z;  5CA3 A;  1K3E A;  1WP8 A;  1VP7 A;  4N21 A;  1G8M A;  5B66 Z;  3CP1 A;  3ZMS A;  2A0L A;  2ZR3 A;  1M9N A;  4DUY O;  4WBN B;  1VF7 A;  1KP2 A;  4YY3 B;  1N8R W;  1L0N H;  5E1A C;  3E8B A;  2AHY A;  3C3S A;  2ADQ B;  3ASO C;  3B8M A;  1NVP D;  4JI7 O;  4E4E A;  2WLL B;  3UQ8 A;  2WAM A;  3CHX A;  2NN4 A;  4O4H B;  3T1H B;  4FZ0 A;  3BA9 A;  1VAR A;  3ZRX A;  3QNE A;  4PA7 A;  1NVP B;  1CEZ A;  1KP3 A;  3UCS C;  5H9C A;  2CH7 B;  1R6N A;  2PF4 E;  3FB7 C;  1NR1 A;  1YDX A;  4I4T B;  4G27 B;  4GZR B;  4YJ3 B;  1AB3 A;  1LUV A;  4YXW G;  2XUM A;  3Q4H B;  3UO3 A;  2CGN A;  1GK9 A;  2DWE C;  3B77 A;  4W4L A;  3ZMU A;  4Z2W A;  1PD3 A;  4GX5 A;  2CE4 A;  1XL6 A;  4I5S A;  3OMA B;  5L3D A;  1XHX A;  1B04 A;  2QM7 A;  4DUZ O;  5EZY A;  1KU9 A;  5KHH A;  4JI3 B;  3UM7 A;  5GTI Z;  1EN4 A;  1OV9 A;  3ASN B;  2HP8 A;  1MOF A;  3SPG A;  2DW4 A;  3SDL A;  3WG7 C;  4L8J A;  1OCZ B;  5L3E A;  1XMQ B;  3LDC A;  2ZIO A;  2RDC A;  4WFF A;  3UT5 A;  1VQO V;  1Q6I A;  3I55 V;  5FNV B;  4DV0 O;  1U97 A;  2NLJ C;  3JAS B;  2ZNJ A;  3STL C;  2UXD B;  1RP3 B;  5EK0 A;  2ZIN A;  2UXB O;  2OTJ V;  1XI1 A;  5DEC A;  1EBO A;  1K97 A;  5IDJ A;  3G6B A;  4FM0 A;  1UJW B;  3K06 A;  1FS0 G;  2UU9 O;  1Y74 B;  2OCC B;  3HKE B;  5EC2 C;  3TGU H;  3JAW B;  2XAJ A;  2MK3 A;  4I7Z B;  4RUF A;  3DSQ A;  2VWJ A;  2EX3 A;  3AG1 B;  3BVO A;  2JVD A;  2YXH A;  3N2K B;  2GTS A;  3OUF A;  1HP8 A;  4IT5 A;  4DR3 O;  1AR1 B;  2IH3 C;  4J7J A;  1ZAU A;  5CMU A;  1JFF B;  4F6R A;  2L6L A;  4FLT A;  1IBK B;  4B3M B;  4NXM B;  1WB7 A;  2RCV A;  1KMI Z;  2EIK C;  1H2G A;  4YHH O;  5H6R A;  1KUQ A;  2Z0A A;  3K0D A;  2AW9 A;  5LXT B;  4B7E A;  5EIB C;  4MVU A;  3CC7 V;  4TQF A;  2Q73 A;  4FLW A;  3K59 A;  3WB1 A;  1QHT A;  4TQD A;  1K73 W;  2QR4 A;  1GN3 A;  2E5L O;  2X6B A;  2RN9 A;  1YXB A;  4O4J B;  3LNM B;  4MVR A;  4N23 A;  5CA0 A;  2OYQ A;  3IJ4 A;  3CJH A;  3H9V A;  3M99 B;  5B1A C;  1VF6 A;  1GAX A;  2WLJ A;  2UXX A;  1SA0 B;  1VQ4 V;  3ZRW A;  4MS2 A;  5LP6 A;  3RYH A;  1D5A A;  4A5U B;  1ENV A;  4K0K B;  3CWB H;  3JCZ A;  4ZKI A;  1K33 A;  3EVK A;  5CA1 A;  4JI2 B;  4Z1V A;  1JX9 A;  4KHP O;  3WB2 A;  1EZJ A;  1DTO A;  1YJ9 V;  4Q6G A;  1I94 B;  2W6I G;  1G6U A;  2UUC B;  1TA8 A;  4UB6 Z;  2YS8 A;  4DR7 O;  2FKX A;  3K0G A;  1AR5 A;  1X4T A;  2XAH A;  3W7S A;  4JAU A;  2ZCE A;  1MAB G;  5DM6 V;  4B08 A;  3OGI B;  2QWR B;  3ETG A;  5GTH Z;  4CBC A;  1SQV H;  4YJ2 A;  4UV9 A;  2BTO A;  4X1Y A;  4H37 A;  4DR6 B;  1YVW A;  4LF8 O;  5EBW C;  3SJA C;  3CME V;  3ZMT A;  1KQS U;  1SQQ H;  3M7M X;  3JD3 A;  4XDL A;  1JOY A;  2BCC H;  3K79 A;  2Q7H A;  2A7W A;  3JCU Z;  1ZLZ A;  4TOI A;  2XTA A;  5KA6 A;  3OD4 A;  3RYI A;  2LFR A;  2KKW A;  5EZY B;  2RMK B;  2PGG A;  3JD0 A;  1YJW V;  1R3L C;  3EXA A;  4LP8 A;  4UCU A;  4XDJ A;  3OE7 G;  1OCO B;  4UXN A;  1HNW B;  3K5O A;  2LQT A;  1HNZ B;  5GON A;  1BT8 A;  3ML0 A;  2Q9L A;  3JAK A;  3JAR A;  3OW2 U;  2IU0 A;  4LF4 B;  4TV8 A;  4DR1 O;  3AG3 C;  3ABT A;  4I9Q A;  3UT5 B;  3THO A;  4K3A A;  1N36 O;  2WPD G;  1XMO B;  4DR2 B;  3FD9 A;  3D3Q A;  5LA6 A;  1NQT A;  1S72 V;  4MT8 A;  2ZIM A;  3JAM N;  2WA4 A;  4BW5 A;  1WPB A;  1M90 W;  2IJH A;  4IYI A;  4PJ0 Z;  2ZR2 A;  3JAL A;  3G71 V;  5FLX N;  1WP7 A;  1H2N A;  4PI0 A;  3SYA A;  1VQP V;  4UCT A;  3MDS A;  4R50 A;  1LNQ A;  1F7Y A;  3CRM A;  3BCC H;  2QGN A;  3R65 A;  2BTQ A;  4DV6 B;  5AG2 A;  4FLY A;  2H3O A;  3CXC U;  4B3S O;  3ETE A;  4X8A A;  4F6R B;  3RVY A;  1V54 B;  4JF3 A;  4MTG A;  2BSK A;  5L3B A;  3HB3 B;  2XAG A;  3E86 A;  3ABL B;  3CCM V;  2QJ1 A;  5FPO A;  1KD1 W;  5A2Q N;  3JD4 A;  4JI0 O;  1IXB A;  1THZ A;  2EZP A;  2Y0P A;  1MMM A;  2DJV A;  4LFA B;  3JD1 A;  4BR6 A;  5BR8 O;  2QKC A;  3UO2 A;  1HW7 A;  4B3R B;  5CA0 B;  1V55 B;  3CJH B;  4C7U A;  2P90 A;  3O9O A;  4DRX B;  5LP6 B;  2WLM A;  3RYH B;  1RM1 C;  1AP5 A;  4LF9 B;  4X20 A;  1MZF A;  4P9P A;  3B4S A;  3HKD A;  2YEV A;  4R6Z A;  2QE7 G;  1G4Y B;  4PI2 A;  2DN9 A;  1H38 A;  4X64 B;  1A32 A;  5CA1 B;  4GX2 A;  2Q8V A;  1YTF D;  4IHJ A;  2ATK C;  1Q43 A;  4O2A A;  1EN6 A;  4PDL A;  3AG2 C;  4D7S A;  4UFZ A;  1WPX A;  1Q86 W;  4MVQ A;  4NTW A;  1GN6 A;  4DV7 B;  2N05 A;  5IWA B;  1SES A;  2IJI A;  2DE0 X;  1FPO A;  3CD6 V;  2ITC C;  2F4V B;  1NS1 A;  3ASO B;  4JAV A;  1TAE A;  4LH6 A;  4AIL C;  1XIL A;  1YHQ V;  3OMN B;  3OMI B;  4YJ2 B;  1AJQ A;  4EB6 B;  5JWP A;  2ZQM A;  4X1Y B;  1BSM A;  2Q0O C;  5LMU B;  3A8T A;  4GLX A;  3EFF K;  4BIO A;  2FTK A;  4BAY A;  1H2K A;  4GYC B;  1GN4 A;  1GO3 F;  2ZM6 B;  2HG5 C;  3CCQ V;  4LF7 B;  4GCZ A;  1YEW A;  4WF9 V;  4O4I A;  3C90 A;  3P3P A;  5L3G A;  3WU2 Z;  3H1L H;  4DO2 A;  1VQ6 V;  1HNX O;  4GT1 A;  2PTM A;  3SGI A;  5H5N A;  2QDO A;  3RYI B;  3OTO O;  5A9G A;  1YIT V;  5F2V O;  4H0L B;  4CZZ A;  4LF5 O;  4JV5 O;  3ABL C;  4JZ2 A;  4X65 B;  4B3T O;  3ZS8 C;  4X66 O;  2AZ2 A;  5GON B;  1H8E G;  3SYC A;  1WJZ A;  5JH7 A;  4LBE C;  4JI8 B;  3JAK B;  1H2L A;  3JAR B;  4JI5 B;  3ZBH A;  1UFI A;  1Q6U A;  4TV8 B;  3QVN A;  2CTR A;  5KX5 A;  3GVM A;  2P7T C;  3LNN A;  3U11 A;  2XT9 A;  1O9G A;  5HFM A;  4PDM A;  5IJ0 A;  3WG7 B;  5J2T A;  4AQY B;  4U7N A;  4MTF A;  3VBB A;  5LA6 B;  5KAF Z;  1LR1 A;  1SZT A;  1AP6 A;  2Y4T A;  2VQF B;  4J10 A;  2IH1 C;  3ZMZ A;  4R7C A;  1K5S A;  3ZHU A;  3RGB A;  1QLN A;  2GDS A;  3IC9 A;  3JAL B;  2YI8 A;  1AI7 A;  1I5Y A;  2JDI G;  2YUA A;  3HPL C;  2EIM C;  3P32 A;  4BW9 A;  2DWD C;  2LFS A;  2BTQ B;  1WNS A;  2FL4 A;  4QPJ A;  1Y4M A;  2KQX A;  4DR5 B;  3CC2 V;  5L3C A;  4JTA B;  2LJ2 A;  3E35 A;  3LSS A;  2BSK B;  3ZRV A;  1N4C A;  4TWK A;  3TET A;  4X62 B;  4UCS A;  5EIB D;  3CMA V;  2QTO A;  3ETQ A;  1K4D C;  4LC1 A;  3K9S A;  4CH5 A;  2EIK B; 
#chains in the Genus database with same CATH homology
 3CC7 V;  4RAI A;  2YSU B;  1K73 W;  5DN6 G;  3E8F A;  2H94 A;  1F4M A;  2X6B A;  3FKS G;  3LNM B;  1QR8 A;  1BL8 A;  2R9R B;  4MVR A;  4N23 A;  3AEI A;  2PI5 A;  3E2E A;  3SPC A;  1Q7Y W;  4MVZ A;  2P67 A;  3M99 B;  5B1A C;  1AI5 A;  5CBH A;  4R8C A;  2WLJ A;  4QJF B;  2UXX A;  5B3S C;  5KUK A;  1VQ4 V;  3ZRW A;  3MD0 A;  4MS2 A;  1PNL A;  4TT3 G;  5B1A B;  3P30 A;  2JK5 C;  3FYI B;  1W0K G;  2YEV B;  5B3S B;  1ENV A;  4MVS A;  1DF5 A;  3QO7 A;  3JCZ A;  4PA4 A;  4ZKI A;  1AI4 A;  1K33 A;  3ZMV A;  1S77 D;  2JEU A;  1JX9 A;  4MVM A;  1EZJ A;  2H8P C;  3LUT B;  1DTO A;  4HAM A;  2EZO A;  1YJ9 V;  5LBQ A;  1YI2 V;  2W6I G;  4UUJ C;  1E1Q G;  2V7Q G;  3SPH A;  3PJS K;  5CBF A;  1H8H G;  2A9H A;  1GM7 A;  1VQ9 V;  3H01 A;  2B1G A;  3RBZ A;  1DF4 A;  1GM9 A;  2ZXW C;  1FXK C;  3K0G A;  3STZ C;  3FYE B;  3ZIA G;  4FK5 C;  5BZB A;  2K1E A;  3W7S A;  2XAH A;  4JAU A;  4QIW F;  2ZDI A;  2UXN A;  2WLI A;  3VOU A;  4Z1M G;  2V1D A;  2ZXW B;  1FXK B;  5B1N A;  3CCS V;  3K9A A;  4UV8 A;  2WLL A;  1MAB G;  4JYB A;  5DM6 V;  2KB1 A;  3ZN1 A;  4LCU C;  2AHZ A;  3FB5 C;  3ETG A;  4CBC A;  2QKS A;  1CP9 A;  4WFB V;  3OR7 C;  4GX1 A;  3B8N A;  3F7V C;  4UV9 A;  2XAF A;  4H37 A;  3OFN G;  2X6C A;  1Q82 W;  5EBW C;  3SPI A;  3BY6 A;  5LGN A;  1F51 A;  3CME V;  4MTO A;  3ZMT A;  3IGA C;  3KG2 A;  1KQS U;  4HYO A;  1K5Q A;  3IFX A;  2OT5 A;  2Y69 C;  3JD3 A;  4XDL A;  1DLB A;  1JOY A;  2B1I A;  3K79 A;  1J95 A;  2GHY A;  1SET A;  3SPJ A;  2OTL V;  2JIZ G;  2Y69 B;  2DQ3 A;  2EIL C;  2WLH A;  1K92 A;  4JTD B;  5KA6 A;  1E1R G;  4H33 A;  2F43 G;  2LFR A;  5LGU A;  1OCO C;  2EIL B;  4MW8 A;  2HFE C;  4PA9 A;  1L1F A;  3JD0 A;  1XL4 A;  3K3W A;  1R3L C;  1YJW V;  4LP8 A;  4XDJ A;  1WLE A;  1KC8 W;  1QVF U;  3OE7 G;  3D3I A;  1OCO B;  1R3J C;  3ABK C;  2D3O W;  1R3K C;  2HJF C;  1OCR C;  4UXN A;  3E8G A;  3CCE V;  4RQF A;  1M56 C;  3ML0 A;  2BOC C;  4F4L A;  3ABK B;  4BIU A;  4PA3 A;  2HVK C;  1OCR B;  3RVZ A;  3LDE A;  3OEH G;  2XND G;  3OW2 U;  2IU0 A;  4X88 A;  2JEX A;  2DYS C;  1M56 B;  4PDV A;  3AG3 C;  1SER A;  5B1O A;  3ABT A;  4JTC B;  1JVM A;  2DYR C;  4I9W A;  2JJ2 G;  1AI6 A;  3K04 A;  4E2L A;  2DYS B;  2WPD G;  3E8H A;  3AG3 B;  3RW0 A;  2DYR B;  4BIZ A;  1NQT A;  1S72 V;  4MT8 A;  2M7W A;  1QLE C;  4FJC C;  3OM3 B;  4JGS A;  3EHB B;  4BW5 A;  2XOK G;  2IW5 A;  1QR9 A;  5IYD O;  2Q6A A;  4TSF G;  2HKO A;  4QPK A;  4PDR A;  1M90 W;  1QLE B;  2X7R B;  4WCE V;  2IJH A;  3K03 A;  4J9Z B;  4L87 A;  3AG4 C;  2EJR A;  1W0J G;  1FXV A;  2ZR2 A;  1S0V A;  1F4N A;  1ROP A;  3G71 V;  2X0L A;  1YIJ V;  4RQE A;  2DQ0 A;  1VQL V;  4OXS A;  3SYA A;  1VQP V;  2PI4 A;  5FL7 G;  3T2M A;  3AG4 B;  4R50 A;  1VQ7 V;  2IJK A;  1LNQ A;  1NBM G;  1PL0 A;  4QNH B;  2HLD G;  3I56 V;  1CPY A;  4RO2 A;  3JYC A;  2EIJ C;  3R65 A;  1V54 C;  2IU3 A;  5L3F A;  1COW G;  1MG1 A;  1P4R A;  1QVG U;  1ORQ C;  3CXC U;  4DXW A;  3G6E V;  3ETE A;  2IJJ A;  4X8A A;  3ZCC A;  1VQK V;  2EIJ B;  1GTO A;  1SRY A;  3RVY A;  4EKW A;  1V54 B;  1QBZ A;  1K4C C;  4JF3 A;  4MTG A;  4P30 A;  5L3B A;  3HB3 B;  3OGC C;  2XAG A;  3E86 A;  1P7B A;  3ABL B;  3CCM V;  1Y66 A;  3A0R A;  3OAA G;  1W2B U;  4J9Y B;  1KD1 W;  4Q20 A;  5B1B B;  3JD4 A;  1THZ A;  4FMT A;  1FFT B;  3CPW U;  1F23 A;  2EZP A;  2W0F C;  1GMG A;  4X89 A;  1QCE A;  1AJN A;  2QA4 V;  3LDD A;  3T4D A;  4QE7 A;  1V55 C;  1HWY A;  5LHH A;  4ZBM A;  4MW3 A;  4GX0 A;  3DGE A;  3JD1 A;  3ABM C;  4G2K A;  3CYO A;  1NH2 D;  1V55 B;  3SYQ A;  1BHB A;  2P90 A;  3WFV A;  1M57 C;  4FPP A;  1BMF G;  3ABM B;  4JAS A;  2Z3Y A;  2WLM A;  1RM1 C;  2XAQ A;  3GWO A;  1M57 B;  1K9M W;  3CCV V;  1NH2 B;  1S5H C;  3ABU A;  4P9P A;  1RM1 B;  1VQ5 V;  2YEV A;  4R6Z A;  1ARO P;  2QE7 G;  1G4Y B;  4JPR A;  1RPR A;  3F5W C;  5GW7 A;  5CA3 A;  1K3E A;  1H38 A;  4MSW C;  1VQ8 V;  4N21 A;  4GX2 A;  1G8M A;  5IYB O;  1YTF D;  3CP1 A;  1R6K A;  4UVC A;  2ATK C;  3ZMS A;  1OCC C;  4PDL A;  3AG2 C;  2A0L A;  2ZR3 A;  1M9N A;  3BEH A;  4P9O A;  1WPX A;  2GSM B;  5LHG A;  5LHI A;  1KP2 A;  1Q86 W;  1OCC B;  2ZDI C;  3AG2 B;  3DTU B;  4MVQ A;  1N8R W;  1S76 D;  2HR3 A;  2WSS G;  2WWW A;  2NNU A;  3OR6 C;  5E1A C;  3E8B A;  2AHY A;  5CBG A;  1RPO A;  3ASO C;  1K7D A;  2WLI B;  1GKF A;  3B8M A;  3F7Y C;  3OEE G;  3W7T A;  3W7U A;  1SES A;  2W6J G;  1NVP D;  3CC4 V;  1TUE B;  2IJI A;  2WLL B;  3CD6 V;  2WAM A;  4KFM A;  2ITC C;  3ZJZ A;  1FXK A;  3ASO B;  4JAV A;  3ETD A;  4U7O A;  1AJP A;  1E79 G;  2C2A A;  1YHQ V;  3OMN B;  3OMI B;  5EBM C;  1AJQ A;  2ZQM A;  3TCU A;  4JYC A;  2P6J A;  4G28 B;  3G4S V;  3ZRX A;  3QNE A;  1Q81 W;  4PA7 A;  1NVP B;  1CEZ A;  1KP3 A;  5H9C A;  3EFF K;  1R6N A;  1PKX A;  2FTK A;  3E83 A;  3MHH C;  4BAY A;  4ASU G;  3T4Z A;  5KUM A;  4WFG A;  1NKD A;  1R3I C;  3QO5 A;  1OZ0 A;  3FB7 C;  1GO3 F;  1B6Q A;  1NR1 A;  2B5U A;  3K08 A;  4XDK A;  2HG5 C;  4G27 B;  3ZN0 A;  3CCQ V;  4PA6 A;  4GCZ A;  4KUM A;  4WF9 V;  1VQM V;  5L3G A;  3CCR V;  4YXW G;  3CCJ V;  4DO2 A;  4WFA V;  4RUE A;  1VQ6 V;  2Q68 A;  1GK9 A;  2DWE C;  2Y48 A;  3B77 A;  4GT1 A;  3ZMU A;  1PD3 A;  4GX5 A;  5KA5 A;  4XBF A;  1JPX A;  1XL6 A;  4I5S A;  3OMA B;  5L3D A;  1YIT V;  4CZZ A;  3E89 A;  3SYO A;  2QEX V;  2QM7 A;  3ABL C;  1K34 A;  3CCL V;  4KP4 A;  3ASN C;  5B1B C;  3UM7 A;  4MTX A;  3JD2 A;  3W7X A;  3QO8 A;  1OCZ C;  1H8E G;  3SYC A;  4LBE C;  3ASN B;  3SPG A;  1MOF A;  2XAS A;  5EC1 C;  2DW4 A;  3WG7 C;  1OCZ B;  2P7T C;  1M1K W;  4UVB A;  1K8A W;  1NR7 A;  2Z5U A;  5L3E A;  3W7W A;  5HFM A;  1KKD A;  2WLK A;  4PDM A;  3LDC A;  2Q67 A;  4WFF A;  3WG7 B;  1NJI W;  4HZ3 A;  4MVU A;  1VQN V;  1VQO V;  3SYP A;  3I55 V;  4U7N A;  2NLJ C;  4MTF A;  3VBB A;  3IC7 A;  1IXM A;  1S3J A;  3STL C;  1PNM A;  2Q69 A;  3ZRW B;  2EIN C;  1GM8 A;  3FB8 C;  5J9P C;  5EK0 A;  5C93 A;  3D36 A;  3CCU V;  2WLN A;  1SZT A;  2OTJ V;  1EBO A;  3OUS A;  2EIN B;  3UKM A;  3X2Q C;  2OCC C;  5CN0 A;  1K97 A;  2IH1 C;  3ZMZ A;  1ZWI C;  4WFE A;  3ZRS A;  4R7C A;  5IDJ A;  1K5S A;  4FIP C;  4WFH A;  1MSW D;  1QLN A;  2BOB C;  1UJW B;  3K06 A;  1FS0 G;  1KEC A;  3GB7 C;  5EBL C;  2OCC B;  1AI7 A;  1I5Y A;  3X2Q B;  5EC2 C;  2JDI G;  1JQ0 A;  3SJQ C;  1PNK A;  3LSQ A;  1YJN V;  3T1C A;  1FXH A;  3HPL C;  2EIM C;  2XAJ A;  2MK3 A;  5IY5 C;  4RUF A;  3AG1 C;  3MHS C;  3P32 A;  5H6Q A;  2DWD C;  2LFS A;  3NXS A;  2JJ1 G;  4QPJ A;  3FB6 C;  2EIM B;  5IY5 B;  3AG1 B;  5HFL A;  1R73 A;  1Y4M A;  1YSC A;  1BHA A;  3CC2 V;  1EFR G;  5L3C A;  1I5X A;  1YTF B;  4UVA A;  3OUF A;  4JTA B;  5IYC O;  2CK3 G;  3E35 A;  3LSS A;  2A79 B;  3ZRV A;  1JJ2 U;  1JCH A;  1AR1 B;  2IH3 C;  2ZD9 A;  4TWK A;  3TET A;  1OHH G;  2EBO A;  5CMU A;  3TK1 A;  2R9I A;  3CMA V;  2QTO A;  5LGT A;  2EIK C;  1H2G A;  1K4D C;  4LC1 A;  5H6R A;  4P2Z A;  4PEL A;  3K0D A;  4MVO A;  4QE9 A;  2HVJ C;  2QM8 A;  2X6A A;  2LP7 A;  2ITD C;  2EIK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...