4PA9A

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa9A00
1OCOC 2ZXWC 4QNHB 4MVZA 3LDEA 2WLHA 2Q67A 2K1EA 3LDDA 3RVYA 3SPJA 2WLLA 3E89A 2DYSC 3SYOA 3UKMA 4DXWA 4GX1A 2EIMC 2OCCC 4P2ZA 4UUJC 4JTDB 2EIJC 4PDLA 2YEVA 1OCCC 3SPIA 2H8PC 1XL4A 4JTAB 4G27B 2Q68A 4H33A 1V55C 2X6CA 5B1BC 3RVZA 5J9PC 3GB7C 4BW5A 2QKSA 4F4LA 4CBCA 3T4DA 5E1AC 4P9OA 1M56C 5B1AC 3TCUA 2KB1A 1S5HC 2AHYA 3FB5C 4I9WA 2JK5C 2R9RB 4EKWA 1XL6A 2DYRC 2Q69A 3F7YC 4MVMA 4MW3A 2ATKC 4XDJA 2QTOA 2HJFC 3PJSK 4MW8A 2WLMA 3ASNC 3LUTB 1ZWIC 4MVRA 4MTGA 4PA3A 4X8AA 3RW0A 4J9YB 3E8BA 5CBFA 4R50A 5IY5C 4GX5A 3SYCA 3E83A 2WLIB 2DWDC 4QE7A 5CBHA 1KKDA 1G4YB 4WFFA 1ORQC 3VOUA 1OCZC 2BOBC 4WFHA 3AG1C 3E8HA 3KG2A 2WLJA 2WLLB 4LBEC 4PA7A 5EK0A 2ZD9A 3AG2C 3ABLC 2X6BA 3IGAC 4LP8A 3ABKC 3FB6C 3T4ZA 3OR6C 4MVUA 1J95A 2AHZA 4KFMA 4X88A 3STZC 2ITDC 3LNMB 4R6ZA 2EILC 3AG3C 4MVQA 2WLKA 5EC2C 2IH1C 3WG7C 3BEHA 1OCRC 5EBLC 2P7TC 3K08A 1BL8A 4RAIA 5EBWC 2Q6AA 3EFFK 4R8CA 3SPGA 5KUKA 3OR7C 3F5WC 2HVJC 1M57C 4WFEA 2HVKC 4RUFA 3RBZA 3K0GA 3ZRSA 5CBGA 4X89A 3HPLC 3E8FA 3SPCA 3T1CA 4PDVA 1R3LC 4RO2A 4QE9A 4P30A 4RUEA 4R7CA 3E8GA 1LNQA 3FB7C 3FB8C 4WFGA 3OUSA 5KUMA 2EIKC 4J9ZB 4MS2A 5EC1C 1R3IC 2BOCC 1K4DC 4PA9A 3K03A 2HG5C 3K0DA 4MVSA 4P9PA 4PDRA 3JYCA 2HFEC 2NLJC 4MTOA 4G28B 4TWKA 3SYPA 2X6AA 3F7VC 1R3JC 4MVOA 4XDLA 3R65A 3SJQC 3ABMC 3K04A 3UM7A 5EBMC 2A79B 4HZ3A 3STLC 2ITCC 4MTFA 4PDMA 1QLEC 4LCUC 3SPHA 3SYAA 4GX0A 1K4CC 4H37A 4PA6A 3TETA 3SYQA 1V54C 3X2QC 4ZBMA 5BZBA 1P7BA 4OXSA 3OUFA 3T2MA 2W0FC 1R3KC 3AG4C 4MSWC 2Y69C 2A9HA 3LDCA 3ZJZA 5B3SC 4JTCB 1JVMA 2A0LA 4XDKA 3OGCC 3E86A 4GX2A 2DWEC 2IH3C 2WLNA 4HYOA 2WLIA 3ASOC 3IFXA 3K06A 2EINC 4PA4A
chains in the Genus database with same CATH superfamily
4BIZA 5LMNO 1ZSPA 4DXWA 4DV5B 2DJVA 4UUJC 2EIJC 4UCSA 1PL0A 4DUZO 3JD1A 1S5LZ 2H8PC 1V55C 5IJ0B 4LF6B 3WU2Z 4J7JA 3K5LA 3APOA 1PNMA 1WN7A 4UV8A 1H2SB 2QTOA 4WFBV 4JI7B 4IHJA 5CBFA 4ICGA 3E8BA 1NBMG 2KSDA 3BFRA 1BHBA 2RQ6A 4WF9V 1YIJV 4ASUG 2ZKOA 1GM9A 2ZIOA 3DC5A 1N33O 4K8XA 2WA3A 2UUAB 2CGOA 2OTLV 3C3TA 3R66A 2QA4V 3Q4HB 2JEUA 2WLKA 4LF8O 2IJIA 2UXDB 1NU1H 5K1PA 3L71H 4H44B 1I5YA 3DSQA 2EIKC 5CA3A 3K03A 3MD0A 1AI4A 3J7AU 1OHHG 1HP8A 1RM1B 3G4SV 3VQWA 3K04A 4NR1A 5GONB 2QWOB 4UCUA 1K5SA 4F6RA 2DYRB 4WFAV 3CEIA 3OEEG 1YJ9V 1M90W 3SYAA 5J2TB 3CXHF 4CC6A 4J42A 4LFCB 3CWBH 3HKCA 3TETA 1VQ4V 1BMFG 4JAUA 3OMAB 4U3FH 3SJCC 3W7WA 5LYJB 1NTZH 3LDCA 3CP1A 2QTSA 3G67A 2JJ2G 4LF7B 2WLNA 4PA4A 3NR7A 4B3RO 3BABA 3RYIA 2Q67A 4JAAA 4IL6Z 3E89A 3A2FA 2DYSC 4JI8B 4PI2A 4DR6B 1AI7A 4QPKA 4LFAO 5D5QA 4PV1B 1R6TA 2X6CA 3CMEV 4UCRA 4GKKO 4CBCA 1YI2V 1B04A 4P9OA 5KUKA 1P4RA 2GHYA 4B3MB 1Q81W 1FFXB 4YHHB 1BZKA 1GN3A 1ZWIC 3VQVA 4X8AA 3B09A 2PF4E 5B5EZ 2ZE7A 3ASOB 4QE7A 3LSQA 4DK1A 3JALA 3E8HA 2YIAA 2VQFO 1IDSA 1XNQO 1YTFB 4DR4O 2RDCA 3FB6C 2YEVB 1YZBA 1NTMH 2DQ0A 3AG3C 4CS4A 2AZ2A 2QWNB 4I50A 2GTSA 1OCRC 4DR5B 1FXHA 4RUFA 5A2QN 5KAIZ 2ZXWB 2QE7G 4DUYO 4NXMO 3N27A 4U3JB 1XILA 4P30A 2KG7A 1NT2B 4JYBA 1KKCA 4O4IB 4PDRA 5L3EA 1KU9A 1NH2B 1U96A 1JMKC 4DO2A 1SQXH 1WA8B 5FLXN 2YIBD 1M56B 1T5EA 5IY5B 4PI0A 3ZMZA 2ITCC 4I0XA 4DV2O 1FXKA 2CTRA 1HNZB 2OIGA 4A5UB 4DV0B 1NJIW 2GUZA 1WPXA 3FFQA 2HLDG 3L72H 2DW4A 3AG4C 4NXNO 4RWUA 3ABUA 4JTCB 1A32A 2ZT9B 3BCCH 3OGCC 2WLIA 3IFXA 1Q90D 5JJNB 1ZX3A 4EFEA 2EIMC 4JTDB 2NR5A 3A0HZ 4FZ1A 4GT1A 2FL4A 4JI6B 5CA1B 1YDXA 4DV6O 1KECA 1N0NA 3JD0A 4LC1A 3RVZA 4F4LA 4JYAB 4O4HA 1H8HG 1TGOA 5B1AC 4OX9O 5EYPA 2Q69A 1VEWA 1ZLZA 4JI4O 3PJSK 1NI8A 2OCHA 4F6EA 2CE4A 3AK1A 2E3CA 1S77D 4DK0A 4WFFA 3VOUA 5KHKA 2VQEO 3DXRA 2AXTZ 3W7UA 1DF5A 1H2GA 1M93A 1SQVH 5LP6C 1XBLA 2LJ2A 4NB5A 3G6BA 2LGWA 5KLVH 4D7TA 4R8CA 3S3WA 4I4TA 4LFBB 1K3EA 3BHPA 1I94O 4IHJB 1H38A 1GN4A 1W59A 1YSCA 2HHHB 1VIBA 3L73H 2LQTA 1OCCB 1EM1A 4O2AA 1SETA 3ZN0A 5KHHA 5KHGA 3H1JH 4XDLA 3CD6V 3P3PA 2JIZG 3EHBB 3STLC 3SPHA 1J5EO 2MW2B 1F7YA 1M57B 1F4MA 4JZ2A 1GKFA 1QU7A 3DTUB 1WP7A 2QR4A 1VP7A 2YI9A 3KCYA 4RQFA 2HEPA 4GX2A 4UCVA 1GTOA 1SQFA 2EJRA 3JD2A 1OCOC 1SZTA 3LDEA 3RVYA 1GM7A 4JI3B 1DGSA 4JI1O 4F6RB 2OWOA 1VQ7V 2ZE6A 5CA0A 1AROP 4J7KA 5FNVB 3HKCB 3TCUA 3ZCCA 3OM3B 5JH7A 2EJ7A 5BR8B 3LSUA 1ORQC 3RYIB 3K58A 2ZE5A 4JV5B 5LBQA 1OV9A 1H2MA 3IGAC 3QO7A 2A7WA 2ADPA 3M7MX 3H1LH 5JQGA 2AHZA 1XNQB 1G6UA 1GRJA 3JSNA 4DYLA 2GV9A 1N0JA 2FB5A 4DRXA 1UFIA 1P84F 2HVKC 1IXBA 2UXBO 1K9MW 4JZGA 4CC5A 2YIDA 3OUSA 3JALB 1K92A 1I08A 5IE9A 2HFEC 2ZE8A 3ABKB 2X6AA 4PELA 5IWAO 4IGGA 1WB8A 2HR3A 1CPYA 1Q43A 4I50B 2IW5A 2OIEA 3SJBC 1QCEA 4Q20A 2IU0A 3ZJZA 1XREA 4FLUA 2ARHA 2KG7B 2Z3YA 5KA6A 4QNHB 2K1EA 4I9QA 2EILB 1N36B 3JAKA 4KL1A 3ZHUA 3W7TA 3ZMUA 3G71V 3H1HH 4B3TB 4I0XB 1FXKB 5F2VO 4FJCC 4FZ0A 4Q6GA 2C2AA 1ZAUA 1S5HC 2AHYA 4EKWA 1O9HA 4J11A 4X1IA 2IBZH 2D2CB 2NN4A 4DV3O 1BE3H 3HR0A 2PYLA 4DR2O 2WLIB 4QPJA 1G4YB 1OCZC 1Q86W 4OX9B 4WFHA 1XQ8A 2ZINA 1FJGO 4PHZA 3ABLC 3MDSA 1AP6A 1K33A 4LP8A 5BXZA 4QGPA 1MNGA 5B1OA 4FLWA 4Z2WA 2XOKG 1V55B 5B1NA 5LP6A 3UQ8A 1GAXA 2IH1C 3IAYA 4O4HB 2CGNA 4KP4A 4YY3O 3QVNA 1BCCH 5EYPB 1QNMA 2HVJC 4W4KA 1Y66A 4YJ3A 3UT5A 1HR0B 3BA8A 3HPLC 2WWWA 5JJJB 3B8MA 4DR3B 1K34A 4FLYA 3B8NA 3ZEDA 3DXRB 5TISZ 1NKDA 2PY5A 4BIOA 1PNLA 1IVSA 3JD4A 4AILC 3VQXA 3JCZA 3ETEA 2E75B 1QLEC 1HWYA 4B3SO 3LNNA 2XT9A 3ASNB 2CTWA 3FKSG 5DN6G 1ZTEA 3ICXA 4I4TB 4HNAA 3BAAA 4AI8A 1J5EB 1FKAO 1AR4A 3OEHG 1NVPD 2YICA 3E35A 1N4CA 4ZHQA 2PZSA 5LMUO 1XOUA 2DE0X 2WLHA 4O2AB 3J81N 2KKWA 2WLLA 4GX1A 5J2UA 1XI1A 4X1YA 3OTOO 2QEXV 3OFNG 1QVGU 4AQYO 1VQNV 3RYCA 3TJTA 4J7ZA 2V7QG 4DR1O 3A0BZ 1SESA 4I9WA 1XL6A 4MW3A 2XHBA 4I55A 4BR6A 4IIJA 2F4VO 4MVRA 1PKXA 4J9YB 4JI0B 3E83A 2DWDC 1SQQH 3D3IA 4CH6A 2JS3A 2FMLA 2P22C 4LF4O 1N34O 1BS3A 2PTMA 2P06A 3WFVA 4JGSA 3B2EE 3OAAG 3ZRWA 4UVBA 5H9CA 1EFRG 2PGGA 3K5NA 5CA0B 1CP9A 2QKCA 3WG7C 5EBLC 4ZI7A 3BRCA 1SERA 1LUWA 1Y4MA 2A06H 5JH7B 3K57A 3SPCA 3D3QA 1R3LC 1THZA 1VQMV 1LNQA 3CCJV 1UPGA 4P9PA 3JD3A 4QIWF 4TWKA 3ZRVA 2P6JA 5JQGB 3RYHB 4HZ3A 3AG3B 1OCRB 2Y4TA 2PUSA 1K73W 4UCOA 4DRXB 4OXSA 3ZX6A 2G38A 1HW7A 4MSWC 4I7ZB 2XAQA 3AG1B 3JARA 2VWKA 2LO1A 1EN4A 5KAFZ 2ETNA 3QO8A 4FM1A 5B66Z 3U11A 2E74B 4EEQA 4HBNA 5L3FA 1FFTB 2OCCC 2P67A 3W7XA 4B7KA 2NNUA 1JJ2U 2E76B 1MZEA 5J9PC 2PI4A 2Y4UA 3QG5A 3FX7A 4HAMA 4DV1O 5E1AC 4D7SA 3T1YB 1G8MA 2XAJA 3AG4B 4OPHA 3I56V 3F7YC 3BA9A 2HJFC 2XUMA 3LUTB 4TT3G 4ABMA 4PA3A 2F66C 4R50A 3GWKC 4U7NA 3G6EV 2R9AA 1BGYH 5C8YA 4DV3B 5L3BA 2EIMB 2L35A 1PPJH 3AG2C 2JGUA 4X20A 3JAKB 2Q73A 2ZR2A 3CCLV 4K0KO 4CS2A 4MVUA 2UU9B 2X7RB 3CCQV 3K59A 2Y69B 3MHSC 3WB0A 5B1AB 1IBLB 1MA1A 2HP8A 2WSSG 1E1RG 4X1IB 2H3OA 3UO3A 3I55V 4DV4O 4X66B 2W0XA 1R73A 1B3QA 4R7CA 1Y76A 5AG2A 4J9ZB 4MS2A 4YY3B 1IBKO 3TXSA 2QGNA 4RQEA 1VF6C 4N23A 4NTXA 2NLJC 1VF5B 3SYPA 2QSAA 1WLEA 1PP9H 5IYZA 2D3OW 5CN0A 5KHJA 5L3GA 4LNUA 4DR7O 4TQFA 3SYQA 4YJ3B 3UT5B 3N2KA 1JJOA 2KQXA 1HNXO 1IBMO 2CAZC 4B3SB 3T1HO 2IH3C 1M4UA 2ZIMA 1UJWB 3ZHQA 2ZDIC 1KBHA 1RPOA 1QQCA 2LP7A 3LDDA 3SPJA 3RYFA 5LGTA 4NVPA 1Z5WA 1ENVA 2BCCH 2HJDA 2OYQA 1Q6UA 1E79G 1XL4A 5LMUB 4JI5B 3GB7C 3ZHVA 5JJEB 4FLTA 2JK5C 1KMIZ 2DYRC 4HNAB 1KUQA 4XDJA 4N21A 5C93A 2QWQB 3RW0A 4KHPO 5D5PA 4ZHQB 1AJQA 2Y48A 1OCOB 5CBHA 2CTPA 1S0VA 1URFA 2F95B 1NTKH 2WLLB 4PA7A 2UUBO 4JF3A 5J2UB 3DGEA 3CX5F 3ZBHA 1WPBA 3OR6C 1SQGA 1DTOA 5LMNB 4X1YB 3STZC 3X2QB 4L8JA 4LR3A 4O4LA 4MVQA 3RYCB 4DUZB 1S3JA 4LF4B 4K35A 3OD4A 3F5WC 1OZ0A 3AK3A 3HKEA 4J41A 2YC0A 4I55B 4IIJB 4ZOLA 4RO2A 4CS3A 4G2KA 2UXXA 2EZPA 3K5MA 3K0DA 1DLBA 2Q7GA 1F23A 3CSXA 3A0RA 1Q6HA 2N04A 5KMGA 3ZRWB 1N33B 2YXHA 2F23A 2QJ1A 3S3XA 1F4NA 2WAMA 5LOVA 1XMQO 3CHXA 1K4CC 4ZI7B 3T2MA 4LF8B 2W0FC 2QWRB 4UB8Z 1MSWD 4X64O 1BT8A 2YS8A 2CH7A 2ZXWC 1H2KA 4MVZA 3RWRD 4DW0A 1KP2A 4BIUA 1JX9A 3D36C 5H2FZ 1CEZA 2IJHA 4G27B 5B1BC 2XTAA 4Z1VA 1VQOV 3T4DA 1H8EG 1M56C 5IY5C 5LGNA 1D5NA 3JATA 1L0LH 3H1KH 3JARB 3H1IH 2WLMA 4YXWG 2Q4PA 3NXSA 4FM2A 2JEXA 4DV1B 4H0LB 1P7GA 1U97A 1AI5A 5CB4A 4B3RB 2B5UA 2IJKA 5IT9N 4XBFA 3G80A 2ITDC 4IYHA 4LFAB 2P7TC 3WB2A 1BL8A 4RAIA 1YVWA 4GKKB 4FM0A 3K0GA 1AR5A 4PDVA 1PNKA 1R1BA 2UXCO 1CXZB 3M8AA 2F1MA 2P4KA 4OGQB 5C8YB 2Q0AA 4PJ0Z 4DV5O 4JYCA 4MVSA 2QDOA 4DV4B 2AZ0A 4X20B 5EIBC 2RNBA 4PD4F 4KUMA 2VQFB 4U7OA 3ABMC 5GTIZ 4YIOA 1IBKB 4DR4B 5IYDO 3EXAA 4UVCA 1H2LA 2B1IA 4PDMA 4WBNA 1KQSU 1IX9A 4FIPC 1E1QG 1RSOA 1AJNA 4UV9A 3BVOA 4JI7O 2ZCEA 4JI2O 1Y6XA 3J80N 1MMMA 3TGUH 3FYEB 3JAWA 1VQKV 1GN6A 5KX5A 3CPWU 1WP8A 2W6IG 4BAYA 4DUYB 3CCMV 2ZDIA 4NXMB 3APQA 1GM8A 3BPZA 1QR9A 1X59A 1GN2A 1Q5OA 3H01A 2UUAO 1O9GA 2GBOA 3T1HB 5FL7G 1OCCC 3CRCA 5IYZB 2XAHA 1QLEB 2ZNJA 4LNUB 1Q8IA 3E22A 1K7DA 4DV2B 2JVDA 2R72A 3N2KB 2XAGA 1MOFA 4NXNB 1FAFA 1KD1W 1RFYA 5LA6A 1QHTA 4UCTA 3RYFB 1SA0A 1W0KG 2IU3A 2LFSA 2QWPB 1V9PA 4X1KA 2GUZB 1FD9A 3K3WA 2YUAA 3P32A 5E79Z 3BY6A 4OPAA 3CCVV 4LFCO 2UUBB 4DV6B 3HKBA 5EBWC 1B6QA 2N74A 1SZXA 2EINB 1NQTA 4LF7O 5ITZA 4JI4B 2JGDA 4LH7A 3W7SA 3U0ZA 2JDIG 5EC1C 4GZRB 2EIJB 4IYIA 1SKVA 4JI8O 1PM9A 2RN9A 3RFRA 1GK9A 4DR6O 2B1GA 2VQEB 3F7VC 2EULA 4X65O 2RJZA 1G1XB 1NS1A 4NYKA 4O4LB 2EBOA 3WG7B 1X4TA 1P7BA 3HKEB 3ML0A 4ZOLB 1XDCA 1D2DA 1SC5B 3HKDA 1XMQB 2DWEC 1I94B 3VQYA 2L6LA 3RT3C 3JAMN 3IJ4A 4BWAA 3EVKA 5L3DA 4ZIBA 4NTYA 5KMGB 4O4IA 4CH3A 3OTFA 2BTOA 4JTAB 2W6JG 1KP3A 4DR5O 4H33A 3CYOA 1S5JA 5LOVB 4K3AA 1NVPB 2QKSA 1SQPH 2RMKB 3U10A 2ZQMA 2R9RB 2EIKB 1ZUQA 4MVMA 3L9DA 1MG1A 4MW8A 4FLVA 3HB3B 4GX5A 2DN9A 2CH7B 1Z2GA 2ILMA 1XUQA 4KXRA 2JRIA 5IJ9A 5LXTA 5EK0A 1FXVA 1VQ5V 1YJNV 1HNZO 2EILC 3OMIB 1COWG 1VQLV 4JI1B 4C7UA 3JATB 4YJ2A 5LHHA 2WA4A 3RBZA 1VQPV 3CE2A 1JQ0A 4X89A 4FFBA 3QF7A 3OGIB 1LUVA 3FAVA 1GH6A 2DYSB 4FVMA 1XEQA 5H5NA 3FB7C 3FB8C 1NZ6A 2XAFA 1K4DC 3AG2B 1MSDA 5IDJA 5CB4B 3OT7A 5JVDA 3IC7A 3R65A 5BMVA 1PD3A 1XNRO 4TUYA 4LCUC 4JYAO 1KB9F 4EB6A 3IC9A 4H37A 3C3SA 1V54C 3OUFA 3K79A 2CTQA 5B3SC 2LFRA 2A0LA 3FD9A 4XDKA 1RPRA 1AI6A 2UXBB 5FPOA 2FYUH 3K06A 2VS0A 2F43G 4JI2B 3E2EA 1AJPA 3ZS8C 3GWOA 4UB6Z 4GLXA 3WB1A 1TAEA 3UO2A 2CDYA 4WBNB 5IWAB 3KKYA 1RSOB 3FYIB 2CK3G 4LFBO 2GSMB 3KZIZ 1Y67A 2QM4A 4O4JA 3JAWB 2BSKA 3F5TA 4GYCB 3ASNC 5KX5B 4L87A 2HHHO 1AP5A 4TSFG 5DEDA 1FS0G 4J10A 1EN5A 2QM8A 3KG2A 2WLJA 2Q7HA 2EZOA 2QM7A 1NR1A 2E5LO 2P5OA 2OT5A 1TUBA 5IYBO 1I5XA 1M1KW 3E22B 3ZMSA 3CS5A 2X0LA 1VMGA 3LSSA 1R6KA 5CBGA 1PV0A 5FNVA 1VQ6V 4QE9A 4E4EA 1BHAA 5GTHZ 4PA9A 4DR2B 5LA6B 2IM9A 1TUEB 4W4LA 5EZYA 4JI3O 3JYCA 1SA0B 1M9NA 1JPXA 2UXNA 3RGBA 2FTKA 4MVOA 4B08A 4X1KB 3SR2C 1FJGB 3ETQA 4TV8A 2LGQA 3HKBB 2Y0IA 4X65B 1Q82W 3M99B 1JA8A 4X62O 3CJHA 2ADQB 1K8AW 5ITZB 5BR8O 2JGDB 1JFFA 4JPRA 4JV5O 4D6TH 1YCIA 2CUGA 3ETDA 4DV7O 5KHIA 1R6NA 2Q7EA 4FFKA 3SYOA 5LP6B 1XHXA 1WJZA 4FPPA 5HFMA 1S72V 1YHQV 2VWJA 1HDJA 2Q68A 4O2BA 1YTFD 3SDLA 1SS3A 1AVMA 2KB1A 1L8DA 1K5QA 1KYOF 5LL6Y 3MAQA 3HKDB 4UFZA 3QNEA 3AG7A 1BQZA 1IZ3A 2GDSA 2P4VA 3AG1C 1IURA 4LBEC 4ZKIA 4TV9A 4FLZA 1RM1C 1OJHA 4KFMA 5JCOC 5B1BB 3LNMB 5DM6V 2UXCB 1I0HA 2JS5A 1NH2D 5EC2C 3OTOB 5K1XA 3CRQA 3K08A 1DF4A 1IXMA 1K97A 4AQYB 4FMTA 3THOA 1Q7YW 3ZRSA 3CXCU 4DR1B 3E8FA 3T1CA 3OE7G 5KA5A 2A3QA 4GKJO 2ZNIA 5KUMA 3CCEV 2F4VB 1ROPA 1EZVH 1N36O 2B9ZA 5IJ9B 3K9SA 5LXTB 3RN4A 2R9IA 4B3TO 3JSLA 1BSMA 3B77A 2YSUB 3P30A 2PI5A 2DQ3A 3CRRA 2A79B 1N34B 1RP3B 2YI8A 4JASA 1D5AA 2F93B 3I5DA 1YITV 4PA6A 4YJ2B 3K9AA 1XNRB 1ZL8A 4FFBB 3ZHSA 1Y74A 2Y69C 3FAVB 3E86A 3ASOC 1Q6IA 2OTJV 3ZMVA 4JYYA 1N32O 2UUCO 3UKMA 3CC4V 5JVDB 2MK3A 3ABMB 5BMVB 5EIBD 4CZZA 2BE3A 3SPIA 4LF5O 3O65A 4TUYB 1H2NA 4EB6B 1SF9A 5H6RA 4NKGB 1WB7A 1HR0O 4DR3O 3CB2A 3CC7V 4LF9O 3CRAA 4MTXA 2BTQA 2M6YA 2DOSA 5GW7A 3TK1A 3SYCA 3N2GA 2BOBC 1B06A 1AR1B 3JASA 3K5OA 4QJFB 2X6BA 1TVKA 5LHGA 1J95A 1GO3F 2AGAA 4E2LA 3L75H 4NTWA 1KC8W 2Q6AA 3EFFK 3C90A 1JOYA 2E5LB 4O4JB 2BSKB 2HKOA 4RUEA 2GTAA 1L1FA 2EX3A 4LWSA 5A9GA 1HNWO 2YXYA 2BOCC 1FPOA 3CRMA 5FPRA 3SGIA 3JCUZ 4H13B 4IT5A 3UCSC 2IJJA 1R3JC 3L74H 2LW1A 1MZFA 3GVMA 1TUBB 3ZRXA 4K0KB 3B4SA 1NR7A 3ZN1A 5IJ0A 4GX0A 1XMOO 2ZR3A 3X2QC 5BZBA 2ZM6O 1TA8A 4JI0O 1OCZB 3SJAC 3AEIA 1VF6A 3A8TA 1VQ9V 1QVFU 1MABG 3ABLB 2Z5UA 3ZHTA 2XASA 4X62B 4GUNA 5EZYB 4LF6O 2DMXA 3O9OA 1LR1A 2V1DA 4TV8B 2VRZA 3ABTA 4X9QA 4DV7B 3Q4HA 3ZMTA 1W0JG 3RYHA 3TXQA 2FKXA 4DR7B 3FB5C 2Q9LA 3CJHB 1Y76B 2ATKC 1EZJA 4MTGA 3DC6A 1JFFB 1WNSA 1US6A 1HNXB 1IBMB 4CH4A 4B7EA 1XHZA 1QR8A 2ZD9A 2RCVA 3T4ZA 2UXDO 4K8ZA 3H9VA 1M5IA 5JCOA 1N8RW 5GONA 2LW7A 4O2BB 4R6ZA 5J2TA 5DECA 1BQ0A 5LGUA 3SPGA 3B40A 3OR7C 1M57C 4Z1MG 2R70A 1I7FA 2Z0AA 5LYJA 1EBOA 1Q3EA 2YXLA 3CCRV 4UVAA 4TQDA 1SQBH 1SRYA 3E8GA 1Z5VA 1R3IC 4KHPB 2HG5C 4BW9A 3PN1A 4MTOA 4TV9B 4G28B 4GKJB 5HFLA 1YEWA 5CMUA 3UM7A 1YXBA 5EBMC 1W2BU 1EN6A 3L70H 4EFBA 3CC2V 5IYCO 2WPDG 2ODMA 3T1YO 1YF2A 3OMNB 3OW2U 4FK5C 4ZBMA 1R3KC 1VF7A 1FFXA 1JVMA 4LH6A 4I5SA 3KCXA 4HYOA 4AHCA 1P49A 2Q8VA 3QO5A 5L3CA 2Q5ZA 2UU9O 4J80A 1L0NH 4P2ZA 4PDLA 2XNDG 2YEVA 4B3MO 1IBLO 4YHHO 1N32B 2QKAA 2UUCB 4BW5A 2P90A 1V54B 4FLXA 4X66O 1FYJA 3P3NA 4LF5B 1ZL8B 5B3SB 1Y74B 2N05A 1WAZA 4U3JA 2Q0OC 2O57A 1QBZA 3CCSV 1KKDA 2K9PA 1AILA 4X64B 3D36A 4GCZA 4LF9B 2YIBA 2M7WA 4JAVA 3ABKC 1VQ8V 2H94A 1WA8A 1VARA 4X88A 3AK2A 1AB3A 2Y0PA 2YDEA 3CMAV 2AW9A 1PL4A 3BEHA 3ZHRA 4CH5A 3MHHC 1S76D 5JWPA 4WFEA 1GMGA 3ZIAG 3ETGA 2BTQB 3VBBA 2PYJA 1JCHA 4WFGA 2OCCB 3N2GB 4TOIA 1DK1A 1F51A 1QLNA 5H6QA 4DV0O 3JASB 1TVKB 3QTCA 2JJ1G 4JI5O 3SJQC 5BY1A 3D8CA 4YIPA 1HNWB 5CA1A 5LHIA 4MTFA 1FXKC 4WCEV 1YJWV 2V4DA 4UXNA 2A9HA 3CCUV 4DW1A 4LWSB 4MT8A 1JR9A 1XMOB 2EINC 4JI6O 2ZM6B
chains in the Genus database with same CATH topology
2ZXWC 4QNHB 4MVZA 3ETDA 4BIZA 2K1EA 1R6NA 2EILB 3SYOA 4DXWA 1KP2A 4UUJC 4BIUA 3W7TA 2EIJC 3ZMUA 1JX9A 3G71V 4FPPA 1PL0A 5HFMA 3JD1A 1S72V 1CEZA 2H8PC 1YHQV 2IJHA 1FXKB 4G27B 2Q68A 5B1BC 1V55C 4FJCC 1VQOV 1YTFD 2C2AA 3T4DA 1H8EG 1M56C 5IY5C 5LGNA 2KB1A 1PNMA 1S5HC 2AHYA 4EKWA 1K5QA 4UV8A 2QTOA 4WFBV 2WLMA 4YXWG 5CBFA 3E8BA 1NBMG 3QNEA 3NXSA 2JEXA 1BHBA 2WLIB 4QPJA 4WF9V 1G4YB 1YIJV 1OCZC 1Q86W 4WFHA 3AG1C 4ASUG 1GM9A 4LBEC 1AI5A 4ZKIA 1RM1C 3ABLC 2B5UA 1K33A 4LP8A 2IJKA 4XBFA 5B1OA 2OTLV 4KFMA 2ITDC 2XOKG 1V55B 3LNMB 5B1BB 5B1NA 2QA4V 5DM6V 2JEUA 2WLKA 1NH2D 5EC2C 2IJIA 2IH1C 2P7TC 4KP4A 3K08A 1BL8A 4RAIA 1DF4A 1IXMA 1K97A 1Q7YW 4FMTA 2HVJC 1Y66A 3ZRSA 3K0GA 3CXCU 3HPLC 1I5YA 3E8FA 3T1CA 3OE7G 2WWWA 4PDVA 5KA5A 1PNKA 3B8MA 1K34A 5KUMA 3CCEV 2EIKC 1ROPA 3B8NA 5CA3A 3K03A 3MD0A 1AI4A 4JYCA 4MVSA 1NKDA 1OHHG 1PNLA 1RM1B 2R9IA 3JD4A 4KUMA 3JCZA 3ETEA 4U7OA 3G4SV 3B77A 2YSUB 3P30A 2PI5A 3ABMC 2DQ3A 3K04A 2A79B 5IYDO 1K5SA 4UVCA 2B1IA 4PDMA 1QLEC 2DYRB 1HWYA 4WFAV 1KQSU 3OEEG 1YJ9V 4FIPC 1M90W 3SYAA 1E1QG 3ASNB 1AJNA 3FKSG 4JASA 5DN6G 1YITV 4PA6A 3TETA 4UV9A 1VQ4V 3K9AA 1BMFG 4JAUA 3OMAB 3W7WA 2Y69C 3FYEB 1VQKV 3LDCA 3CP1A 3CPWU 2W6IG 2JJ2G 3OEHG 1NVPD 3E86A 4BAYA 2WLNA 3E35A 3CCMV 2ZDIA 3ASOC 2OTJV 3ZMVA 4PA4A 1GM8A 1QR9A 2WLHA 2Q67A 3H01A 2WLLA 3E89A 2DYSC 3UKMA 3CC4V 4GX1A 2MK3A 5FL7G 3ABMB 4CZZA 1OCCC 1AI7A 4QPKA 2XAHA 3SPIA 1QLEB 2QEXV 3OFNG 1QVGU 2X6CA 3CMEV 1VQNV 5H6RA 4CBCA 1K7DA 2V7QG 1YI2V 4P9OA 5KUKA 1P4RA 1SESA 4I9WA 1XL6A 2GHYA 1Q81W 2XAGA 4MW3A 3CC7V 1ZWIC 4MVRA 1MOFA 4MTXA 1PKXA 4J9YB 4X8AA 5GW7A 1KD1W 3ASOB 3SYCA 3TK1A 3E83A 2DWDC 4QE7A 3D3IA 3LSQA 2BOBC 3E8HA 1AR1B 1YTFB 1W0KG 2IU3A 2LFSA 4QJFB 2X6BA 3FB6C 3WFVA 2YEVB 4JGSA 3OAAG 5LHGA 1J95A 1GO3F 3ZRWA 3K3WA 4UVBA 4E2LA 3P32A 5H9CA 2DQ0A 1EFRG 3BY6A 3AG3C 3CCVV 1CP9A 3WG7C 1OCRC 5EBLC 1KC8W 5EBWC 1SERA 1FXHA 2Q6AA 3EFFK 1B6QA 1Y4MA 1JOYA 2EINB 4RUFA 2ZXWB 1NQTA 3SPCA 2QE7G 1R3LC 1THZA 2HKOA 4P30A 4RUEA 1VQMV 3W7SA 1LNQA 1L1FA 2JDIG 5EC1C 3CCJV 4JYBA 2EIJB 2BOCC 4P9PA 1GK9A 4PDRA 5L3EA 3JD3A 4QIWF 2B1GA 1NH2B 4TWKA 2IJJA 3F7VC 1R3JC 3ZRVA 2P6JA 4DO2A 1M56B 5IY5B 4HZ3A 3AG3B 3ZRXA 3ZMZA 2ITCC 2EBOA 1NR7A 3ZN1A 1FXKA 3WG7B 1NJIW 1OCRB 4GX0A 1WPXA 1K73W 2HLDG 2ZR3A 3X2QC 5BZBA 1P7BA 4OXSA 2DW4A 3AG4C 3ML0A 4MSWC 1OCZB 2XAQA 3ABUA 3AG1B 3AEIA 4JTCB 1VQ9V 3OGCC 1MABG 1QVFU 2DWEC 3ABLB 2Z5UA 2WLIA 3IFXA 3QO8A 2XASA 5L3FA 5L3DA 1FFTB 2EIMC 2OCCC 2P67A 4JTDB 3W7XA 4GT1A 2V1DA 2NNUA 1JJ2U 3ABTA 1KECA 4JTAB 2W6JG 3JD0A 1KP3A 4LC1A 4H33A 5J9PC 2PI4A 3RVZA 3CYOA 1NVPB 4F4LA 2QKSA 3ZMTA 4HAMA 1W0JG 5E1AC 1H8HG 1G8MA 2XAJA 2ZQMA 3AG4B 3FB5C 5B1AC 3I56V 2R9RB 2EIKB 2Q69A 3F7YC 4MVMA 2ATKC 3PJSK 2HJFC 1MG1A 3LUTB 4MW8A 4TT3G 1EZJA 4MTGA 4PA3A 4R50A 3HB3B 4GX5A 4U7NA 3G6EV 1S77D 4WFFA 3VOUA 5L3BA 1QR8A 5EK0A 2EIMB 2ZD9A 1FXVA 3AG2C 1VQ5V 2ZR2A 3T4ZA 3CCLV 1YJNV 3W7UA 1DF5A 1H2GA 4MVUA 1N8RW 2X7RB 4R6ZA 2EILC 3CCQV 3OMIB 1COWG 1VQLV 2Y69B 3MHSC 5B1AB 5LGUA 3SPGA 4R8CA 2WSSG 5LHHA 1E1RG 3OR7C 1M57C 3RBZA 4Z1MG 1VQPV 1K3EA 1JQ0A 4X89A 3I55V 1EBOA 1H38A 3CCRV 4UVAA 1R73A 2DYSB 1SRYA 4R7CA 1YSCA 3E8GA 3FB7C 3FB8C 4J9ZB 4MS2A 1R3IC 2XAFA 1K4DC 1OCCB 2HG5C 4RQEA 3AG2B 4N23A 2NLJC 4MTOA 1SETA 4G28B 3ZN0A 5IDJA 3SYPA 5HFLA 1WLEA 3IC7A 4XDLA 3R65A 5CMUA 1PD3A 2JIZG 3CD6V 3EHBB 3UM7A 1W2BU 5EBMC 3STLC 2D3OW 5CN0A 3CC2V 4LCUC 3SPHA 5L3GA 5IYCO 2WPDG 3OMNB 3OW2U 4H37A 3SYQA 1M57B 1F4MA 1V54C 4FK5C 4ZBMA 1GKFA 3OUFA 3K79A 1R3KC 3DTUB 5B3SC 2LFRA 1JVMA 2A0LA 4XDKA 1RPRA 1AI6A 4RQFA 4GX2A 2IH3C 4I5SA 4HYOA 1GTOA 3K06A 1UJWB 2ZDIC 2EJRA 2F43G 3JD2A 1OCOC 1RPOA 1SZTA 3LDEA 3E2EA 1AJPA 3QO5A 5L3CA 2LP7A 3LDDA 3RVYA 3SPJA 5LGTA 3GWOA 4P2ZA 1GM7A 4PDLA 2XNDG 1ENVA 2YEVA 1E79G 1XL4A 1VQ7V 3GB7C 1AROP 2P90A 3FYIB 4BW5A 2CK3G 2GSMB 1V54B 3TCUA 3ZCCA 2JK5C 3OM3B 2DYRC 5B3SB 4XDJA 4N21A 5C93A 3ASNC 4L87A 3RW0A 4TSFG 1AJQA 1FS0G 1OCOB 1QBZA 2Y48A 5CBHA 3CCSV 1KKDA 1S0VA 1ORQC 2QM8A 3D36A 3KG2A 2WLJA 4GCZA 2EZOA 2WLLB 4PA7A 5LBQA 4JF3A 3DGEA 2QM7A 3IGAC 2M7WA 3QO7A 3ABKC 4JAVA 1VQ8V 3OR6C 2H94A 1DTOA 1NR1A 2AHZA 4X88A 3STZC 3X2QB 2OT5A 5IYBO 1I5XA 1M1KW 4MVQA 3ZMSA 3CMAV 1S3JA 2X0LA 3BEHA 1S76D 3MHHC 3LSSA 1R6KA 1OZ0A 3F5WC 4WFEA 2HVKC 5CBGA 1GMGA 3ZIAG 3ETGA 1K9MW 4RO2A 1VQ6V 4QE9A 3VBBA 1BHAA 1JCHA 4WFGA 4G2KA 3OUSA 2OCCB 2UXXA 2EZPA 4PA9A 1K92A 1F51A 3K0DA 1QLNA 1TUEB 3JYCA 5H6QA 2HFEC 1M9NA 3ABKB 1DLBA 1JPXA 1F23A 2UXNA 2X6AA 4PELA 2FTKA 4MVOA 3A0RA 2JJ1G 3SJQC 3ZRWB 2HR3A 5LHIA 4MTFA 1F4NA 2WAMA 1FXKC 1CPYA 2IW5A 1K4CC 1Q82W 3M99B 1QCEA 3T2MA 4WCEV 2W0FC 4Q20A 1YJWV 1K8AW 4UXNA 2IU0A 2A9HA 1MSWD 3ZJZA 3CCUV 4JPRA 2Z3YA 4MT8A 5KA6A 2EINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO C;  2ZXW C;  4QNH B;  4MVZ A;  3LDE A;  2WLH A;  2Q67 A;  2K1E A;  3LDD A;  3RVY A;  3SPJ A;  2WLL A;  3E89 A;  2DYS C;  3SYO A;  3UKM A;  4DXW A;  4GX1 A;  2EIM C;  2OCC C;  4P2Z A;  4UUJ C;  4JTD B;  2EIJ C;  4PDL A;  2YEV A;  1OCC C;  3SPI A;  2H8P C;  1XL4 A;  4JTA B;  4G27 B;  2Q68 A;  4H33 A;  1V55 C;  2X6C A;  5B1B C;  3RVZ A;  5J9P C;  3GB7 C;  4BW5 A;  2QKS A;  4F4L A;  4CBC A;  3T4D A;  5E1A C;  4P9O A;  1M56 C;  5B1A C;  3TCU A;  2KB1 A;  1S5H C;  2AHY A;  3FB5 C;  4I9W A;  2JK5 C;  2R9R B;  4EKW A;  1XL6 A;  2DYR C;  2Q69 A;  3F7Y C;  4MVM A;  4MW3 A;  2ATK C;  4XDJ A;  2QTO A;  2HJF C;  3PJS K;  4MW8 A;  2WLM A;  3ASN C;  3LUT B;  1ZWI C;  4MVR A;  4MTG A;  4PA3 A;  4X8A A;  3RW0 A;  4J9Y B;  3E8B A;  5CBF A;  4R50 A;  5IY5 C;  4GX5 A;  3SYC A;  3E83 A;  2WLI B;  2DWD C;  4QE7 A;  5CBH A;  1KKD A;  1G4Y B;  4WFF A;  1ORQ C;  3VOU A;  1OCZ C;  2BOB C;  4WFH A;  3AG1 C;  3E8H A;  3KG2 A;  2WLJ A;  2WLL B;  4LBE C;  4PA7 A;  5EK0 A;  2ZD9 A;  3AG2 C;  3ABL C;  2X6B A;  3IGA C;  4LP8 A;  3ABK C;  3FB6 C;  3T4Z A;  3OR6 C;  4MVU A;  1J95 A;  2AHZ A;  4KFM A;  4X88 A;  3STZ C;  2ITD C;  3LNM B;  4R6Z A;  2EIL C;  3AG3 C;  4MVQ A;  2WLK A;  5EC2 C;  2IH1 C;  3WG7 C;  3BEH A;  1OCR C;  5EBL C;  2P7T C;  3K08 A;  1BL8 A;  4RAI A;  5EBW C;  2Q6A A;  3EFF K;  4R8C A;  3SPG A;  5KUK A;  3OR7 C;  3F5W C;  2HVJ C;  1M57 C;  4WFE A;  2HVK C;  4RUF A;  3RBZ A;  3K0G A;  3ZRS A;  5CBG A;  4X89 A;  3HPL C;  3E8F A;  3SPC A;  3T1C A;  4PDV A;  1R3L C;  4RO2 A;  4QE9 A;  4P30 A;  4RUE A;  4R7C A;  3E8G A;  1LNQ A;  3FB7 C;  3FB8 C;  4WFG A;  3OUS A;  5KUM A;  2EIK C;  4J9Z B;  4MS2 A;  5EC1 C;  1R3I C;  2BOC C;  1K4D C;  4PA9 A;  3K03 A;  2HG5 C;  3K0D A;  4MVS A;  4P9P A;  4PDR A;  3JYC A;  2HFE C;  2NLJ C;  4MTO A;  4G28 B;  4TWK A;  3SYP A;  2X6A A;  3F7V C;  1R3J C;  4MVO A;  4XDL A;  3R65 A;  3SJQ C;  3ABM C;  3K04 A;  3UM7 A;  5EBM C;  2A79 B;  4HZ3 A;  3STL C;  2ITC C;  4MTF A;  4PDM A;  1QLE C;  4LCU C;  3SPH A;  3SYA A;  4GX0 A;  1K4C C;  4H37 A;  4PA6 A;  3TET A;  3SYQ A;  1V54 C;  3X2Q C;  4ZBM A;  5BZB A;  1P7B A;  4OXS A;  3OUF A;  3T2M A;  2W0F C;  1R3K C;  3AG4 C;  4MSW C;  2Y69 C;  2A9H A;  3LDC A;  3ZJZ A;  5B3S C;  4JTC B;  1JVM A;  2A0L A;  4XDK A;  3OGC C;  3E86 A;  4GX2 A;  2DWE C;  2IH3 C;  2WLN A;  4HYO A;  2WLI A;  3ASO C;  3IFX A;  3K06 A;  2EIN C;  4PA4 A; 
#chains in the Genus database with same CATH topology
 4BIZ A;  5LMN O;  1ZSP A;  4DXW A;  4DV5 B;  2DJV A;  4UUJ C;  2EIJ C;  4UCS A;  1PL0 A;  4DUZ O;  3JD1 A;  1S5L Z;  2H8P C;  1V55 C;  5IJ0 B;  4LF6 B;  3WU2 Z;  4J7J A;  3K5L A;  3APO A;  1PNM A;  1WN7 A;  4UV8 A;  1H2S B;  2QTO A;  4WFB V;  4JI7 B;  4IHJ A;  5CBF A;  4ICG A;  3E8B A;  1NBM G;  2KSD A;  3BFR A;  1BHB A;  2RQ6 A;  4WF9 V;  1YIJ V;  4ASU G;  2ZKO A;  1GM9 A;  2ZIO A;  3DC5 A;  1N33 O;  4K8X A;  2WA3 A;  2UUA B;  2CGO A;  2OTL V;  3C3T A;  3R66 A;  2QA4 V;  3Q4H B;  2JEU A;  2WLK A;  4LF8 O;  2IJI A;  2UXD B;  1NU1 H;  5K1P A;  3L71 H;  4H44 B;  1I5Y A;  3DSQ A;  2EIK C;  5CA3 A;  3K03 A;  3MD0 A;  1AI4 A;  3J7A U;  1OHH G;  1HP8 A;  1RM1 B;  3G4S V;  3VQW A;  3K04 A;  4NR1 A;  5GON B;  2QWO B;  4UCU A;  1K5S A;  4F6R A;  2DYR B;  4WFA V;  3CEI A;  3OEE G;  1YJ9 V;  1M90 W;  3SYA A;  5J2T B;  3CXH F;  4CC6 A;  4J42 A;  4LFC B;  3CWB H;  3HKC A;  3TET A;  1VQ4 V;  1BMF G;  4JAU A;  3OMA B;  4U3F H;  3SJC C;  3W7W A;  5LYJ B;  1NTZ H;  3LDC A;  3CP1 A;  2QTS A;  3G67 A;  2JJ2 G;  4LF7 B;  2WLN A;  4PA4 A;  3NR7 A;  4B3R O;  3BAB A;  3RYI A;  2Q67 A;  4JAA A;  4IL6 Z;  3E89 A;  3A2F A;  2DYS C;  4JI8 B;  4PI2 A;  4DR6 B;  1AI7 A;  4QPK A;  4LFA O;  5D5Q A;  4PV1 B;  1R6T A;  2X6C A;  3CME V;  4UCR A;  4GKK O;  4CBC A;  1YI2 V;  1B04 A;  4P9O A;  5KUK A;  1P4R A;  2GHY A;  4B3M B;  1Q81 W;  1FFX B;  4YHH B;  1BZK A;  1GN3 A;  1ZWI C;  3VQV A;  4X8A A;  3B09 A;  2PF4 E;  5B5E Z;  2ZE7 A;  3ASO B;  4QE7 A;  3LSQ A;  4DK1 A;  3JAL A;  3E8H A;  2YIA A;  2VQF O;  1IDS A;  1XNQ O;  1YTF B;  4DR4 O;  2RDC A;  3FB6 C;  2YEV B;  1YZB A;  1NTM H;  2DQ0 A;  3AG3 C;  4CS4 A;  2AZ2 A;  2QWN B;  4I50 A;  2GTS A;  1OCR C;  4DR5 B;  1FXH A;  4RUF A;  5A2Q N;  5KAI Z;  2ZXW B;  2QE7 G;  4DUY O;  4NXM O;  3N27 A;  4U3J B;  1XIL A;  4P30 A;  2KG7 A;  1NT2 B;  4JYB A;  1KKC A;  4O4I B;  4PDR A;  5L3E A;  1KU9 A;  1NH2 B;  1U96 A;  1JMK C;  4DO2 A;  1SQX H;  1WA8 B;  5FLX N;  2YIB D;  1M56 B;  1T5E A;  5IY5 B;  4PI0 A;  3ZMZ A;  2ITC C;  4I0X A;  4DV2 O;  1FXK A;  2CTR A;  1HNZ B;  2OIG A;  4A5U B;  4DV0 B;  1NJI W;  2GUZ A;  1WPX A;  3FFQ A;  2HLD G;  3L72 H;  2DW4 A;  3AG4 C;  4NXN O;  4RWU A;  3ABU A;  4JTC B;  1A32 A;  2ZT9 B;  3BCC H;  3OGC C;  2WLI A;  3IFX A;  1Q90 D;  5JJN B;  1ZX3 A;  4EFE A;  2EIM C;  4JTD B;  2NR5 A;  3A0H Z;  4FZ1 A;  4GT1 A;  2FL4 A;  4JI6 B;  5CA1 B;  1YDX A;  4DV6 O;  1KEC A;  1N0N A;  3JD0 A;  4LC1 A;  3RVZ A;  4F4L A;  4JYA B;  4O4H A;  1H8H G;  1TGO A;  5B1A C;  4OX9 O;  5EYP A;  2Q69 A;  1VEW A;  1ZLZ A;  4JI4 O;  3PJS K;  1NI8 A;  2OCH A;  4F6E A;  2CE4 A;  3AK1 A;  2E3C A;  1S77 D;  4DK0 A;  4WFF A;  3VOU A;  5KHK A;  2VQE O;  3DXR A;  2AXT Z;  3W7U A;  1DF5 A;  1H2G A;  1M93 A;  1SQV H;  5LP6 C;  1XBL A;  2LJ2 A;  4NB5 A;  3G6B A;  2LGW A;  5KLV H;  4D7T A;  4R8C A;  3S3W A;  4I4T A;  4LFB B;  1K3E A;  3BHP A;  1I94 O;  4IHJ B;  1H38 A;  1GN4 A;  1W59 A;  1YSC A;  2HHH B;  1VIB A;  3L73 H;  2LQT A;  1OCC B;  1EM1 A;  4O2A A;  1SET A;  3ZN0 A;  5KHH A;  5KHG A;  3H1J H;  4XDL A;  3CD6 V;  3P3P A;  2JIZ G;  3EHB B;  3STL C;  3SPH A;  1J5E O;  2MW2 B;  1F7Y A;  1M57 B;  1F4M A;  4JZ2 A;  1GKF A;  1QU7 A;  3DTU B;  1WP7 A;  2QR4 A;  1VP7 A;  2YI9 A;  3KCY A;  4RQF A;  2HEP A;  4GX2 A;  4UCV A;  1GTO A;  1SQF A;  2EJR A;  3JD2 A;  1OCO C;  1SZT A;  3LDE A;  3RVY A;  1GM7 A;  4JI3 B;  1DGS A;  4JI1 O;  4F6R B;  2OWO A;  1VQ7 V;  2ZE6 A;  5CA0 A;  1ARO P;  4J7K A;  5FNV B;  3HKC B;  3TCU A;  3ZCC A;  3OM3 B;  5JH7 A;  2EJ7 A;  5BR8 B;  3LSU A;  1ORQ C;  3RYI B;  3K58 A;  2ZE5 A;  4JV5 B;  5LBQ A;  1OV9 A;  1H2M A;  3IGA C;  3QO7 A;  2A7W A;  2ADP A;  3M7M X;  3H1L H;  5JQG A;  2AHZ A;  1XNQ B;  1G6U A;  1GRJ A;  3JSN A;  4DYL A;  2GV9 A;  1N0J A;  2FB5 A;  4DRX A;  1UFI A;  1P84 F;  2HVK C;  1IXB A;  2UXB O;  1K9M W;  4JZG A;  4CC5 A;  2YID A;  3OUS A;  3JAL B;  1K92 A;  1I08 A;  5IE9 A;  2HFE C;  2ZE8 A;  3ABK B;  2X6A A;  4PEL A;  5IWA O;  4IGG A;  1WB8 A;  2HR3 A;  1CPY A;  1Q43 A;  4I50 B;  2IW5 A;  2OIE A;  3SJB C;  1QCE A;  4Q20 A;  2IU0 A;  3ZJZ A;  1XRE A;  4FLU A;  2ARH A;  2KG7 B;  2Z3Y A;  5KA6 A;  4QNH B;  2K1E A;  4I9Q A;  2EIL B;  1N36 B;  3JAK A;  4KL1 A;  3ZHU A;  3W7T A;  3ZMU A;  3G71 V;  3H1H H;  4B3T B;  4I0X B;  1FXK B;  5F2V O;  4FJC C;  4FZ0 A;  4Q6G A;  2C2A A;  1ZAU A;  1S5H C;  2AHY A;  4EKW A;  1O9H A;  4J11 A;  4X1I A;  2IBZ H;  2D2C B;  2NN4 A;  4DV3 O;  1BE3 H;  3HR0 A;  2PYL A;  4DR2 O;  2WLI B;  4QPJ A;  1G4Y B;  1OCZ C;  1Q86 W;  4OX9 B;  4WFH A;  1XQ8 A;  2ZIN A;  1FJG O;  4PHZ A;  3ABL C;  3MDS A;  1AP6 A;  1K33 A;  4LP8 A;  5BXZ A;  4QGP A;  1MNG A;  5B1O A;  4FLW A;  4Z2W A;  2XOK G;  1V55 B;  5B1N A;  5LP6 A;  3UQ8 A;  1GAX A;  2IH1 C;  3IAY A;  4O4H B;  2CGN A;  4KP4 A;  4YY3 O;  3QVN A;  1BCC H;  5EYP B;  1QNM A;  2HVJ C;  4W4K A;  1Y66 A;  4YJ3 A;  3UT5 A;  1HR0 B;  3BA8 A;  3HPL C;  2WWW A;  5JJJ B;  3B8M A;  4DR3 B;  1K34 A;  4FLY A;  3B8N A;  3ZED A;  3DXR B;  5TIS Z;  1NKD A;  2PY5 A;  4BIO A;  1PNL A;  1IVS A;  3JD4 A;  4AIL C;  3VQX A;  3JCZ A;  3ETE A;  2E75 B;  1QLE C;  1HWY A;  4B3S O;  3LNN A;  2XT9 A;  3ASN B;  2CTW A;  3FKS G;  5DN6 G;  1ZTE A;  3ICX A;  4I4T B;  4HNA A;  3BAA A;  4AI8 A;  1J5E B;  1FKA O;  1AR4 A;  3OEH G;  1NVP D;  2YIC A;  3E35 A;  1N4C A;  4ZHQ A;  2PZS A;  5LMU O;  1XOU A;  2DE0 X;  2WLH A;  4O2A B;  3J81 N;  2KKW A;  2WLL A;  4GX1 A;  5J2U A;  1XI1 A;  4X1Y A;  3OTO O;  2QEX V;  3OFN G;  1QVG U;  4AQY O;  1VQN V;  3RYC A;  3TJT A;  4J7Z A;  2V7Q G;  4DR1 O;  3A0B Z;  1SES A;  4I9W A;  1XL6 A;  4MW3 A;  2XHB A;  4I55 A;  4BR6 A;  4IIJ A;  2F4V O;  4MVR A;  1PKX A;  4J9Y B;  4JI0 B;  3E83 A;  2DWD C;  1SQQ H;  3D3I A;  4CH6 A;  2JS3 A;  2FML A;  2P22 C;  4LF4 O;  1N34 O;  1BS3 A;  2PTM A;  2P06 A;  3WFV A;  4JGS A;  3B2E E;  3OAA G;  3ZRW A;  4UVB A;  5H9C A;  1EFR G;  2PGG A;  3K5N A;  5CA0 B;  1CP9 A;  2QKC A;  3WG7 C;  5EBL C;  4ZI7 A;  3BRC A;  1SER A;  1LUW A;  1Y4M A;  2A06 H;  5JH7 B;  3K57 A;  3SPC A;  3D3Q A;  1R3L C;  1THZ A;  1VQM V;  1LNQ A;  3CCJ V;  1UPG A;  4P9P A;  3JD3 A;  4QIW F;  4TWK A;  3ZRV A;  2P6J A;  5JQG B;  3RYH B;  4HZ3 A;  3AG3 B;  1OCR B;  2Y4T A;  2PUS A;  1K73 W;  4UCO A;  4DRX B;  4OXS A;  3ZX6 A;  2G38 A;  1HW7 A;  4MSW C;  4I7Z B;  2XAQ A;  3AG1 B;  3JAR A;  2VWK A;  2LO1 A;  1EN4 A;  5KAF Z;  2ETN A;  3QO8 A;  4FM1 A;  5B66 Z;  3U11 A;  2E74 B;  4EEQ A;  4HBN A;  5L3F A;  1FFT B;  2OCC C;  2P67 A;  3W7X A;  4B7K A;  2NNU A;  1JJ2 U;  2E76 B;  1MZE A;  5J9P C;  2PI4 A;  2Y4U A;  3QG5 A;  3FX7 A;  4HAM A;  4DV1 O;  5E1A C;  4D7S A;  3T1Y B;  1G8M A;  2XAJ A;  3AG4 B;  4OPH A;  3I56 V;  3F7Y C;  3BA9 A;  2HJF C;  2XUM A;  3LUT B;  4TT3 G;  4ABM A;  4PA3 A;  2F66 C;  4R50 A;  3GWK C;  4U7N A;  3G6E V;  2R9A A;  1BGY H;  5C8Y A;  4DV3 B;  5L3B A;  2EIM B;  2L35 A;  1PPJ H;  3AG2 C;  2JGU A;  4X20 A;  3JAK B;  2Q73 A;  2ZR2 A;  3CCL V;  4K0K O;  4CS2 A;  4MVU A;  2UU9 B;  2X7R B;  3CCQ V;  3K59 A;  2Y69 B;  3MHS C;  3WB0 A;  5B1A B;  1IBL B;  1MA1 A;  2HP8 A;  2WSS G;  1E1R G;  4X1I B;  2H3O A;  3UO3 A;  3I55 V;  4DV4 O;  4X66 B;  2W0X A;  1R73 A;  1B3Q A;  4R7C A;  1Y76 A;  5AG2 A;  4J9Z B;  4MS2 A;  4YY3 B;  1IBK O;  3TXS A;  2QGN A;  4RQE A;  1VF6 C;  4N23 A;  4NTX A;  2NLJ C;  1VF5 B;  3SYP A;  2QSA A;  1WLE A;  1PP9 H;  5IYZ A;  2D3O W;  5CN0 A;  5KHJ A;  5L3G A;  4LNU A;  4DR7 O;  4TQF A;  3SYQ A;  4YJ3 B;  3UT5 B;  3N2K A;  1JJO A;  2KQX A;  1HNX O;  1IBM O;  2CAZ C;  4B3S B;  3T1H O;  2IH3 C;  1M4U A;  2ZIM A;  1UJW B;  3ZHQ A;  2ZDI C;  1KBH A;  1RPO A;  1QQC A;  2LP7 A;  3LDD A;  3SPJ A;  3RYF A;  5LGT A;  4NVP A;  1Z5W A;  1ENV A;  2BCC H;  2HJD A;  2OYQ A;  1Q6U A;  1E79 G;  1XL4 A;  5LMU B;  4JI5 B;  3GB7 C;  3ZHV A;  5JJE B;  4FLT A;  2JK5 C;  1KMI Z;  2DYR C;  4HNA B;  1KUQ A;  4XDJ A;  4N21 A;  5C93 A;  2QWQ B;  3RW0 A;  4KHP O;  5D5P A;  4ZHQ B;  1AJQ A;  2Y48 A;  1OCO B;  5CBH A;  2CTP A;  1S0V A;  1URF A;  2F95 B;  1NTK H;  2WLL B;  4PA7 A;  2UUB O;  4JF3 A;  5J2U B;  3DGE A;  3CX5 F;  3ZBH A;  1WPB A;  3OR6 C;  1SQG A;  1DTO A;  5LMN B;  4X1Y B;  3STZ C;  3X2Q B;  4L8J A;  4LR3 A;  4O4L A;  4MVQ A;  3RYC B;  4DUZ B;  1S3J A;  4LF4 B;  4K35 A;  3OD4 A;  3F5W C;  1OZ0 A;  3AK3 A;  3HKE A;  4J41 A;  2YC0 A;  4I55 B;  4IIJ B;  4ZOL A;  4RO2 A;  4CS3 A;  4G2K A;  2UXX A;  2EZP A;  3K5M A;  3K0D A;  1DLB A;  2Q7G A;  1F23 A;  3CSX A;  3A0R A;  1Q6H A;  2N04 A;  5KMG A;  3ZRW B;  1N33 B;  2YXH A;  2F23 A;  2QJ1 A;  3S3X A;  1F4N A;  2WAM A;  5LOV A;  1XMQ O;  3CHX A;  1K4C C;  4ZI7 B;  3T2M A;  4LF8 B;  2W0F C;  2QWR B;  4UB8 Z;  1MSW D;  4X64 O;  1BT8 A;  2YS8 A;  2CH7 A;  2ZXW C;  1H2K A;  4MVZ A;  3RWR D;  4DW0 A;  1KP2 A;  4BIU A;  1JX9 A;  3D36 C;  5H2F Z;  1CEZ A;  2IJH A;  4G27 B;  5B1B C;  2XTA A;  4Z1V A;  1VQO V;  3T4D A;  1H8E G;  1M56 C;  5IY5 C;  5LGN A;  1D5N A;  3JAT A;  1L0L H;  3H1K H;  3JAR B;  3H1I H;  2WLM A;  4YXW G;  2Q4P A;  3NXS A;  4FM2 A;  2JEX A;  4DV1 B;  4H0L B;  1P7G A;  1U97 A;  1AI5 A;  5CB4 A;  4B3R B;  2B5U A;  2IJK A;  5IT9 N;  4XBF A;  3G80 A;  2ITD C;  4IYH A;  4LFA B;  2P7T C;  3WB2 A;  1BL8 A;  4RAI A;  1YVW A;  4GKK B;  4FM0 A;  3K0G A;  1AR5 A;  4PDV A;  1PNK A;  1R1B A;  2UXC O;  1CXZ B;  3M8A A;  2F1M A;  2P4K A;  4OGQ B;  5C8Y B;  2Q0A A;  4PJ0 Z;  4DV5 O;  4JYC A;  4MVS A;  2QDO A;  4DV4 B;  2AZ0 A;  4X20 B;  5EIB C;  2RNB A;  4PD4 F;  4KUM A;  2VQF B;  4U7O A;  3ABM C;  5GTI Z;  4YIO A;  1IBK B;  4DR4 B;  5IYD O;  3EXA A;  4UVC A;  1H2L A;  2B1I A;  4PDM A;  4WBN A;  1KQS U;  1IX9 A;  4FIP C;  1E1Q G;  1RSO A;  1AJN A;  4UV9 A;  3BVO A;  4JI7 O;  2ZCE A;  4JI2 O;  1Y6X A;  3J80 N;  1MMM A;  3TGU H;  3FYE B;  3JAW A;  1VQK V;  1GN6 A;  5KX5 A;  3CPW U;  1WP8 A;  2W6I G;  4BAY A;  4DUY B;  3CCM V;  2ZDI A;  4NXM B;  3APQ A;  1GM8 A;  3BPZ A;  1QR9 A;  1X59 A;  1GN2 A;  1Q5O A;  3H01 A;  2UUA O;  1O9G A;  2GBO A;  3T1H B;  5FL7 G;  1OCC C;  3CRC A;  5IYZ B;  2XAH A;  1QLE B;  2ZNJ A;  4LNU B;  1Q8I A;  3E22 A;  1K7D A;  4DV2 B;  2JVD A;  2R72 A;  3N2K B;  2XAG A;  1MOF A;  4NXN B;  1FAF A;  1KD1 W;  1RFY A;  5LA6 A;  1QHT A;  4UCT A;  3RYF B;  1SA0 A;  1W0K G;  2IU3 A;  2LFS A;  2QWP B;  1V9P A;  4X1K A;  2GUZ B;  1FD9 A;  3K3W A;  2YUA A;  3P32 A;  5E79 Z;  3BY6 A;  4OPA A;  3CCV V;  4LFC O;  2UUB B;  4DV6 B;  3HKB A;  5EBW C;  1B6Q A;  2N74 A;  1SZX A;  2EIN B;  1NQT A;  4LF7 O;  5ITZ A;  4JI4 B;  2JGD A;  4LH7 A;  3W7S A;  3U0Z A;  2JDI G;  5EC1 C;  4GZR B;  2EIJ B;  4IYI A;  1SKV A;  4JI8 O;  1PM9 A;  2RN9 A;  3RFR A;  1GK9 A;  4DR6 O;  2B1G A;  2VQE B;  3F7V C;  2EUL A;  4X65 O;  2RJZ A;  1G1X B;  1NS1 A;  4NYK A;  4O4L B;  2EBO A;  3WG7 B;  1X4T A;  1P7B A;  3HKE B;  3ML0 A;  4ZOL B;  1XDC A;  1D2D A;  1SC5 B;  3HKD A;  1XMQ B;  2DWE C;  1I94 B;  3VQY A;  2L6L A;  3RT3 C;  3JAM N;  3IJ4 A;  4BWA A;  3EVK A;  5L3D A;  4ZIB A;  4NTY A;  5KMG B;  4O4I A;  4CH3 A;  3OTF A;  2BTO A;  4JTA B;  2W6J G;  1KP3 A;  4DR5 O;  4H33 A;  3CYO A;  1S5J A;  5LOV B;  4K3A A;  1NVP B;  2QKS A;  1SQP H;  2RMK B;  3U10 A;  2ZQM A;  2R9R B;  2EIK B;  1ZUQ A;  4MVM A;  3L9D A;  1MG1 A;  4MW8 A;  4FLV A;  3HB3 B;  4GX5 A;  2DN9 A;  2CH7 B;  1Z2G A;  2ILM A;  1XUQ A;  4KXR A;  2JRI A;  5IJ9 A;  5LXT A;  5EK0 A;  1FXV A;  1VQ5 V;  1YJN V;  1HNZ O;  2EIL C;  3OMI B;  1COW G;  1VQL V;  4JI1 B;  4C7U A;  3JAT B;  4YJ2 A;  5LHH A;  2WA4 A;  3RBZ A;  1VQP V;  3CE2 A;  1JQ0 A;  4X89 A;  4FFB A;  3QF7 A;  3OGI B;  1LUV A;  3FAV A;  1GH6 A;  2DYS B;  4FVM A;  1XEQ A;  5H5N A;  3FB7 C;  3FB8 C;  1NZ6 A;  2XAF A;  1K4D C;  3AG2 B;  1MSD A;  5IDJ A;  5CB4 B;  3OT7 A;  5JVD A;  3IC7 A;  3R65 A;  5BMV A;  1PD3 A;  1XNR O;  4TUY A;  4LCU C;  4JYA O;  1KB9 F;  4EB6 A;  3IC9 A;  4H37 A;  3C3S A;  1V54 C;  3OUF A;  3K79 A;  2CTQ A;  5B3S C;  2LFR A;  2A0L A;  3FD9 A;  4XDK A;  1RPR A;  1AI6 A;  2UXB B;  5FPO A;  2FYU H;  3K06 A;  2VS0 A;  2F43 G;  4JI2 B;  3E2E A;  1AJP A;  3ZS8 C;  3GWO A;  4UB6 Z;  4GLX A;  3WB1 A;  1TAE A;  3UO2 A;  2CDY A;  4WBN B;  5IWA B;  3KKY A;  1RSO B;  3FYI B;  2CK3 G;  4LFB O;  2GSM B;  3KZI Z;  1Y67 A;  2QM4 A;  4O4J A;  3JAW B;  2BSK A;  3F5T A;  4GYC B;  3ASN C;  5KX5 B;  4L87 A;  2HHH O;  1AP5 A;  4TSF G;  5DED A;  1FS0 G;  4J10 A;  1EN5 A;  2QM8 A;  3KG2 A;  2WLJ A;  2Q7H A;  2EZO A;  2QM7 A;  1NR1 A;  2E5L O;  2P5O A;  2OT5 A;  1TUB A;  5IYB O;  1I5X A;  1M1K W;  3E22 B;  3ZMS A;  3CS5 A;  2X0L A;  1VMG A;  3LSS A;  1R6K A;  5CBG A;  1PV0 A;  5FNV A;  1VQ6 V;  4QE9 A;  4E4E A;  1BHA A;  5GTH Z;  4PA9 A;  4DR2 B;  5LA6 B;  2IM9 A;  1TUE B;  4W4L A;  5EZY A;  4JI3 O;  3JYC A;  1SA0 B;  1M9N A;  1JPX A;  2UXN A;  3RGB A;  2FTK A;  4MVO A;  4B08 A;  4X1K B;  3SR2 C;  1FJG B;  3ETQ A;  4TV8 A;  2LGQ A;  3HKB B;  2Y0I A;  4X65 B;  1Q82 W;  3M99 B;  1JA8 A;  4X62 O;  3CJH A;  2ADQ B;  1K8A W;  5ITZ B;  5BR8 O;  2JGD B;  1JFF A;  4JPR A;  4JV5 O;  4D6T H;  1YCI A;  2CUG A;  3ETD A;  4DV7 O;  5KHI A;  1R6N A;  2Q7E A;  4FFK A;  3SYO A;  5LP6 B;  1XHX A;  1WJZ A;  4FPP A;  5HFM A;  1S72 V;  1YHQ V;  2VWJ A;  1HDJ A;  2Q68 A;  4O2B A;  1YTF D;  3SDL A;  1SS3 A;  1AVM A;  2KB1 A;  1L8D A;  1K5Q A;  1KYO F;  5LL6 Y;  3MAQ A;  3HKD B;  4UFZ A;  3QNE A;  3AG7 A;  1BQZ A;  1IZ3 A;  2GDS A;  2P4V A;  3AG1 C;  1IUR A;  4LBE C;  4ZKI A;  4TV9 A;  4FLZ A;  1RM1 C;  1OJH A;  4KFM A;  5JCO C;  5B1B B;  3LNM B;  5DM6 V;  2UXC B;  1I0H A;  2JS5 A;  1NH2 D;  5EC2 C;  3OTO B;  5K1X A;  3CRQ A;  3K08 A;  1DF4 A;  1IXM A;  1K97 A;  4AQY B;  4FMT A;  3THO A;  1Q7Y W;  3ZRS A;  3CXC U;  4DR1 B;  3E8F A;  3T1C A;  3OE7 G;  5KA5 A;  2A3Q A;  4GKJ O;  2ZNI A;  5KUM A;  3CCE V;  2F4V B;  1ROP A;  1EZV H;  1N36 O;  2B9Z A;  5IJ9 B;  3K9S A;  5LXT B;  3RN4 A;  2R9I A;  4B3T O;  3JSL A;  1BSM A;  3B77 A;  2YSU B;  3P30 A;  2PI5 A;  2DQ3 A;  3CRR A;  2A79 B;  1N34 B;  1RP3 B;  2YI8 A;  4JAS A;  1D5A A;  2F93 B;  3I5D A;  1YIT V;  4PA6 A;  4YJ2 B;  3K9A A;  1XNR B;  1ZL8 A;  4FFB B;  3ZHS A;  1Y74 A;  2Y69 C;  3FAV B;  3E86 A;  3ASO C;  1Q6I A;  2OTJ V;  3ZMV A;  4JYY A;  1N32 O;  2UUC O;  3UKM A;  3CC4 V;  5JVD B;  2MK3 A;  3ABM B;  5BMV B;  5EIB D;  4CZZ A;  2BE3 A;  3SPI A;  4LF5 O;  3O65 A;  4TUY B;  1H2N A;  4EB6 B;  1SF9 A;  5H6R A;  4NKG B;  1WB7 A;  1HR0 O;  4DR3 O;  3CB2 A;  3CC7 V;  4LF9 O;  3CRA A;  4MTX A;  2BTQ A;  2M6Y A;  2DOS A;  5GW7 A;  3TK1 A;  3SYC A;  3N2G A;  2BOB C;  1B06 A;  1AR1 B;  3JAS A;  3K5O A;  4QJF B;  2X6B A;  1TVK A;  5LHG A;  1J95 A;  1GO3 F;  2AGA A;  4E2L A;  3L75 H;  4NTW A;  1KC8 W;  2Q6A A;  3EFF K;  3C90 A;  1JOY A;  2E5L B;  4O4J B;  2BSK B;  2HKO A;  4RUE A;  2GTA A;  1L1F A;  2EX3 A;  4LWS A;  5A9G A;  1HNW O;  2YXY A;  2BOC C;  1FPO A;  3CRM A;  5FPR A;  3SGI A;  3JCU Z;  4H13 B;  4IT5 A;  3UCS C;  2IJJ A;  1R3J C;  3L74 H;  2LW1 A;  1MZF A;  3GVM A;  1TUB B;  3ZRX A;  4K0K B;  3B4S A;  1NR7 A;  3ZN1 A;  5IJ0 A;  4GX0 A;  1XMO O;  2ZR3 A;  3X2Q C;  5BZB A;  2ZM6 O;  1TA8 A;  4JI0 O;  1OCZ B;  3SJA C;  3AEI A;  1VF6 A;  3A8T A;  1VQ9 V;  1QVF U;  1MAB G;  3ABL B;  2Z5U A;  3ZHT A;  2XAS A;  4X62 B;  4GUN A;  5EZY B;  4LF6 O;  2DMX A;  3O9O A;  1LR1 A;  2V1D A;  4TV8 B;  2VRZ A;  3ABT A;  4X9Q A;  4DV7 B;  3Q4H A;  3ZMT A;  1W0J G;  3RYH A;  3TXQ A;  2FKX A;  4DR7 B;  3FB5 C;  2Q9L A;  3CJH B;  1Y76 B;  2ATK C;  1EZJ A;  4MTG A;  3DC6 A;  1JFF B;  1WNS A;  1US6 A;  1HNX B;  1IBM B;  4CH4 A;  4B7E A;  1XHZ A;  1QR8 A;  2ZD9 A;  2RCV A;  3T4Z A;  2UXD O;  4K8Z A;  3H9V A;  1M5I A;  5JCO A;  1N8R W;  5GON A;  2LW7 A;  4O2B B;  4R6Z A;  5J2T A;  5DEC A;  1BQ0 A;  5LGU A;  3SPG A;  3B40 A;  3OR7 C;  1M57 C;  4Z1M G;  2R70 A;  1I7F A;  2Z0A A;  5LYJ A;  1EBO A;  1Q3E A;  2YXL A;  3CCR V;  4UVA A;  4TQD A;  1SQB H;  1SRY A;  3E8G A;  1Z5V A;  1R3I C;  4KHP B;  2HG5 C;  4BW9 A;  3PN1 A;  4MTO A;  4TV9 B;  4G28 B;  4GKJ B;  5HFL A;  1YEW A;  5CMU A;  3UM7 A;  1YXB A;  5EBM C;  1W2B U;  1EN6 A;  3L70 H;  4EFB A;  3CC2 V;  5IYC O;  2WPD G;  2ODM A;  3T1Y O;  1YF2 A;  3OMN B;  3OW2 U;  4FK5 C;  4ZBM A;  1R3K C;  1VF7 A;  1FFX A;  1JVM A;  4LH6 A;  4I5S A;  3KCX A;  4HYO A;  4AHC A;  1P49 A;  2Q8V A;  3QO5 A;  5L3C A;  2Q5Z A;  2UU9 O;  4J80 A;  1L0N H;  4P2Z A;  4PDL A;  2XND G;  2YEV A;  4B3M O;  1IBL O;  4YHH O;  1N32 B;  2QKA A;  2UUC B;  4BW5 A;  2P90 A;  1V54 B;  4FLX A;  4X66 O;  1FYJ A;  3P3N A;  4LF5 B;  1ZL8 B;  5B3S B;  1Y74 B;  2N05 A;  1WAZ A;  4U3J A;  2Q0O C;  2O57 A;  1QBZ A;  3CCS V;  1KKD A;  2K9P A;  1AIL A;  4X64 B;  3D36 A;  4GCZ A;  4LF9 B;  2YIB A;  2M7W A;  4JAV A;  3ABK C;  1VQ8 V;  2H94 A;  1WA8 A;  1VAR A;  4X88 A;  3AK2 A;  1AB3 A;  2Y0P A;  2YDE A;  3CMA V;  2AW9 A;  1PL4 A;  3BEH A;  3ZHR A;  4CH5 A;  3MHH C;  1S76 D;  5JWP A;  4WFE A;  1GMG A;  3ZIA G;  3ETG A;  2BTQ B;  3VBB A;  2PYJ A;  1JCH A;  4WFG A;  2OCC B;  3N2G B;  4TOI A;  1DK1 A;  1F51 A;  1QLN A;  5H6Q A;  4DV0 O;  3JAS B;  1TVK B;  3QTC A;  2JJ1 G;  4JI5 O;  3SJQ C;  5BY1 A;  3D8C A;  4YIP A;  1HNW B;  5CA1 A;  5LHI A;  4MTF A;  1FXK C;  4WCE V;  1YJW V;  2V4D A;  4UXN A;  2A9H A;  3CCU V;  4DW1 A;  4LWS B;  4MT8 A;  1JR9 A;  1XMO B;  2EIN C;  4JI6 O;  2ZM6 B; 
#chains in the Genus database with same CATH homology
 2ZXW C;  4QNH B;  4MVZ A;  3ETD A;  4BIZ A;  2K1E A;  1R6N A;  2EIL B;  3SYO A;  4DXW A;  1KP2 A;  4UUJ C;  4BIU A;  3W7T A;  2EIJ C;  3ZMU A;  1JX9 A;  3G71 V;  4FPP A;  1PL0 A;  5HFM A;  3JD1 A;  1S72 V;  1CEZ A;  2H8P C;  1YHQ V;  2IJH A;  1FXK B;  4G27 B;  2Q68 A;  5B1B C;  1V55 C;  4FJC C;  1VQO V;  1YTF D;  2C2A A;  3T4D A;  1H8E G;  1M56 C;  5IY5 C;  5LGN A;  2KB1 A;  1PNM A;  1S5H C;  2AHY A;  4EKW A;  1K5Q A;  4UV8 A;  2QTO A;  4WFB V;  2WLM A;  4YXW G;  5CBF A;  3E8B A;  1NBM G;  3QNE A;  3NXS A;  2JEX A;  1BHB A;  2WLI B;  4QPJ A;  4WF9 V;  1G4Y B;  1YIJ V;  1OCZ C;  1Q86 W;  4WFH A;  3AG1 C;  4ASU G;  1GM9 A;  4LBE C;  1AI5 A;  4ZKI A;  1RM1 C;  3ABL C;  2B5U A;  1K33 A;  4LP8 A;  2IJK A;  4XBF A;  5B1O A;  2OTL V;  4KFM A;  2ITD C;  2XOK G;  1V55 B;  3LNM B;  5B1B B;  5B1N A;  2QA4 V;  5DM6 V;  2JEU A;  2WLK A;  1NH2 D;  5EC2 C;  2IJI A;  2IH1 C;  2P7T C;  4KP4 A;  3K08 A;  1BL8 A;  4RAI A;  1DF4 A;  1IXM A;  1K97 A;  1Q7Y W;  4FMT A;  2HVJ C;  1Y66 A;  3ZRS A;  3K0G A;  3CXC U;  3HPL C;  1I5Y A;  3E8F A;  3T1C A;  3OE7 G;  2WWW A;  4PDV A;  5KA5 A;  1PNK A;  3B8M A;  1K34 A;  5KUM A;  3CCE V;  2EIK C;  1ROP A;  3B8N A;  5CA3 A;  3K03 A;  3MD0 A;  1AI4 A;  4JYC A;  4MVS A;  1NKD A;  1OHH G;  1PNL A;  1RM1 B;  2R9I A;  3JD4 A;  4KUM A;  3JCZ A;  3ETE A;  4U7O A;  3G4S V;  3B77 A;  2YSU B;  3P30 A;  2PI5 A;  3ABM C;  2DQ3 A;  3K04 A;  2A79 B;  5IYD O;  1K5S A;  4UVC A;  2B1I A;  4PDM A;  1QLE C;  2DYR B;  1HWY A;  4WFA V;  1KQS U;  3OEE G;  1YJ9 V;  4FIP C;  1M90 W;  3SYA A;  1E1Q G;  3ASN B;  1AJN A;  3FKS G;  4JAS A;  5DN6 G;  1YIT V;  4PA6 A;  3TET A;  4UV9 A;  1VQ4 V;  3K9A A;  1BMF G;  4JAU A;  3OMA B;  3W7W A;  2Y69 C;  3FYE B;  1VQK V;  3LDC A;  3CP1 A;  3CPW U;  2W6I G;  2JJ2 G;  3OEH G;  1NVP D;  3E86 A;  4BAY A;  2WLN A;  3E35 A;  3CCM V;  2ZDI A;  3ASO C;  2OTJ V;  3ZMV A;  4PA4 A;  1GM8 A;  1QR9 A;  2WLH A;  2Q67 A;  3H01 A;  2WLL A;  3E89 A;  2DYS C;  3UKM A;  3CC4 V;  4GX1 A;  2MK3 A;  5FL7 G;  3ABM B;  4CZZ A;  1OCC C;  1AI7 A;  4QPK A;  2XAH A;  3SPI A;  1QLE B;  2QEX V;  3OFN G;  1QVG U;  2X6C A;  3CME V;  1VQN V;  5H6R A;  4CBC A;  1K7D A;  2V7Q G;  1YI2 V;  4P9O A;  5KUK A;  1P4R A;  1SES A;  4I9W A;  1XL6 A;  2GHY A;  1Q81 W;  2XAG A;  4MW3 A;  3CC7 V;  1ZWI C;  4MVR A;  1MOF A;  4MTX A;  1PKX A;  4J9Y B;  4X8A A;  5GW7 A;  1KD1 W;  3ASO B;  3SYC A;  3TK1 A;  3E83 A;  2DWD C;  4QE7 A;  3D3I A;  3LSQ A;  2BOB C;  3E8H A;  1AR1 B;  1YTF B;  1W0K G;  2IU3 A;  2LFS A;  4QJF B;  2X6B A;  3FB6 C;  3WFV A;  2YEV B;  4JGS A;  3OAA G;  5LHG A;  1J95 A;  1GO3 F;  3ZRW A;  3K3W A;  4UVB A;  4E2L A;  3P32 A;  5H9C A;  2DQ0 A;  1EFR G;  3BY6 A;  3AG3 C;  3CCV V;  1CP9 A;  3WG7 C;  1OCR C;  5EBL C;  1KC8 W;  5EBW C;  1SER A;  1FXH A;  2Q6A A;  3EFF K;  1B6Q A;  1Y4M A;  1JOY A;  2EIN B;  4RUF A;  2ZXW B;  1NQT A;  3SPC A;  2QE7 G;  1R3L C;  1THZ A;  2HKO A;  4P30 A;  4RUE A;  1VQM V;  3W7S A;  1LNQ A;  1L1F A;  2JDI G;  5EC1 C;  3CCJ V;  4JYB A;  2EIJ B;  2BOC C;  4P9P A;  1GK9 A;  4PDR A;  5L3E A;  3JD3 A;  4QIW F;  2B1G A;  1NH2 B;  4TWK A;  2IJJ A;  3F7V C;  1R3J C;  3ZRV A;  2P6J A;  4DO2 A;  1M56 B;  5IY5 B;  4HZ3 A;  3AG3 B;  3ZRX A;  3ZMZ A;  2ITC C;  2EBO A;  1NR7 A;  3ZN1 A;  1FXK A;  3WG7 B;  1NJI W;  1OCR B;  4GX0 A;  1WPX A;  1K73 W;  2HLD G;  2ZR3 A;  3X2Q C;  5BZB A;  1P7B A;  4OXS A;  2DW4 A;  3AG4 C;  3ML0 A;  4MSW C;  1OCZ B;  2XAQ A;  3ABU A;  3AG1 B;  3AEI A;  4JTC B;  1VQ9 V;  3OGC C;  1MAB G;  1QVF U;  2DWE C;  3ABL B;  2Z5U A;  2WLI A;  3IFX A;  3QO8 A;  2XAS A;  5L3F A;  5L3D A;  1FFT B;  2EIM C;  2OCC C;  2P67 A;  4JTD B;  3W7X A;  4GT1 A;  2V1D A;  2NNU A;  1JJ2 U;  3ABT A;  1KEC A;  4JTA B;  2W6J G;  3JD0 A;  1KP3 A;  4LC1 A;  4H33 A;  5J9P C;  2PI4 A;  3RVZ A;  3CYO A;  1NVP B;  4F4L A;  2QKS A;  3ZMT A;  4HAM A;  1W0J G;  5E1A C;  1H8H G;  1G8M A;  2XAJ A;  2ZQM A;  3AG4 B;  3FB5 C;  5B1A C;  3I56 V;  2R9R B;  2EIK B;  2Q69 A;  3F7Y C;  4MVM A;  2ATK C;  3PJS K;  2HJF C;  1MG1 A;  3LUT B;  4MW8 A;  4TT3 G;  1EZJ A;  4MTG A;  4PA3 A;  4R50 A;  3HB3 B;  4GX5 A;  4U7N A;  3G6E V;  1S77 D;  4WFF A;  3VOU A;  5L3B A;  1QR8 A;  5EK0 A;  2EIM B;  2ZD9 A;  1FXV A;  3AG2 C;  1VQ5 V;  2ZR2 A;  3T4Z A;  3CCL V;  1YJN V;  3W7U A;  1DF5 A;  1H2G A;  4MVU A;  1N8R W;  2X7R B;  4R6Z A;  2EIL C;  3CCQ V;  3OMI B;  1COW G;  1VQL V;  2Y69 B;  3MHS C;  5B1A B;  5LGU A;  3SPG A;  4R8C A;  2WSS G;  5LHH A;  1E1R G;  3OR7 C;  1M57 C;  3RBZ A;  4Z1M G;  1VQP V;  1K3E A;  1JQ0 A;  4X89 A;  3I55 V;  1EBO A;  1H38 A;  3CCR V;  4UVA A;  1R73 A;  2DYS B;  1SRY A;  4R7C A;  1YSC A;  3E8G A;  3FB7 C;  3FB8 C;  4J9Z B;  4MS2 A;  1R3I C;  2XAF A;  1K4D C;  1OCC B;  2HG5 C;  4RQE A;  3AG2 B;  4N23 A;  2NLJ C;  4MTO A;  1SET A;  4G28 B;  3ZN0 A;  5IDJ A;  3SYP A;  5HFL A;  1WLE A;  3IC7 A;  4XDL A;  3R65 A;  5CMU A;  1PD3 A;  2JIZ G;  3CD6 V;  3EHB B;  3UM7 A;  1W2B U;  5EBM C;  3STL C;  2D3O W;  5CN0 A;  3CC2 V;  4LCU C;  3SPH A;  5L3G A;  5IYC O;  2WPD G;  3OMN B;  3OW2 U;  4H37 A;  3SYQ A;  1M57 B;  1F4M A;  1V54 C;  4FK5 C;  4ZBM A;  1GKF A;  3OUF A;  3K79 A;  1R3K C;  3DTU B;  5B3S C;  2LFR A;  1JVM A;  2A0L A;  4XDK A;  1RPR A;  1AI6 A;  4RQF A;  4GX2 A;  2IH3 C;  4I5S A;  4HYO A;  1GTO A;  3K06 A;  1UJW B;  2ZDI C;  2EJR A;  2F43 G;  3JD2 A;  1OCO C;  1RPO A;  1SZT A;  3LDE A;  3E2E A;  1AJP A;  3QO5 A;  5L3C A;  2LP7 A;  3LDD A;  3RVY A;  3SPJ A;  5LGT A;  3GWO A;  4P2Z A;  1GM7 A;  4PDL A;  2XND G;  1ENV A;  2YEV A;  1E79 G;  1XL4 A;  1VQ7 V;  3GB7 C;  1ARO P;  2P90 A;  3FYI B;  4BW5 A;  2CK3 G;  2GSM B;  1V54 B;  3TCU A;  3ZCC A;  2JK5 C;  3OM3 B;  2DYR C;  5B3S B;  4XDJ A;  4N21 A;  5C93 A;  3ASN C;  4L87 A;  3RW0 A;  4TSF G;  1AJQ A;  1FS0 G;  1OCO B;  1QBZ A;  2Y48 A;  5CBH A;  3CCS V;  1KKD A;  1S0V A;  1ORQ C;  2QM8 A;  3D36 A;  3KG2 A;  2WLJ A;  4GCZ A;  2EZO A;  2WLL B;  4PA7 A;  5LBQ A;  4JF3 A;  3DGE A;  2QM7 A;  3IGA C;  2M7W A;  3QO7 A;  3ABK C;  4JAV A;  1VQ8 V;  3OR6 C;  2H94 A;  1DTO A;  1NR1 A;  2AHZ A;  4X88 A;  3STZ C;  3X2Q B;  2OT5 A;  5IYB O;  1I5X A;  1M1K W;  4MVQ A;  3ZMS A;  3CMA V;  1S3J A;  2X0L A;  3BEH A;  1S76 D;  3MHH C;  3LSS A;  1R6K A;  1OZ0 A;  3F5W C;  4WFE A;  2HVK C;  5CBG A;  1GMG A;  3ZIA G;  3ETG A;  1K9M W;  4RO2 A;  1VQ6 V;  4QE9 A;  3VBB A;  1BHA A;  1JCH A;  4WFG A;  4G2K A;  3OUS A;  2OCC B;  2UXX A;  2EZP A;  4PA9 A;  1K92 A;  1F51 A;  3K0D A;  1QLN A;  1TUE B;  3JYC A;  5H6Q A;  2HFE C;  1M9N A;  3ABK B;  1DLB A;  1JPX A;  1F23 A;  2UXN A;  2X6A A;  4PEL A;  2FTK A;  4MVO A;  3A0R A;  2JJ1 G;  3SJQ C;  3ZRW B;  2HR3 A;  5LHI A;  4MTF A;  1F4N A;  2WAM A;  1FXK C;  1CPY A;  2IW5 A;  1K4C C;  1Q82 W;  3M99 B;  1QCE A;  3T2M A;  4WCE V;  2W0F C;  4Q20 A;  1YJW V;  1K8A W;  4UXN A;  2IU0 A;  2A9H A;  1MSW D;  3ZJZ A;  3CCU V;  4JPR A;  2Z3Y A;  4MT8 A;  5KA6 A;  2EIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...