4PA6A

Structure of navms pore and c-terminal domain crystallised in the presence of channel blocking compound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 29
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa6A00
4X88A 3LNMB 2WLJA 3R65A 4R50A 3SYOA 4RO2A 5J9PC 2DYSC 2HJFC 4MVMA 3GB7C 3K0DA 4MVSA 3SYQA 4KFMA 4LCUC 3ASOC 2AHYA 4R8CA 4PDMA 3WG7C 4H33A 5B1BC 3ABKC 3K06A 1G4YB 4UUJC 3LUTB 3AG2C 2ZXWC 4XDLA 2EIMC 4F4LA 4J9YB 3HPLC 1R3IC 2HG5C 5EBMC 2EINC 3UM7A 3OUFA 2A0LA 4RUEA 1OCRC 2WLMA 5E1AC 3SPGA 3SYCA 3T4ZA 3F7VC 3SPHA 3IFXA 4HYOA 4RAIA 2NLJC 3SPIA 1XL4A 4PA4A 1J95A 1K4DC 1BL8A 3ABLC 4I9WA 2WLKA 1JVMA 4MW3A 3STLC 2ITDC 2IH3C 2WLIB 2Q67A 4WFGA 5EK0A 3F5WC 3OGCC 2QKSA 4RUFA 5EC1C 3RW0A 2X6CA 4EKWA 1OCZC 2H8PC 3K08A 3STZC 4P9OA 4R7CA 4MW8A 4OXSA 3E83A 3FB8C 3OR7C 4PA9A 3RVZA 4PA7A 2WLHA 3SPCA 4MTGA 4MSWC 4X89A 3AG4C 3E89A 4CBCA 4GX5A 4MS2A 3T4DA 3OUSA 3TETA 2KB1A 4MVQA 5BZBA 4WFFA 5KUKA 3LDDA 4LBEC 3FB6C 1OCCC 1LNQA 2ZD9A 2WLIA 5KUMA 4JTAB 3LDCA 4GX1A 1ZWIC 4PA6A 2DWDC 3PJSK 5EBLC 2BOCC 2X6BA 3E8FA 3E86A 3K03A 3K04A 4XDJA 3SJQC 5CBGA 4LP8A 1M56C 4QNHB 3ABMC 2Q69A 2DWEC 3E8GA 2HFEC 4PDVA 3T2MA 4HZ3A 4MTFA 3T1CA 3LDEA 4P30A 2DYRC 4BW5A 4JTCB 2EIJC 2Y69C 3AG1C 3ASNC 4PA3A 5EC2C 1P7BA 4X8AA 3TCUA 1R3LC 4G27B 3RVYA 4JTDB 2WLLB 4MVOA 1OCOC 2AHZA 5IY5C 4MTOA 3AG3C 3E8HA 2OCCC 3KG2A 3UKMA 4ZBMA 4TWKA 4WFHA 4XDKA 3F7YC 5B1AC 3JYCA 2ITCC 3X2QC 4G28B 1ORQC 1R3JC 2Q68A 2HVKC 2QTOA 3OR6C 4QE7A 2EIKC 1V54C 1XL6A 4J9ZB 4MVRA 2JK5C 1V55C 2A9HA 2P7TC 5CBHA 4WFEA 3IGAC 3ZJZA 1R3KC 3RBZA 3SPJA 3FB5C 3SYAA 3SYPA 4MVUA 2WLLA 2R9RB 3FB7C 4QE9A 1QLEC 4R6ZA 2IH1C 3BEHA 1K4CC 5EBWC 2K1EA 2A79B 4GX0A 4P9PA 2W0FC 4H37A 3EFFK 1M57C 2ATKC 3VOUA 2HVJC 4PDLA 3K0GA 5B3SC 4P2ZA 4PDRA 5CBFA 2YEVA 3ZRSA 3E8BA 2EILC 2WLNA 2BOBC 1S5HC 4GX2A 2X6AA 4MVZA 4DXWA 1KKDA 2Q6AA
chains in the Genus database with same CATH superfamily
2ILMA 2BE3A 3CJHB 1PP9H 3CRAA 3O65A 2QM7A 3E35A 1LUWA 2CTWA 1J5EO 4IYHA 2CH7B 4DW0A 1PL0A 2FTKA 1KU9A 5LHIA 3SYCA 3LSQA 1O9GA 3SJBC 5JJNB 1J95A 3G71V 5LGTA 1HNXB 1GMGA 1VQKV 5L3GA 4WFGA 1S5LZ 3OGCC 1Q5OA 5DM6V 1IBKB 2P06A 4MW8A 4QPJA 4PA7A 3MAQA 2A06H 3AG3B 3P3NA 4LFCO 2EILB 5H6RA 1KP2A 4JTAB 1HNWO 2BOCC 4XDJA 2QKAA 2JGDB 3ASOB 3F5TA 2FB5A 3AG1C 1IXBA 1Y74A 4Q20A 3EHBB 2NR5A 3RYIB 1HNWB 5KMGB 3RYCB 2JS5A 1FXKA 3VBBA 5FNVA 4ICGA 5ITZA 2HEPA 1FXKB 5FNVB 1KB9F 1AVMA 3CX5F 5CBHA 3VQYA 2JDIG 2IU3A 2DJVA 5H5NA 2ZR2A 4LFBO 1SKVA 1QLEC 3AK1A 4EEQA 4YJ3A 1VP7A 1K4CC 2LFRA 5IJ9A 2N04A 2LW7A 4DV7O 3H1KH 5GONB 2Y4UA 4P9PA 1I08A 1BHAA 4K3AA 3G80A 3W7TA 1DTOA 1COWG 1F4NA 5JJEB 3B8NA 2YEVA 3ZRSA 2RDCA 4I50A 4X1YB 1SQFA 2HHHO 2LGWA 2DYRB 1WPXA 3K79A 3RYFA 4RO2A 1PNKA 5IWAO 4MVSA 3JSNA 3RFRA 4FLVA 3AG2C 3IAYA 1SRYA 2LFSA 1AR4A 5KAIZ 1QQCA 2QSAA 2EULA 2RCVA 1PKXA 5IWAB 2IBZH 2P90A 1V55B 3ABMB 4I0XA 2UUCO 4BAYA 4PA4A 2C2AA 1XNRO 4E2LA 1XMQO 2H8PC 2VRZA 4NTXA 3AG7A 1EN4A 1GTOA 2AZ2A 1TVKA 4KHPO 4J7JA 1NKDA 1EBOA 3N2KB 3E8GA 3T2MA 2ZKOA 3ASNC 5EC2C 4X8AA 5L3CA 4X1IB 3ZN1A 3RVYA 2QJ1A 4X66O 1M4UA 2Q5ZA 3UKMA 2ZE8A 2ITCC 3LSSA 2F4VB 1B3QA 4LWSA 4X66B 4DRXA 4UFZA 4DYLA 4LC1A 2QEXV 1FJGB 3I55V 2ZXWB 3ML0A 2K1EA 2XTAA 1OCRB 5GTIZ 2O57A 1KUQA 2ZQMA 2YC0A 2R72A 2WLNA 3BA8A 3VQXA 4X88A 3AG1B 1H2MA 4TQDA 3G67A 1MSDA 1T5EA 3IC9A 1VF5B 2IJHA 2IW5A 2EIMC 4J9YB 4JI4O 2WAMA 3LSUA 5JQGA 4RUEA 2DQ3A 3WFVA 1R6KA 1RP3B 2QWPB 3IFXA 1Q43A 4JZGA 5FL7G 4ZHQB 3HKBA 1JVMA 2IH3C 5B1NA 4DR6B 1SERA 1X4TA 1NH2B 5EYPB 1QLEB 3CRRA 4J42A 2XAFA 4DUZO 2E76B 2Q8VA 1N33O 1H8HG 3FAVA 4OPAA 2GUZB 3N27A 3TETA 1CP9A 1XI1A 1HDJA 1JMKC 1ZWIC 4ABMA 3C3TA 1M56C 3O9OA 3UCSC 1N33B 3CC7V 2XAGA 2ZIMA 3AG2B 2DOSA 1N36B 1P7BA 1Q7YW 5KHKA 4CS4A 3SJCC 2AZ0A 2E5LO 1P7GA 3QO5A 2LQTA 3X2QC 1VARA 1Q86W 2KQXA 5J2TA 1OV9A 1G1XB 2IJIA 2EIKC 1V54C 3CCSV 2Q73A 3DC6A 1Q6UA 1KBHA 4ZI7B 1XREA 2E5LB 4MVUA 2ZDIC 1L0NH 2A79B 3FYIB 5LP6C 3HKEB 2Q0AA 1URFA 1HNZO 3EFFK 3CWBH 2ATKC 1CXZB 4NVPA 3ZRVA 1HR0B 3CP1A 1S77D 4JI3O 2P5OA 4YJ2A 1VQ7V 5CA0A 3JAKA 5IYZA 1WPBA 4FIPC 2FL4A 4FJCC 4LCUC 5GW7A 3CXHF 3JASA 5LMUB 4X62B 2Q7GA 2FKXA 1R6NA 4FM2A 3UO2A 2V7QG 3JASB 5IYCO 5EBMC 3SDLA 1Q81W 2CGOA 4DR1O 1ZSPA 2KSDA 1K4DC 5KAFZ 2A3QA 4GT1A 2PF4E 4I5SA 2KKWA 3CS5A 4GKJO 2ETNA 1Q3EA 4FZ1A 3BFRA 4LNUB 3H1JH 3OE7G 1YXBA 3SGIA 1EZVH 1NVPD 1BCCH 3RWRD 3K03A 5LHHA 1XNQB 2BTQA 2YI9A 3TCUA 1P4RA 1SA0B 1JOYA 3ZHRA 4JYAO 3RYHB 3CB2A 5LXTA 4X64O 1YCIA 2MK3A 1E1RG 4JYYA 5F2VO 1VQ8V 4K8XA 1RPRA 2Q68A 2QWNB 2OT5A 4PV1B 2JK5C 1HWYA 2BSKA 4TV8A 4LF7O 5JWPA 2RNBA 3OTFA 2IH1C 3CHXA 1NBMG 2EINB 5E79Z 4RWUA 3H01A 2W0FC 1L0LH 1SQXH 3K0GA 2PTMA 1M1KW 1GN3A 3JAWB 1S5HC 2UXNA 1KKDA 4U7OA 3MD0A 4FFBA 2WLJA 3OMAB 4DV6B 1MMMA 3W7WA 2HJFC 1Q8IA 3SYQA 4KFMA 2ZM6B 3T1HO 4JAVA 1YF2A 3ZMUA 1DF5A 3A2FA 3ZBHA 1K9MW 4UUJC 4X20A 3A0HZ 5JH7A 4AQYO 4UV9A 1V54B 2XNDG 2V1DA 3SPHA 2NLJC 1IBMO 3OAAG 1U96A 3CYOA 2OTJV 2WLIB 3HKCB 2B1IA 1XHXA 4XBFA 4CH6A 2OWOA 4R7CA 5C8YB 4PA9A 4JV5O 1KMIZ 4MTGA 1NZ6A 4NKGB 1IZ3A 4TUYA 2YDEA 2Q4PA 3LDDA 3ZMTA 3FB6C 1LNQA 5KUMA 3JATB 3NR7A 2HFEC 4EFBA 2WWWA 4W4KA 2EIJC 1Y6XA 1MZEA 4LF5B 2YSUB 3OMNB 3JCUZ 3CE2A 1IVSA 4K8ZA 4LFAB 1Q6IA 1M90W 3ETGA 2L35A 1YI2V 4TWKA 2Y48A 4J9ZB 5LYJB 1XQ8A 2EZOA 3B09A 3IJ4A 1BT8A 5LA6A 4YHHB 2WLLA 4JGSA 1K97A 1TUBA 5KA5A 1I94B 3AK3A 1E1QG 5KA6A 3Q4HB 5B1OA 2VQFB 2KG7B 4LF9O 4NR1A 4PI0A 4PDLA 5HFLA 1VF7A 2FMLA 2QKCA 3QO8A 4MVZA 2X6AA 4I4TB 3S3XA 5CB4A 4B3TO 2LJ2A 1IXMA 4FPPA 2AW9A 2CE4A 1K34A 1Q90D 5JVDA 4H33A 4LF9B 3AG4B 2WSSG 1PM9A 1EN5A 3JSLA 1OCCB 2QTSA 3JARA 5D5PA 2WLMA 4PI2A 1H38A 4JI0O 3CJHA 3OGIB 1K5SA 4NXMO 1D5NA 4JAAA 4O4JA 3F5WC 4NXNB 2ZIOA 2UXXA 1SQVH 2X6CA 1AI5A 1OCZC 2RMKB 3OEEG 3ZRWB 2CH7A 1BE3H 3FB8C 4O4JB 2PZSA 2UXCO 3SPCA 2GDSA 2IJJA 2Q0OC 4B3MO 3U0ZA 4HNAB 3LDCA 1A32A 1RPOA 5LL6Y 3I5DA 4X1KB 2CDYA 1F7YA 2Q69A 1S0VA 1J5EB 3ZMZA 2EJRA 5EZYB 1QHTA 3T1CA 4BR6A 1GK9A 3RT3C 4JI1O 2HP8A 5LGUA 4UCVA 1OCOC 4IL6Z 5IY5C 2OCCC 4ZBMA 4KL1A 2JGDA 1FFXB 1KC8W 3PN1A 4IHJA 2R70A 5FPOA 4F6RB 3J7AU 1K7DA 4FLXA 3UO3A 1D5AA 1EZJA 1WA8B 4IHJB 5B1BB 3WG7B 4LFCB 1AJNA 3RYIA 5KMGA 4O4LB 3RYCA 5D5QA 3BY6A 1SZXA 1R6TA 1GH6A 1GRJA 1NVPB 2R9IA 1JCHA 3JD4A 4YIPA 1ZUQA 2UXBO 4DR7O 3B40A 3E2EA 2EIJB 1ZX3A 2DYSC 2EBOA 3K0DA 4H0LB 1VQ6V 5JCOA 5BR8O 5GONA 4OPHA 3ABKC 2B5UA 3WB2A 2E75B 4JI7O 4XDLA 1AILA 1TUEB 1SC5B 1PNLA 3OUFA 2A0LA 2YICA 4GCZA 1UPGA 4X1YA 1ROPA 2N74A 2XOKG 1RM1C 2WLKA 4LFBB 4JI7B 1D2DA 1GKFA 2F1MA 4DV7B 1WB8A 2B1GA 1N32O 2PYJA 3I56V 4X65O 1H2LA 3OR7C 2YXYA 3RVZA 1QR9A 2GTAA 2ZE5A 5LGNA 3T4DA 2HHHB 1VQNV 1NTKH 1GN4A 2MW2B 4RQEA 4X65B 1N0JA 3SJQC 4QNHB 1KQSU 2PYLA 5CA1B 2UXDO 3LDEA 4BW5A 4JTCB 2Y69C 3GWOA 3H9VA 3BPZA 4FFKA 2UUCB 1XEQA 3OTOO 1TA8A 1BZKA 2JJ2G 3KG2A 3N2KA 4BIOA 1XNRB 4DV1O 1XMQB 1M5IA 1OCZB 2XUMA 4WFEA 4X1IA 4AHCA 1WP8A 3L75H 3OTOB 4LF8O 2W0XA 3M7MX 3CCEV 4KHPB 4R6ZA 3BEHA 3L72H 3APOA 5LMNO 1JFFB 3BHPA 2ZNJA 4DR3O 2HVJC 4LF8B 2ZNIA 1K3EA 4O2AB 5GTHZ 4GX2A 1GN6A 2Q6AA 2CK3G 5J9PC 4FM1A 5IJ0B 3K5MA 1I7FA 4UCOA 4DR3B 1JA8A 4TV9A 1AP5A 2CTRA 1JJOA 5IY5B 1AROP 2XAQA 2YIBA 3LNNA 4JASA 3K58A 4TV9B 3ZIAG 2LO1A 3KCXA 1SETA 1BQ0A 2CGNA 4DUYO 1YSCA 3J81N 1SQGA 1K8AW 1AJPA 4UCUA 1MNGA 4J10A 3QG5A 1YITV 4W4LA 2WLHA 1IBLO 4QIWF 4DW1A 4UCTA 3OFNG 5BZBA 2DN9A 1Q82W 4ZHQA 4DR5O 1K5QA 2YXLA 3KZIZ 3WB0A 4DK1A 5EYPA 2L6LA 1FYJA 4DV0O 1WJZA 4JI5O 3ABKB 5DECA 4JI4B 5CN0A 1S5JA 2GUZA 1GN2A 3M8AA 4JTDB 4MVOA 5EIBD 5JJJB 1VQPV 4EFEA 1RM1B 2PY5A 4I9QA 4DV3O 4J7KA 3JYCA 4YY3O 1JPXA 4J7ZA 4DUZB 4DO2A 1R3KC 2OIEA 3OT7A 4JZ2A 4OX9O 2M7WA 3JALB 5TISZ 2WA3A 1RSOB 1BMFG 3MDSA 1GO3F 4ZI7A 4UB6Z 3BRCA 2Y69B 1AR1B 2P6JA 2R9AA 1VQ5V 3TGUH 3ZHSA 4R8CA 3HKEA 1EM1A 5A2QN 1KECA 3ZCCA 1N34O 2G38A 4B08A 1Y76B 3CMEV 2IJKA 3ASNB 4DV4O 4FLUA 3RW0A 3G4SV 4WFBV 1XMOO 1Z5VA 1H2SB 1KKCA 2JS3A 3U11A 1HNZB 4ASUG 2F95B 4G2KA 4JI3B 4CBCA 1MA1A 3P3PA 1MG1A 1NI8A 3BAAA 4MT8A 4ZOLB 1XDCA 4UB8Z 2ZE6A 3ETEA 3FYEB 3E22A 2IM9A 3PJSK 3K04A 1OZ0A 1Z2GA 1M93A 1B6QA 3E22B 4UVBA 4D6TH 4LNUA 4DR1B 4UCRA 5J2UB 1LUVA 3KKYA 3RGBA 2ADPA 3BABA 3CEIA 5EIBC 3DGEA 3D36C 1NQTA 1QR8A 1WB7A 5B5EZ 3ICXA 1K33A 4KP4A 1TAEA 4TOIA 4GKJB 1SA0A 3RBZA 4I7ZB 4IYIA 3SYAA 1S3JA 4U3JB 2QM4A 2A7WA 2EIMB 4L87A 4QE9A 3T1YO 3RYHA 2XAHA 3TXQA 3G6EV 4K0KO 2QDOA 3FFQA 1M57C 1XOUA 1YVWA 4P2ZA 4K35A 4NB5A 2DQ0A 5H2FZ 5CMUA 2QWRB 4B3SO 2K9PA 5BMVB 5AG2A 3GB7C 4A5UB 4JYAB 1IDSA 4LR3A 2HJDA 4PDMA 4X64B 4UXNA 2Y0PA 2LGQA 2VWKA 1XUQA 1HW7A 3CCJV 2ODMA 3JAWA 1QVGU 3SPGA 5L3DA 1M56B 1SS3A 3AK2A 3P32A 4LF7B 4I9WA 2UUBO 4J11A 2JGUA 4RUFA 3HR0A 1VF6C 3STZC 2GSMB 1WN7A 1H2GA 1Y66A 4EB6B 3CCLV 1NR7A 2QWQB 3X2QB 1P84F 1U97A 2EIKB 4B3RO 2WLIA 3TK1A 3HKCA 3T1HB 3BVOA 2X6BA 2ZDIA 4BWAA 4YIOA 4LP8A 2VQEO 2IU0A 4LF4O 2W6JG 2FYUH 5IE9A 5C8YA 1H2KA 4P30A 2JJ1G 4AQYB 2ARHA 4X9QA 5LP6B 2X7RB 1SZTA 3JCZA 5KX5B 1IBMB 4FLYA 1V9PA 4D7SA 3JATA 3AG3C 5KHIA 2X0LA 4DV5O 4JI6O 1K92A 2VS0A 1JR9A 4CH5A 1YJ9V 2ZINA 2A9HA 4JV5B 1FFTB 5DN6G 4JYCA 3SPJA 1ZAUA 1GM8A 3FB5C 3QO7A 4N21A 1OHHG 3THOA 3DSQA 2YIAA 1BSMA 3VQVA 2UUAO 4UCSA 2ADQB 4O4IB 5LBQA 1GAXA 2OYQA 4DR2O 1YJNV 4H37A 4IIJB 5LYJA 2F23A 1FPOA 5CBFA 2LW1A 2QR4A 5CA3A 4NTYA 1FXKC 1BQZA 5LOVB 1ZLZA 1AI6A 3DXRB 3Q4HA 1PPJH 2KG7A 1KP3A 1SQPH 5JCOC 2ZT9B 4I4TA 2AGAA 3CD6V 3F7VC 3QF7A 1THZA 1XL4A 1KYOF 4FLZA 1QU7A 3JD1A 3SJAC 2Q9LA 3WU2Z 4CH3A 5LHGA 2QKSA 5EC1C 1MSWD 2LP7A 5L3BA 3K59A 2DW4A 4JAUA 4WBNB 1M57B 1WLEA 4NTWA 3E89A 3J80N 3OUSA 4QGPA 1DK1A 1YDXA 4RQFA 4B3TB 5L3FA 2DWDC 4KUMA 1AI4A 3E86A 3ABMC 3ZRWA 3ZMSA 4O2BB 4PDVA 1RFYA 4PELA 2UU9O 3B4SA 1NTZH 1ENVA 3DC5A 4D7TA 3KCYA 1NU1H 1F23A 3NXSA 2EZPA 1R3LC 3APQA 4I55B 3ZHVA 4JI0B 4DK0A 1AP6A 4HNAA 1H8EG 4NXMB 2AHZA 4C7UA 1SF9A 4X1KA 1EN6A 5B1AC 4G28B 3N2GB 5EZYA 1KD1W 4MVRA 4B7KA 2E74B 2UXCB 3QNEA 3JD0A 5IYBO 4FVMA 3CC2V 3U10A 1HNXO 4B3MB 4HBNA 3A0RA 1FFXA 1W59A 1IBKO 4FZ0A 4F6RA 2Q7EA 1JJ2U 3UQ8A 3E8BA 4DXWA 1WA8A 2B9ZA 2H94A 4ZKIA 3LNMB 3R65A 4R50A 3SYOA 4O4LA 3CCRV 3W7XA 3SR2C 4JI1B 4CC5A 3A0BZ 4DR4O 5IDJA 3LUTB 2ZXWC 3RN4A 4F4LA 2HG5C 2RJZA 1OCRC 4J80A 2OCHA 3P30A 1JQ0A 4DR4B 1NR1A 3STLC 5EK0A 1BHBA 3C3SA 2YI8A 4GYCB 2PI4A 4U3FH 2QM8A 3K9AA 1CEZA 4JI8O 2UXBB 4DR7B 1Y74B 4KXRA 3HB3B 4TT3G 3EXAA 1AR5A 4BW9A 2ZR3A 3CSXA 4AI8A 5BR8B 5CBGA 4JI8B 5ITZB 2DWEC 3D3IA 2Q7HA 1BS3A 4L8JA 3ZS8C 1YTFD 4JYBA 4G27B 1MOFA 3M99B 2Z0AA 2N05A 4YJ3B 3OEHG 5IJ9B 1E79G 4WF9V 2GBOA 5CA1A 3ETDA 2HVKC 1N32B 2P67A 3CXCU 4DV2O 2YEVB 4I50B 1AB3A 1PNMA 1O9HA 3L74H 3RYFB 4F6EA 4DV2B 4CH4A 3HKDA 2WPDG 2UXDB 1ZTEA 3CRCA 5B3SC 4PDRA 4Z2WA 2JEUA 5KLVH 3HKDB 4BIZA 2HR3A 4I0XB 3ZHTA 1JFFA 3W7SA 4DV1B 1S72V 5B1AB 3A8TA 2E3CA 1K73W 4O2AA 1NS1A 1TVKB 1NJIW 3SPIA 2PI5A 5IJ0A 3ABLC 1Q6HA 1BL8A 5BY1A 2DE0X 4NYKA 2Q67A 3K5LA 4OGQB 4ZIBA 5LMNB 1JX9A 2PUSA 4EKWA 3ZMVA 1QVFU 3K08A 4P9OA 2Z5UA 3CCQV 1B04A 2F4VO 4J41A 2V4DA 1OCOB 4MSWC 2OCCB 4GX5A 1HP8A 4FM0A 2KB1A 1FJGO 3L73H 4AILC 4GX1A 4PA6A 1SQBH 3W7UA 1VQMV 2YXHA 4IT5A 4HAMA 4LWSB 4DRXB 4Q6GA 5FLXN 2P4KA 2BTOA 4DUYB 4MTOA 3E8HA 1P49A 1R3JC 1F51A 2QTOA 2DYSB 4CS2A 3R66A 3IGAC 1IBLB 4QPKA 5K1XA 3G6BA 1QBZA 1VQOV 3H1IH 2D2CB 3UT5A 1I5XA 4DR5B 3JD2A 4DR6O 4PHZA 5C93A 2GTSA 1PV0A 2EX3A 3S3WA 3BCCH 1UFIA 4DV0B 2GHYA 3UT5B 4JI5B 4B7EA 3L71H 1VQ9V 5KHGA 5JQGB 2ZCEA 2BOBC 5BXZA 2OIGA 2NNUA 3JALA 4E4EA 1RSOA 3HKBB 3CCMV 3CCVV 2VWJA 2DMXA 2AHYA 1G4YB 4DV3B 1IURA 2QGNA 4YY3B 1R3IC 1NT2B 2EINC 3UM7A 1GM9A 3CCUV 1N36O 1DLBA 3FD9A 3FAVB 3T4ZA 3B2EE 4HYOA 4MTXA 4OX9B 2JIZG 3B8MA 2F66C 5A9GA 3CMAV 3K9SA 3CPWU 3E83A 2NN4A 2QE7G 1XHZA 1YZBA 3K5OA 2ZE7A 1Y76A 1Y4MA 1YEWA 2QA4V 1PL4A 2WA4A 5B3SB 2P22C 4LBEC 3ABUA 1VQLV 3E8FA 4Z1VA 1XBLA 5L3EA 5J2TB 1HR0O 1N34B 4HZ3A 3B77A 4LH7A 4UVCA 3OMIB 4ZOLA 4GKKO 5IYDO 3DTUB 2PGGA 5LMUO 3FKSG 4X62O 3ABLB 4WFHA 4DV4B 2P4VA 4Z1MG 1GM7A 2M6YA 1L1FA 3ZN0A 4LH6A 3ZX6A 2Y4TA 1XMOB 1XL6A 4FLTA 4LF6O 4IGGA 1UJWB 3CRQA 1AI7A 4GKKB 1SESA 2RQ6A 4YJ2B 2XHBA 5J2UA 4GZRB 5CA0B 3SYPA 3JAKB 2W6IG 5IYZB 1SQQH 1FXHA 4LF6B 1QLNA 2CUGA 3VOUA 5KHJA 1N0NA 5DEDA 4U3JA 1L8DA 1YTFB 1ZL8A 4JPRA 3CC4V 1G8MA 4BIUA 1XNQO 4FLWA 1ZL8B 3H1HH 2CAZC 3HPLC 1Z5WA 3IC7A 4N23A 5H9CA 1AJQA 5B66Z 4CZZA 5E1AC 5BMVA 1CPYA 4CS3A 2Z3YA 4CC6A 2ITDC 3T1YB 1R1BA 1VQ4V 4K0KB 2BTQB 3L9DA 3H1LH 5KHHA 1DGSA 1YJWV 2CTPA 4X89A 3AG4C 4MS2A 3ZRXA 4MVQA 3GWKC 4B3SB 4WFFA 3MHHC 4TSFG 1OCCC 5LXTB 3JAMN 1TGOA 3TJTA 2XT9A 4EB6A 3TXSA 4PA3A 2F93B 4QJFB 4WCEV 4H44B 1WP7A 1B06A 1N4CA 2BSKB 4UV8A 4DV6O 5IT9N 4TV8B 1WNSA 1DF4A 2ZM6O 4PD4F 1F4MA 2UUBB 2YUAA 3OW2U 2HLDG 2F43G 4XDKA 1N8RW 3GVMA 3OR6C 4QE7A 3VQWA 3L70H 2BCCH 2P7TC 5LP6A 3JD3A 5KX5A 4FFBB 1US6A 4B3RB 2QWOB 1EFRG 5K1PA 2VQEB 4X20B 1I0HA 4JF3A 4LF4B 1FXVA 3D3QA 2AXTZ 5JH7B 4FK5C 4JI2O 2EILC 3ZEDA 1BGYH 1R73A 3AEIA 4MVMA 1IX9A 1YIJV 2HKOA 2XAJA 2RN9A 2Y0IA 3ASOC 3WG7C 4O4IA 5B1BC 5H6QA 3K06A 4DV5B 4JI6B 3K57A 1LR1A 3OM3B 5HFMA 2D3OW 4JI2B 3EVKA 4IIJA 1H2NA 3QVNA 4LF5O 3K3WA 1Y67A 4TUYB 4RAIA 2JEXA 2YIDA 4LFAO 4MW3A 5LOVA 1NTMH 3DXRA 1G6UA 1FAFA 2UUAB 2JRIA 4UVAA 3D36A 4DR2B 2H3OA 4OXSA 1QNMA 2EJ7A 1WAZA 4GLXA 1QCEA 3ABTA 4YHHO 4U7NA 5KUKA 3ZHUA 2JVDA 5FPRA 2ZD9A 3MHSC 3WB1A 1I94O 5EBLC 1FKAO 1XILA 2YIBD 3ZHQA 2GV9A 3ETQA 1VIBA 2VQFO 4YXWG 2YS8A 4MTFA 3CRMA 4WBNA 2DYRC 1W2BU 5LA6B 3BA9A 1S76D 3OD4A 1VEWA 1W0JG 2WLLB 1YHQV 4GUNA 1TUBB 3C90A 3F7YC 1ORQC 4O4HA 4O2BA 1FS0G 1I5YA 1MZFA 1V55C 4FMTA 3D8CA 1VMGA 4O4HB 3ZJZA 1MABG 4I55A 3FX7A 5CB4B 1FD9A 4TQFA 2XASA 1NH2D 1M9NA 2R9RB 3FB7C 4H13B 5EBWC 4NXNO 1X59A 4GX0A 5JVDB 1W0KG 3N2GA 1OJHA 2UU9B 1VF6A 2OTLV 1PD3A 3QTCA 3JARB 4WFAV 4PJ0Z 2CTQA 3K5NA
chains in the Genus database with same CATH topology
2HR3A 2WLJA 2Y69B 3OMAB 1AR1B 3W7WA 2HJFC 2P6JA 1VQ5V 3SYQA 4KFMA 4JAVA 3ZMUA 4R8CA 1DF5A 2QM7A 3E35A 3W7SA 1KECA 1K9MW 4UUJC 3ZCCA 1S72V 5B1AB 1PL0A 2FTKA 4UV9A 1K73W 5LHIA 1V54B 3SYCA 3LSQA 2XNDG 1NJIW 2V1DA 3SPHA 3CMEV 2IJKA 2NLJC 3SPIA 2PI5A 3OAAG 1J95A 3ABLC 1BL8A 3G71V 5LGTA 1GMGA 3CYOA 1VQKV 2WLIB 2OTJV 5L3GA 2Q67A 4WFGA 2B1IA 3ASNB 3OGCC 1JX9A 5DM6V 4EKWA 3RW0A 3G4SV 4XBFA 3ZMVA 3K08A 4WFBV 1QVFU 4P9OA 2Z5UA 3CCQV 4R7CA 4MW8A 4PA9A 4QPJA 4PA7A 4ASUG 1OCOB 4MTGA 4MSWC 4G2KA 3AG3B 4CBCA 2OCCB 4GX5A 2KB1A 1MG1A 4MT8A 3LDDA 2EILB 3ZMTA 3FB6C 5H6RA 3ETEA 1LNQA 1KP2A 3FYEB 5KUMA 4JTAB 4GX1A 4PA6A 3PJSK 2BOCC 3K04A 4XDJA 3W7UA 1OZ0A 1VQMV 3ASOB 2HFEC 1B6QA 2WWWA 4UVBA 2EIJC 3AG1C 4HAMA 4Q20A 3EHBB 2YSUB 3OMNB 1M90W 3ETGA 1FXKA 3VBBA 4MTOA 3DGEA 3E8HA 1YI2V 4TWKA 1NQTA 1QR8A 2Y48A 1R3JC 1F51A 2QTOA 1FXKB 1K33A 2DYSB 4J9ZB 4KP4A 2EZOA 5CBHA 3IGAC 4QPKA 3RBZA 2JDIG 3SYAA 1S3JA 1QBZA 2IU3A 1VQOV 4L87A 2ZR2A 2EIMB 2WLLA 4JGSA 4QE9A 1I5XA 1QLEC 3JD2A 2XAHA 1K97A 5C93A 1K4CC 2LFRA 5KA5A 3G6EV 1E1QG 4P9PA 1BHAA 5KA6A 3W7TA 2GHYA 1DTOA 5B1OA 1COWG 1F4NA 1M57C 4PDLA 3B8NA 4P2ZA 5HFLA 1VQ9V 2YEVA 3ZRSA 2DQ0A 5CMUA 2BOBC 3QO8A 4MVZA 2X6AA 2DYRB 1WPXA 3K79A 4RO2A 4FPPA 1IXMA 2NNUA 1PNKA 3GB7C 4MVSA 1K34A 3CCMV 3CCVV 2AHYA 4PDMA 4H33A 3AG4B 2WSSG 1G4YB 4UXNA 3AG2C 1SRYA 2LFSA 1R3IC 1OCCB 2EINC 3UM7A 1GM9A 3CCUV 1PKXA 3CCJV 1QVGU 1DLBA 2WLMA 3SPGA 1H38A 2P90A 1V55B 5L3DA 1M56B 3T4ZA 3ABMB 4HYOA 3P32A 4MTXA 4BAYA 4PA4A 4I9WA 1K5SA 2C2AA 2JIZG 3B8MA 3F5WC 4E2LA 3CMAV 2UXXA 4RUFA 2X6CA 1AI5A 1OCZC 3OEEG 3ZRWB 2H8PC 3STZC 3CPWU 2GSMB 3E83A 3FB8C 2QE7G 1H2GA 1Y66A 3SPCA 3CCLV 1Y4MA 1GTOA 2QA4V 1NR7A 2IJJA 5B3SB 3X2QB 4LBEC 2EIKB 2WLIA 3TK1A 3ABUA 3LDCA 1RPOA 1VQLV 2X6BA 1NKDA 1EBOA 2ZDIA 3E8FA 4LP8A 5L3EA 2Q69A 1S0VA 2IU0A 3E8GA 2W6JG 3ZMZA 2EJRA 3T2MA 4HZ3A 3B77A 3T1CA 4P30A 2JJ1G 3ASNC 1GK9A 5EC2C 4X8AA 2X7RB 5L3CA 1SZTA 4UVCA 3OMIB 3ZN1A 3RVYA 3JCZA 5LGUA 1OCOC 5IYDO 3DTUB 5IY5C 3FKSG 3AG3C 2OCCC 2X0LA 3ABLB 4ZBMA 3UKMA 4WFHA 4Z1MG 1GM7A 1K92A 2ITCC 1L1FA 1KC8W 3ZN0A 3LSSA 1XL6A 1YJ9V 1K7DA 2A9HA 1UJWB 1EZJA 1FFTB 1AI7A 3WG7B 5DN6G 1SESA 4JYCA 5B1BB 1AJNA 3SPJA 1GM8A 4LC1A 3FB5C 3SYPA 2QEXV 3QO7A 4N21A 3I55V 2ZXWB 2W6IG 3ML0A 1OHHG 2K1EA 3BY6A 1FXHA 1OCRB 5LBQA 1NVPB 1YJNV 2R9IA 1JCHA 4H37A 1QLNA 3JD4A 3VOUA 5CBFA 2ZQMA 3E2EA 2WLNA 5CA3A 4X88A 2EIJB 1FXKC 3AG1B 2DYSC 2EBOA 3K0DA 1YTFB 1VQ6V 4JPRA 3CC4V 1G8MA 1AI6A 4BIUA 3ABKC 2B5UA 2IJHA 4XDLA 2IW5A 2EIMC 1TUEB 3HPLC 1KP3A 4J9YB 1PNLA 2WAMA 3IC7A 3OUFA 2A0LA 4N23A 5H9CA 1AJQA 4GCZA 4RUEA 4CZZA 5E1AC 2DQ3A 3WFVA 3CD6V 1R6KA 3F7VC 1ROPA 3IFXA 1CPYA 1THZA 1XL4A 5FL7G 2XOKG 2Z3YA 1RM1C 2WLKA 1JVMA 2ITDC 2IH3C 3JD1A 5B1NA 1SERA 1VQ4V 1GKFA 1NH2B 5LHGA 1QLEB 2QKSA 5EC1C 1MSWD 2LP7A 2B1GA 3I56V 2XAFA 5L3BA 3OR7C 3RVZA 2DW4A 1QR9A 4JAUA 1YJWV 1M57B 1WLEA 4X89A 3AG4C 3E89A 1H8HG 4MS2A 3ZRXA 5LGNA 3T4DA 3OUSA 3TETA 4MVQA 1VQNV 4WFFA 4RQFA 3MHHC 4TSFG 1CP9A 1OCCC 5L3FA 1ZWIC 4RQEA 2DWDC 4KUMA 1AI4A 3E86A 3SJQC 1M56C 4QNHB 3ABMC 1KQSU 3ZRWA 3ZMSA 4PDVA 3CC7V 4PELA 2XAGA 3LDEA 1ENVA 3AG2B 4BW5A 4JTCB 2Y69C 4PA3A 4QJFB 1P7BA 1F23A 3NXSA 4WCEV 2EZPA 1R3LC 1Q7YW 3GWOA 4UV8A 1DF4A 1H8EG 1F4MA 2AHZA 3OW2U 2HLDG 2JJ2G 3KG2A 3QO5A 2F43G 4XDKA 5B1AC 3X2QC 1Q86W 1N8RW 4G28B 2IJIA 3OR6C 1KD1W 4QE7A 2EIKC 1V54C 3CCSV 4MVRA 1OCZB 2P7TC 3QNEA 4WFEA 3JD0A 5IYBO 3CC2V 3JD3A 4MVUA 2ZDIC 3CCEV 4R6ZA 3BEHA 2A79B 3FYIB 1EFRG 3A0RA 3EFFK 4JF3A 1FXVA 2ATKC 3ZRVA 3CP1A 2HVJC 1S77D 1K3EA 1JJ2U 4FK5C 3E8BA 2EILC 4DXWA 4GX2A 2H94A 4ZKIA 1VQ7V 2Q6AA 2CK3G 3LNMB 3R65A 4R50A 1R73A 3SYOA 5J9PC 3W7XA 3CCRV 3AEIA 4MVMA 1YIJV 4FIPC 4FJCC 4LCUC 5GW7A 2HKOA 2XAJA 3ASOC 3WG7C 5H6QA 5B1BC 3K06A 5IDJA 3OM3B 5HFMA 5IY5B 1R6NA 3LUTB 2ZXWC 2D3OW 1AROP 2V7QG 2XAQA 4F4LA 4JASA 2HG5C 5IYCO 5EBMC 1Q81W 3ZIAG 1OCRC 3P30A 3K3WA 1JQ0A 4RAIA 1SETA 2JEXA 1K4DC 4MW3A 1NR1A 3STLC 5EK0A 1BHBA 1YSCA 4GT1A 4UVAA 1K8AW 2PI4A 1AJPA 3D36A 4I5SA 2QM8A 3K9AA 4OXSA 1CEZA 1YITV 2WLHA 4QIWF 3OFNG 1QCEA 3OE7G 5BZBA 3ABTA 3HB3B 4TT3G 4U7NA 5KUKA 1Q82W 1K5QA 2ZR3A 1NVPD 2ZD9A 3MHSC 5EBLC 3K03A 5CBGA 5LHHA 2DWEC 4YXWG 3D3IA 3ABKB 4MTFA 2DYRC 5CN0A 3TCUA 1W2BU 1P4RA 1YTFD 4JYBA 4G27B 1MOFA 3M99B 4JTDB 1S76D 1JOYA 1W0JG 2WLLB 4MVOA 1YHQV 1VQPV 3OEHG 2MK3A 1E1RG 1RM1B 3F7YC 1E79G 3JYCA 4WF9V 1VQ8V 1ORQC 1RPRA 2Q68A 3ETDA 2HVKC 1JPXA 2P67A 1FS0G 2OT5A 3CXCU 2JK5C 1I5YA 1V55C 4FMTA 2YEVB 4DO2A 1HWYA 3ZJZA 1PNMA 1R3KC 1MABG 2XASA 2M7WA 1NH2D 1M9NA 2R9RB 3FB7C 2IH1C 1BMFG 1NBMG 2EINB 5EBWC 4GX0A 3H01A 1W0KG 2W0FC 2WPDG 1GO3F 3K0GA 5B3SC 4PDRA 2OTLV 1PD3A 1M1KW 2JEUA 4WFAV 1S5HC 2UXNA 1KKDA 4BIZA 4U7OA 3MD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X88 A;  3LNM B;  2WLJ A;  3R65 A;  4R50 A;  3SYO A;  4RO2 A;  5J9P C;  2DYS C;  2HJF C;  4MVM A;  3GB7 C;  3K0D A;  4MVS A;  3SYQ A;  4KFM A;  4LCU C;  3ASO C;  2AHY A;  4R8C A;  4PDM A;  3WG7 C;  4H33 A;  5B1B C;  3ABK C;  3K06 A;  1G4Y B;  4UUJ C;  3LUT B;  3AG2 C;  2ZXW C;  4XDL A;  2EIM C;  4F4L A;  4J9Y B;  3HPL C;  1R3I C;  2HG5 C;  5EBM C;  2EIN C;  3UM7 A;  3OUF A;  2A0L A;  4RUE A;  1OCR C;  2WLM A;  5E1A C;  3SPG A;  3SYC A;  3T4Z A;  3F7V C;  3SPH A;  3IFX A;  4HYO A;  4RAI A;  2NLJ C;  3SPI A;  1XL4 A;  4PA4 A;  1J95 A;  1K4D C;  1BL8 A;  3ABL C;  4I9W A;  2WLK A;  1JVM A;  4MW3 A;  3STL C;  2ITD C;  2IH3 C;  2WLI B;  2Q67 A;  4WFG A;  5EK0 A;  3F5W C;  3OGC C;  2QKS A;  4RUF A;  5EC1 C;  3RW0 A;  2X6C A;  4EKW A;  1OCZ C;  2H8P C;  3K08 A;  3STZ C;  4P9O A;  4R7C A;  4MW8 A;  4OXS A;  3E83 A;  3FB8 C;  3OR7 C;  4PA9 A;  3RVZ A;  4PA7 A;  2WLH A;  3SPC A;  4MTG A;  4MSW C;  4X89 A;  3AG4 C;  3E89 A;  4CBC A;  4GX5 A;  4MS2 A;  3T4D A;  3OUS A;  3TET A;  2KB1 A;  4MVQ A;  5BZB A;  4WFF A;  5KUK A;  3LDD A;  4LBE C;  3FB6 C;  1OCC C;  1LNQ A;  2ZD9 A;  2WLI A;  5KUM A;  4JTA B;  3LDC A;  4GX1 A;  1ZWI C;  4PA6 A;  2DWD C;  3PJS K;  5EBL C;  2BOC C;  2X6B A;  3E8F A;  3E86 A;  3K03 A;  3K04 A;  4XDJ A;  3SJQ C;  5CBG A;  4LP8 A;  1M56 C;  4QNH B;  3ABM C;  2Q69 A;  2DWE C;  3E8G A;  2HFE C;  4PDV A;  3T2M A;  4HZ3 A;  4MTF A;  3T1C A;  3LDE A;  4P30 A;  2DYR C;  4BW5 A;  4JTC B;  2EIJ C;  2Y69 C;  3AG1 C;  3ASN C;  4PA3 A;  5EC2 C;  1P7B A;  4X8A A;  3TCU A;  1R3L C;  4G27 B;  3RVY A;  4JTD B;  2WLL B;  4MVO A;  1OCO C;  2AHZ A;  5IY5 C;  4MTO A;  3AG3 C;  3E8H A;  2OCC C;  3KG2 A;  3UKM A;  4ZBM A;  4TWK A;  4WFH A;  4XDK A;  3F7Y C;  5B1A C;  3JYC A;  2ITC C;  3X2Q C;  4G28 B;  1ORQ C;  1R3J C;  2Q68 A;  2HVK C;  2QTO A;  3OR6 C;  4QE7 A;  2EIK C;  1V54 C;  1XL6 A;  4J9Z B;  4MVR A;  2JK5 C;  1V55 C;  2A9H A;  2P7T C;  5CBH A;  4WFE A;  3IGA C;  3ZJZ A;  1R3K C;  3RBZ A;  3SPJ A;  3FB5 C;  3SYA A;  3SYP A;  4MVU A;  2WLL A;  2R9R B;  3FB7 C;  4QE9 A;  1QLE C;  4R6Z A;  2IH1 C;  3BEH A;  1K4C C;  5EBW C;  2K1E A;  2A79 B;  4GX0 A;  4P9P A;  2W0F C;  4H37 A;  3EFF K;  1M57 C;  2ATK C;  3VOU A;  2HVJ C;  4PDL A;  3K0G A;  5B3S C;  4P2Z A;  4PDR A;  5CBF A;  2YEV A;  3ZRS A;  3E8B A;  2EIL C;  2WLN A;  2BOB C;  1S5H C;  4GX2 A;  2X6A A;  4MVZ A;  4DXW A;  1KKD A;  2Q6A A; 
#chains in the Genus database with same CATH topology
 2ILM A;  2BE3 A;  3CJH B;  1PP9 H;  3CRA A;  3O65 A;  2QM7 A;  3E35 A;  1LUW A;  2CTW A;  1J5E O;  4IYH A;  2CH7 B;  4DW0 A;  1PL0 A;  2FTK A;  1KU9 A;  5LHI A;  3SYC A;  3LSQ A;  1O9G A;  3SJB C;  5JJN B;  1J95 A;  3G71 V;  5LGT A;  1HNX B;  1GMG A;  1VQK V;  5L3G A;  4WFG A;  1S5L Z;  3OGC C;  1Q5O A;  5DM6 V;  1IBK B;  2P06 A;  4MW8 A;  4QPJ A;  4PA7 A;  3MAQ A;  2A06 H;  3AG3 B;  3P3N A;  4LFC O;  2EIL B;  5H6R A;  1KP2 A;  4JTA B;  1HNW O;  2BOC C;  4XDJ A;  2QKA A;  2JGD B;  3ASO B;  3F5T A;  2FB5 A;  3AG1 C;  1IXB A;  1Y74 A;  4Q20 A;  3EHB B;  2NR5 A;  3RYI B;  1HNW B;  5KMG B;  3RYC B;  2JS5 A;  1FXK A;  3VBB A;  5FNV A;  4ICG A;  5ITZ A;  2HEP A;  1FXK B;  5FNV B;  1KB9 F;  1AVM A;  3CX5 F;  5CBH A;  3VQY A;  2JDI G;  2IU3 A;  2DJV A;  5H5N A;  2ZR2 A;  4LFB O;  1SKV A;  1QLE C;  3AK1 A;  4EEQ A;  4YJ3 A;  1VP7 A;  1K4C C;  2LFR A;  5IJ9 A;  2N04 A;  2LW7 A;  4DV7 O;  3H1K H;  5GON B;  2Y4U A;  4P9P A;  1I08 A;  1BHA A;  4K3A A;  3G80 A;  3W7T A;  1DTO A;  1COW G;  1F4N A;  5JJE B;  3B8N A;  2YEV A;  3ZRS A;  2RDC A;  4I50 A;  4X1Y B;  1SQF A;  2HHH O;  2LGW A;  2DYR B;  1WPX A;  3K79 A;  3RYF A;  4RO2 A;  1PNK A;  5IWA O;  4MVS A;  3JSN A;  3RFR A;  4FLV A;  3AG2 C;  3IAY A;  1SRY A;  2LFS A;  1AR4 A;  5KAI Z;  1QQC A;  2QSA A;  2EUL A;  2RCV A;  1PKX A;  5IWA B;  2IBZ H;  2P90 A;  1V55 B;  3ABM B;  4I0X A;  2UUC O;  4BAY A;  4PA4 A;  2C2A A;  1XNR O;  4E2L A;  1XMQ O;  2H8P C;  2VRZ A;  4NTX A;  3AG7 A;  1EN4 A;  1GTO A;  2AZ2 A;  1TVK A;  4KHP O;  4J7J A;  1NKD A;  1EBO A;  3N2K B;  3E8G A;  3T2M A;  2ZKO A;  3ASN C;  5EC2 C;  4X8A A;  5L3C A;  4X1I B;  3ZN1 A;  3RVY A;  2QJ1 A;  4X66 O;  1M4U A;  2Q5Z A;  3UKM A;  2ZE8 A;  2ITC C;  3LSS A;  2F4V B;  1B3Q A;  4LWS A;  4X66 B;  4DRX A;  4UFZ A;  4DYL A;  4LC1 A;  2QEX V;  1FJG B;  3I55 V;  2ZXW B;  3ML0 A;  2K1E A;  2XTA A;  1OCR B;  5GTI Z;  2O57 A;  1KUQ A;  2ZQM A;  2YC0 A;  2R72 A;  2WLN A;  3BA8 A;  3VQX A;  4X88 A;  3AG1 B;  1H2M A;  4TQD A;  3G67 A;  1MSD A;  1T5E A;  3IC9 A;  1VF5 B;  2IJH A;  2IW5 A;  2EIM C;  4J9Y B;  4JI4 O;  2WAM A;  3LSU A;  5JQG A;  4RUE A;  2DQ3 A;  3WFV A;  1R6K A;  1RP3 B;  2QWP B;  3IFX A;  1Q43 A;  4JZG A;  5FL7 G;  4ZHQ B;  3HKB A;  1JVM A;  2IH3 C;  5B1N A;  4DR6 B;  1SER A;  1X4T A;  1NH2 B;  5EYP B;  1QLE B;  3CRR A;  4J42 A;  2XAF A;  4DUZ O;  2E76 B;  2Q8V A;  1N33 O;  1H8H G;  3FAV A;  4OPA A;  2GUZ B;  3N27 A;  3TET A;  1CP9 A;  1XI1 A;  1HDJ A;  1JMK C;  1ZWI C;  4ABM A;  3C3T A;  1M56 C;  3O9O A;  3UCS C;  1N33 B;  3CC7 V;  2XAG A;  2ZIM A;  3AG2 B;  2DOS A;  1N36 B;  1P7B A;  1Q7Y W;  5KHK A;  4CS4 A;  3SJC C;  2AZ0 A;  2E5L O;  1P7G A;  3QO5 A;  2LQT A;  3X2Q C;  1VAR A;  1Q86 W;  2KQX A;  5J2T A;  1OV9 A;  1G1X B;  2IJI A;  2EIK C;  1V54 C;  3CCS V;  2Q73 A;  3DC6 A;  1Q6U A;  1KBH A;  4ZI7 B;  1XRE A;  2E5L B;  4MVU A;  2ZDI C;  1L0N H;  2A79 B;  3FYI B;  5LP6 C;  3HKE B;  2Q0A A;  1URF A;  1HNZ O;  3EFF K;  3CWB H;  2ATK C;  1CXZ B;  4NVP A;  3ZRV A;  1HR0 B;  3CP1 A;  1S77 D;  4JI3 O;  2P5O A;  4YJ2 A;  1VQ7 V;  5CA0 A;  3JAK A;  5IYZ A;  1WPB A;  4FIP C;  2FL4 A;  4FJC C;  4LCU C;  5GW7 A;  3CXH F;  3JAS A;  5LMU B;  4X62 B;  2Q7G A;  2FKX A;  1R6N A;  4FM2 A;  3UO2 A;  2V7Q G;  3JAS B;  5IYC O;  5EBM C;  3SDL A;  1Q81 W;  2CGO A;  4DR1 O;  1ZSP A;  2KSD A;  1K4D C;  5KAF Z;  2A3Q A;  4GT1 A;  2PF4 E;  4I5S A;  2KKW A;  3CS5 A;  4GKJ O;  2ETN A;  1Q3E A;  4FZ1 A;  3BFR A;  4LNU B;  3H1J H;  3OE7 G;  1YXB A;  3SGI A;  1EZV H;  1NVP D;  1BCC H;  3RWR D;  3K03 A;  5LHH A;  1XNQ B;  2BTQ A;  2YI9 A;  3TCU A;  1P4R A;  1SA0 B;  1JOY A;  3ZHR A;  4JYA O;  3RYH B;  3CB2 A;  5LXT A;  4X64 O;  1YCI A;  2MK3 A;  1E1R G;  4JYY A;  5F2V O;  1VQ8 V;  4K8X A;  1RPR A;  2Q68 A;  2QWN B;  2OT5 A;  4PV1 B;  2JK5 C;  1HWY A;  2BSK A;  4TV8 A;  4LF7 O;  5JWP A;  2RNB A;  3OTF A;  2IH1 C;  3CHX A;  1NBM G;  2EIN B;  5E79 Z;  4RWU A;  3H01 A;  2W0F C;  1L0L H;  1SQX H;  3K0G A;  2PTM A;  1M1K W;  1GN3 A;  3JAW B;  1S5H C;  2UXN A;  1KKD A;  4U7O A;  3MD0 A;  4FFB A;  2WLJ A;  3OMA B;  4DV6 B;  1MMM A;  3W7W A;  2HJF C;  1Q8I A;  3SYQ A;  4KFM A;  2ZM6 B;  3T1H O;  4JAV A;  1YF2 A;  3ZMU A;  1DF5 A;  3A2F A;  3ZBH A;  1K9M W;  4UUJ C;  4X20 A;  3A0H Z;  5JH7 A;  4AQY O;  4UV9 A;  1V54 B;  2XND G;  2V1D A;  3SPH A;  2NLJ C;  1IBM O;  3OAA G;  1U96 A;  3CYO A;  2OTJ V;  2WLI B;  3HKC B;  2B1I A;  1XHX A;  4XBF A;  4CH6 A;  2OWO A;  4R7C A;  5C8Y B;  4PA9 A;  4JV5 O;  1KMI Z;  4MTG A;  1NZ6 A;  4NKG B;  1IZ3 A;  4TUY A;  2YDE A;  2Q4P A;  3LDD A;  3ZMT A;  3FB6 C;  1LNQ A;  5KUM A;  3JAT B;  3NR7 A;  2HFE C;  4EFB A;  2WWW A;  4W4K A;  2EIJ C;  1Y6X A;  1MZE A;  4LF5 B;  2YSU B;  3OMN B;  3JCU Z;  3CE2 A;  1IVS A;  4K8Z A;  4LFA B;  1Q6I A;  1M90 W;  3ETG A;  2L35 A;  1YI2 V;  4TWK A;  2Y48 A;  4J9Z B;  5LYJ B;  1XQ8 A;  2EZO A;  3B09 A;  3IJ4 A;  1BT8 A;  5LA6 A;  4YHH B;  2WLL A;  4JGS A;  1K97 A;  1TUB A;  5KA5 A;  1I94 B;  3AK3 A;  1E1Q G;  5KA6 A;  3Q4H B;  5B1O A;  2VQF B;  2KG7 B;  4LF9 O;  4NR1 A;  4PI0 A;  4PDL A;  5HFL A;  1VF7 A;  2FML A;  2QKC A;  3QO8 A;  4MVZ A;  2X6A A;  4I4T B;  3S3X A;  5CB4 A;  4B3T O;  2LJ2 A;  1IXM A;  4FPP A;  2AW9 A;  2CE4 A;  1K34 A;  1Q90 D;  5JVD A;  4H33 A;  4LF9 B;  3AG4 B;  2WSS G;  1PM9 A;  1EN5 A;  3JSL A;  1OCC B;  2QTS A;  3JAR A;  5D5P A;  2WLM A;  4PI2 A;  1H38 A;  4JI0 O;  3CJH A;  3OGI B;  1K5S A;  4NXM O;  1D5N A;  4JAA A;  4O4J A;  3F5W C;  4NXN B;  2ZIO A;  2UXX A;  1SQV H;  2X6C A;  1AI5 A;  1OCZ C;  2RMK B;  3OEE G;  3ZRW B;  2CH7 A;  1BE3 H;  3FB8 C;  4O4J B;  2PZS A;  2UXC O;  3SPC A;  2GDS A;  2IJJ A;  2Q0O C;  4B3M O;  3U0Z A;  4HNA B;  3LDC A;  1A32 A;  1RPO A;  5LL6 Y;  3I5D A;  4X1K B;  2CDY A;  1F7Y A;  2Q69 A;  1S0V A;  1J5E B;  3ZMZ A;  2EJR A;  5EZY B;  1QHT A;  3T1C A;  4BR6 A;  1GK9 A;  3RT3 C;  4JI1 O;  2HP8 A;  5LGU A;  4UCV A;  1OCO C;  4IL6 Z;  5IY5 C;  2OCC C;  4ZBM A;  4KL1 A;  2JGD A;  1FFX B;  1KC8 W;  3PN1 A;  4IHJ A;  2R70 A;  5FPO A;  4F6R B;  3J7A U;  1K7D A;  4FLX A;  3UO3 A;  1D5A A;  1EZJ A;  1WA8 B;  4IHJ B;  5B1B B;  3WG7 B;  4LFC B;  1AJN A;  3RYI A;  5KMG A;  4O4L B;  3RYC A;  5D5Q A;  3BY6 A;  1SZX A;  1R6T A;  1GH6 A;  1GRJ A;  1NVP B;  2R9I A;  1JCH A;  3JD4 A;  4YIP A;  1ZUQ A;  2UXB O;  4DR7 O;  3B40 A;  3E2E A;  2EIJ B;  1ZX3 A;  2DYS C;  2EBO A;  3K0D A;  4H0L B;  1VQ6 V;  5JCO A;  5BR8 O;  5GON A;  4OPH A;  3ABK C;  2B5U A;  3WB2 A;  2E75 B;  4JI7 O;  4XDL A;  1AIL A;  1TUE B;  1SC5 B;  1PNL A;  3OUF A;  2A0L A;  2YIC A;  4GCZ A;  1UPG A;  4X1Y A;  1ROP A;  2N74 A;  2XOK G;  1RM1 C;  2WLK A;  4LFB B;  4JI7 B;  1D2D A;  1GKF A;  2F1M A;  4DV7 B;  1WB8 A;  2B1G A;  1N32 O;  2PYJ A;  3I56 V;  4X65 O;  1H2L A;  3OR7 C;  2YXY A;  3RVZ A;  1QR9 A;  2GTA A;  2ZE5 A;  5LGN A;  3T4D A;  2HHH B;  1VQN V;  1NTK H;  1GN4 A;  2MW2 B;  4RQE A;  4X65 B;  1N0J A;  3SJQ C;  4QNH B;  1KQS U;  2PYL A;  5CA1 B;  2UXD O;  3LDE A;  4BW5 A;  4JTC B;  2Y69 C;  3GWO A;  3H9V A;  3BPZ A;  4FFK A;  2UUC B;  1XEQ A;  3OTO O;  1TA8 A;  1BZK A;  2JJ2 G;  3KG2 A;  3N2K A;  4BIO A;  1XNR B;  4DV1 O;  1XMQ B;  1M5I A;  1OCZ B;  2XUM A;  4WFE A;  4X1I A;  4AHC A;  1WP8 A;  3L75 H;  3OTO B;  4LF8 O;  2W0X A;  3M7M X;  3CCE V;  4KHP B;  4R6Z A;  3BEH A;  3L72 H;  3APO A;  5LMN O;  1JFF B;  3BHP A;  2ZNJ A;  4DR3 O;  2HVJ C;  4LF8 B;  2ZNI A;  1K3E A;  4O2A B;  5GTH Z;  4GX2 A;  1GN6 A;  2Q6A A;  2CK3 G;  5J9P C;  4FM1 A;  5IJ0 B;  3K5M A;  1I7F A;  4UCO A;  4DR3 B;  1JA8 A;  4TV9 A;  1AP5 A;  2CTR A;  1JJO A;  5IY5 B;  1ARO P;  2XAQ A;  2YIB A;  3LNN A;  4JAS A;  3K58 A;  4TV9 B;  3ZIA G;  2LO1 A;  3KCX A;  1SET A;  1BQ0 A;  2CGN A;  4DUY O;  1YSC A;  3J81 N;  1SQG A;  1K8A W;  1AJP A;  4UCU A;  1MNG A;  4J10 A;  3QG5 A;  1YIT V;  4W4L A;  2WLH A;  1IBL O;  4QIW F;  4DW1 A;  4UCT A;  3OFN G;  5BZB A;  2DN9 A;  1Q82 W;  4ZHQ A;  4DR5 O;  1K5Q A;  2YXL A;  3KZI Z;  3WB0 A;  4DK1 A;  5EYP A;  2L6L A;  1FYJ A;  4DV0 O;  1WJZ A;  4JI5 O;  3ABK B;  5DEC A;  4JI4 B;  5CN0 A;  1S5J A;  2GUZ A;  1GN2 A;  3M8A A;  4JTD B;  4MVO A;  5EIB D;  5JJJ B;  1VQP V;  4EFE A;  1RM1 B;  2PY5 A;  4I9Q A;  4DV3 O;  4J7K A;  3JYC A;  4YY3 O;  1JPX A;  4J7Z A;  4DUZ B;  4DO2 A;  1R3K C;  2OIE A;  3OT7 A;  4JZ2 A;  4OX9 O;  2M7W A;  3JAL B;  5TIS Z;  2WA3 A;  1RSO B;  1BMF G;  3MDS A;  1GO3 F;  4ZI7 A;  4UB6 Z;  3BRC A;  2Y69 B;  1AR1 B;  2P6J A;  2R9A A;  1VQ5 V;  3TGU H;  3ZHS A;  4R8C A;  3HKE A;  1EM1 A;  5A2Q N;  1KEC A;  3ZCC A;  1N34 O;  2G38 A;  4B08 A;  1Y76 B;  3CME V;  2IJK A;  3ASN B;  4DV4 O;  4FLU A;  3RW0 A;  3G4S V;  4WFB V;  1XMO O;  1Z5V A;  1H2S B;  1KKC A;  2JS3 A;  3U11 A;  1HNZ B;  4ASU G;  2F95 B;  4G2K A;  4JI3 B;  4CBC A;  1MA1 A;  3P3P A;  1MG1 A;  1NI8 A;  3BAA A;  4MT8 A;  4ZOL B;  1XDC A;  4UB8 Z;  2ZE6 A;  3ETE A;  3FYE B;  3E22 A;  2IM9 A;  3PJS K;  3K04 A;  1OZ0 A;  1Z2G A;  1M93 A;  1B6Q A;  3E22 B;  4UVB A;  4D6T H;  4LNU A;  4DR1 B;  4UCR A;  5J2U B;  1LUV A;  3KKY A;  3RGB A;  2ADP A;  3BAB A;  3CEI A;  5EIB C;  3DGE A;  3D36 C;  1NQT A;  1QR8 A;  1WB7 A;  5B5E Z;  3ICX A;  1K33 A;  4KP4 A;  1TAE A;  4TOI A;  4GKJ B;  1SA0 A;  3RBZ A;  4I7Z B;  4IYI A;  3SYA A;  1S3J A;  4U3J B;  2QM4 A;  2A7W A;  2EIM B;  4L87 A;  4QE9 A;  3T1Y O;  3RYH A;  2XAH A;  3TXQ A;  3G6E V;  4K0K O;  2QDO A;  3FFQ A;  1M57 C;  1XOU A;  1YVW A;  4P2Z A;  4K35 A;  4NB5 A;  2DQ0 A;  5H2F Z;  5CMU A;  2QWR B;  4B3S O;  2K9P A;  5BMV B;  5AG2 A;  3GB7 C;  4A5U B;  4JYA B;  1IDS A;  4LR3 A;  2HJD A;  4PDM A;  4X64 B;  4UXN A;  2Y0P A;  2LGQ A;  2VWK A;  1XUQ A;  1HW7 A;  3CCJ V;  2ODM A;  3JAW A;  1QVG U;  3SPG A;  5L3D A;  1M56 B;  1SS3 A;  3AK2 A;  3P32 A;  4LF7 B;  4I9W A;  2UUB O;  4J11 A;  2JGU A;  4RUF A;  3HR0 A;  1VF6 C;  3STZ C;  2GSM B;  1WN7 A;  1H2G A;  1Y66 A;  4EB6 B;  3CCL V;  1NR7 A;  2QWQ B;  3X2Q B;  1P84 F;  1U97 A;  2EIK B;  4B3R O;  2WLI A;  3TK1 A;  3HKC A;  3T1H B;  3BVO A;  2X6B A;  2ZDI A;  4BWA A;  4YIO A;  4LP8 A;  2VQE O;  2IU0 A;  4LF4 O;  2W6J G;  2FYU H;  5IE9 A;  5C8Y A;  1H2K A;  4P30 A;  2JJ1 G;  4AQY B;  2ARH A;  4X9Q A;  5LP6 B;  2X7R B;  1SZT A;  3JCZ A;  5KX5 B;  1IBM B;  4FLY A;  1V9P A;  4D7S A;  3JAT A;  3AG3 C;  5KHI A;  2X0L A;  4DV5 O;  4JI6 O;  1K92 A;  2VS0 A;  1JR9 A;  4CH5 A;  1YJ9 V;  2ZIN A;  2A9H A;  4JV5 B;  1FFT B;  5DN6 G;  4JYC A;  3SPJ A;  1ZAU A;  1GM8 A;  3FB5 C;  3QO7 A;  4N21 A;  1OHH G;  3THO A;  3DSQ A;  2YIA A;  1BSM A;  3VQV A;  2UUA O;  4UCS A;  2ADQ B;  4O4I B;  5LBQ A;  1GAX A;  2OYQ A;  4DR2 O;  1YJN V;  4H37 A;  4IIJ B;  5LYJ A;  2F23 A;  1FPO A;  5CBF A;  2LW1 A;  2QR4 A;  5CA3 A;  4NTY A;  1FXK C;  1BQZ A;  5LOV B;  1ZLZ A;  1AI6 A;  3DXR B;  3Q4H A;  1PPJ H;  2KG7 A;  1KP3 A;  1SQP H;  5JCO C;  2ZT9 B;  4I4T A;  2AGA A;  3CD6 V;  3F7V C;  3QF7 A;  1THZ A;  1XL4 A;  1KYO F;  4FLZ A;  1QU7 A;  3JD1 A;  3SJA C;  2Q9L A;  3WU2 Z;  4CH3 A;  5LHG A;  2QKS A;  5EC1 C;  1MSW D;  2LP7 A;  5L3B A;  3K59 A;  2DW4 A;  4JAU A;  4WBN B;  1M57 B;  1WLE A;  4NTW A;  3E89 A;  3J80 N;  3OUS A;  4QGP A;  1DK1 A;  1YDX A;  4RQF A;  4B3T B;  5L3F A;  2DWD C;  4KUM A;  1AI4 A;  3E86 A;  3ABM C;  3ZRW A;  3ZMS A;  4O2B B;  4PDV A;  1RFY A;  4PEL A;  2UU9 O;  3B4S A;  1NTZ H;  1ENV A;  3DC5 A;  4D7T A;  3KCY A;  1NU1 H;  1F23 A;  3NXS A;  2EZP A;  1R3L C;  3APQ A;  4I55 B;  3ZHV A;  4JI0 B;  4DK0 A;  1AP6 A;  4HNA A;  1H8E G;  4NXM B;  2AHZ A;  4C7U A;  1SF9 A;  4X1K A;  1EN6 A;  5B1A C;  4G28 B;  3N2G B;  5EZY A;  1KD1 W;  4MVR A;  4B7K A;  2E74 B;  2UXC B;  3QNE A;  3JD0 A;  5IYB O;  4FVM A;  3CC2 V;  3U10 A;  1HNX O;  4B3M B;  4HBN A;  3A0R A;  1FFX A;  1W59 A;  1IBK O;  4FZ0 A;  4F6R A;  2Q7E A;  1JJ2 U;  3UQ8 A;  3E8B A;  4DXW A;  1WA8 A;  2B9Z A;  2H94 A;  4ZKI A;  3LNM B;  3R65 A;  4R50 A;  3SYO A;  4O4L A;  3CCR V;  3W7X A;  3SR2 C;  4JI1 B;  4CC5 A;  3A0B Z;  4DR4 O;  5IDJ A;  3LUT B;  2ZXW C;  3RN4 A;  4F4L A;  2HG5 C;  2RJZ A;  1OCR C;  4J80 A;  2OCH A;  3P30 A;  1JQ0 A;  4DR4 B;  1NR1 A;  3STL C;  5EK0 A;  1BHB A;  3C3S A;  2YI8 A;  4GYC B;  2PI4 A;  4U3F H;  2QM8 A;  3K9A A;  1CEZ A;  4JI8 O;  2UXB B;  4DR7 B;  1Y74 B;  4KXR A;  3HB3 B;  4TT3 G;  3EXA A;  1AR5 A;  4BW9 A;  2ZR3 A;  3CSX A;  4AI8 A;  5BR8 B;  5CBG A;  4JI8 B;  5ITZ B;  2DWE C;  3D3I A;  2Q7H A;  1BS3 A;  4L8J A;  3ZS8 C;  1YTF D;  4JYB A;  4G27 B;  1MOF A;  3M99 B;  2Z0A A;  2N05 A;  4YJ3 B;  3OEH G;  5IJ9 B;  1E79 G;  4WF9 V;  2GBO A;  5CA1 A;  3ETD A;  2HVK C;  1N32 B;  2P67 A;  3CXC U;  4DV2 O;  2YEV B;  4I50 B;  1AB3 A;  1PNM A;  1O9H A;  3L74 H;  3RYF B;  4F6E A;  4DV2 B;  4CH4 A;  3HKD A;  2WPD G;  2UXD B;  1ZTE A;  3CRC A;  5B3S C;  4PDR A;  4Z2W A;  2JEU A;  5KLV H;  3HKD B;  4BIZ A;  2HR3 A;  4I0X B;  3ZHT A;  1JFF A;  3W7S A;  4DV1 B;  1S72 V;  5B1A B;  3A8T A;  2E3C A;  1K73 W;  4O2A A;  1NS1 A;  1TVK B;  1NJI W;  3SPI A;  2PI5 A;  5IJ0 A;  3ABL C;  1Q6H A;  1BL8 A;  5BY1 A;  2DE0 X;  4NYK A;  2Q67 A;  3K5L A;  4OGQ B;  4ZIB A;  5LMN B;  1JX9 A;  2PUS A;  4EKW A;  3ZMV A;  1QVF U;  3K08 A;  4P9O A;  2Z5U A;  3CCQ V;  1B04 A;  2F4V O;  4J41 A;  2V4D A;  1OCO B;  4MSW C;  2OCC B;  4GX5 A;  1HP8 A;  4FM0 A;  2KB1 A;  1FJG O;  3L73 H;  4AIL C;  4GX1 A;  4PA6 A;  1SQB H;  3W7U A;  1VQM V;  2YXH A;  4IT5 A;  4HAM A;  4LWS B;  4DRX B;  4Q6G A;  5FLX N;  2P4K A;  2BTO A;  4DUY B;  4MTO A;  3E8H A;  1P49 A;  1R3J C;  1F51 A;  2QTO A;  2DYS B;  4CS2 A;  3R66 A;  3IGA C;  1IBL B;  4QPK A;  5K1X A;  3G6B A;  1QBZ A;  1VQO V;  3H1I H;  2D2C B;  3UT5 A;  1I5X A;  4DR5 B;  3JD2 A;  4DR6 O;  4PHZ A;  5C93 A;  2GTS A;  1PV0 A;  2EX3 A;  3S3W A;  3BCC H;  1UFI A;  4DV0 B;  2GHY A;  3UT5 B;  4JI5 B;  4B7E A;  3L71 H;  1VQ9 V;  5KHG A;  5JQG B;  2ZCE A;  2BOB C;  5BXZ A;  2OIG A;  2NNU A;  3JAL A;  4E4E A;  1RSO A;  3HKB B;  3CCM V;  3CCV V;  2VWJ A;  2DMX A;  2AHY A;  1G4Y B;  4DV3 B;  1IUR A;  2QGN A;  4YY3 B;  1R3I C;  1NT2 B;  2EIN C;  3UM7 A;  1GM9 A;  3CCU V;  1N36 O;  1DLB A;  3FD9 A;  3FAV B;  3T4Z A;  3B2E E;  4HYO A;  4MTX A;  4OX9 B;  2JIZ G;  3B8M A;  2F66 C;  5A9G A;  3CMA V;  3K9S A;  3CPW U;  3E83 A;  2NN4 A;  2QE7 G;  1XHZ A;  1YZB A;  3K5O A;  2ZE7 A;  1Y76 A;  1Y4M A;  1YEW A;  2QA4 V;  1PL4 A;  2WA4 A;  5B3S B;  2P22 C;  4LBE C;  3ABU A;  1VQL V;  3E8F A;  4Z1V A;  1XBL A;  5L3E A;  5J2T B;  1HR0 O;  1N34 B;  4HZ3 A;  3B77 A;  4LH7 A;  4UVC A;  3OMI B;  4ZOL A;  4GKK O;  5IYD O;  3DTU B;  2PGG A;  5LMU O;  3FKS G;  4X62 O;  3ABL B;  4WFH A;  4DV4 B;  2P4V A;  4Z1M G;  1GM7 A;  2M6Y A;  1L1F A;  3ZN0 A;  4LH6 A;  3ZX6 A;  2Y4T A;  1XMO B;  1XL6 A;  4FLT A;  4LF6 O;  4IGG A;  1UJW B;  3CRQ A;  1AI7 A;  4GKK B;  1SES A;  2RQ6 A;  4YJ2 B;  2XHB A;  5J2U A;  4GZR B;  5CA0 B;  3SYP A;  3JAK B;  2W6I G;  5IYZ B;  1SQQ H;  1FXH A;  4LF6 B;  1QLN A;  2CUG A;  3VOU A;  5KHJ A;  1N0N A;  5DED A;  4U3J A;  1L8D A;  1YTF B;  1ZL8 A;  4JPR A;  3CC4 V;  1G8M A;  4BIU A;  1XNQ O;  4FLW A;  1ZL8 B;  3H1H H;  2CAZ C;  3HPL C;  1Z5W A;  3IC7 A;  4N23 A;  5H9C A;  1AJQ A;  5B66 Z;  4CZZ A;  5E1A C;  5BMV A;  1CPY A;  4CS3 A;  2Z3Y A;  4CC6 A;  2ITD C;  3T1Y B;  1R1B A;  1VQ4 V;  4K0K B;  2BTQ B;  3L9D A;  3H1L H;  5KHH A;  1DGS A;  1YJW V;  2CTP A;  4X89 A;  3AG4 C;  4MS2 A;  3ZRX A;  4MVQ A;  3GWK C;  4B3S B;  4WFF A;  3MHH C;  4TSF G;  1OCC C;  5LXT B;  3JAM N;  1TGO A;  3TJT A;  2XT9 A;  4EB6 A;  3TXS A;  4PA3 A;  2F93 B;  4QJF B;  4WCE V;  4H44 B;  1WP7 A;  1B06 A;  1N4C A;  2BSK B;  4UV8 A;  4DV6 O;  5IT9 N;  4TV8 B;  1WNS A;  1DF4 A;  2ZM6 O;  4PD4 F;  1F4M A;  2UUB B;  2YUA A;  3OW2 U;  2HLD G;  2F43 G;  4XDK A;  1N8R W;  3GVM A;  3OR6 C;  4QE7 A;  3VQW A;  3L70 H;  2BCC H;  2P7T C;  5LP6 A;  3JD3 A;  5KX5 A;  4FFB B;  1US6 A;  4B3R B;  2QWO B;  1EFR G;  5K1P A;  2VQE B;  4X20 B;  1I0H A;  4JF3 A;  4LF4 B;  1FXV A;  3D3Q A;  2AXT Z;  5JH7 B;  4FK5 C;  4JI2 O;  2EIL C;  3ZED A;  1BGY H;  1R73 A;  3AEI A;  4MVM A;  1IX9 A;  1YIJ V;  2HKO A;  2XAJ A;  2RN9 A;  2Y0I A;  3ASO C;  3WG7 C;  4O4I A;  5B1B C;  5H6Q A;  3K06 A;  4DV5 B;  4JI6 B;  3K57 A;  1LR1 A;  3OM3 B;  5HFM A;  2D3O W;  4JI2 B;  3EVK A;  4IIJ A;  1H2N A;  3QVN A;  4LF5 O;  3K3W A;  1Y67 A;  4TUY B;  4RAI A;  2JEX A;  2YID A;  4LFA O;  4MW3 A;  5LOV A;  1NTM H;  3DXR A;  1G6U A;  1FAF A;  2UUA B;  2JRI A;  4UVA A;  3D36 A;  4DR2 B;  2H3O A;  4OXS A;  1QNM A;  2EJ7 A;  1WAZ A;  4GLX A;  1QCE A;  3ABT A;  4YHH O;  4U7N A;  5KUK A;  3ZHU A;  2JVD A;  5FPR A;  2ZD9 A;  3MHS C;  3WB1 A;  1I94 O;  5EBL C;  1FKA O;  1XIL A;  2YIB D;  3ZHQ A;  2GV9 A;  3ETQ A;  1VIB A;  2VQF O;  4YXW G;  2YS8 A;  4MTF A;  3CRM A;  4WBN A;  2DYR C;  1W2B U;  5LA6 B;  3BA9 A;  1S76 D;  3OD4 A;  1VEW A;  1W0J G;  2WLL B;  1YHQ V;  4GUN A;  1TUB B;  3C90 A;  3F7Y C;  1ORQ C;  4O4H A;  4O2B A;  1FS0 G;  1I5Y A;  1MZF A;  1V55 C;  4FMT A;  3D8C A;  1VMG A;  4O4H B;  3ZJZ A;  1MAB G;  4I55 A;  3FX7 A;  5CB4 B;  1FD9 A;  4TQF A;  2XAS A;  1NH2 D;  1M9N A;  2R9R B;  3FB7 C;  4H13 B;  5EBW C;  4NXN O;  1X59 A;  4GX0 A;  5JVD B;  1W0K G;  3N2G A;  1OJH A;  2UU9 B;  1VF6 A;  2OTL V;  1PD3 A;  3QTC A;  3JAR B;  4WFA V;  4PJ0 Z;  2CTQ A;  3K5N A; 
#chains in the Genus database with same CATH homology
 2HR3 A;  2WLJ A;  2Y69 B;  3OMA B;  1AR1 B;  3W7W A;  2HJF C;  2P6J A;  1VQ5 V;  3SYQ A;  4KFM A;  4JAV A;  3ZMU A;  4R8C A;  1DF5 A;  2QM7 A;  3E35 A;  3W7S A;  1KEC A;  1K9M W;  4UUJ C;  3ZCC A;  1S72 V;  5B1A B;  1PL0 A;  2FTK A;  4UV9 A;  1K73 W;  5LHI A;  1V54 B;  3SYC A;  3LSQ A;  2XND G;  1NJI W;  2V1D A;  3SPH A;  3CME V;  2IJK A;  2NLJ C;  3SPI A;  2PI5 A;  3OAA G;  1J95 A;  3ABL C;  1BL8 A;  3G71 V;  5LGT A;  1GMG A;  3CYO A;  1VQK V;  2WLI B;  2OTJ V;  5L3G A;  2Q67 A;  4WFG A;  2B1I A;  3ASN B;  3OGC C;  1JX9 A;  5DM6 V;  4EKW A;  3RW0 A;  3G4S V;  4XBF A;  3ZMV A;  3K08 A;  4WFB V;  1QVF U;  4P9O A;  2Z5U A;  3CCQ V;  4R7C A;  4MW8 A;  4PA9 A;  4QPJ A;  4PA7 A;  4ASU G;  1OCO B;  4MTG A;  4MSW C;  4G2K A;  3AG3 B;  4CBC A;  2OCC B;  4GX5 A;  2KB1 A;  1MG1 A;  4MT8 A;  3LDD A;  2EIL B;  3ZMT A;  3FB6 C;  5H6R A;  3ETE A;  1LNQ A;  1KP2 A;  3FYE B;  5KUM A;  4JTA B;  4GX1 A;  4PA6 A;  3PJS K;  2BOC C;  3K04 A;  4XDJ A;  3W7U A;  1OZ0 A;  1VQM V;  3ASO B;  2HFE C;  1B6Q A;  2WWW A;  4UVB A;  2EIJ C;  3AG1 C;  4HAM A;  4Q20 A;  3EHB B;  2YSU B;  3OMN B;  1M90 W;  3ETG A;  1FXK A;  3VBB A;  4MTO A;  3DGE A;  3E8H A;  1YI2 V;  4TWK A;  1NQT A;  1QR8 A;  2Y48 A;  1R3J C;  1F51 A;  2QTO A;  1FXK B;  1K33 A;  2DYS B;  4J9Z B;  4KP4 A;  2EZO A;  5CBH A;  3IGA C;  4QPK A;  3RBZ A;  2JDI G;  3SYA A;  1S3J A;  1QBZ A;  2IU3 A;  1VQO V;  4L87 A;  2ZR2 A;  2EIM B;  2WLL A;  4JGS A;  4QE9 A;  1I5X A;  1QLE C;  3JD2 A;  2XAH A;  1K97 A;  5C93 A;  1K4C C;  2LFR A;  5KA5 A;  3G6E V;  1E1Q G;  4P9P A;  1BHA A;  5KA6 A;  3W7T A;  2GHY A;  1DTO A;  5B1O A;  1COW G;  1F4N A;  1M57 C;  4PDL A;  3B8N A;  4P2Z A;  5HFL A;  1VQ9 V;  2YEV A;  3ZRS A;  2DQ0 A;  5CMU A;  2BOB C;  3QO8 A;  4MVZ A;  2X6A A;  2DYR B;  1WPX A;  3K79 A;  4RO2 A;  4FPP A;  1IXM A;  2NNU A;  1PNK A;  3GB7 C;  4MVS A;  1K34 A;  3CCM V;  3CCV V;  2AHY A;  4PDM A;  4H33 A;  3AG4 B;  2WSS G;  1G4Y B;  4UXN A;  3AG2 C;  1SRY A;  2LFS A;  1R3I C;  1OCC B;  2EIN C;  3UM7 A;  1GM9 A;  3CCU V;  1PKX A;  3CCJ V;  1QVG U;  1DLB A;  2WLM A;  3SPG A;  1H38 A;  2P90 A;  1V55 B;  5L3D A;  1M56 B;  3T4Z A;  3ABM B;  4HYO A;  3P32 A;  4MTX A;  4BAY A;  4PA4 A;  4I9W A;  1K5S A;  2C2A A;  2JIZ G;  3B8M A;  3F5W C;  4E2L A;  3CMA V;  2UXX A;  4RUF A;  2X6C A;  1AI5 A;  1OCZ C;  3OEE G;  3ZRW B;  2H8P C;  3STZ C;  3CPW U;  2GSM B;  3E83 A;  3FB8 C;  2QE7 G;  1H2G A;  1Y66 A;  3SPC A;  3CCL V;  1Y4M A;  1GTO A;  2QA4 V;  1NR7 A;  2IJJ A;  5B3S B;  3X2Q B;  4LBE C;  2EIK B;  2WLI A;  3TK1 A;  3ABU A;  3LDC A;  1RPO A;  1VQL V;  2X6B A;  1NKD A;  1EBO A;  2ZDI A;  3E8F A;  4LP8 A;  5L3E A;  2Q69 A;  1S0V A;  2IU0 A;  3E8G A;  2W6J G;  3ZMZ A;  2EJR A;  3T2M A;  4HZ3 A;  3B77 A;  3T1C A;  4P30 A;  2JJ1 G;  3ASN C;  1GK9 A;  5EC2 C;  4X8A A;  2X7R B;  5L3C A;  1SZT A;  4UVC A;  3OMI B;  3ZN1 A;  3RVY A;  3JCZ A;  5LGU A;  1OCO C;  5IYD O;  3DTU B;  5IY5 C;  3FKS G;  3AG3 C;  2OCC C;  2X0L A;  3ABL B;  4ZBM A;  3UKM A;  4WFH A;  4Z1M G;  1GM7 A;  1K92 A;  2ITC C;  1L1F A;  1KC8 W;  3ZN0 A;  3LSS A;  1XL6 A;  1YJ9 V;  1K7D A;  2A9H A;  1UJW B;  1EZJ A;  1FFT B;  1AI7 A;  3WG7 B;  5DN6 G;  1SES A;  4JYC A;  5B1B B;  1AJN A;  3SPJ A;  1GM8 A;  4LC1 A;  3FB5 C;  3SYP A;  2QEX V;  3QO7 A;  4N21 A;  3I55 V;  2ZXW B;  2W6I G;  3ML0 A;  1OHH G;  2K1E A;  3BY6 A;  1FXH A;  1OCR B;  5LBQ A;  1NVP B;  1YJN V;  2R9I A;  1JCH A;  4H37 A;  1QLN A;  3JD4 A;  3VOU A;  5CBF A;  2ZQM A;  3E2E A;  2WLN A;  5CA3 A;  4X88 A;  2EIJ B;  1FXK C;  3AG1 B;  2DYS C;  2EBO A;  3K0D A;  1YTF B;  1VQ6 V;  4JPR A;  3CC4 V;  1G8M A;  1AI6 A;  4BIU A;  3ABK C;  2B5U A;  2IJH A;  4XDL A;  2IW5 A;  2EIM C;  1TUE B;  3HPL C;  1KP3 A;  4J9Y B;  1PNL A;  2WAM A;  3IC7 A;  3OUF A;  2A0L A;  4N23 A;  5H9C A;  1AJQ A;  4GCZ A;  4RUE A;  4CZZ A;  5E1A C;  2DQ3 A;  3WFV A;  3CD6 V;  1R6K A;  3F7V C;  1ROP A;  3IFX A;  1CPY A;  1THZ A;  1XL4 A;  5FL7 G;  2XOK G;  2Z3Y A;  1RM1 C;  2WLK A;  1JVM A;  2ITD C;  2IH3 C;  3JD1 A;  5B1N A;  1SER A;  1VQ4 V;  1GKF A;  1NH2 B;  5LHG A;  1QLE B;  2QKS A;  5EC1 C;  1MSW D;  2LP7 A;  2B1G A;  3I56 V;  2XAF A;  5L3B A;  3OR7 C;  3RVZ A;  2DW4 A;  1QR9 A;  4JAU A;  1YJW V;  1M57 B;  1WLE A;  4X89 A;  3AG4 C;  3E89 A;  1H8H G;  4MS2 A;  3ZRX A;  5LGN A;  3T4D A;  3OUS A;  3TET A;  4MVQ A;  1VQN V;  4WFF A;  4RQF A;  3MHH C;  4TSF G;  1CP9 A;  1OCC C;  5L3F A;  1ZWI C;  4RQE A;  2DWD C;  4KUM A;  1AI4 A;  3E86 A;  3SJQ C;  1M56 C;  4QNH B;  3ABM C;  1KQS U;  3ZRW A;  3ZMS A;  4PDV A;  3CC7 V;  4PEL A;  2XAG A;  3LDE A;  1ENV A;  3AG2 B;  4BW5 A;  4JTC B;  2Y69 C;  4PA3 A;  4QJF B;  1P7B A;  1F23 A;  3NXS A;  4WCE V;  2EZP A;  1R3L C;  1Q7Y W;  3GWO A;  4UV8 A;  1DF4 A;  1H8E G;  1F4M A;  2AHZ A;  3OW2 U;  2HLD G;  2JJ2 G;  3KG2 A;  3QO5 A;  2F43 G;  4XDK A;  5B1A C;  3X2Q C;  1Q86 W;  1N8R W;  4G28 B;  2IJI A;  3OR6 C;  1KD1 W;  4QE7 A;  2EIK C;  1V54 C;  3CCS V;  4MVR A;  1OCZ B;  2P7T C;  3QNE A;  4WFE A;  3JD0 A;  5IYB O;  3CC2 V;  3JD3 A;  4MVU A;  2ZDI C;  3CCE V;  4R6Z A;  3BEH A;  2A79 B;  3FYI B;  1EFR G;  3A0R A;  3EFF K;  4JF3 A;  1FXV A;  2ATK C;  3ZRV A;  3CP1 A;  2HVJ C;  1S77 D;  1K3E A;  1JJ2 U;  4FK5 C;  3E8B A;  2EIL C;  4DXW A;  4GX2 A;  2H94 A;  4ZKI A;  1VQ7 V;  2Q6A A;  2CK3 G;  3LNM B;  3R65 A;  4R50 A;  1R73 A;  3SYO A;  5J9P C;  3W7X A;  3CCR V;  3AEI A;  4MVM A;  1YIJ V;  4FIP C;  4FJC C;  4LCU C;  5GW7 A;  2HKO A;  2XAJ A;  3ASO C;  3WG7 C;  5H6Q A;  5B1B C;  3K06 A;  5IDJ A;  3OM3 B;  5HFM A;  5IY5 B;  1R6N A;  3LUT B;  2ZXW C;  2D3O W;  1ARO P;  2V7Q G;  2XAQ A;  4F4L A;  4JAS A;  2HG5 C;  5IYC O;  5EBM C;  1Q81 W;  3ZIA G;  1OCR C;  3P30 A;  3K3W A;  1JQ0 A;  4RAI A;  1SET A;  2JEX A;  1K4D C;  4MW3 A;  1NR1 A;  3STL C;  5EK0 A;  1BHB A;  1YSC A;  4GT1 A;  4UVA A;  1K8A W;  2PI4 A;  1AJP A;  3D36 A;  4I5S A;  2QM8 A;  3K9A A;  4OXS A;  1CEZ A;  1YIT V;  2WLH A;  4QIW F;  3OFN G;  1QCE A;  3OE7 G;  5BZB A;  3ABT A;  3HB3 B;  4TT3 G;  4U7N A;  5KUK A;  1Q82 W;  1K5Q A;  2ZR3 A;  1NVP D;  2ZD9 A;  3MHS C;  5EBL C;  3K03 A;  5CBG A;  5LHH A;  2DWE C;  4YXW G;  3D3I A;  3ABK B;  4MTF A;  2DYR C;  5CN0 A;  3TCU A;  1W2B U;  1P4R A;  1YTF D;  4JYB A;  4G27 B;  1MOF A;  3M99 B;  4JTD B;  1S76 D;  1JOY A;  1W0J G;  2WLL B;  4MVO A;  1YHQ V;  1VQP V;  3OEH G;  2MK3 A;  1E1R G;  1RM1 B;  3F7Y C;  1E79 G;  3JYC A;  4WF9 V;  1VQ8 V;  1ORQ C;  1RPR A;  2Q68 A;  3ETD A;  2HVK C;  1JPX A;  2P67 A;  1FS0 G;  2OT5 A;  3CXC U;  2JK5 C;  1I5Y A;  1V55 C;  4FMT A;  2YEV B;  4DO2 A;  1HWY A;  3ZJZ A;  1PNM A;  1R3K C;  1MAB G;  2XAS A;  2M7W A;  1NH2 D;  1M9N A;  2R9R B;  3FB7 C;  2IH1 C;  1BMF G;  1NBM G;  2EIN B;  5EBW C;  4GX0 A;  3H01 A;  1W0K G;  2W0F C;  2WPD G;  1GO3 F;  3K0G A;  5B3S C;  4PDR A;  2OTL V;  1PD3 A;  1M1K W;  2JEU A;  4WFA V;  1S5H C;  2UXN A;  1KKD A;  4BIZ A;  4U7O A;  3MD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...