4PA6A

Structure of navms pore and c-terminal domain crystallised in the presence of channel blocking compound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 29
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa6A00
4RUEA 2IH3C 3SPCA 4X8AA 3BEHA 4P9PA 4MSWC 2P7TC 3RVYA 2X6BA 3X2QC 2X6AA 5EC2C 1BL8A 2BOCC 2WLLA 2WLIA 1K4DC 3K04A 4PA7A 4P2ZA 1OCZC 3UM7A 2Y69C 4GX0A 3IFXA 3GB7C 3TCUA 3AG4C 1LNQA 5E1AC 2WLNA 5B3SC 5IY5C 2HVJC 1V55C 3T4DA 4R8CA 4WFHA 3SYPA 3FB8C 2EIKC 4MVUA 3SPGA 4MVZA 5KUKA 3HPLC 4P30A 4PDLA 2ATKC 2QTOA 1JVMA 4G28B 3K06A 3FB5C 2WLMA 2HJFC 4HZ3A 4CBCA 3LDCA 3E86A 3K03A 5KUMA 2WLLB 2WLJA 4PA4A 1XL4A 3FB7C 4P9OA 2EIJC 2R9RB 3AG2C 3OR7C 1OCCC 4JTCB 2KB1A 4MTOA 3RBZA 3F5WC 5EBLC 5B1BC 4PA3A 4LCUC 4GX2A 4MVMA 2A79B 3STZC 1V54C 3AG1C 4JTDB 2QKSA 1K4CC 1XL6A 4TWKA 4XDKA 3ZRSA 2A9HA 3PJSK 4XDJA 4QE9A 4RAIA 3ASOC 3OR6C 2A0LA 4MS2A 4R50A 3ABLC 4MTGA 4XDLA 4LP8A 4J9YB 4MTFA 3OUSA 5B1AC 1M56C 2YEVA 3OGCC 4QE7A 4GX5A 1R3LC 3SYCA 3IGAC 4X89A 2WLKA 4WFFA 2K1EA 2EIMC 4MVOA 3K08A 4HYOA 2HVKC 2EINC 4R6ZA 4JTAB 3SPHA 4PA9A 2H8PC 3LDDA 5J9PC 2AHZA 3LNMB 4G27B 1ZWIC 4F4LA 3TETA 1R3JC 4DXWA 4PDMA 4MVSA 4WFEA 3E8GA 2ITCC 4H37A 4UUJC 2AHYA 2DYRC 1OCOC 2X6CA 2ZXWC 2ZD9A 5EBWC 3F7VC 3AG3C 4RO2A 4I9WA 3FB6C 4X88A 2Q68A 3SYOA 5CBHA 1QLEC 2OCCC 4MW3A 4MVRA 5EBMC 3ZJZA 2HFEC 2JK5C 3JYCA 1J95A 4QNHB 1G4YB 3WG7C 4OXSA 4PDRA 4LBEC 3STLC 4MW8A 1S5HC 5EC1C 4H33A 3LDEA 1OCRC 4MVQA 4KFMA 3E8HA 2EILC 3SPJA 2BOBC 3EFFK 4PA6A 3SYAA 3OUFA 3UKMA 4EKWA 3ASNC 3K0GA 5BZBA 5EK0A 3T1CA 3SPIA 3E8BA 3E8FA 3RVZA 4R7CA 5CBGA 1P7BA 3T4ZA 2HG5C 2IH1C 1KKDA 1R3IC 2DYSC 1R3KC 4J9ZB 3RW0A 3KG2A 5CBFA 1M57C 4GX1A 1ORQC 2DWEC 2W0FC 2WLHA 4WFGA 4ZBMA 3R65A 3VOUA 3E83A 2WLIB 4RUFA 3SJQC 4PDVA 3LUTB 4BW5A 2Q6AA 3E89A 2NLJC 3ABMC 3K0DA 3T2MA 3F7YC 3ABKC 2Q67A 3SYQA 2ITDC 2Q69A 2DWDC
chains in the Genus database with same CATH superfamily
4TQFA 1F23A 3HKCB 2A3QA 3BEHA 2B9ZA 2ZM6O 3HKEA 1KUQA 2ZCEA 1PNLA 1TA8A 1WA8B 2WLIA 2G38A 1KC8W 4P2ZA 1V9PA 2Y69C 5CMUA 4O2AB 5LHHA 2WLNA 3OTOB 1DF4A 3T4DA 1FPOA 1YTFD 4FM1A 1XNQB 1XREA 1N8RW 4P30A 3K9SA 1HR0B 1SQQH 1JFFA 3SJBC 4J41A 1XUQA 5JH7B 2LGWA 4P9OA 1OCCC 4YJ2B 1K5QA 2KB1A 4LFCB 3K5OA 1EFRG 4KHPO 2QKSA 3OM3B 3PJSK 3QO5A 1YTFB 4DV6B 2LQTA 2EIKB 1OCZB 2ZE8A 4MS2A 4JF3A 4XDLA 4LP8A 1DK1A 2XAJA 2ZDIA 5IJ0B 2FYUH 1NH2B 4LF5O 1H2NA 2M6YA 1Y4MA 2LO1A 3D36C 1KMIZ 2AHZA 3W7WA 1N4CA 1YITV 3E8GA 4JPRA 4I9WA 5EBMC 3L71H 3HB3B 5J2UA 1AR5A 4JI6B 3N2GA 2YIBA 3G4SV 3WB1A 4JI5B 3LSQA 1QNMA 1JR9A 1W0JG 2UU9O 3D3IA 1IBMB 5C93A 3OUFA 3UKMA 1P4RA 5KA5A 3K5NA 4JYAB 1HDJA 1VQ6V 3WB2A 3E8BA 1BHBA 4FVMA 2EZPA 4UVAA 2DYSC 1AJPA 5LP6C 3RW0A 3FX7A 2CAZC 2YIDA 5LP6B 2IJJA 3BA8A 1N0NA 4O4IB 5FNVA 1YVWA 5CA1B 5IYBO 1NVPD 3ZHVA 3ZMZA 3GB7C 2Q4PA 4TV9B 1SZTA 1ZAUA 3H1HH 3FAVB 2EIJB 3FFQA 1IBKB 5KLVH 5IJ0A 4CBCA 2WLMA 1N34B 4UCVA 3MDSA 5LYJB 4LF8B 1NZ6A 2E75B 2Y4UA 1Y67A 2R9RB 1VEWA 3F5WC 2XHBA 1Q6HA 3J81N 5FPOA 4AQYB 3CCLV 1V54C 2P67A 1MMMA 3AG1C 4JTDB 4PI0A 3ZN1A 2W0XA 2ARHA 3M8AA 3ABLC 3W7SA 2CUGA 4GZRB 1HNZB 2ODMA 3IGAC 2ADPA 2WLKA 2LP7A 1JOYA 5DM6V 4HYOA 2EINC 1HNXO 4QGPA 4PHZA 1BZKA 1M1KW 1ZSPA 4HBNA 5J9PC 3T1YO 1GO3F 4HAMA 3SGIA 2V7QG 3ZMSA 5KHHA 4FLUA 1XMQB 2AHYA 1OCOC 4X1KB 2CH7A 1VARA 4I9QA 3ZHRA 3JYCA 2GUZB 2UUAB 3FYIB 1DTOA 1S5HC 5EC1C 1Q6IA 4DR4B 3Q4HA 4H44B 2GUZA 3JSLA 1Y66A 4Q20A 3E2EA 1CXZB 4LF7B 1SF9A 2B1GA 1WNSA 1M57C 1I7FA 1O9GA 3CWBH 4IYHA 2Q69A 4AILC 2ZKOA 1SQFA 4DR5O 2V4DA 3OMAB 4U3FH 3JCZA 1TAEA 1YSCA 5FL7G 2RJZA 2WLLA 3G6EV 4GX0A 3CRCA 1OV9A 5GONA 4O4HB 3RYHB 1EZVH 3RYFA 2KSDA 3APOA 4MVZA 4UCRA 2PGGA 4EB6B 1MG1A 1P84F 3CCQV 4YXWG 1H2GA 1AI5A 1Q86W 2LJ2A 3OMNB 5C8YA 5JVDB 3T1HO 1XL6A 4JI7O 2ZNJA 4DUYB 4B3RO 4QPJA 3BHPA 1E1RG 1MZEA 3ICXA 4JI3O 3FAVA 3AG3B 3C90A 4JTAB 4UXNA 2ZR2A 5IT9N 3LDDA 3J80N 4FZ0A 4FLWA 4X1YB 4QNHB 2UUBB 5BXZA 4RO2A 5CBHA 1QLEC 4MW3A 2OCCC 3BPZA 1Z5WA 2EULA 3ZBHA 2QJ1A 1K7DA 1H2SB 4UV8A 1NS1A 2BCCH 2E76B 2E3CA 5IYDO 1PKXA 3C3SA 1IBMO 1BE3H 1H2KA 1YXBA 4O4JA 3CMEV 4I50A 3CPWU 1V55B 4FLZA 1QVGU 1ZLZA 3CCRV 3JASA 1R3IC 1W0KG 3KG2A 1KB9F 2Q7GA 2WWWA 2WLIB 4NTWA 1EN6A 5DEDA 4NYKA 3F7YC 3O9OA 3F5TA 1XBLA 3HKCA 1KBHA 3K5LA 3H1LH 2P7TC 2RMKB 1FJGO 2CH7B 1BL8A 4DV7B 2ETNA 3OEEG 5IY5C 3OD4A 1RFYA 2ZQMA 4WFHA 4CC5A 2JJ1G 1H8HG 2YDEA 1SESA 1UJWB 3K06A 3FB5C 1BCCH 1J5EO 1Q81W 1XNRB 1M4UA 4LF8O 4GCZA 5B1BB 4E2LA 1SERA 1I0HA 1GTOA 3X2QB 2B1IA 1COWG 1VQ7V 3CSXA 1Q6UA 1VF7A 3AK2A 4FJCC 4GT1A 5L3FA 3W7TA 3SJAC 2PF4E 4UV9A 4JI2O 1OCCB 3OGCC 3CCMV 4UFZA 2A06H 2R70A 4GKJO 3IC9A 3K08A 5LGTA 3JAMN 1YZBA 1R6KA 1L0LH 3T1YB 1QR8A 4MVSA 1XDCA 1NR1A 1KQSU 2ZNIA 3CB2A 1GMGA 2P5OA 5JVDA 5BY1A 3CC4V 2QTSA 5D5QA 2JS5A 2ZINA 2F95B 1SA0A 4JASA 2CK3G 2UXCB 5FNVB 1FXHA 1I5XA 3CEIA 1PM9A 4U7NA 2O57A 4MVQA 1QR9A 1S72V 3SYAA 3H9VA 3Q4HB 4UB6Z 4O4LB 4I50B 5B1OA 1KP2A 5CBGA 4PELA 1AI6A 4BR6A 5GONB 4KP4A 1L1FA 3CXHF 3LSSA 2H3OA 3L70H 3DTUB 3MHHC 4I5SA 1AJNA 1SRYA 2MW2B 3R66A 2YXYA 2ZT9B 4JI8O 3JALB 4L87A 4YY3B 2QEXV 2UUBO 3RN4A 2HEPA 3J7AU 2XTAA 3CXCU 2KG7B 3CRAA 1B3QA 5KAFZ 4LF9O 1MA1A 1BQZA 5KHKA 1XHXA 2Q0AA 2XAGA 4I4TA 4DK0A 1JVMA 4G28B 2JIZG 2OIGA 1PD3A 3NR7A 2IBZH 4FIPC 1LUWA 1RP3B 2P06A 2N05A 2RN9A 3STZC 4O2BB 1OJHA 1HNZO 3ZMVA 4LF4O 1Y74A 4QE9A 4MTGA 4MTFA 2UXXA 1HNWO 5IWAO 1TVKB 3TGUH 4UB8Z 4X64B 3IAYA 3WB0A 1TUEB 5GW7A 3DGEA 3TETA 4DR2B 3JSNA 3L73H 1NI8A 3N2KB 2FKXA 5DN6G 1K34A 1S77D 4L8JA 1J5EB 4NXNB 4TOIA 4DUZB 2BTQA 5H9CA 3AK1A 1QHTA 1L8DA 4CH3A 2F93B 4DRXB 5JWPA 5LMUO 4TQDA 3EFFK 3K5MA 1BGYH 4J11A 4I7ZB 2OTJV 5B3SB 2P6JA 1KKDA 5FLXN 3ML0A 1AR1B 3BRCA 3E83A 1EZJA 5CN0A 3OTOO 5JCOA 4CS3A 3ABMC 4ZHQA 2IH3C 4DR6B 2HJDA 4ABMA 1BS3A 3X2QC 4ICGA 4WF9V 5LXTB 3BFRA 3ABKB 4IL6Z 4LWSB 1AP6A 3AG4C 5ITZA 5B1NA 1M9NA 1U96A 4DV2O 4H0LB 4PDLA 2AZ2A 1Y74B 2HJFC 2PI5A 4DR5B 2C2AA 3OR7C 4RQFA 2F1MA 4LWSA 4X62B 1QCEA 4LF7O 1UFIA 3A0HZ 2VQFB 3JARA 1EBOA 4JI1B 4YY3O 3C3TA 1M56C 4ZIBA 5IYZB 1Q90D 3OEHG 3S3WA 1VQKV 1M56B 1M93A 4R6ZA 5BMVB 3OTFA 2H8PC 3ASOB 3BAAA 4G27B 1ZWIC 1G8MA 3VQYA 4J7JA 4FZ1A 1JJ2U 1H2MA 3OW2U 2UUCO 1W2BU 2R72A 1YHQV 2HFEC 3A8TA 4UCTA 2PI4A 2BSKB 2GBOA 4TV9A 3JASB 1JJOA 1I94B 2OCCB 5EYPB 4KFMA 4GYCB 1NH2D 4B7KA 4IGGA 4MT8A 3T1CA 3SPIA 4LF4B 3E8FA 3RVZA 1SQVH 5LXTA 1QLNA 1GM8A 3SJQC 4X64O 1TVKA 1MSWD 4DV5O 2P90A 4Q6GA 3K0DA 1OCRB 1TGOA 2AGAA 4RUEA 3THOA 5IJ9A 1VQMV 4LFAO 4ZI7B 1K73W 1QQCA 1BQ0A 1Y76B 2Z3YA 1AP5A 5J2UB 1NJIW 2E74B 5B3SC 3UQ8A 3HKBA 3B8NA 3H1KH 1Q43A 1FYJA 1RSOA 1H2LA 3CE2A 3L75H 1R6NA 4X1IA 2JGDA 5LOVB 3K9AA 4HZ3A 1F51A 1ENVA 1HWYA 2GDSA 2ILMA 3N27A 5D5PA 1HNXB 4TUYA 5EBLC 3W7XA 4MVMA 5JH7A 1YJWV 4ZOLA 2D2CB 4I55A 3UCSC 4QE7A 1HNWB 3S3XA 1E1QG 3L72H 2HVKC 5B66Z 2N74A 3KZIZ 1R1BA 2FMLA 5AG2A 2EZOA 5KX5A 2UXDB 4QIWF 4FLYA 3OMIB 1G1XB 2XASA 4I55B 4H37A 1PNKA 4DV1B 3SYOA 2LFSA 3FB6C 3ETQA 4YIPA 3QF7A 3CC2V 1G4YB 3ABTA 4OPAA 5JCOC 1NVPB 1Q3EA 5E79Z 2GSMB 5LOVA 1VF6C 1UPGA 1FFTB 5LGNA 3QVNA 4DR7B 1SQBH 3T4ZA 2GTAA 4PJ0Z 1ZL8B 1PPJH 2Q0OC 1XMOB 3DXRA 3M7MX 5B5EZ 1ORQC 3DC6A 4X20B 3RFRA 2KQXA 3CS5A 4BW5A 2A7WA 2VWKA 1N33B 3ABKC 1QLEB 2UXCO 1CP9A 3VQWA 3SPCA 3E35A 4Z1VA 2EJRA 2JDIG 4P9PA 4MSWC 4DR6O 2ADQB 4W4LA 1YJNV 2LW1A 5EC2C 1FAFA 4JYYA 4EFBA 3K04A 3K57A 1KD1W 2HHHO 4B3MB 1VMGA 2Y0PA 3SYPA 4E4EA 2Z5UA 1EM1A 3JD2A 1SQGA 2IU3A 3OT7A 3E86A 2YXLA 5KHIA 5CA3A 3FB7C 1LUVA 4DR3O 1S3JA 3RWRD 1K4CC 5LA6B 3CRMA 1FD9A 3ZRXA 2OWOA 2IM9A 5K1XA 3ASOC 3OR6C 3AG7A 1GM7A 5B1AC 2YEVA 4J42A 3AG1B 4DR2O 2QGNA 4I4TB 3A0BZ 4O4IA 3SPHA 1GH6A 4LNUB 3JALA 4FM2A 1R3JC 1GN2A 4DXWA 2VWJA 1A32A 2ITCC 1OZ0A 1YIJV 3F7VC 4IHJA 2UUCB 3RYFB 2UXNA 1YF2A 2YI8A 1VQ8V 2R9AA 4BIZA 2HKOA 1H38A 1IXMA 4JZ2A 4O4LA 2PUSA 1YCIA 1BSMA 3MAQA 3SPJA 2BSKA 4YJ3A 2ZE6A 4J10A 2QWNB 5EK0A 4TV8A 4G2KA 4K8XA 2ZE5A 2HP8A 2EJ7A 3OE7G 4KXRA 3AK3A 4WFGA 2JGUA 1Z5VA 4PDVA 5LHGA 1QU7A 5JJEB 5J2TB 1WP8A 3HKDA 4IIJA 1GM9A 3SDLA 2UUAO 4X8AA 5EZYA 1XNRO 2XAQA 1PL4A 2RQ6A 4DRXA 1EN4A 1PL0A 2W6JG 2BOCC 2PTMA 5L3CA 3JD0A 1S0VA 4TSFG 4CH4A 1NTKH 2Y69B 3EHBB 3I55V 4NXNO 1RPOA 3HR0A 3N2KA 5GTIZ 4TUYB 2WPDG 2YSUB 3LDCA 1B04A 3K03A 1VQ4V 2WAMA 3RGBA 4LH6A 2CE4A 2QE7G 1XNQO 4XDKA 4IHJB 3JATB 3HKBB 4FMTA 4Z1MG 4R50A 3QNEA 4B3SO 4F6RA 5IDJA 4OGQB 2E5LO 2ZXWB 5KMGB 3CYOA 4JI6O 4JI4B 1IBLO 1K9MW 3BVOA 2JJ2G 4JI5O 3I5DA 1OHHG 5KA6A 3LNNA 4UUJC 4CH6A 1YI2V 2F23A 4N23A 1VQNV 2X6CA 3AG3C 3OGIB 4MVRA 4WBNB 4LF5B 4BW9A 3D3QA 3I56V 2X7RB 4NB5A 4GUNA 4JI8B 1GKFA 4O4JB 3ZN0A 2DYRB 4PD4F 3JCUZ 2MK3A 4O4HA 4JI3B 1FFXB 1AROP 4R7CA 5EIBC 4J9ZB 2VQFO 1XI1A 4ZBMA 4LF9B 4BIUA 1BT8A 5L3DA 3KKYA 1URFA 2FB5A 3SYQA 2ITDC 2YUAA 5KUKA 5BMVA 1FS0G 4FM0A 5H5NA 5TISZ 4B3TO 5IYZA 1K4DC 3TXSA 4U3JB 3TJTA 5CA0B 3RYCB 3ETGA 1HW7A 2VQEO 1TUBB 4PI2A 3CCJV 2H94A 1RM1B 2Q9LA 1AVMA 1I94O 2PY5A 5B1AB 2ZDIC 4X65O 2DMXA 1VQPV 5BR8B 2KKWA 4N21A 2DE0X 4FFBA 2DQ3A 3ABMB 1D2DA 3AG2C 4MTOA 1BMFG 4YJ2A 3JARB 1WB8A 2EIMB 4DW0A 2JS3A 4TWKA 1FJGB 2QKCA 1WN7A 2OYQA 3RYIB 3MD0A 1F4MA 4J9YB 4NVPA 1IX9A 4LH7A 2VS0A 3K59A 4DV4O 3EVKA 2EINB 5JQGA 3ZRWB 3L74H 4DV3O 2UXDO 4AQYO 4LFAB 1FFXA 1BHAA 3SR2C 5DECA 4PA9A 4DR4O 1Q5OA 3LNMB 1JFFB 3CP1A 4WFEA 2CTQA 1K8AW 2XT9A 2EILB 1R73A 3DSQA 3VQXA 2OCHA 2Q68A 4DV0O 5GTHZ 1XQ8A 2IU0A 4CS4A 1T5EA 4OXSA 4MW8A 2YI9A 3CCSV 2PZSA 2RCVA 1SA0B 3HKDB 1P7GA 3QO7A 3UO2A 4PA6A 4GKJB 2X0LA 1X4TA 1CPYA 2WA4A 1GRJA 4DO2A 1IZ3A 3QG5A 2Q5ZA 4D6TH 1JCHA 4JZGA 3VBBA 2F43G 4DV1O 4DW1A 3ZHTA 1IBLB 1QBZA 4D7SA 2OT5A 2B5UA 4ZI7A 1MABG 3AG4B 2CTPA 4FLTA 1DGSA 2F4VB 3UT5A 3W7UA 2BTQB 4GLXA 2CTWA 1YDXA 4X62O 2GHYA 4LFBO 5E1AC 2L6LA 3FB8C 4JYBA 4MVUA 4FLVA 1WPBA 2ATKC 2QTOA 4DR3B 4LR3A 1N33O 3ZEDA 5LGUA 5KUMA 2UXBB 5EYPA 1XL4A 4O2AA 2YICA 5LA6A 4UCSA 2JEXA 3ZRSA 3BCCH 1WLEA 4BIOA 1O9HA 1H8EG 1G6UA 4RAIA 1RM1C 3P3PA 2UU9B 1AI4A 1ZX3A 4H13B 4JV5B 3GWOA 2IJIA 1KECA 1SQXH 1FXKC 4TV8B 3T1HB 2FL4A 3JAKB 4JAVA 1VQLV 1JA8A 2FTKA 3U11A 4X65B 2DW4A 4LF6O 3JD1A 3K3WA 3ETEA 3CC7V 3RYHA 3WG7C 4JI0O 4DV5B 1THZA 2IJKA 1N0JA 1AR4A 1XHZA 4EKWA 1SZXA 5CB4B 1M90W 5LP6A 3CJHA 4J7ZA 1NTMH 1Q7YW 4OPHA 2CTRA 5CBFA 1VF6A 3ASNB 3EXAA 4CC6A 3SJCC 3E89A 1N34O 1VQ9V 2XAHA 2Y48A 3MHSC 2QKAA 3H01A 4O2BA 4DUZO 2WSSG 1GN3A 5LMNB 1NU1H 3RVYA 2AZ0A 2F66C 1PNMA 2P4VA 5LMUB 4PA7A 1YEWA 4FPPA 1M57B 2QR4A 3D36A 4YHHB 3K79A 2EBOA 2HVJC 5H6QA 4GKKO 5LHIA 1GN4A 3HPLC 5CB4A 4WCEV 4JYCA 2XOKG 5JQGB 2ZM6B 4JI2B 2WLJA 1M5IA 2AW9A 4UCOA 4D7TA 3BABA 3BY6A 1U97A 3ZS8C 2QM4A 2CGOA 2DQ0A 1SETA 3P30A 4NR1A 1Q8IA 3OAAG 3APQA 1N32B 3ZRWA 3CCEV 1HR0O 4X20A 4IIJB 3SYCA 4DV4B 4GX5A 1YJ9V 4UVCA 2K1EA 1OCOB 4ZHQB 4X1IB 1MZFA 2QSAA 4DR7O 1EN5A 1MSDA 5EBWC 2XNDG 1KU9A 3ETDA 1Z2GA 2JK5C 3ZMTA 2JGDB 4DR1B 1NKDA 4PDRA 4LBEC 4JI1O 4QPKA 2NN4A 1NR7A 5KHJA 1MNGA 4U3JA 4TT3G 2GTSA 1B06A 2HG5C 3WFVA 2DOSA 1GN6A 1N36O 2W0FC 5IJ9B 3U10A 3NXSA 2Q6AA 2DJVA 5JJJB 4X66O 2E5LB 3IJ4A 3UO3A 3CCVV 2DYSB 1QVFU 2Q7EA 4RWUA 1R6TA 4LF6B 2VQEB 3ABUA 4JI7B 1OCZC 4ZKIA 1WP7A 1F4NA 3TCUA 3RYIA 3ZHSA 1V55C 4EFEA 2YEVB 4YIOA 3KCYA 3QTCA 2L35A 2EIJC 3RBZA 3N2GB 2CDYA 2ZR3A 4BWAA 2ZIOA 3VQVA 1JQ0A 3B09A 5FPRA 2A9HA 2QDOA 4NXMO 1XOUA 5CA0A 3RYCA 4DV3B 4OX9B 5KMGA 5IY5B 4X89A 3CCUV 1US6A 3E22A 3P32A 2XAFA 3CX5F 2QWPB 4PDMA 2R9IA 4PV1B 2LGQA 1S76D 5IWAB 1J95A 2HLDG 1JPXA 4MTXA 1WA8A 3O65A 2EILC 3CRQA 2BTOA 1LR1A 3B4SA 3DC5A 1ZTEA 4W4KA 1XMQO 1N32O 2IH1C 1R3KC 1NQTA 4F6RB 2DWEC 4HNAB 4A5UB 3LUTB 3U0ZA 4K0KO 3T2MA 1P49A 3A2FA 3AEIA 3P3NA 1L0NH 4EEQA 4LFBB 2X6BA 4IYIA 5H2FZ 2M7WA 5H6RA 1ROPA 4ZOLB 3L9DA 2IJHA 2AXTZ 4X9QA 1B6QA 1GAXA 2GV9A 3JAWA 4I0XA 4YJ3B 4QJFB 1Y6XA 1SC5B 4UCUA 2QWRB 3SPGA 4NKGB 1XMOO 2YXHA 1JX9A 4B3SB 5LBQA 1K5SA 2WLLB 3H1JH 4PA4A 3FD9A 4JYAO 4JI4O 3LSUA 3E22B 4LCUC 3G71V 5LL6Y 4DV2B 1WPXA 4CS2A 3K58A 3OUSA 1AJQA 5A9GA 1R3LC 3G67A 4IT5A 2YS8A 4MVOA 3PN1A 5L3BA 1SS3A 5EZYB 2F4VO 3CJHB 2IW5A 1Y76A 2UXBO 3CMAV 2OIEA 2JVDA 3ZIAG 5HFLA 1VF5B 2P4KA 2KG7A 1Q82W 2LFRA 2YIBD 1WAZA 2DYRC 2QWOB 4NTYA 2Y4TA 3JD3A 1V54B 5F2VO 1IURA 1I5YA 4CH5A 1W59A 2W6IG 3ZRVA 3LDEA 4CZZA 3E8HA 3CHXA 4KL1A 1IXBA 2ZE7A 1I08A 5BZBA 4LNUA 3TXQA 1E79G 2NNUA 4B3TB 4X1YA 4FK5C 1SQPH 4DYLA 5ITZB 1NT2B 3ZHQA 2D3OW 1X59A 3CD6V 3TK1A 3B40A 1VQOV 2Q8VA 4B08A 2NLJC 3BA9A 3D8CA 4JV5O 4B7EA 2DWDC 4RQEA 2JRIA 5BR8O 1FKAO 4J7KA 2X6AA 4K8ZA 3G80A 2QM8A 1HP8A 2DN9A 1DF5A 1LNQA 4R8CA 2Q73A 2QWQB 2JEUA 5A2QN 4JI0B 5HFMA 2VRZA 3B8MA 2N04A 1SKVA 1IBKO 2PYJA 3M99B 2LW7A 5C8YB 2RNBA 3QO8A 5IE9A 5B1BC 4DV7O 4KHPB 3FYEB 4X1KA 2HR3A 4YHHO 4OX9O 4DV6O 2OTLV 4DV0B 4AHCA 2QA4V 3DXRB 4AI8A 5EIBD 1IDSA 1D5NA 1WJZA 5LMNO 1ZUQA 3OFNG 2Y0IA 4F6EA 3B77A 1NBMG 5K1PA 3ZX6A 2ZXWC 4FFBB 2PYLA 5L3EA 4GKKB 3ZJZA 1VIBA 1ZL8A 4ASUG 5J2TA 3HKEB 4JAUA 4NTXA 2RDCA 3B2EE 4H33A 1IVSA 1AB3A 1K33A 1KYOF 5KX5B 1K97A 5CA1A 4HNAA 3FKSG 2P22C 1P7BA 1XILA 4GX1A 1VP7A 4DUYO 4LFCO 1KKCA 4RUFA 4Z2WA 3A0RA 3GWKC 2HHHB 4B3MO 4DK1A 4LC1A 2WA3A 1PV0A 3ZHUA 1F7YA 1K3EA 3G6BA 3H1IH 3ZMUA 2ZIMA 3UM7A 3RT3C 2XUMA 3IFXA 3JD4A 4B3RB 2V1DA 4U7OA 1AI7A 2Q7HA 1FXKA 1WB7A 5L3GA 1JMKC 5LYJA 3CRRA 2EIKC 4C7UA 4DR1O 2NR5A 1K92A 4K35A 5KAIZ 3JAKA 1DLBA 4JAAA 4JTCB 4PA3A 4UVBA 4GX2A 4J80A 1FXVA 2A79B 4FFKA 1RSOB 1MOFA 1FXKB 3GVMA 1TUBA 1N36B 1AILA 4XDJA 2A0LA 2BE3A 2EX3A 1RPRA 4KUMA 4X66B 4WFFA 2EIMC 2CGNA 3KCXA 1VQ5V 1D5AA 4BAYA 1S5JA 3ABLB 4K3AA 4FLXA 4F4LA 4WFAV 5IYCO 2ZD9A 4X88A 3WG7B 2QM7A 5JJNB 4WBNA 2YC0A 3JAWB 4I0XB 4EB6A 3STLC 4WFBV 1OCRC 4JGSA 2BOBC 3ASNC 3K0GA 3ZCCA 3UT5B 2Z0AA 1CEZA 4K0KB 1PP9H 1S5LZ 4NXMB 1NTZH 2WLHA 1XEQA 3R65A 3VOUA 3WU2Z 1KP3A 5KHGA 2K9PA 3IC7A 4XBFA 3AG2B 3JATA 2Q67A 1GK9A 2YIAA
chains in the Genus database with same CATH topology
1GM9A 1QVFU 1F23A 4X8AA 3BEHA 2QEXV 2XAQA 1PNLA 3ABUA 1PL0A 2W6JG 2BOCC 2WLIA 5L3CA 1KC8W 4P2ZA 1OCZC 2Y69C 3JD0A 4ZKIA 5CMUA 1F4NA 3TCUA 3CXCU 1S0VA 4TSFG 5LHHA 2WLNA 3EHBB 2Y69B 3I55V 1V55C 1DF4A 3T4DA 1YTFD 1RPOA 2YEVB 1N8RW 2XAGA 4P30A 1JVMA 4G28B 2WPDG 2YSUB 3LDCA 2JIZG 3K03A 1PD3A 4P9OA 2EIJC 3RBZA 4FIPC 1OCCC 2ZR3A 1K5QA 2KB1A 1VQ4V 2WAMA 1EFRG 2QE7G 3STZC 3CCVV 1JQ0A 2QKSA 4XDKA 3OM3B 2A9HA 3PJSK 3QO5A 1YTFB 3ZMVA 4FMTA 4QE9A 4Z1MG 2EIKB 1OCZB 4MS2A 4MTGA 4JF3A 4R50A 4LP8A 2UXXA 4MTFA 4XDLA 3QNEA 2XAJA 2ZDIA 5IY5B 4X89A 5IDJA 3CCUV 2ZXWB 3CYOA 3P32A 1NH2B 1K9MW 1Y4MA 2JJ2G 1TUEB 5GW7A 2XAFA 2AHZA 3DGEA 3TETA 1OHHG 5KA6A 4PDMA 3W7WA 1YITV 3E8GA 2R9IA 4UUJC 4JPRA 1YI2V 4N23A 1VQNV 2X6CA 3AG3C 4I9WA 1K34A 5DN6G 1S77D 5EBMC 4MVRA 1S76D 3HB3B 1J95A 2HLDG 5H9CA 1JPXA 3I56V 2X7RB 4MTXA 3G4SV 3LSQA 1GKFA 3ZN0A 1W0JG 2DYRB 2EILC 3D3IA 3EFFK 5C93A 3OUFA 3UKMA 1P4RA 2MK3A 5KA5A 1VQ6V 2OTJV 3E8BA 5B3SB 2P6JA 1BHBA 4R7CA 1AROP 2EZPA 4UVAA 2IH1C 1KKDA 2DYSC 1AJPA 1NQTA 1R3KC 4J9ZB 3RW0A 3ML0A 2DWEC 4ZBMA 1AR1B 3E83A 1EZJA 5CN0A 3LUTB 4BIUA 2IJJA 3T2MA 3ABMC 5L3DA 3SYQA 2ITDC 3AEIA 5KUKA 2IH3C 1FS0G 5IYBO 2X6BA 1NVPD 2M7WA 5H6RA 3X2QC 4WF9V 1ROPA 2IJHA 1K4DC 1B6QA 3ZMZA 3ABKB 3GB7C 3AG4C 1SZTA 4QJFB 3ETGA 2EIJB 3CCJV 5B1NA 1M9NA 2H94A 1RM1B 3SPGA 4PDLA 5B1AB 2ZDIC 1JX9A 5LBQA 4CBCA 2HJFC 2WLMA 1VQPV 2PI5A 1K5SA 2WLLB 4PA4A 4N21A 2C2AA 2DQ3A 3ABMB 3OR7C 2R9RB 3AG2C 4MTOA 4RQFA 3F5WC 1BMFG 4LCUC 3CCLV 3G71V 1V54C 1QCEA 2EIMB 2P67A 3AG1C 4JTDB 3ZN1A 1WPXA 4TWKA 1EBOA 3ABLC 3MD0A 3W7SA 1F4MA 4J9YB 3OUSA 1AJQA 1M56C 1R3LC 3IGAC 2WLKA 2EINB 3ZRWB 2LP7A 1JOYA 3OEHG 4MVOA 5DM6V 5L3BA 1M56B 1VQKV 4HYOA 1BHAA 2EINC 4R6ZA 2IW5A 4PA9A 1M1KW 3CMAV 2H8PC 3ASOB 5J9PC 3LNMB 4G27B 1ZWIC 1G8MA 5HFLA 3ZIAG 3CP1A 1GO3F 4HAMA 4WFEA 2V7QG 1K8AW 3ZMSA 2LFRA 1Q82W 1JJ2U 2AHYA 2DYRC 2EILB 1OCOC 1R73A 3OW2U 2Q68A 1W2BU 1YHQV 3JD3A 2HFEC 2PI4A 3JYCA 1V54B 1I5YA 2IU0A 2OCCB 3FYIB 4OXSA 1DTOA 4MW8A 1S5HC 5EC1C 3CCSV 2W6IG 3ZRVA 3LDEA 4CZZA 4KFMA 3E8HA 3QO7A 4PA6A 1Y66A 5BZBA 1NH2D 4MT8A 1E79G 2X0LA 2NNUA 4Q20A 3T1CA 3SPIA 1CPYA 3E8FA 3RVZA 3E2EA 4DO2A 1QLNA 1JCHA 2B1GA 4FK5C 3VBBA 1M57C 2F43G 1GM8A 2D3OW 3CD6V 3TK1A 3SJQC 1VQOV 1QBZA 1MSWD 2P90A 2OT5A 2B5UA 2NLJC 3K0DA 1MABG 1OCRB 2Q69A 2DWDC 4RQEA 3AG4B 4RUEA 1VQMV 3OMAB 3W7UA 1K73W 3JCZA 2X6AA 1YSCA 5FL7G 2WLLA 2Z3YA 2QM8A 3G6EV 4GX0A 1DF5A 2GHYA 1NJIW 1LNQA 5E1AC 5B3SC 4R8CA 3B8NA 3FB8C 4JYBA 2JEUA 4MVUA 4MVZA 1R6NA 2ATKC 2QTOA 5HFMA 1MG1A 3B8MA 3K9AA 5LGUA 4HZ3A 1F51A 5KUMA 1ENVA 1HWYA 3M99B 1XL4A 3CCQV 3QO8A 4YXWG 1H2GA 1AI5A 5EBLC 5B1BC 1Q86W 3W7XA 4MVMA 3OMNB 3FYEB 1XL6A 2JEXA 1YJWV 3ZRSA 2HR3A 1WLEA 4QPJA 1H8EG 4RAIA 1RM1C 2OTLV 1E1RG 2QA4V 4QE7A 1AI4A 1E1QG 3GWOA 2IJIA 1KECA 3AG3B 1FXKC 2HVKC 3OFNG 4JTAB 4UXNA 2ZR2A 3B77A 3LDDA 2EZOA 1NBMG 4JAVA 1VQLV 4QIWF 2FTKA 3OMIB 2XASA 4H37A 1PNKA 2ZXWC 4QNHB 2DW4A 3SYOA 4RO2A 2LFSA 3FB6C 5CBHA 1QLEC 2OCCC 3JD1A 4MW3A 3K3WA 3ZJZA 4ASUG 5L3EA 1K7DA 3ETEA 3CC7V 4UV8A 3CC2V 4JAUA 1G4YB 3WG7C 1THZA 3ABTA 2IJKA 4H33A 1NVPB 5IYDO 1PKXA 2GSMB 1K33A 4EKWA 1K97A 1FFTB 5LGNA 3CMEV 1M90W 3CPWU 1V55B 1QVGU 3FKSG 1P7BA 3T4ZA 3CCRV 1R3IC 1W0KG 1Q7YW 3KG2A 5CBFA 4GX1A 1ORQC 2WWWA 3ASNB 2WLIB 4RUFA 3A0RA 4BW5A 3E89A 1VQ9V 2XAHA 3F7YC 3ABKC 1QLEB 2Y48A 3MHSC 1CP9A 3H01A 4LC1A 2WSSG 3SPCA 3E35A 2EJRA 2JDIG 4P9PA 1K3EA 2P7TC 4MSWC 3RVYA 1YJNV 1PNMA 5EC2C 3ZMUA 1BL8A 4PA7A 3UM7A 3K04A 4FPPA 3IFXA 1M57B 3OEEG 1KD1W 3JD4A 3D36A 2V1DA 3K79A 4U7OA 1AI7A 2EBOA 5IY5C 2HVJC 5H6QA 2ZQMA 1FXKA 4WFHA 3SYPA 5L3GA 5LHIA 2EIKC 2JJ1G 3HPLC 2Z5UA 1H8HG 4WCEV 1K92A 3JD2A 4JYCA 1SESA 2IU3A 2XOKG 1UJWB 3K06A 3FB5C 1Q81W 3E86A 1DLBA 4GCZA 2WLJA 5B1BB 4E2LA 1SERA 5CA3A 3FB7C 1GTOA 3X2QB 2B1IA 1COWG 3BY6A 4JTCB 1S3JA 4PA3A 1VQ7V 4UVBA 4GX2A 1FXVA 2A79B 4FJCC 1MOFA 2DQ0A 1K4CC 1SETA 4GT1A 1FXKB 5L3FA 3P30A 3ZRXA 3W7TA 4XDJA 3ASOC 3OR6C 2A0LA 3OAAG 4UV9A 1RPRA 3ZRWA 3CCEV 1GM7A 1OCCB 5B1AC 2YEVA 3SYCA 3OGCC 4GX5A 3CCMV 4KUMA 4WFFA 1YJ9V 4UVCA 2K1EA 1OCOB 2EIMC 3AG1B 3K08A 5LGTA 1VQ5V 1R6KA 3SPHA 4BAYA 3ABLB 4F4LA 1QR8A 1R3JC 4DXWA 4MVSA 4WFAV 2ITCC 1OZ0A 1NR1A 1YIJV 1KQSU 5IYCO 2ZD9A 5EBWC 3F7VC 1GMGA 2XNDG 4X88A 3CC4V 3WG7B 2QM7A 2UXNA 3ETDA 2JK5C 1VQ8V 3ZMTA 4JASA 1H38A 2CK3G 2HKOA 1NKDA 1IXMA 4LBEC 4PDRA 1FXHA 1I5XA 3STLC 4BIZA 4QPKA 4WFBV 1NR7A 4U7NA 4MVQA 1OCRC 4JGSA 1QR9A 3SPJA 2BOBC 3SYAA 1S72V 3ASNC 3K0GA 3ZCCA 5EK0A 4TT3G 1CEZA 5B1OA 1KP2A 4G2KA 5CBGA 4PELA 2HG5C 3WFVA 1AI6A 3OE7G 4KP4A 1L1FA 2W0FC 2WLHA 3LSSA 4WFGA 3R65A 3VOUA 3DTUB 4PDVA 1KP3A 5LHGA 3MHHC 3NXSA 2Q6AA 4I5SA 1AJNA 1SRYA 3IC7A 4XBFA 3AG2B 2Q67A 1GK9A 4L87A 2DYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUE A;  2IH3 C;  3SPC A;  4X8A A;  3BEH A;  4P9P A;  4MSW C;  2P7T C;  3RVY A;  2X6B A;  3X2Q C;  2X6A A;  5EC2 C;  1BL8 A;  2BOC C;  2WLL A;  2WLI A;  1K4D C;  3K04 A;  4PA7 A;  4P2Z A;  1OCZ C;  3UM7 A;  2Y69 C;  4GX0 A;  3IFX A;  3GB7 C;  3TCU A;  3AG4 C;  1LNQ A;  5E1A C;  2WLN A;  5B3S C;  5IY5 C;  2HVJ C;  1V55 C;  3T4D A;  4R8C A;  4WFH A;  3SYP A;  3FB8 C;  2EIK C;  4MVU A;  3SPG A;  4MVZ A;  5KUK A;  3HPL C;  4P30 A;  4PDL A;  2ATK C;  2QTO A;  1JVM A;  4G28 B;  3K06 A;  3FB5 C;  2WLM A;  2HJF C;  4HZ3 A;  4CBC A;  3LDC A;  3E86 A;  3K03 A;  5KUM A;  2WLL B;  2WLJ A;  4PA4 A;  1XL4 A;  3FB7 C;  4P9O A;  2EIJ C;  2R9R B;  3AG2 C;  3OR7 C;  1OCC C;  4JTC B;  2KB1 A;  4MTO A;  3RBZ A;  3F5W C;  5EBL C;  5B1B C;  4PA3 A;  4LCU C;  4GX2 A;  4MVM A;  2A79 B;  3STZ C;  1V54 C;  3AG1 C;  4JTD B;  2QKS A;  1K4C C;  1XL6 A;  4TWK A;  4XDK A;  3ZRS A;  2A9H A;  3PJS K;  4XDJ A;  4QE9 A;  4RAI A;  3ASO C;  3OR6 C;  2A0L A;  4MS2 A;  4R50 A;  3ABL C;  4MTG A;  4XDL A;  4LP8 A;  4J9Y B;  4MTF A;  3OUS A;  5B1A C;  1M56 C;  2YEV A;  3OGC C;  4QE7 A;  4GX5 A;  1R3L C;  3SYC A;  3IGA C;  4X89 A;  2WLK A;  4WFF A;  2K1E A;  2EIM C;  4MVO A;  3K08 A;  4HYO A;  2HVK C;  2EIN C;  4R6Z A;  4JTA B;  3SPH A;  4PA9 A;  2H8P C;  3LDD A;  5J9P C;  2AHZ A;  3LNM B;  4G27 B;  1ZWI C;  4F4L A;  3TET A;  1R3J C;  4DXW A;  4PDM A;  4MVS A;  4WFE A;  3E8G A;  2ITC C;  4H37 A;  4UUJ C;  2AHY A;  2DYR C;  1OCO C;  2X6C A;  2ZXW C;  2ZD9 A;  5EBW C;  3F7V C;  3AG3 C;  4RO2 A;  4I9W A;  3FB6 C;  4X88 A;  2Q68 A;  3SYO A;  5CBH A;  1QLE C;  2OCC C;  4MW3 A;  4MVR A;  5EBM C;  3ZJZ A;  2HFE C;  2JK5 C;  3JYC A;  1J95 A;  4QNH B;  1G4Y B;  3WG7 C;  4OXS A;  4PDR A;  4LBE C;  3STL C;  4MW8 A;  1S5H C;  5EC1 C;  4H33 A;  3LDE A;  1OCR C;  4MVQ A;  4KFM A;  3E8H A;  2EIL C;  3SPJ A;  2BOB C;  3EFF K;  4PA6 A;  3SYA A;  3OUF A;  3UKM A;  4EKW A;  3ASN C;  3K0G A;  5BZB A;  5EK0 A;  3T1C A;  3SPI A;  3E8B A;  3E8F A;  3RVZ A;  4R7C A;  5CBG A;  1P7B A;  3T4Z A;  2HG5 C;  2IH1 C;  1KKD A;  1R3I C;  2DYS C;  1R3K C;  4J9Z B;  3RW0 A;  3KG2 A;  5CBF A;  1M57 C;  4GX1 A;  1ORQ C;  2DWE C;  2W0F C;  2WLH A;  4WFG A;  4ZBM A;  3R65 A;  3VOU A;  3E83 A;  2WLI B;  4RUF A;  3SJQ C;  4PDV A;  3LUT B;  4BW5 A;  2Q6A A;  3E89 A;  2NLJ C;  3ABM C;  3K0D A;  3T2M A;  3F7Y C;  3ABK C;  2Q67 A;  3SYQ A;  2ITD C;  2Q69 A;  2DWD C; 
#chains in the Genus database with same CATH topology
 4TQF A;  1F23 A;  3HKC B;  2A3Q A;  3BEH A;  2B9Z A;  2ZM6 O;  3HKE A;  1KUQ A;  2ZCE A;  1PNL A;  1TA8 A;  1WA8 B;  2WLI A;  2G38 A;  1KC8 W;  4P2Z A;  1V9P A;  2Y69 C;  5CMU A;  4O2A B;  5LHH A;  2WLN A;  3OTO B;  1DF4 A;  3T4D A;  1FPO A;  1YTF D;  4FM1 A;  1XNQ B;  1XRE A;  1N8R W;  4P30 A;  3K9S A;  1HR0 B;  1SQQ H;  1JFF A;  3SJB C;  4J41 A;  1XUQ A;  5JH7 B;  2LGW A;  4P9O A;  1OCC C;  4YJ2 B;  1K5Q A;  2KB1 A;  4LFC B;  3K5O A;  1EFR G;  4KHP O;  2QKS A;  3OM3 B;  3PJS K;  3QO5 A;  1YTF B;  4DV6 B;  2LQT A;  2EIK B;  1OCZ B;  2ZE8 A;  4MS2 A;  4JF3 A;  4XDL A;  4LP8 A;  1DK1 A;  2XAJ A;  2ZDI A;  5IJ0 B;  2FYU H;  1NH2 B;  4LF5 O;  1H2N A;  2M6Y A;  1Y4M A;  2LO1 A;  3D36 C;  1KMI Z;  2AHZ A;  3W7W A;  1N4C A;  1YIT V;  3E8G A;  4JPR A;  4I9W A;  5EBM C;  3L71 H;  3HB3 B;  5J2U A;  1AR5 A;  4JI6 B;  3N2G A;  2YIB A;  3G4S V;  3WB1 A;  4JI5 B;  3LSQ A;  1QNM A;  1JR9 A;  1W0J G;  2UU9 O;  3D3I A;  1IBM B;  5C93 A;  3OUF A;  3UKM A;  1P4R A;  5KA5 A;  3K5N A;  4JYA B;  1HDJ A;  1VQ6 V;  3WB2 A;  3E8B A;  1BHB A;  4FVM A;  2EZP A;  4UVA A;  2DYS C;  1AJP A;  5LP6 C;  3RW0 A;  3FX7 A;  2CAZ C;  2YID A;  5LP6 B;  2IJJ A;  3BA8 A;  1N0N A;  4O4I B;  5FNV A;  1YVW A;  5CA1 B;  5IYB O;  1NVP D;  3ZHV A;  3ZMZ A;  3GB7 C;  2Q4P A;  4TV9 B;  1SZT A;  1ZAU A;  3H1H H;  3FAV B;  2EIJ B;  3FFQ A;  1IBK B;  5KLV H;  5IJ0 A;  4CBC A;  2WLM A;  1N34 B;  4UCV A;  3MDS A;  5LYJ B;  4LF8 B;  1NZ6 A;  2E75 B;  2Y4U A;  1Y67 A;  2R9R B;  1VEW A;  3F5W C;  2XHB A;  1Q6H A;  3J81 N;  5FPO A;  4AQY B;  3CCL V;  1V54 C;  2P67 A;  1MMM A;  3AG1 C;  4JTD B;  4PI0 A;  3ZN1 A;  2W0X A;  2ARH A;  3M8A A;  3ABL C;  3W7S A;  2CUG A;  4GZR B;  1HNZ B;  2ODM A;  3IGA C;  2ADP A;  2WLK A;  2LP7 A;  1JOY A;  5DM6 V;  4HYO A;  2EIN C;  1HNX O;  4QGP A;  4PHZ A;  1BZK A;  1M1K W;  1ZSP A;  4HBN A;  5J9P C;  3T1Y O;  1GO3 F;  4HAM A;  3SGI A;  2V7Q G;  3ZMS A;  5KHH A;  4FLU A;  1XMQ B;  2AHY A;  1OCO C;  4X1K B;  2CH7 A;  1VAR A;  4I9Q A;  3ZHR A;  3JYC A;  2GUZ B;  2UUA B;  3FYI B;  1DTO A;  1S5H C;  5EC1 C;  1Q6I A;  4DR4 B;  3Q4H A;  4H44 B;  2GUZ A;  3JSL A;  1Y66 A;  4Q20 A;  3E2E A;  1CXZ B;  4LF7 B;  1SF9 A;  2B1G A;  1WNS A;  1M57 C;  1I7F A;  1O9G A;  3CWB H;  4IYH A;  2Q69 A;  4AIL C;  2ZKO A;  1SQF A;  4DR5 O;  2V4D A;  3OMA B;  4U3F H;  3JCZ A;  1TAE A;  1YSC A;  5FL7 G;  2RJZ A;  2WLL A;  3G6E V;  4GX0 A;  3CRC A;  1OV9 A;  5GON A;  4O4H B;  3RYH B;  1EZV H;  3RYF A;  2KSD A;  3APO A;  4MVZ A;  4UCR A;  2PGG A;  4EB6 B;  1MG1 A;  1P84 F;  3CCQ V;  4YXW G;  1H2G A;  1AI5 A;  1Q86 W;  2LJ2 A;  3OMN B;  5C8Y A;  5JVD B;  3T1H O;  1XL6 A;  4JI7 O;  2ZNJ A;  4DUY B;  4B3R O;  4QPJ A;  3BHP A;  1E1R G;  1MZE A;  3ICX A;  4JI3 O;  3FAV A;  3AG3 B;  3C90 A;  4JTA B;  4UXN A;  2ZR2 A;  5IT9 N;  3LDD A;  3J80 N;  4FZ0 A;  4FLW A;  4X1Y B;  4QNH B;  2UUB B;  5BXZ A;  4RO2 A;  5CBH A;  1QLE C;  4MW3 A;  2OCC C;  3BPZ A;  1Z5W A;  2EUL A;  3ZBH A;  2QJ1 A;  1K7D A;  1H2S B;  4UV8 A;  1NS1 A;  2BCC H;  2E76 B;  2E3C A;  5IYD O;  1PKX A;  3C3S A;  1IBM O;  1BE3 H;  1H2K A;  1YXB A;  4O4J A;  3CME V;  4I50 A;  3CPW U;  1V55 B;  4FLZ A;  1QVG U;  1ZLZ A;  3CCR V;  3JAS A;  1R3I C;  1W0K G;  3KG2 A;  1KB9 F;  2Q7G A;  2WWW A;  2WLI B;  4NTW A;  1EN6 A;  5DED A;  4NYK A;  3F7Y C;  3O9O A;  3F5T A;  1XBL A;  3HKC A;  1KBH A;  3K5L A;  3H1L H;  2P7T C;  2RMK B;  1FJG O;  2CH7 B;  1BL8 A;  4DV7 B;  2ETN A;  3OEE G;  5IY5 C;  3OD4 A;  1RFY A;  2ZQM A;  4WFH A;  4CC5 A;  2JJ1 G;  1H8H G;  2YDE A;  1SES A;  1UJW B;  3K06 A;  3FB5 C;  1BCC H;  1J5E O;  1Q81 W;  1XNR B;  1M4U A;  4LF8 O;  4GCZ A;  5B1B B;  4E2L A;  1SER A;  1I0H A;  1GTO A;  3X2Q B;  2B1I A;  1COW G;  1VQ7 V;  3CSX A;  1Q6U A;  1VF7 A;  3AK2 A;  4FJC C;  4GT1 A;  5L3F A;  3W7T A;  3SJA C;  2PF4 E;  4UV9 A;  4JI2 O;  1OCC B;  3OGC C;  3CCM V;  4UFZ A;  2A06 H;  2R70 A;  4GKJ O;  3IC9 A;  3K08 A;  5LGT A;  3JAM N;  1YZB A;  1R6K A;  1L0L H;  3T1Y B;  1QR8 A;  4MVS A;  1XDC A;  1NR1 A;  1KQS U;  2ZNI A;  3CB2 A;  1GMG A;  2P5O A;  5JVD A;  5BY1 A;  3CC4 V;  2QTS A;  5D5Q A;  2JS5 A;  2ZIN A;  2F95 B;  1SA0 A;  4JAS A;  2CK3 G;  2UXC B;  5FNV B;  1FXH A;  1I5X A;  3CEI A;  1PM9 A;  4U7N A;  2O57 A;  4MVQ A;  1QR9 A;  1S72 V;  3SYA A;  3H9V A;  3Q4H B;  4UB6 Z;  4O4L B;  4I50 B;  5B1O A;  1KP2 A;  5CBG A;  4PEL A;  1AI6 A;  4BR6 A;  5GON B;  4KP4 A;  1L1F A;  3CXH F;  3LSS A;  2H3O A;  3L70 H;  3DTU B;  3MHH C;  4I5S A;  1AJN A;  1SRY A;  2MW2 B;  3R66 A;  2YXY A;  2ZT9 B;  4JI8 O;  3JAL B;  4L87 A;  4YY3 B;  2QEX V;  2UUB O;  3RN4 A;  2HEP A;  3J7A U;  2XTA A;  3CXC U;  2KG7 B;  3CRA A;  1B3Q A;  5KAF Z;  4LF9 O;  1MA1 A;  1BQZ A;  5KHK A;  1XHX A;  2Q0A A;  2XAG A;  4I4T A;  4DK0 A;  1JVM A;  4G28 B;  2JIZ G;  2OIG A;  1PD3 A;  3NR7 A;  2IBZ H;  4FIP C;  1LUW A;  1RP3 B;  2P06 A;  2N05 A;  2RN9 A;  3STZ C;  4O2B B;  1OJH A;  1HNZ O;  3ZMV A;  4LF4 O;  1Y74 A;  4QE9 A;  4MTG A;  4MTF A;  2UXX A;  1HNW O;  5IWA O;  1TVK B;  3TGU H;  4UB8 Z;  4X64 B;  3IAY A;  3WB0 A;  1TUE B;  5GW7 A;  3DGE A;  3TET A;  4DR2 B;  3JSN A;  3L73 H;  1NI8 A;  3N2K B;  2FKX A;  5DN6 G;  1K34 A;  1S77 D;  4L8J A;  1J5E B;  4NXN B;  4TOI A;  4DUZ B;  2BTQ A;  5H9C A;  3AK1 A;  1QHT A;  1L8D A;  4CH3 A;  2F93 B;  4DRX B;  5JWP A;  5LMU O;  4TQD A;  3EFF K;  3K5M A;  1BGY H;  4J11 A;  4I7Z B;  2OTJ V;  5B3S B;  2P6J A;  1KKD A;  5FLX N;  3ML0 A;  1AR1 B;  3BRC A;  3E83 A;  1EZJ A;  5CN0 A;  3OTO O;  5JCO A;  4CS3 A;  3ABM C;  4ZHQ A;  2IH3 C;  4DR6 B;  2HJD A;  4ABM A;  1BS3 A;  3X2Q C;  4ICG A;  4WF9 V;  5LXT B;  3BFR A;  3ABK B;  4IL6 Z;  4LWS B;  1AP6 A;  3AG4 C;  5ITZ A;  5B1N A;  1M9N A;  1U96 A;  4DV2 O;  4H0L B;  4PDL A;  2AZ2 A;  1Y74 B;  2HJF C;  2PI5 A;  4DR5 B;  2C2A A;  3OR7 C;  4RQF A;  2F1M A;  4LWS A;  4X62 B;  1QCE A;  4LF7 O;  1UFI A;  3A0H Z;  2VQF B;  3JAR A;  1EBO A;  4JI1 B;  4YY3 O;  3C3T A;  1M56 C;  4ZIB A;  5IYZ B;  1Q90 D;  3OEH G;  3S3W A;  1VQK V;  1M56 B;  1M93 A;  4R6Z A;  5BMV B;  3OTF A;  2H8P C;  3ASO B;  3BAA A;  4G27 B;  1ZWI C;  1G8M A;  3VQY A;  4J7J A;  4FZ1 A;  1JJ2 U;  1H2M A;  3OW2 U;  2UUC O;  1W2B U;  2R72 A;  1YHQ V;  2HFE C;  3A8T A;  4UCT A;  2PI4 A;  2BSK B;  2GBO A;  4TV9 A;  3JAS B;  1JJO A;  1I94 B;  2OCC B;  5EYP B;  4KFM A;  4GYC B;  1NH2 D;  4B7K A;  4IGG A;  4MT8 A;  3T1C A;  3SPI A;  4LF4 B;  3E8F A;  3RVZ A;  1SQV H;  5LXT A;  1QLN A;  1GM8 A;  3SJQ C;  4X64 O;  1TVK A;  1MSW D;  4DV5 O;  2P90 A;  4Q6G A;  3K0D A;  1OCR B;  1TGO A;  2AGA A;  4RUE A;  3THO A;  5IJ9 A;  1VQM V;  4LFA O;  4ZI7 B;  1K73 W;  1QQC A;  1BQ0 A;  1Y76 B;  2Z3Y A;  1AP5 A;  5J2U B;  1NJI W;  2E74 B;  5B3S C;  3UQ8 A;  3HKB A;  3B8N A;  3H1K H;  1Q43 A;  1FYJ A;  1RSO A;  1H2L A;  3CE2 A;  3L75 H;  1R6N A;  4X1I A;  2JGD A;  5LOV B;  3K9A A;  4HZ3 A;  1F51 A;  1ENV A;  1HWY A;  2GDS A;  2ILM A;  3N27 A;  5D5P A;  1HNX B;  4TUY A;  5EBL C;  3W7X A;  4MVM A;  5JH7 A;  1YJW V;  4ZOL A;  2D2C B;  4I55 A;  3UCS C;  4QE7 A;  1HNW B;  3S3X A;  1E1Q G;  3L72 H;  2HVK C;  5B66 Z;  2N74 A;  3KZI Z;  1R1B A;  2FML A;  5AG2 A;  2EZO A;  5KX5 A;  2UXD B;  4QIW F;  4FLY A;  3OMI B;  1G1X B;  2XAS A;  4I55 B;  4H37 A;  1PNK A;  4DV1 B;  3SYO A;  2LFS A;  3FB6 C;  3ETQ A;  4YIP A;  3QF7 A;  3CC2 V;  1G4Y B;  3ABT A;  4OPA A;  5JCO C;  1NVP B;  1Q3E A;  5E79 Z;  2GSM B;  5LOV A;  1VF6 C;  1UPG A;  1FFT B;  5LGN A;  3QVN A;  4DR7 B;  1SQB H;  3T4Z A;  2GTA A;  4PJ0 Z;  1ZL8 B;  1PPJ H;  2Q0O C;  1XMO B;  3DXR A;  3M7M X;  5B5E Z;  1ORQ C;  3DC6 A;  4X20 B;  3RFR A;  2KQX A;  3CS5 A;  4BW5 A;  2A7W A;  2VWK A;  1N33 B;  3ABK C;  1QLE B;  2UXC O;  1CP9 A;  3VQW A;  3SPC A;  3E35 A;  4Z1V A;  2EJR A;  2JDI G;  4P9P A;  4MSW C;  4DR6 O;  2ADQ B;  4W4L A;  1YJN V;  2LW1 A;  5EC2 C;  1FAF A;  4JYY A;  4EFB A;  3K04 A;  3K57 A;  1KD1 W;  2HHH O;  4B3M B;  1VMG A;  2Y0P A;  3SYP A;  4E4E A;  2Z5U A;  1EM1 A;  3JD2 A;  1SQG A;  2IU3 A;  3OT7 A;  3E86 A;  2YXL A;  5KHI A;  5CA3 A;  3FB7 C;  1LUV A;  4DR3 O;  1S3J A;  3RWR D;  1K4C C;  5LA6 B;  3CRM A;  1FD9 A;  3ZRX A;  2OWO A;  2IM9 A;  5K1X A;  3ASO C;  3OR6 C;  3AG7 A;  1GM7 A;  5B1A C;  2YEV A;  4J42 A;  3AG1 B;  4DR2 O;  2QGN A;  4I4T B;  3A0B Z;  4O4I A;  3SPH A;  1GH6 A;  4LNU B;  3JAL A;  4FM2 A;  1R3J C;  1GN2 A;  4DXW A;  2VWJ A;  1A32 A;  2ITC C;  1OZ0 A;  1YIJ V;  3F7V C;  4IHJ A;  2UUC B;  3RYF B;  2UXN A;  1YF2 A;  2YI8 A;  1VQ8 V;  2R9A A;  4BIZ A;  2HKO A;  1H38 A;  1IXM A;  4JZ2 A;  4O4L A;  2PUS A;  1YCI A;  1BSM A;  3MAQ A;  3SPJ A;  2BSK A;  4YJ3 A;  2ZE6 A;  4J10 A;  2QWN B;  5EK0 A;  4TV8 A;  4G2K A;  4K8X A;  2ZE5 A;  2HP8 A;  2EJ7 A;  3OE7 G;  4KXR A;  3AK3 A;  4WFG A;  2JGU A;  1Z5V A;  4PDV A;  5LHG A;  1QU7 A;  5JJE B;  5J2T B;  1WP8 A;  3HKD A;  4IIJ A;  1GM9 A;  3SDL A;  2UUA O;  4X8A A;  5EZY A;  1XNR O;  2XAQ A;  1PL4 A;  2RQ6 A;  4DRX A;  1EN4 A;  1PL0 A;  2W6J G;  2BOC C;  2PTM A;  5L3C A;  3JD0 A;  1S0V A;  4TSF G;  4CH4 A;  1NTK H;  2Y69 B;  3EHB B;  3I55 V;  4NXN O;  1RPO A;  3HR0 A;  3N2K A;  5GTI Z;  4TUY B;  2WPD G;  2YSU B;  3LDC A;  1B04 A;  3K03 A;  1VQ4 V;  2WAM A;  3RGB A;  4LH6 A;  2CE4 A;  2QE7 G;  1XNQ O;  4XDK A;  4IHJ B;  3JAT B;  3HKB B;  4FMT A;  4Z1M G;  4R50 A;  3QNE A;  4B3S O;  4F6R A;  5IDJ A;  4OGQ B;  2E5L O;  2ZXW B;  5KMG B;  3CYO A;  4JI6 O;  4JI4 B;  1IBL O;  1K9M W;  3BVO A;  2JJ2 G;  4JI5 O;  3I5D A;  1OHH G;  5KA6 A;  3LNN A;  4UUJ C;  4CH6 A;  1YI2 V;  2F23 A;  4N23 A;  1VQN V;  2X6C A;  3AG3 C;  3OGI B;  4MVR A;  4WBN B;  4LF5 B;  4BW9 A;  3D3Q A;  3I56 V;  2X7R B;  4NB5 A;  4GUN A;  4JI8 B;  1GKF A;  4O4J B;  3ZN0 A;  2DYR B;  4PD4 F;  3JCU Z;  2MK3 A;  4O4H A;  4JI3 B;  1FFX B;  1ARO P;  4R7C A;  5EIB C;  4J9Z B;  2VQF O;  1XI1 A;  4ZBM A;  4LF9 B;  4BIU A;  1BT8 A;  5L3D A;  3KKY A;  1URF A;  2FB5 A;  3SYQ A;  2ITD C;  2YUA A;  5KUK A;  5BMV A;  1FS0 G;  4FM0 A;  5H5N A;  5TIS Z;  4B3T O;  5IYZ A;  1K4D C;  3TXS A;  4U3J B;  3TJT A;  5CA0 B;  3RYC B;  3ETG A;  1HW7 A;  2VQE O;  1TUB B;  4PI2 A;  3CCJ V;  2H94 A;  1RM1 B;  2Q9L A;  1AVM A;  1I94 O;  2PY5 A;  5B1A B;  2ZDI C;  4X65 O;  2DMX A;  1VQP V;  5BR8 B;  2KKW A;  4N21 A;  2DE0 X;  4FFB A;  2DQ3 A;  3ABM B;  1D2D A;  3AG2 C;  4MTO A;  1BMF G;  4YJ2 A;  3JAR B;  1WB8 A;  2EIM B;  4DW0 A;  2JS3 A;  4TWK A;  1FJG B;  2QKC A;  1WN7 A;  2OYQ A;  3RYI B;  3MD0 A;  1F4M A;  4J9Y B;  4NVP A;  1IX9 A;  4LH7 A;  2VS0 A;  3K59 A;  4DV4 O;  3EVK A;  2EIN B;  5JQG A;  3ZRW B;  3L74 H;  4DV3 O;  2UXD O;  4AQY O;  4LFA B;  1FFX A;  1BHA A;  3SR2 C;  5DEC A;  4PA9 A;  4DR4 O;  1Q5O A;  3LNM B;  1JFF B;  3CP1 A;  4WFE A;  2CTQ A;  1K8A W;  2XT9 A;  2EIL B;  1R73 A;  3DSQ A;  3VQX A;  2OCH A;  2Q68 A;  4DV0 O;  5GTH Z;  1XQ8 A;  2IU0 A;  4CS4 A;  1T5E A;  4OXS A;  4MW8 A;  2YI9 A;  3CCS V;  2PZS A;  2RCV A;  1SA0 B;  3HKD B;  1P7G A;  3QO7 A;  3UO2 A;  4PA6 A;  4GKJ B;  2X0L A;  1X4T A;  1CPY A;  2WA4 A;  1GRJ A;  4DO2 A;  1IZ3 A;  3QG5 A;  2Q5Z A;  4D6T H;  1JCH A;  4JZG A;  3VBB A;  2F43 G;  4DV1 O;  4DW1 A;  3ZHT A;  1IBL B;  1QBZ A;  4D7S A;  2OT5 A;  2B5U A;  4ZI7 A;  1MAB G;  3AG4 B;  2CTP A;  4FLT A;  1DGS A;  2F4V B;  3UT5 A;  3W7U A;  2BTQ B;  4GLX A;  2CTW A;  1YDX A;  4X62 O;  2GHY A;  4LFB O;  5E1A C;  2L6L A;  3FB8 C;  4JYB A;  4MVU A;  4FLV A;  1WPB A;  2ATK C;  2QTO A;  4DR3 B;  4LR3 A;  1N33 O;  3ZED A;  5LGU A;  5KUM A;  2UXB B;  5EYP A;  1XL4 A;  4O2A A;  2YIC A;  5LA6 A;  4UCS A;  2JEX A;  3ZRS A;  3BCC H;  1WLE A;  4BIO A;  1O9H A;  1H8E G;  1G6U A;  4RAI A;  1RM1 C;  3P3P A;  2UU9 B;  1AI4 A;  1ZX3 A;  4H13 B;  4JV5 B;  3GWO A;  2IJI A;  1KEC A;  1SQX H;  1FXK C;  4TV8 B;  3T1H B;  2FL4 A;  3JAK B;  4JAV A;  1VQL V;  1JA8 A;  2FTK A;  3U11 A;  4X65 B;  2DW4 A;  4LF6 O;  3JD1 A;  3K3W A;  3ETE A;  3CC7 V;  3RYH A;  3WG7 C;  4JI0 O;  4DV5 B;  1THZ A;  2IJK A;  1N0J A;  1AR4 A;  1XHZ A;  4EKW A;  1SZX A;  5CB4 B;  1M90 W;  5LP6 A;  3CJH A;  4J7Z A;  1NTM H;  1Q7Y W;  4OPH A;  2CTR A;  5CBF A;  1VF6 A;  3ASN B;  3EXA A;  4CC6 A;  3SJC C;  3E89 A;  1N34 O;  1VQ9 V;  2XAH A;  2Y48 A;  3MHS C;  2QKA A;  3H01 A;  4O2B A;  4DUZ O;  2WSS G;  1GN3 A;  5LMN B;  1NU1 H;  3RVY A;  2AZ0 A;  2F66 C;  1PNM A;  2P4V A;  5LMU B;  4PA7 A;  1YEW A;  4FPP A;  1M57 B;  2QR4 A;  3D36 A;  4YHH B;  3K79 A;  2EBO A;  2HVJ C;  5H6Q A;  4GKK O;  5LHI A;  1GN4 A;  3HPL C;  5CB4 A;  4WCE V;  4JYC A;  2XOK G;  5JQG B;  2ZM6 B;  4JI2 B;  2WLJ A;  1M5I A;  2AW9 A;  4UCO A;  4D7T A;  3BAB A;  3BY6 A;  1U97 A;  3ZS8 C;  2QM4 A;  2CGO A;  2DQ0 A;  1SET A;  3P30 A;  4NR1 A;  1Q8I A;  3OAA G;  3APQ A;  1N32 B;  3ZRW A;  3CCE V;  1HR0 O;  4X20 A;  4IIJ B;  3SYC A;  4DV4 B;  4GX5 A;  1YJ9 V;  4UVC A;  2K1E A;  1OCO B;  4ZHQ B;  4X1I B;  1MZF A;  2QSA A;  4DR7 O;  1EN5 A;  1MSD A;  5EBW C;  2XND G;  1KU9 A;  3ETD A;  1Z2G A;  2JK5 C;  3ZMT A;  2JGD B;  4DR1 B;  1NKD A;  4PDR A;  4LBE C;  4JI1 O;  4QPK A;  2NN4 A;  1NR7 A;  5KHJ A;  1MNG A;  4U3J A;  4TT3 G;  2GTS A;  1B06 A;  2HG5 C;  3WFV A;  2DOS A;  1GN6 A;  1N36 O;  2W0F C;  5IJ9 B;  3U10 A;  3NXS A;  2Q6A A;  2DJV A;  5JJJ B;  4X66 O;  2E5L B;  3IJ4 A;  3UO3 A;  3CCV V;  2DYS B;  1QVF U;  2Q7E A;  4RWU A;  1R6T A;  4LF6 B;  2VQE B;  3ABU A;  4JI7 B;  1OCZ C;  4ZKI A;  1WP7 A;  1F4N A;  3TCU A;  3RYI A;  3ZHS A;  1V55 C;  4EFE A;  2YEV B;  4YIO A;  3KCY A;  3QTC A;  2L35 A;  2EIJ C;  3RBZ A;  3N2G B;  2CDY A;  2ZR3 A;  4BWA A;  2ZIO A;  3VQV A;  1JQ0 A;  3B09 A;  5FPR A;  2A9H A;  2QDO A;  4NXM O;  1XOU A;  5CA0 A;  3RYC A;  4DV3 B;  4OX9 B;  5KMG A;  5IY5 B;  4X89 A;  3CCU V;  1US6 A;  3E22 A;  3P32 A;  2XAF A;  3CX5 F;  2QWP B;  4PDM A;  2R9I A;  4PV1 B;  2LGQ A;  1S76 D;  5IWA B;  1J95 A;  2HLD G;  1JPX A;  4MTX A;  1WA8 A;  3O65 A;  2EIL C;  3CRQ A;  2BTO A;  1LR1 A;  3B4S A;  3DC5 A;  1ZTE A;  4W4K A;  1XMQ O;  1N32 O;  2IH1 C;  1R3K C;  1NQT A;  4F6R B;  2DWE C;  4HNA B;  4A5U B;  3LUT B;  3U0Z A;  4K0K O;  3T2M A;  1P49 A;  3A2F A;  3AEI A;  3P3N A;  1L0N H;  4EEQ A;  4LFB B;  2X6B A;  4IYI A;  5H2F Z;  2M7W A;  5H6R A;  1ROP A;  4ZOL B;  3L9D A;  2IJH A;  2AXT Z;  4X9Q A;  1B6Q A;  1GAX A;  2GV9 A;  3JAW A;  4I0X A;  4YJ3 B;  4QJF B;  1Y6X A;  1SC5 B;  4UCU A;  2QWR B;  3SPG A;  4NKG B;  1XMO O;  2YXH A;  1JX9 A;  4B3S B;  5LBQ A;  1K5S A;  2WLL B;  3H1J H;  4PA4 A;  3FD9 A;  4JYA O;  4JI4 O;  3LSU A;  3E22 B;  4LCU C;  3G71 V;  5LL6 Y;  4DV2 B;  1WPX A;  4CS2 A;  3K58 A;  3OUS A;  1AJQ A;  5A9G A;  1R3L C;  3G67 A;  4IT5 A;  2YS8 A;  4MVO A;  3PN1 A;  5L3B A;  1SS3 A;  5EZY B;  2F4V O;  3CJH B;  2IW5 A;  1Y76 A;  2UXB O;  3CMA V;  2OIE A;  2JVD A;  3ZIA G;  5HFL A;  1VF5 B;  2P4K A;  2KG7 A;  1Q82 W;  2LFR A;  2YIB D;  1WAZ A;  2DYR C;  2QWO B;  4NTY A;  2Y4T A;  3JD3 A;  1V54 B;  5F2V O;  1IUR A;  1I5Y A;  4CH5 A;  1W59 A;  2W6I G;  3ZRV A;  3LDE A;  4CZZ A;  3E8H A;  3CHX A;  4KL1 A;  1IXB A;  2ZE7 A;  1I08 A;  5BZB A;  4LNU A;  3TXQ A;  1E79 G;  2NNU A;  4B3T B;  4X1Y A;  4FK5 C;  1SQP H;  4DYL A;  5ITZ B;  1NT2 B;  3ZHQ A;  2D3O W;  1X59 A;  3CD6 V;  3TK1 A;  3B40 A;  1VQO V;  2Q8V A;  4B08 A;  2NLJ C;  3BA9 A;  3D8C A;  4JV5 O;  4B7E A;  2DWD C;  4RQE A;  2JRI A;  5BR8 O;  1FKA O;  4J7K A;  2X6A A;  4K8Z A;  3G80 A;  2QM8 A;  1HP8 A;  2DN9 A;  1DF5 A;  1LNQ A;  4R8C A;  2Q73 A;  2QWQ B;  2JEU A;  5A2Q N;  4JI0 B;  5HFM A;  2VRZ A;  3B8M A;  2N04 A;  1SKV A;  1IBK O;  2PYJ A;  3M99 B;  2LW7 A;  5C8Y B;  2RNB A;  3QO8 A;  5IE9 A;  5B1B C;  4DV7 O;  4KHP B;  3FYE B;  4X1K A;  2HR3 A;  4YHH O;  4OX9 O;  4DV6 O;  2OTL V;  4DV0 B;  4AHC A;  2QA4 V;  3DXR B;  4AI8 A;  5EIB D;  1IDS A;  1D5N A;  1WJZ A;  5LMN O;  1ZUQ A;  3OFN G;  2Y0I A;  4F6E A;  3B77 A;  1NBM G;  5K1P A;  3ZX6 A;  2ZXW C;  4FFB B;  2PYL A;  5L3E A;  4GKK B;  3ZJZ A;  1VIB A;  1ZL8 A;  4ASU G;  5J2T A;  3HKE B;  4JAU A;  4NTX A;  2RDC A;  3B2E E;  4H33 A;  1IVS A;  1AB3 A;  1K33 A;  1KYO F;  5KX5 B;  1K97 A;  5CA1 A;  4HNA A;  3FKS G;  2P22 C;  1P7B A;  1XIL A;  4GX1 A;  1VP7 A;  4DUY O;  4LFC O;  1KKC A;  4RUF A;  4Z2W A;  3A0R A;  3GWK C;  2HHH B;  4B3M O;  4DK1 A;  4LC1 A;  2WA3 A;  1PV0 A;  3ZHU A;  1F7Y A;  1K3E A;  3G6B A;  3H1I H;  3ZMU A;  2ZIM A;  3UM7 A;  3RT3 C;  2XUM A;  3IFX A;  3JD4 A;  4B3R B;  2V1D A;  4U7O A;  1AI7 A;  2Q7H A;  1FXK A;  1WB7 A;  5L3G A;  1JMK C;  5LYJ A;  3CRR A;  2EIK C;  4C7U A;  4DR1 O;  2NR5 A;  1K92 A;  4K35 A;  5KAI Z;  3JAK A;  1DLB A;  4JAA A;  4JTC B;  4PA3 A;  4UVB A;  4GX2 A;  4J80 A;  1FXV A;  2A79 B;  4FFK A;  1RSO B;  1MOF A;  1FXK B;  3GVM A;  1TUB A;  1N36 B;  1AIL A;  4XDJ A;  2A0L A;  2BE3 A;  2EX3 A;  1RPR A;  4KUM A;  4X66 B;  4WFF A;  2EIM C;  2CGN A;  3KCX A;  1VQ5 V;  1D5A A;  4BAY A;  1S5J A;  3ABL B;  4K3A A;  4FLX A;  4F4L A;  4WFA V;  5IYC O;  2ZD9 A;  4X88 A;  3WG7 B;  2QM7 A;  5JJN B;  4WBN A;  2YC0 A;  3JAW B;  4I0X B;  4EB6 A;  3STL C;  4WFB V;  1OCR C;  4JGS A;  2BOB C;  3ASN C;  3K0G A;  3ZCC A;  3UT5 B;  2Z0A A;  1CEZ A;  4K0K B;  1PP9 H;  1S5L Z;  4NXM B;  1NTZ H;  2WLH A;  1XEQ A;  3R65 A;  3VOU A;  3WU2 Z;  1KP3 A;  5KHG A;  2K9P A;  3IC7 A;  4XBF A;  3AG2 B;  3JAT A;  2Q67 A;  1GK9 A;  2YIA A; 
#chains in the Genus database with same CATH homology
 1GM9 A;  1QVF U;  1F23 A;  4X8A A;  3BEH A;  2QEX V;  2XAQ A;  1PNL A;  3ABU A;  1PL0 A;  2W6J G;  2BOC C;  2WLI A;  5L3C A;  1KC8 W;  4P2Z A;  1OCZ C;  2Y69 C;  3JD0 A;  4ZKI A;  5CMU A;  1F4N A;  3TCU A;  3CXC U;  1S0V A;  4TSF G;  5LHH A;  2WLN A;  3EHB B;  2Y69 B;  3I55 V;  1V55 C;  1DF4 A;  3T4D A;  1YTF D;  1RPO A;  2YEV B;  1N8R W;  2XAG A;  4P30 A;  1JVM A;  4G28 B;  2WPD G;  2YSU B;  3LDC A;  2JIZ G;  3K03 A;  1PD3 A;  4P9O A;  2EIJ C;  3RBZ A;  4FIP C;  1OCC C;  2ZR3 A;  1K5Q A;  2KB1 A;  1VQ4 V;  2WAM A;  1EFR G;  2QE7 G;  3STZ C;  3CCV V;  1JQ0 A;  2QKS A;  4XDK A;  3OM3 B;  2A9H A;  3PJS K;  3QO5 A;  1YTF B;  3ZMV A;  4FMT A;  4QE9 A;  4Z1M G;  2EIK B;  1OCZ B;  4MS2 A;  4MTG A;  4JF3 A;  4R50 A;  4LP8 A;  2UXX A;  4MTF A;  4XDL A;  3QNE A;  2XAJ A;  2ZDI A;  5IY5 B;  4X89 A;  5IDJ A;  3CCU V;  2ZXW B;  3CYO A;  3P32 A;  1NH2 B;  1K9M W;  1Y4M A;  2JJ2 G;  1TUE B;  5GW7 A;  2XAF A;  2AHZ A;  3DGE A;  3TET A;  1OHH G;  5KA6 A;  4PDM A;  3W7W A;  1YIT V;  3E8G A;  2R9I A;  4UUJ C;  4JPR A;  1YI2 V;  4N23 A;  1VQN V;  2X6C A;  3AG3 C;  4I9W A;  1K34 A;  5DN6 G;  1S77 D;  5EBM C;  4MVR A;  1S76 D;  3HB3 B;  1J95 A;  2HLD G;  5H9C A;  1JPX A;  3I56 V;  2X7R B;  4MTX A;  3G4S V;  3LSQ A;  1GKF A;  3ZN0 A;  1W0J G;  2DYR B;  2EIL C;  3D3I A;  3EFF K;  5C93 A;  3OUF A;  3UKM A;  1P4R A;  2MK3 A;  5KA5 A;  1VQ6 V;  2OTJ V;  3E8B A;  5B3S B;  2P6J A;  1BHB A;  4R7C A;  1ARO P;  2EZP A;  4UVA A;  2IH1 C;  1KKD A;  2DYS C;  1AJP A;  1NQT A;  1R3K C;  4J9Z B;  3RW0 A;  3ML0 A;  2DWE C;  4ZBM A;  1AR1 B;  3E83 A;  1EZJ A;  5CN0 A;  3LUT B;  4BIU A;  2IJJ A;  3T2M A;  3ABM C;  5L3D A;  3SYQ A;  2ITD C;  3AEI A;  5KUK A;  2IH3 C;  1FS0 G;  5IYB O;  2X6B A;  1NVP D;  2M7W A;  5H6R A;  3X2Q C;  4WF9 V;  1ROP A;  2IJH A;  1K4D C;  1B6Q A;  3ZMZ A;  3ABK B;  3GB7 C;  3AG4 C;  1SZT A;  4QJF B;  3ETG A;  2EIJ B;  3CCJ V;  5B1N A;  1M9N A;  2H94 A;  1RM1 B;  3SPG A;  4PDL A;  5B1A B;  2ZDI C;  1JX9 A;  5LBQ A;  4CBC A;  2HJF C;  2WLM A;  1VQP V;  2PI5 A;  1K5S A;  2WLL B;  4PA4 A;  4N21 A;  2C2A A;  2DQ3 A;  3ABM B;  3OR7 C;  2R9R B;  3AG2 C;  4MTO A;  4RQF A;  3F5W C;  1BMF G;  4LCU C;  3CCL V;  3G71 V;  1V54 C;  1QCE A;  2EIM B;  2P67 A;  3AG1 C;  4JTD B;  3ZN1 A;  1WPX A;  4TWK A;  1EBO A;  3ABL C;  3MD0 A;  3W7S A;  1F4M A;  4J9Y B;  3OUS A;  1AJQ A;  1M56 C;  1R3L C;  3IGA C;  2WLK A;  2EIN B;  3ZRW B;  2LP7 A;  1JOY A;  3OEH G;  4MVO A;  5DM6 V;  5L3B A;  1M56 B;  1VQK V;  4HYO A;  1BHA A;  2EIN C;  4R6Z A;  2IW5 A;  4PA9 A;  1M1K W;  3CMA V;  2H8P C;  3ASO B;  5J9P C;  3LNM B;  4G27 B;  1ZWI C;  1G8M A;  5HFL A;  3ZIA G;  3CP1 A;  1GO3 F;  4HAM A;  4WFE A;  2V7Q G;  1K8A W;  3ZMS A;  2LFR A;  1Q82 W;  1JJ2 U;  2AHY A;  2DYR C;  2EIL B;  1OCO C;  1R73 A;  3OW2 U;  2Q68 A;  1W2B U;  1YHQ V;  3JD3 A;  2HFE C;  2PI4 A;  3JYC A;  1V54 B;  1I5Y A;  2IU0 A;  2OCC B;  3FYI B;  4OXS A;  1DTO A;  4MW8 A;  1S5H C;  5EC1 C;  3CCS V;  2W6I G;  3ZRV A;  3LDE A;  4CZZ A;  4KFM A;  3E8H A;  3QO7 A;  4PA6 A;  1Y66 A;  5BZB A;  1NH2 D;  4MT8 A;  1E79 G;  2X0L A;  2NNU A;  4Q20 A;  3T1C A;  3SPI A;  1CPY A;  3E8F A;  3RVZ A;  3E2E A;  4DO2 A;  1QLN A;  1JCH A;  2B1G A;  4FK5 C;  3VBB A;  1M57 C;  2F43 G;  1GM8 A;  2D3O W;  3CD6 V;  3TK1 A;  3SJQ C;  1VQO V;  1QBZ A;  1MSW D;  2P90 A;  2OT5 A;  2B5U A;  2NLJ C;  3K0D A;  1MAB G;  1OCR B;  2Q69 A;  2DWD C;  4RQE A;  3AG4 B;  4RUE A;  1VQM V;  3OMA B;  3W7U A;  1K73 W;  3JCZ A;  2X6A A;  1YSC A;  5FL7 G;  2WLL A;  2Z3Y A;  2QM8 A;  3G6E V;  4GX0 A;  1DF5 A;  2GHY A;  1NJI W;  1LNQ A;  5E1A C;  5B3S C;  4R8C A;  3B8N A;  3FB8 C;  4JYB A;  2JEU A;  4MVU A;  4MVZ A;  1R6N A;  2ATK C;  2QTO A;  5HFM A;  1MG1 A;  3B8M A;  3K9A A;  5LGU A;  4HZ3 A;  1F51 A;  5KUM A;  1ENV A;  1HWY A;  3M99 B;  1XL4 A;  3CCQ V;  3QO8 A;  4YXW G;  1H2G A;  1AI5 A;  5EBL C;  5B1B C;  1Q86 W;  3W7X A;  4MVM A;  3OMN B;  3FYE B;  1XL6 A;  2JEX A;  1YJW V;  3ZRS A;  2HR3 A;  1WLE A;  4QPJ A;  1H8E G;  4RAI A;  1RM1 C;  2OTL V;  1E1R G;  2QA4 V;  4QE7 A;  1AI4 A;  1E1Q G;  3GWO A;  2IJI A;  1KEC A;  3AG3 B;  1FXK C;  2HVK C;  3OFN G;  4JTA B;  4UXN A;  2ZR2 A;  3B77 A;  3LDD A;  2EZO A;  1NBM G;  4JAV A;  1VQL V;  4QIW F;  2FTK A;  3OMI B;  2XAS A;  4H37 A;  1PNK A;  2ZXW C;  4QNH B;  2DW4 A;  3SYO A;  4RO2 A;  2LFS A;  3FB6 C;  5CBH A;  1QLE C;  2OCC C;  3JD1 A;  4MW3 A;  3K3W A;  3ZJZ A;  4ASU G;  5L3E A;  1K7D A;  3ETE A;  3CC7 V;  4UV8 A;  3CC2 V;  4JAU A;  1G4Y B;  3WG7 C;  1THZ A;  3ABT A;  2IJK A;  4H33 A;  1NVP B;  5IYD O;  1PKX A;  2GSM B;  1K33 A;  4EKW A;  1K97 A;  1FFT B;  5LGN A;  3CME V;  1M90 W;  3CPW U;  1V55 B;  1QVG U;  3FKS G;  1P7B A;  3T4Z A;  3CCR V;  1R3I C;  1W0K G;  1Q7Y W;  3KG2 A;  5CBF A;  4GX1 A;  1ORQ C;  2WWW A;  3ASN B;  2WLI B;  4RUF A;  3A0R A;  4BW5 A;  3E89 A;  1VQ9 V;  2XAH A;  3F7Y C;  3ABK C;  1QLE B;  2Y48 A;  3MHS C;  1CP9 A;  3H01 A;  4LC1 A;  2WSS G;  3SPC A;  3E35 A;  2EJR A;  2JDI G;  4P9P A;  1K3E A;  2P7T C;  4MSW C;  3RVY A;  1YJN V;  1PNM A;  5EC2 C;  3ZMU A;  1BL8 A;  4PA7 A;  3UM7 A;  3K04 A;  4FPP A;  3IFX A;  1M57 B;  3OEE G;  1KD1 W;  3JD4 A;  3D36 A;  2V1D A;  3K79 A;  4U7O A;  1AI7 A;  2EBO A;  5IY5 C;  2HVJ C;  5H6Q A;  2ZQM A;  1FXK A;  4WFH A;  3SYP A;  5L3G A;  5LHI A;  2EIK C;  2JJ1 G;  3HPL C;  2Z5U A;  1H8H G;  4WCE V;  1K92 A;  3JD2 A;  4JYC A;  1SES A;  2IU3 A;  2XOK G;  1UJW B;  3K06 A;  3FB5 C;  1Q81 W;  3E86 A;  1DLB A;  4GCZ A;  2WLJ A;  5B1B B;  4E2L A;  1SER A;  5CA3 A;  3FB7 C;  1GTO A;  3X2Q B;  2B1I A;  1COW G;  3BY6 A;  4JTC B;  1S3J A;  4PA3 A;  1VQ7 V;  4UVB A;  4GX2 A;  1FXV A;  2A79 B;  4FJC C;  1MOF A;  2DQ0 A;  1K4C C;  1SET A;  4GT1 A;  1FXK B;  5L3F A;  3P30 A;  3ZRX A;  3W7T A;  4XDJ A;  3ASO C;  3OR6 C;  2A0L A;  3OAA G;  4UV9 A;  1RPR A;  3ZRW A;  3CCE V;  1GM7 A;  1OCC B;  5B1A C;  2YEV A;  3SYC A;  3OGC C;  4GX5 A;  3CCM V;  4KUM A;  4WFF A;  1YJ9 V;  4UVC A;  2K1E A;  1OCO B;  2EIM C;  3AG1 B;  3K08 A;  5LGT A;  1VQ5 V;  1R6K A;  3SPH A;  4BAY A;  3ABL B;  4F4L A;  1QR8 A;  1R3J C;  4DXW A;  4MVS A;  4WFA V;  2ITC C;  1OZ0 A;  1NR1 A;  1YIJ V;  1KQS U;  5IYC O;  2ZD9 A;  5EBW C;  3F7V C;  1GMG A;  2XND G;  4X88 A;  3CC4 V;  3WG7 B;  2QM7 A;  2UXN A;  3ETD A;  2JK5 C;  1VQ8 V;  3ZMT A;  4JAS A;  1H38 A;  2CK3 G;  2HKO A;  1NKD A;  1IXM A;  4LBE C;  4PDR A;  1FXH A;  1I5X A;  3STL C;  4BIZ A;  4QPK A;  4WFB V;  1NR7 A;  4U7N A;  4MVQ A;  1OCR C;  4JGS A;  1QR9 A;  3SPJ A;  2BOB C;  3SYA A;  1S72 V;  3ASN C;  3K0G A;  3ZCC A;  5EK0 A;  4TT3 G;  1CEZ A;  5B1O A;  1KP2 A;  4G2K A;  5CBG A;  4PEL A;  2HG5 C;  3WFV A;  1AI6 A;  3OE7 G;  4KP4 A;  1L1F A;  2W0F C;  2WLH A;  3LSS A;  4WFG A;  3R65 A;  3VOU A;  3DTU B;  4PDV A;  1KP3 A;  5LHG A;  3MHH C;  3NXS A;  2Q6A A;  4I5S A;  1AJN A;  1SRY A;  3IC7 A;  4XBF A;  3AG2 B;  2Q67 A;  1GK9 A;  4L87 A;  2DYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...