4PA9A

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa9A00
4PDVA 3AG3C 1ZWIC 2OCCC 3OR6C 2WLHA 3KG2A 2A0LA 2ZD9A 4JTDB 1QLEC 3F7YC 4UUJC 3RBZA 5B3SC 5BZBA 3RVYA 3SJQC 4MVZA 4MSWC 3ASNC 2A79B 2IH3C 3E8BA 4OXSA 4MVRA 3TETA 4MVSA 4R7CA 4MW3A 4RAIA 4MTGA 4QNHB 1R3KC 1OCOC 3UM7A 2EIKC 3K08A 3OUFA 3F7VC 3STLC 2YEVA 4J9ZB 3LNMB 4LP8A 4WFGA 5EC2C 4QE7A 3LDCA 4R50A 3X2QC 3T4DA 3ZRSA 3F5WC 4MTFA 4PA7A 5EBMC 5EK0A 3SYAA 3E86A 1K4CC 2AHZA 4G28B 5KUKA 4G27B 3ASOC 4X8AA 1K4DC 4PDMA 3T2MA 4KFMA 4LBEC 2QKSA 3GB7C 4ZBMA 3ZJZA 3E8GA 4XDJA 4GX2A 1V55C 2HVJC 1P7BA 3SPHA 3LDDA 3WG7C 2DWDC 3T4ZA 3LUTB 4P9OA 4DXWA 4MS2A 3RW0A 1M56C 2EINC 5CBHA 3K04A 4GX0A 2EIMC 5E1AC 3E89A 2BOCC 3LDEA 3SYOA 4PA4A 3ABLC 4H37A 4R8CA 4MTOA 2ZXWC 3ABMC 3T1CA 1OCZC 3FB8C 3UKMA 1KKDA 4LCUC 5EBLC 2QTOA 1S5HC 2X6CA 2HG5C 3AG1C 4PDRA 2Y69C 2DWEC 4P30A 2WLKA 2WLJA 3K0DA 3OGCC 4RUFA 4XDKA 1JVMA 2A9HA 3SYPA 3RVZA 4HYOA 4MVQA 3IFXA 4RUEA 2W0FC 4P2ZA 4PA6A 2X6AA 2BOBC 1XL4A 2ITCC 2NLJC 3IGAC 1XL6A 1LNQA 2ITDC 2WLLB 3OUSA 3SPIA 5J9PC 1M57C 2P7TC 3E83A 2WLIB 2HVKC 4MVMA 5KUMA 4R6ZA 3VOUA 5CBFA 2Q68A 4QE9A 3OR7C 2Q69A 4X88A 3ABKC 4J9YB 5EC1C 3STZC 1V54C 2IH1C 3JYCA 4BW5A 4EKWA 2X6BA 3TCUA 4P9PA 3E8FA 4TWKA 3EFFK 3HPLC 1ORQC 2ATKC 2EIJC 4I9WA 5EBWC 5B1AC 4F4LA 2HJFC 3SYCA 2JK5C 3FB6C 4MW8A 4WFFA 4X89A 3SPGA 2H8PC 3K06A 5B1BC 5IY5C 4WFHA 2HFEC 4JTCB 4CBCA 2KB1A 3K0GA 1R3LC 1G4YB 4H33A 2AHYA 4JTAB 4PDLA 2Q6AA 2R9RB 1OCCC 1BL8A 3R65A 4XDLA 3E8HA 4MVUA 4MVOA 1OCRC 3PJSK 3SPJA 3SYQA 1J95A 3FB7C 1R3IC 2K1EA 2Q67A 2WLNA 4PA3A 2DYRC 4GX5A 3BEHA 3FB5C 3SPCA 4RO2A 1R3JC 5CBGA 2WLLA 4PA9A 3AG2C 2WLIA 4GX1A 2EILC 2WLMA 2DYSC 4WFEA 3AG4C 3K03A 4HZ3A
chains in the Genus database with same CATH superfamily
4RQFA 2GV9A 5KLVH 5JCOC 2E74B 2KG7A 3B09A 2E5LB 4A5UB 4O2BA 4LWSB 2VS0A 3CMEV 1VQNV 2C2AA 1ZLZA 2PI4A 5KHGA 1IURA 3ZHUA 2YEVA 3HKCA 4NR1A 2EILB 4JI6O 3ICXA 1LUVA 5EK0A 1VQLV 3SGIA 3SYAA 1IX9A 1EZVH 4GKJB 2ZDIA 1VF5B 4CH5A 5B3SB 4TQFA 5LYJA 3C3TA 3ZJZA 3K57A 3ABUA 3CCMV 1VMGA 1TVKB 1WN7A 2P67A 1YTFB 1N32B 3C3SA 3LDEA 1I08A 4JI1O 3X2QB 1X59A 1SQBH 5LGTA 2IJJA 3FYEB 4K3AA 1VF7A 3DC6A 2WLJA 3CS5A 4DR6O 4HYOA 1PNMA 4IT5A 2CK3G 4MVQA 3W7SA 1MOFA 3D3IA 3ZN1A 2E3CA 2IM9A 3RYCA 3U0ZA 1R6NA 2VQEB 1K3EA 2M7WA 3G4SV 4I4TA 4X65O 1I94O 1COWG 3STZC 1SETA 5H2FZ 2H3OA 2YIAA 3JARB 3ZRWA 3OTOB 2KQXA 1N36B 2F4VO 3HKBB 3BPZA 5B66Z 3KKYA 1M56B 2QGNA 3E8HA 4IL6Z 4EB6A 1VQMV 3T1YO 1F23A 3FB5C 1RP3B 4JI4O 2ZCEA 1AI6A 2K9PA 4DV0B 4GLXA 2OIGA 4UV9A 2ZR2A 4PDVA 1EN6A 2EIJB 1VARA 4X64B 4DW0A 1S77D 2H94A 1VQ6V 4QIWF 2CTRA 1H2GA 3JCUZ 4H13B 4MVRA 4L87A 1Q86W 4QNHB 5BMVB 4DR2O 1SF9A 1ZTEA 2F93B 3JD3A 3ZRVA 1WA8B 4J10A 4WFGA 5EC2C 3IC9A 1MMMA 5LHHA 3IC7A 2YDEA 3ZRSA 1UPGA 1URFA 3RN4A 4G28B 1QR9A 1OZ0A 2ZR3A 3A2FA 3LUTB 4P9OA 3BA9A 1ZL8B 3TGUH 2VQFB 2JIZG 5KAFZ 5LA6B 1Z5VA 2JJ1G 3CC2V 4I50B 2CE4A 5B5EZ 2N74A 1Y76B 1D5AA 2QTOA 2UUCB 2HG5C 1RSOA 2NR5A 1LUWA 2IBZH 4LF6O 3QTCA 3IFXA 1XILA 4B7KA 5J2UA 3A0RA 1FXKC 3J7AU 2JDIG 3QO7A 2ITDC 2HJDA 3JASB 2GUZA 2JGUA 3OM3B 4LFCB 2YXLA 2KKWA 1JOYA 1H2SB 4O2BB 2UXBO 1PM9A 4LF5O 1V9PA 1V55B 2ODMA 1S3JA 1GM7A 5A2QN 3OW2U 1M5IA 4UVCA 4XDLA 4MVOA 3PJSK 3AEIA 3FB7C 1WB7A 4FPPA 1N0NA 4JI0B 5LYJB 4NTXA 1RM1C 5H9CA 5L3GA 3ASNC 3E8BA 2CTWA 1M1KW 4OXSA 4D7SA 5BR8B 3UQ8A 3JAKA 4YIOA 2QM4A 4KUMA 3CRCA 3BABA 4DYLA 1K8AW 3CCSV 4O2AB 4UCTA 5LXTA 2PUSA 4BR6A 2LW1A 3RYCB 2CH7A 3LDDA 2ZQMA 1OCRB 3VQWA 1FJGB 2DYRB 3I5DA 3T1HB 3K59A 1GM9A 2EULA 3DXRA 2CTPA 4JI6B 1Q43A 1P84F 2ETNA 1SC5B 2GHYA 3DTUB 3CCEV 1A32A 1S5JA 4EB6B 1XL4A 4NXNO 4X1KA 3OEHG 4ZI7A 1MSWD 4Q6GA 2UUAB 2PY5A 4LF4O 1BMFG 5KUMA 2V7QG 4KP4A 3VOUA 5C93A 3OGIB 1XOUA 3ETGA 4DO2A 1R1BA 3B77A 1OV9A 4TWKA 2IJIA 2ATKC 1BE3H 2ADPA 3ZRXA 4DK1A 3VQXA 3B8NA 3WG7B 2UXCO 5GW7A 3ZEDA 1OCCC 2QJ1A 4PI0A 1YIJV 2LFSA 1J95A 1KECA 2HP8A 5GTHZ 1I94B 2JRIA 5CA0A 1I5XA 2XUMA 1THZA 5EIBC 1ZSPA 1J5EB 1NH2D 4WFEA 1FFXA 1Q3EA 1BHBA 4J11A 4C7UA 3N2KB 4AQYB 4JAVA 2BTQA 5IJ0B 4JI7O 3RVYA 4MVZA 5CN0A 2F95B 4PV1B 4JV5B 1NZ6A 4DV1O 1H8HG 3T1YB 3O9OA 4U3FH 4JI4B 4LFAO 2E76B 2LQTA 3EHBB 1RSOB 2Q73A 3HKDA 3VBBA 4LNUA 2O57A 1JPXA 1RPRA 4B3SB 2Z5UA 4NB5A 5J2UB 5KUKA 5B1AB 1WNSA 4IGGA 3MHSC 3ZCCA 3B4SA 1HNWO 4DV6B 1GRJA 1Q6IA 4YXWG 1VF6C 1YJNV 4R8CA 3UT5A 1NH2B 4B3RO 3ZMZA 5DEDA 1GN4A 4DV2O 1AILA 3AG4B 2RN9A 2HLDG 1VQ8V 5L3BA 4RUEA 3EXAA 1Q6UA 1XNQB 3FD9A 2ZM6O 1WJZA 3G71V 1M57C 2P7TC 5KX5A 4FFKA 2XAQA 4LWSA 1O9HA 2P90A 4FLZA 3W7WA 1S72V 1BT8A 2QSAA 2BSKB 5EC1C 3H1HH 3CCRV 2WSSG 4FLTA 4LF6B 3L9DA 4TV8A 1YDXA 1N33B 4MT8A 1H2NA 2KB1A 2W0XA 2AZ0A 3ZIAG 3AK1A 3JD1A 5IYCO 3JSLA 3ABLB 2YIBA 1TVKA 2E75B 5LXTB 1YZBA 4DK0A 3G6EV 1P4RA 1PNKA 2UXBB 5KAIZ 2CH7B 2WLHA 4NTYA 5A9GA 4LF5B 4EEQA 4UFZA 2A3QA 1W59A 4FFBB 4QPKA 4E2LA 4EFBA 4RAIA 1U97A 1LR1A 2YC0A 4GT1A 1KYOF 3KCXA 2EIKC 3K08A 4DR7B 4UB6Z 1JX9A 3ABKB 2Z3YA 1R73A 2EBOA 1D5NA 1Q8IA 2CTQA 3BCCH 4FM1A 1KKCA 5L3FA 4ZI7B 2JS5A 3JD2A 2QKSA 2XNDG 2X7RB 3E8GA 4XDJA 1IDSA 4WFAV 1P7GA 3A0HZ 1JA8A 3CRAA 2QM7A 1QR8A 5CBHA 3HKBA 3Q4HA 2CGNA 4FLWA 1CXZB 5KA6A 4X66O 3BA8A 1SRYA 5KHIA 3AG2B 4TQDA 2N05A 5IWAO 5EBLC 4GUNA 2XAGA 2QKCA 1VQ4V 5KA5A 2DWEC 2CAZC 1IBKO 3OEEG 2PF4E 2YIDA 1AI4A 2NLJC 4ZHQA 4ABMA 1QHTA 1L0LH 1DF4A 1B04A 1KBHA 1T5EA 2YI9A 1FFXB 4TSFG 5CA3A 1CP9A 1V54C 2IH1C 5EZYA 2DW4A 2BTQB 5BMVA 1WA8A 3CCUV 2UUBO 1HR0O 2QA4V 2JK5C 1YJWV 3M8AA 3QNEA 1H2KA 4JTCB 1SQQH 1TAEA 2UXNA 1BS3A 1JR9A 1SKVA 2WA3A 2DE0X 1AJQA 3H1KH 1WP8A 2ZXWB 1R3JC 2ZIOA 5CBGA 5IJ9A 2R9IA 2EZOA 5LA6A 3KCYA 3PN1A 1EFRG 5ITZA 1QBZA 1ZWIC 4PHZA 4I50A 2Q9LA 5JH7B 2UXCB 1Y76A 4WBNA 3SJQC 3LSQA 2ADQB 4LH6A 5IYZB 3UT5B 1XMQB 3MD0A 2ZE5A 3K79A 4PJ0Z 5LBQA 1SQPH 2YIBD 4X9QA 3RYFB 4JI3O 4KFMA 1NT2B 3CRRA 5KX5B 1FPOA 4DV1B 3WB2A 3CC4V 3IJ4A 5E1AC 3SYOA 4PA4A 2BTOA 1SQFA 4H37A 1YJ9V 5DECA 4YIPA 2LW7A 1UJWB 1H2MA 4FVMA 3ZHQA 4TV8B 3GWOA 3HB3B 4FM0A 2OCCB 5IE9A 4FLVA 1F4MA 2WLKA 4RUFA 1IZ3A 4K0KB 5D5PA 4B3MO 4JI8O 3SPIA 3OUSA 3K58A 4KHPB 1EN4A 3QF7A 4B3TO 1BQ0A 3WB0A 3E8FA 1HP8A 2UU9O 2V4DA 2ZE6A 5CMUA 4O2AA 4OPAA 4NVPA 1US6A 1G4YB 1IBLO 1YXBA 4GKKO 2ZINA 5H6RA 1Q82W 2M6YA 4PA3A 4OPHA 4DR4O 2MW2B 2XASA 4CS3A 4EFEA 3AK2A 3F5TA 3MHHC 3L73H 4DV3O 5CA1A 1JMKC 5BZBA 3RBZA 3Q4HB 4JASA 5L3EA 3MDSA 4JAAA 1PP9H 2PGGA 1VP7A 1OCOC 1R6TA 4LC1A 3H1IH 1FXVA 3S3WA 5KHJA 2DJVA 2WAMA 5H5NA 3W7XA 1RM1B 4DR3O 1CEZA 1WPXA 3ASOC 2Q7GA 4ZHQB 1BQZA 2FB5A 5FLXN 3LNNA 3CC7V 3ZN0A 1TUEB 3FAVB 4LFBO 2EINC 4GX0A 3B2EE 2LGQA 5EZYB 1K33A 5LP6A 2QWRB 2EZPA 1HNZB 5KHKA 4F6EA 4O4IA 4NXMB 2L6LA 1AB3A 3NXSA 5FL7G 3ZX6A 2A9HA 3CCQV 2KSDA 4X20B 4I55A 4TV9A 4LF8O 1E1QG 2IU3A 2DOSA 5C8YB 2BCCH 3N2KA 1YVWA 4BIUA 5IJ9B 5IJ0A 2F66C 2EX3A 4Z1VA 4R6ZA 1XHZA 1HWYA 4UB8Z 5ITZB 5IYBO 3QVNA 3W7TA 4WBNB 4F4LA 2R9AA 4X89A 2DN9A 1UFIA 4DUZO 4JYCA 3FFQA 2GTAA 1BCCH 2OTLV 1NI8A 4TT3G 4CH4A 4DR1O 1R3IC 2Q67A 1F51A 3K5LA 2JS3A 3ZHSA 2WLLA 1SQGA 1Y4MA 3JD0A 4UCRA 3AG1B 1PV0A 2P22C 3K5NA 4CS4A 2UUBB 1HR0B 2YUAA 5BXZA 1RFYA 4JTDB 3RYIA 3F7YC 4BWAA 1YCIA 1MG1A 4MSWC 4DV5O 2A79B 5DN6G 1OCCB 3TETA 1I5YA 4JI5B 3LSUA 1JJOA 1H38A 4LR3A 5CB4B 2ZIMA 4ZKIA 4J9ZB 5LMUB 1XHXA 2A06H 4R50A 1YEWA 1YITV 5LOVB 3THOA 2BSKA 5LGNA 4ASUG 4DV7O 1GO3F 4PD4F 2HVJC 3SPHA 3UCSC 4YHHO 1M56C 1XNRO 1K97A 4LH7A 1E79G 1OCZC 3CXHF 1NTKH 4U3JA 3H1JH 3BFRA 4JI2O 2B9ZA 3SYPA 1L8DA 2W0FC 4HNAA 3K5MA 2Q7HA 2ITCC 2MK3A 2CUGA 4QPJA 3OFNG 3SDLA 4LF7O 4OX9O 5FPRA 1KUQA 3D36C 2W6JG 4CZZA 3CP1A 4QE9A 4FFBA 2F1MA 2ILMA 2QWQB 2OTJV 1MZFA 5CA1B 3TCUA 3EFFK 1YHQV 1YI2V 1ORQC 3CRQA 3RYHB 3FB6C 5JCOA 3GWKC 4H33A 2AHYA 3R65A 3SPJA 5JVDB 4JYYA 3CCLV 1SQXH 4JI1B 2OIEA 3BRCA 5GTIZ 1Z2GA 3ABMB 4PA9A 4J7KA 2UU9B 5IYDO 4LF9O 2Y0IA 4DR6B 4UUJC 1NJIW 3G67A 3CHXA 3U11A 1IBLB 1U96A 3DC5A 4YY3O 5LP6B 2CGOA 2Z0AA 5JJNB 1DK1A 5HFMA 4X62O 4IYIA 4O4IB 4X65B 3BHPA 2P4KA 5D5QA 4UCVA 1VQKV 3IAYA 3T4DA 1G6UA 3F5WC 3JAWB 4I55B 4TV9B 3LSSA 1L1FA 1K4DC 2F4VB 1DTOA 4GX2A 1V55C 4KL1A 3SJAC 1FYJA 2WWWA 1CPYA 1DLBA 3QO5A 5FNVB 1VQ9V 1XQ8A 2P5OA 3HR0A 2LGWA 2ZDIC 1S5HC 3FKSG 4IIJA 4P30A 2FYUH 2E5LO 1D2DA 3L71H 5H6QA 3TXSA 4U7NA 1EZJA 3A8TA 3IGAC 1QVFU 1Q5OA 4N23A 5JH7A 2WLLB 4J80A 4DR2B 3OR7C 5IYZA 3H01A 4J9YB 1FFTB 3HKEB 2IW5A 1FD9A 3RYIB 2ZKOA 2AGAA 1S0VA 5LL6Y 2JEUA 4D6TH 1PKXA 3RYFA 1K7DA 4UVBA 1R3LC 2D2CB 4I5SA 1OCRC 1N32O 2WLNA 2YS8A 5L3CA 2DYRC 5LHIA 3CMAV 1GK9A 1SZTA 4GX1A 2NNUA 3ABTA 1NTMH 1AJPA 3P3PA 4WFBV 5K1XA 3AG3C 1Y66A 3KG2A 2A0LA 1NR7A 1Y6XA 4UCUA 3P3NA 1XREA 2JVDA 1I7FA 4MW3A 2G38A 5JWPA 4MTGA 3AK3A 4JPRA 4U3JB 3OUFA 1AI7A 4FZ0A 2ZNIA 5B1NA 2PZSA 3APOA 4LP8A 2FMLA 1Y67A 4G2KA 4DR5O 1IXMA 4HNAB 4HAMA 4X8AA 4LBEC 1MNGA 5B1BB 3WG7C 1N36O 1M9NA 2UXDO 5FPOA 4J7ZA 4KXRA 3DSQA 1FXKA 4MTOA 3T1CA 1R6KA 4RQEA 5F2VO 4DV0O 1AR4A 3K0DA 4DV7B 1JVMA 1K34A 4X64O 1B3QA 1GMGA 1XL6A 1SA0B 1X4TA 5AG2A 2N04A 1N34O 2JGDB 4F6RB 3BY6A 4O4JA 2GTSA 3RT3C 1AJNA 4JI2B 3HPLC 2Y4UA 5B1AC 4Z1MG 1XBLA 1AR5A 4WFFA 3SPGA 1Q7YW 4CH3A 1W0JG 5IY5C 3JALB 1MSDA 4CBCA 4LF7B 4CH6A 2QWNB 4OX9B 2ZE8A 3SJCC 2Q6AA 4NTWA 1Y74A 4BAYA 2QM8A 4MVUA 3SYQA 2VQFO 3CXCU 2K1EA 4ZOLB 3FAVA 2XHBA 1WP7A 2LO1A 3OT7A 2DYSC 3AG4C 1GAXA 2UUCO 2A7WA 3D3QA 2ZD9A 4DW1A 1QLEC 3ETQA 1GN3A 4NXNB 3L70H 4LF4B 3RWRD 4X20A 4JAUA 1R3KC 3J80N 2R72A 3OD4A 1ZUQA 4J42A 4H44B 5C8YA 3LNMB 4IIJB 5EYPB 3ML0A 3I56V 3U10A 1QU7A 4TUYA 3JATA 4FM2A 2JJ2G 3SR2C 1O9GA 1HDJA 1VQ7V 4ZIBA 2BOCC 4N21A 3QO8A 3ABLC 1AR1B 2DQ0A 3P32A 4PDRA 2Y69C 4JI0O 1XUQA 2RDCA 4JI7B 2RNBA 1NBMG 4PA6A 2PI5A 5LMNO 2QR4A 4FLXA 3TXQA 4O4LA 4OGQB 1XMOO 3E83A 4LFAB 1K5SA 1PL0A 3ZMSA 5LGUA 1IVSA 1PNLA 4RWUA 3P30A 2Q69A 1KD1W 3ABKC 2DQ3A 3QG5A 5CB4A 1WPBA 1NVPD 3ZHVA 3JCZA 4Q20A 5LOVA 3BVOA 3K0GA 1HNWB 3SJBC 4B3RB 1FJGO 5K1PA 5HFLA 3VQYA 1B06A 4JYAO 3T1HO 4DV2B 3AG2C 2WLIA 2WLMA 1NS1A 3J81N 2XT9A 4MTXA 3OR6C 2IU0A 3CCVV 4K8ZA 4UCOA 3K9AA 2OCHA 2RMKB 4XBFA 2V1DA 2ZM6B 3OAAG 1FXKB 4MVSA 2UUAO 5GONB 3UM7A 4WF9V 4X1YA 3R66A 4QE7A 3LDCA 1NVPB 1OHHG 1VF6A 1IBMO 4PA7A 3OTFA 1I0HA 3E86A 2AHZA 5J2TA 1MA1A 4O4HB 3GB7C 4YJ2A 4ZBMA 1QNMA 4O4JB 3L72H 1VEWA 3RYHA 2EIMC 2WA4A 4U7OA 3E89A 2YI8A 1XEQA 1VQ5V 2ZXWC 1YSCA 5JVDA 2RCVA 2GBOA 4LCUC 4DR5B 2OYQA 1J5EO 1G1XB 5JJEB 4AQYO 3RGBA 1Y74B 3CX5F 2UXDB 2BOBC 3ASNB 2LFRA 3ZMTA 1HNXO 5B1OA 4JV5O 3O65A 4HBNA 3APQA 2FL4A 1OCZB 4E4EA 3JYCA 1N0JA 4B3SO 2B1IA 1YF2A 4GCZA 4K8XA 4FIPC 2P6JA 4X1IA 3E35A 3OMNB 3JAWA 3ZHRA 4JTAB 4I9QA 1N34B 1BL8A 4I7ZB 5JJJB 5KHHA 1ZAUA 4DV6O 3K9SA 4X66B 1AROP 1NR1A 4GX5A 3SPCA 4RO2A 4TUYB 5IWAB 3JATB 2EILC 5FNVA 2RJZA 2OCCC 5EIBD 1IBKB 2VWJA 3W7UA 2Y0PA 3ZMVA 5B3SC 2Q0OC 3CJHA 5JQGB 1XNQO 1IXBA 2VWKA 1K92A 3B40A 3X2QC 1F4NA 1SQVH 1VQOV 1Q81W 2XAFA 4JZ2A 1FS0G 3HKEA 4O4LB 4UVAA 4IHJA 1NTZH 4K35A 1ROPA 2Q8VA 1N33O 4W4KA 1H2LA 3UO2A 4DXWA 4J41A 1P49A 1L0NH 1WB8A 2YICA 1AI5A 2VRZA 2KG7B 1TGOA 5IDJA 4ICGA 5L3DA 2Q5ZA 1H8EG 3N2GA 2EJ7A 3RVZA 3D8CA 3TJTA 4P2ZA 2GSMB 4DUYO 3G6BA 2LJ2A 2EJRA 2YEVB 2GDSA 2XTAA 3E22A 3HKCB 1QCEA 3M7MX 2WLIB 2JEXA 1GM8A 2FKXA 5BY1A 2Q68A 4DR7O 3VQVA 1B6QA 1W2BU 1FXHA 4JI3B 2EIJC 4I9WA 2P4VA 3G80A 3SYCA 4MW8A 2H8PC 5LMNB 1JJ2U 1BSMA 4PDLA 5LHGA 1XMOB 1HW7A 3WFVA 2YSUB 4X1YB 1K73W 1GH6A 1WLEA 2ZNJA 2BE3A 1M93A 1N4CA 5IT9N 1MABG 5J2TB 4QJFB 4NYKA 4JGSA 1KP2A 4YJ2B 4BIZA 4JZGA 3ETEA 4JYBA 2Q4PA 3CSXA 3OE7G 3H9VA 1S5LZ 2IH3C 4B3MB 4I4TB 4JI8B 4R7CA 4DV4O 1Z5WA 1M57B 2HR3A 4JYAB 4B3TB 2W6IG 3DGEA 3ZRWB 1SA0A 2JGDA 4F6RA 2B5UA 3CCJV 3AG3B 2WPDG 1AP6A 4DRXA 3T2MA 2QDOA 2XOKG 1NU1H 3RFRA 1P7BA 4GKKB 4MS2A 3RW0A 1M90W 3K04A 3GVMA 3JALA 4DR4B 4UXNA 1F7YA 3FX7A 1IBMB 1KKDA 3EVKA 1SS3A 4DV3B 3AG1C 4YJ3A 4X1IB 3K5OA 4ZOLA 4FLUA 4UCSA 1GTOA 2ARHA 2Y4TA 3L74H 1MZEA 1LNQA 4FLYA 2HHHO 2LP7A 1XMQO 5KMGA 2HVKC 5CBFA 2Y48A 1ZX3A 2EIKB 2XAJA 3MAQA 3A0BZ 4EKWA 4W4LA 4DR3B 3ETDA 3CJHB 2IJHA 5EYPA 4B7EA 3S3XA 1JFFA 4WFHA 3E2EA 1HNXB 4LFBB 1RPOA 2IJKA 3BEHA 5E79Z 3CWBH 3C90A 4I0XA 1K9MW 1KMIZ 2Q7EA 2YXYA 2AXTZ 4IHJB 5DM6V 3ZBHA 4FMTA 1TUBA 4GKJO 5IY5B 4LF8B 2GUZB 4K0KO 1PL4A 2YXHA 1S76D 3OMIB 4KHPO 3STLC 1KP3A 3N2GB 2UXXA 3CPWU 1V54B 2DYSB 1GN6A 1WAZA 4MTFA 1K4CC 4G27B 1QLEB 2QKAA 4PDMA 2F43G 2CDYA 3E22B 3OMAB 4DUZB 2X0LA 2DWDC 1OJHA 3T4ZA 1TA8A 4BIOA 4DR1B 3I55V 2PYJA 4B08A 2VQEO 3ABMC 1Q90D 3TK1A 3UKMA 4CC6A 1EN5A 2HEPA 1EM1A 2R70A 2Q0AA 4JF3A 1XI1A 3B8MA 1NQTA 1VIBA 1KC8W 4DV5B 4WCEV 3JAKB 3OTOO 2AW9A 5LP6C 3NR7A 4TOIA 5J9PC 4L8JA 4D7TA 1SESA 4FJCC 4X88A 4BW9A 1EBOA 4GYCB 5GONA 2X6BA 1AVMA 3CB2A 2Y69B 3KZIZ 2HJFC 3N27A 3BAAA 3CEIA 4Z2WA 4DUYB 1GN2A 4GZRB 2HFEC 4AI8A 4YHHB 2R9RB 1XNRB 3DXRB 4O4HA 2PTMA 3CYOA 2QWPB 2OWOA 1HNZO 4DRXB 4CC5A 4AILC 2B1GA 2L35A 1SERA 4X1KB 4NXMO 4H0LB 1NKDA 3JARA 1BZKA 1Q6HA 1XDCA 1KQSU 3WU2Z 1BHAA 4QGPA 3F7VC 1K5QA 2PYLA 4YJ3B 3CE2A 2QE7G 5EBMC 4FK5C 3ZS8C 3K3WA 1FAFA 1G8MA 3H1LH 2FTKA 1PPJH 5KMGB 4PELA 1QQCA 1BGYH 2D3OW 4DV4B 5CA0B 4FZ1A 1QLNA 1QVGU 4LFCO 3WB1A 3L75H 3FB8C 3D36A 3JAMN 2X6CA 4LF9B 2DMXA 1JFFB 2QEXV 1JCHA 3CD6V 2HKOA 1VQPV 3OGCC 2AZ2A 4XDKA 1GKFA 2OT5A 3UO3A 3AG7A 4CS2A 2X6AA 3JD4A 4UV8A 4YY3B 5TISZ 2XAHA 2EIMB 3HKDB 4X62B 4JI5O 4LNUB 4I0XB 1OCOB 4MVMA 4PI2A 2NN4A 4AHCA 5JQGA 3FYIB 2ZE7A 1AP5A 1DGSA 1ZL8A 4NKGB 5LMUO 4BW5A 1DF5A 1KU9A 3JSNA 4P9PA 1TUBB 1SZXA 3CRMA 5EBWC 1ENVA 1PD3A 3M99B 3ASOB 1KB9F 3K06A 4IYHA 2QWOB 5B1BC 1E1RG 1N8RW 2F23A 2HHHB 2QTSA 2EINB 3ZHTA 5BR8O 2ZT9B 4J7JA 3ZMUA 1FKAO 1M4UA 1W0KG 1YTFD 2P06A 2RQ6A 1JQ0A 3JASA 3K03A 4HZ3A
chains in the Genus database with same CATH topology
1PNKA 5IYDO 2OCCC 2WLHA 4RQFA 3W7UA 3ZMVA 4UUJC 5B3SC 1NJIW 3CMEV 1VQNV 4QPKA 4E2LA 4RAIA 2C2AA 5HFMA 4GT1A 2PI4A 2EIKC 3K08A 2YEVA 1JX9A 1K92A 3ABKB 2EILB 2Z3YA 1VQKV 1R73A 3T4DA 1F4NA 3X2QC 2EBOA 3F5WC 5EK0A 1VQLV 3SYAA 1VQOV 3LSSA 5L3FA 1L1FA 2ZDIA 2XAFA 1Q81W 1K4DC 1FS0G 3JD2A 5B3SB 2QKSA 4UVAA 2XNDG 1DTOA 2X7RB 3E8GA 4GX2A 1V55C 4XDJA 3ZJZA 1ROPA 2WWWA 3ABUA 3CCMV 4WFAV 1CPYA 2P67A 4DXWA 2QM7A 1DLBA 1QR8A 5CBHA 1YTFB 3QO5A 3LDEA 1VQ9V 5KA6A 1AI5A 1SRYA 5IDJA 3AG2B 3X2QB 2ZDIC 5LGTA 5EBLC 5L3DA 1S5HC 2XAGA 2IJJA 3FYEB 1VQ4V 1H8EG 3FKSG 5KA5A 2DWEC 4P30A 2WLJA 3RVZA 4HYOA 1PNMA 4MVQA 2CK3G 3W7SA 3OEEG 4P2ZA 5H6QA 2GSMB 4U7NA 1AI4A 1MOFA 1EZJA 3D3IA 3ZN1A 2NLJC 3IGAC 2EJRA 1QVFU 2YEVB 4N23A 2WLLB 1DF4A 1QCEA 2WLIB 1R6NA 1K3EA 2JEXA 1GM8A 2M7WA 2Q68A 3OR7C 3G4SV 3H01A 4TSFG 4J9YB 1FFTB 1COWG 5CA3A 3STZC 1CP9A 1V54C 1B6QA 1SETA 2IH1C 2DW4A 1W2BU 1FXHA 2IW5A 3CCUV 2EIJC 4I9WA 3ZRWA 1S0VA 2JEUA 3SYCA 2QA4V 2JK5C 4MW8A 1PKXA 1YJWV 2H8PC 1JJ2U 1K7DA 4UVBA 3QNEA 4JTCB 2UXNA 1R3LC 4PDLA 5LHGA 4I5SA 3WFVA 1M56B 2YSUB 3E8HA 1OCRC 1K73W 1WLEA 1AJQA 2WLNA 1VQMV 5L3CA 2DYRC 1F23A 3FB5C 2ZXWB 1R3JC 5CBGA 5LHIA 1GK9A 3CMAV 2R9IA 1AI6A 1MABG 1SZTA 4GX1A 4QJFB 2EZOA 2NNUA 3ABTA 1AJPA 4JGSA 4UV9A 2ZR2A 1EFRG 1KP2A 4PDVA 4WFBV 1QBZA 3AG3C 1Y66A 1ZWIC 2EIJB 4BIZA 3KG2A 2A0LA 3ETEA 4JYBA 1S77D 2H94A 1VQ6V 4QIWF 3OE7G 3SJQC 1NR7A 1H2GA 2IH3C 3LSQA 4MVRA 4L87A 4R7CA 3MD0A 4MW3A 1M57B 4MTGA 3K79A 4QNHB 1Q86W 2HR3A 5LBQA 4JPRA 3OUFA 1AI7A 2W6IG 3DGEA 3ZRVA 3JD3A 5B1NA 3ZRWB 4LP8A 4WFGA 5EC2C 5LHHA 3IC7A 2B5UA 3ZRSA 3CCJV 4G2KA 3AG3B 2WPDG 1IXMA 4G28B 4HAMA 4X8AA 3T2MA 4KFMA 4LBEC 1QR9A 1OZ0A 2XOKG 2ZR3A 5B1BB 3WG7C 1P7BA 1M9NA 3LUTB 4P9OA 4MS2A 3RW0A 1M90W 3CC4V 3K04A 2JIZG 5E1AC 3SYOA 4PA4A 2JJ1G 4H37A 1YJ9V 4UXNA 1FXKA 3CC2V 4MTOA 3T1CA 1R6KA 1UJWB 4RQEA 1KKDA 2QTOA 3AG1C 2HG5C 3GWOA 3HB3B 2OCCB 1F4MA 2WLKA 3K0DA 4RUFA 1JVMA 1K34A 3IFXA 1GTOA 3A0RA 1GMGA 1FXKC 2JDIG 1XL6A 1LNQA 2ITDC 3QO7A 2LP7A 3OUSA 3SPIA 2HVKC 3BY6A 3OM3B 5CBFA 2Y48A 2EIKB 2XAJA 1AJNA 4EKWA 3E8FA 1JOYA 3HPLC 3ETDA 2IJHA 5B1AC 4Z1MG 4WFFA 3SPGA 5CMUA 1Q7YW 1W0JG 5IY5C 4WFHA 1V55B 4CBCA 3E2EA 1S3JA 1G4YB 1GM7A 2Q6AA 3OW2U 4UVCA 4XDLA 4BAYA 2QM8A 4MVUA 4MVOA 3SYQA 3PJSK 3AEIA 5H6RA 1RPOA 1Q82W 3FB7C 3CXCU 2K1EA 4PA3A 2IJKA 3BEHA 2XASA 4FPPA 1K9MW 3MHHC 2DYSC 3AG4C 5DM6V 1RM1C 4FMTA 2ZD9A 1QLEC 5H9CA 5BZBA 3RBZA 5IY5B 5L3GA 3ASNC 4JASA 5L3EA 3E8BA 1M1KW 4OXSA 4JAUA 1R3KC 1OCOC 1S76D 4LC1A 3OMIB 1FXVA 4KUMA 3STLC 1KP3A 3LNMB 2UXXA 1K8AW 3ML0A 3I56V 3CPWU 3CCSV 1V54B 2WAMA 2DYSB 4MTFA 3W7XA 1K4CC 1RM1B 1CEZA 1WPXA 4G27B 1QLEB 3ASOC 4PDMA 2F43G 3OMAB 2JJ2G 2X0LA 3LDDA 2DWDC 2ZQMA 3T4ZA 3CC7V 3ZN0A 1TUEB 2EINC 4GX0A 1OCRB 1VQ7V 3I55V 2BOCC 1K33A 4N21A 3QO8A 3ABLC 2DYRB 2EZPA 1AR1B 3ABMC 1GM9A 2DQ0A 3TK1A 3UKMA 3P32A 4PDRA 2Y69C 4JF3A 3NXSA 3B8MA 5FL7G 2GHYA 1NQTA 2A9HA 3CCQV 3DTUB 1KC8W 1NBMG 4PA6A 4WCEV 3CCEV 1E1QG 2PI5A 1XL4A 2IU3A 3OEHG 4BIUA 1MSWD 5J9PC 3E83A 1K5SA 1PL0A 1BMFG 5KUMA 3ZMSA 5LGUA 1PNLA 2V7QG 4KP4A 1HWYA 4R6ZA 1SESA 3VOUA 5C93A 3ETGA 3P30A 2Q69A 4FJCC 5IYBO 1KD1W 4X88A 3ABKC 4DO2A 2DQ3A 1EBOA 3B77A 2X6BA 2Y69B 4TWKA 3W7TA 2IJIA 2ATKC 1NVPD 4F4LA 3ZRXA 2HJFC 3JCZA 4X89A 4Q20A 3B8NA 3WG7B 2HFEC 3K0GA 4JYCA 5GW7A 2R9RB 1OCCC 2OTLV 4TT3G 1YIJV 2LFSA 1J95A 1KECA 1R3IC 2Q67A 3CYOA 5HFLA 1F51A 1I5XA 1THZA 2WLLA 1Y4MA 3AG2C 2WLIA 3JD0A 2WLMA 1NH2D 4WFEA 2B1GA 3AG1B 4MTXA 3OR6C 1SERA 1BHBA 4JAVA 2IU0A 3CCVV 4JTDB 3K9AA 1NKDA 3F7YC 3RVYA 4MVZA 1MG1A 4MSWC 2A79B 5CN0A 4XBFA 2V1DA 5DN6G 1OCCB 3OAAG 1FXKB 1I5YA 4MVSA 3TETA 1KQSU 1BHAA 1H8HG 1H38A 3UM7A 4WF9V 3F7VC 1K5QA 4ZKIA 3EHBB 4J9ZB 4QE7A 3LDCA 1NVPB 3VBBA 1OHHG 4R50A 2QE7G 1YITV 1JPXA 1RPRA 4PA7A 2Z5UA 5EBMC 4FK5C 3E86A 2AHZA 3K3WA 5KUKA 5B1AB 1G8MA 5LGNA 2FTKA 3GB7C 4ASUG 4ZBMA 1GO3F 4PELA 2HVJC 3SPHA 2D3OW 3MHSC 3ZCCA 1M56C 2EIMC 1K97A 4U7OA 3E89A 4YXWG 1E79G 1YJNV 1QLNA 1QVGU 4R8CA 1NH2B 1VQ5V 2ZXWC 3ZMZA 1YSCA 1OCZC 3FB8C 3D36A 4LCUC 2X6CA 3AG4B 2QEXV 2HLDG 1JCHA 1VQ8V 2HKOA 5L3BA 1VQPV 3OGCC 3CD6V 4XDKA 3SYPA 1GKFA 2OT5A 4RUEA 2W0FC 2X6AA 3JD4A 4UV8A 2BOBC 2ITCC 2MK3A 2LFRA 3ASNB 4QPJA 3ZMTA 3OFNG 2XAHA 2EIMB 5B1OA 3G71V 1M57C 2P7TC 1OCOB 4MVMA 2XAQA 2W6JG 3FYIB 3CP1A 4QE9A 4CZZA 2P90A 3W7WA 1OCZB 1S72V 5EC1C 2OTJV 3JYCA 4BW5A 1DF5A 4P9PA 3TCUA 3EFFK 1YHQV 1YI2V 1ORQC 3CCRV 2B1IA 2WSSG 5EBWC 1ENVA 1PD3A 3M99B 3ASOB 4GCZA 3FB6C 3K06A 4FIPC 2P6JA 5B1BC 3E35A 1E1RG 3OMNB 4MT8A 1N8RW 2KB1A 4H33A 2AHYA 4JTAB 3ZIAG 1BL8A 3R65A 2EINB 3JD1A 5IYCO 3SPJA 3CCLV 3ZMUA 3ABLB 1AROP 1NR1A 4GX5A 3SPCA 4RO2A 3ABMB 1W0KG 1YTFD 4PA9A 1JQ0A 3G6EV 2EILC 1P4RA 3K03A 4HZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDV A;  3AG3 C;  1ZWI C;  2OCC C;  3OR6 C;  2WLH A;  3KG2 A;  2A0L A;  2ZD9 A;  4JTD B;  1QLE C;  3F7Y C;  4UUJ C;  3RBZ A;  5B3S C;  5BZB A;  3RVY A;  3SJQ C;  4MVZ A;  4MSW C;  3ASN C;  2A79 B;  2IH3 C;  3E8B A;  4OXS A;  4MVR A;  3TET A;  4MVS A;  4R7C A;  4MW3 A;  4RAI A;  4MTG A;  4QNH B;  1R3K C;  1OCO C;  3UM7 A;  2EIK C;  3K08 A;  3OUF A;  3F7V C;  3STL C;  2YEV A;  4J9Z B;  3LNM B;  4LP8 A;  4WFG A;  5EC2 C;  4QE7 A;  3LDC A;  4R50 A;  3X2Q C;  3T4D A;  3ZRS A;  3F5W C;  4MTF A;  4PA7 A;  5EBM C;  5EK0 A;  3SYA A;  3E86 A;  1K4C C;  2AHZ A;  4G28 B;  5KUK A;  4G27 B;  3ASO C;  4X8A A;  1K4D C;  4PDM A;  3T2M A;  4KFM A;  4LBE C;  2QKS A;  3GB7 C;  4ZBM A;  3ZJZ A;  3E8G A;  4XDJ A;  4GX2 A;  1V55 C;  2HVJ C;  1P7B A;  3SPH A;  3LDD A;  3WG7 C;  2DWD C;  3T4Z A;  3LUT B;  4P9O A;  4DXW A;  4MS2 A;  3RW0 A;  1M56 C;  2EIN C;  5CBH A;  3K04 A;  4GX0 A;  2EIM C;  5E1A C;  3E89 A;  2BOC C;  3LDE A;  3SYO A;  4PA4 A;  3ABL C;  4H37 A;  4R8C A;  4MTO A;  2ZXW C;  3ABM C;  3T1C A;  1OCZ C;  3FB8 C;  3UKM A;  1KKD A;  4LCU C;  5EBL C;  2QTO A;  1S5H C;  2X6C A;  2HG5 C;  3AG1 C;  4PDR A;  2Y69 C;  2DWE C;  4P30 A;  2WLK A;  2WLJ A;  3K0D A;  3OGC C;  4RUF A;  4XDK A;  1JVM A;  2A9H A;  3SYP A;  3RVZ A;  4HYO A;  4MVQ A;  3IFX A;  4RUE A;  2W0F C;  4P2Z A;  4PA6 A;  2X6A A;  2BOB C;  1XL4 A;  2ITC C;  2NLJ C;  3IGA C;  1XL6 A;  1LNQ A;  2ITD C;  2WLL B;  3OUS A;  3SPI A;  5J9P C;  1M57 C;  2P7T C;  3E83 A;  2WLI B;  2HVK C;  4MVM A;  5KUM A;  4R6Z A;  3VOU A;  5CBF A;  2Q68 A;  4QE9 A;  3OR7 C;  2Q69 A;  4X88 A;  3ABK C;  4J9Y B;  5EC1 C;  3STZ C;  1V54 C;  2IH1 C;  3JYC A;  4BW5 A;  4EKW A;  2X6B A;  3TCU A;  4P9P A;  3E8F A;  4TWK A;  3EFF K;  3HPL C;  1ORQ C;  2ATK C;  2EIJ C;  4I9W A;  5EBW C;  5B1A C;  4F4L A;  2HJF C;  3SYC A;  2JK5 C;  3FB6 C;  4MW8 A;  4WFF A;  4X89 A;  3SPG A;  2H8P C;  3K06 A;  5B1B C;  5IY5 C;  4WFH A;  2HFE C;  4JTC B;  4CBC A;  2KB1 A;  3K0G A;  1R3L C;  1G4Y B;  4H33 A;  2AHY A;  4JTA B;  4PDL A;  2Q6A A;  2R9R B;  1OCC C;  1BL8 A;  3R65 A;  4XDL A;  3E8H A;  4MVU A;  4MVO A;  1OCR C;  3PJS K;  3SPJ A;  3SYQ A;  1J95 A;  3FB7 C;  1R3I C;  2K1E A;  2Q67 A;  2WLN A;  4PA3 A;  2DYR C;  4GX5 A;  3BEH A;  3FB5 C;  3SPC A;  4RO2 A;  1R3J C;  5CBG A;  2WLL A;  4PA9 A;  3AG2 C;  2WLI A;  4GX1 A;  2EIL C;  2WLM A;  2DYS C;  4WFE A;  3AG4 C;  3K03 A;  4HZ3 A; 
#chains in the Genus database with same CATH topology
 4RQF A;  2GV9 A;  5KLV H;  5JCO C;  2E74 B;  2KG7 A;  3B09 A;  2E5L B;  4A5U B;  4O2B A;  4LWS B;  2VS0 A;  3CME V;  1VQN V;  2C2A A;  1ZLZ A;  2PI4 A;  5KHG A;  1IUR A;  3ZHU A;  2YEV A;  3HKC A;  4NR1 A;  2EIL B;  4JI6 O;  3ICX A;  1LUV A;  5EK0 A;  1VQL V;  3SGI A;  3SYA A;  1IX9 A;  1EZV H;  4GKJ B;  2ZDI A;  1VF5 B;  4CH5 A;  5B3S B;  4TQF A;  5LYJ A;  3C3T A;  3ZJZ A;  3K57 A;  3ABU A;  3CCM V;  1VMG A;  1TVK B;  1WN7 A;  2P67 A;  1YTF B;  1N32 B;  3C3S A;  3LDE A;  1I08 A;  4JI1 O;  3X2Q B;  1X59 A;  1SQB H;  5LGT A;  2IJJ A;  3FYE B;  4K3A A;  1VF7 A;  3DC6 A;  2WLJ A;  3CS5 A;  4DR6 O;  4HYO A;  1PNM A;  4IT5 A;  2CK3 G;  4MVQ A;  3W7S A;  1MOF A;  3D3I A;  3ZN1 A;  2E3C A;  2IM9 A;  3RYC A;  3U0Z A;  1R6N A;  2VQE B;  1K3E A;  2M7W A;  3G4S V;  4I4T A;  4X65 O;  1I94 O;  1COW G;  3STZ C;  1SET A;  5H2F Z;  2H3O A;  2YIA A;  3JAR B;  3ZRW A;  3OTO B;  2KQX A;  1N36 B;  2F4V O;  3HKB B;  3BPZ A;  5B66 Z;  3KKY A;  1M56 B;  2QGN A;  3E8H A;  4IL6 Z;  4EB6 A;  1VQM V;  3T1Y O;  1F23 A;  3FB5 C;  1RP3 B;  4JI4 O;  2ZCE A;  1AI6 A;  2K9P A;  4DV0 B;  4GLX A;  2OIG A;  4UV9 A;  2ZR2 A;  4PDV A;  1EN6 A;  2EIJ B;  1VAR A;  4X64 B;  4DW0 A;  1S77 D;  2H94 A;  1VQ6 V;  4QIW F;  2CTR A;  1H2G A;  3JCU Z;  4H13 B;  4MVR A;  4L87 A;  1Q86 W;  4QNH B;  5BMV B;  4DR2 O;  1SF9 A;  1ZTE A;  2F93 B;  3JD3 A;  3ZRV A;  1WA8 B;  4J10 A;  4WFG A;  5EC2 C;  3IC9 A;  1MMM A;  5LHH A;  3IC7 A;  2YDE A;  3ZRS A;  1UPG A;  1URF A;  3RN4 A;  4G28 B;  1QR9 A;  1OZ0 A;  2ZR3 A;  3A2F A;  3LUT B;  4P9O A;  3BA9 A;  1ZL8 B;  3TGU H;  2VQF B;  2JIZ G;  5KAF Z;  5LA6 B;  1Z5V A;  2JJ1 G;  3CC2 V;  4I50 B;  2CE4 A;  5B5E Z;  2N74 A;  1Y76 B;  1D5A A;  2QTO A;  2UUC B;  2HG5 C;  1RSO A;  2NR5 A;  1LUW A;  2IBZ H;  4LF6 O;  3QTC A;  3IFX A;  1XIL A;  4B7K A;  5J2U A;  3A0R A;  1FXK C;  3J7A U;  2JDI G;  3QO7 A;  2ITD C;  2HJD A;  3JAS B;  2GUZ A;  2JGU A;  3OM3 B;  4LFC B;  2YXL A;  2KKW A;  1JOY A;  1H2S B;  4O2B B;  2UXB O;  1PM9 A;  4LF5 O;  1V9P A;  1V55 B;  2ODM A;  1S3J A;  1GM7 A;  5A2Q N;  3OW2 U;  1M5I A;  4UVC A;  4XDL A;  4MVO A;  3PJS K;  3AEI A;  3FB7 C;  1WB7 A;  4FPP A;  1N0N A;  4JI0 B;  5LYJ B;  4NTX A;  1RM1 C;  5H9C A;  5L3G A;  3ASN C;  3E8B A;  2CTW A;  1M1K W;  4OXS A;  4D7S A;  5BR8 B;  3UQ8 A;  3JAK A;  4YIO A;  2QM4 A;  4KUM A;  3CRC A;  3BAB A;  4DYL A;  1K8A W;  3CCS V;  4O2A B;  4UCT A;  5LXT A;  2PUS A;  4BR6 A;  2LW1 A;  3RYC B;  2CH7 A;  3LDD A;  2ZQM A;  1OCR B;  3VQW A;  1FJG B;  2DYR B;  3I5D A;  3T1H B;  3K59 A;  1GM9 A;  2EUL A;  3DXR A;  2CTP A;  4JI6 B;  1Q43 A;  1P84 F;  2ETN A;  1SC5 B;  2GHY A;  3DTU B;  3CCE V;  1A32 A;  1S5J A;  4EB6 B;  1XL4 A;  4NXN O;  4X1K A;  3OEH G;  4ZI7 A;  1MSW D;  4Q6G A;  2UUA B;  2PY5 A;  4LF4 O;  1BMF G;  5KUM A;  2V7Q G;  4KP4 A;  3VOU A;  5C93 A;  3OGI B;  1XOU A;  3ETG A;  4DO2 A;  1R1B A;  3B77 A;  1OV9 A;  4TWK A;  2IJI A;  2ATK C;  1BE3 H;  2ADP A;  3ZRX A;  4DK1 A;  3VQX A;  3B8N A;  3WG7 B;  2UXC O;  5GW7 A;  3ZED A;  1OCC C;  2QJ1 A;  4PI0 A;  1YIJ V;  2LFS A;  1J95 A;  1KEC A;  2HP8 A;  5GTH Z;  1I94 B;  2JRI A;  5CA0 A;  1I5X A;  2XUM A;  1THZ A;  5EIB C;  1ZSP A;  1J5E B;  1NH2 D;  4WFE A;  1FFX A;  1Q3E A;  1BHB A;  4J11 A;  4C7U A;  3N2K B;  4AQY B;  4JAV A;  2BTQ A;  5IJ0 B;  4JI7 O;  3RVY A;  4MVZ A;  5CN0 A;  2F95 B;  4PV1 B;  4JV5 B;  1NZ6 A;  4DV1 O;  1H8H G;  3T1Y B;  3O9O A;  4U3F H;  4JI4 B;  4LFA O;  2E76 B;  2LQT A;  3EHB B;  1RSO B;  2Q73 A;  3HKD A;  3VBB A;  4LNU A;  2O57 A;  1JPX A;  1RPR A;  4B3S B;  2Z5U A;  4NB5 A;  5J2U B;  5KUK A;  5B1A B;  1WNS A;  4IGG A;  3MHS C;  3ZCC A;  3B4S A;  1HNW O;  4DV6 B;  1GRJ A;  1Q6I A;  4YXW G;  1VF6 C;  1YJN V;  4R8C A;  3UT5 A;  1NH2 B;  4B3R O;  3ZMZ A;  5DED A;  1GN4 A;  4DV2 O;  1AIL A;  3AG4 B;  2RN9 A;  2HLD G;  1VQ8 V;  5L3B A;  4RUE A;  3EXA A;  1Q6U A;  1XNQ B;  3FD9 A;  2ZM6 O;  1WJZ A;  3G71 V;  1M57 C;  2P7T C;  5KX5 A;  4FFK A;  2XAQ A;  4LWS A;  1O9H A;  2P90 A;  4FLZ A;  3W7W A;  1S72 V;  1BT8 A;  2QSA A;  2BSK B;  5EC1 C;  3H1H H;  3CCR V;  2WSS G;  4FLT A;  4LF6 B;  3L9D A;  4TV8 A;  1YDX A;  1N33 B;  4MT8 A;  1H2N A;  2KB1 A;  2W0X A;  2AZ0 A;  3ZIA G;  3AK1 A;  3JD1 A;  5IYC O;  3JSL A;  3ABL B;  2YIB A;  1TVK A;  2E75 B;  5LXT B;  1YZB A;  4DK0 A;  3G6E V;  1P4R A;  1PNK A;  2UXB B;  5KAI Z;  2CH7 B;  2WLH A;  4NTY A;  5A9G A;  4LF5 B;  4EEQ A;  4UFZ A;  2A3Q A;  1W59 A;  4FFB B;  4QPK A;  4E2L A;  4EFB A;  4RAI A;  1U97 A;  1LR1 A;  2YC0 A;  4GT1 A;  1KYO F;  3KCX A;  2EIK C;  3K08 A;  4DR7 B;  4UB6 Z;  1JX9 A;  3ABK B;  2Z3Y A;  1R73 A;  2EBO A;  1D5N A;  1Q8I A;  2CTQ A;  3BCC H;  4FM1 A;  1KKC A;  5L3F A;  4ZI7 B;  2JS5 A;  3JD2 A;  2QKS A;  2XND G;  2X7R B;  3E8G A;  4XDJ A;  1IDS A;  4WFA V;  1P7G A;  3A0H Z;  1JA8 A;  3CRA A;  2QM7 A;  1QR8 A;  5CBH A;  3HKB A;  3Q4H A;  2CGN A;  4FLW A;  1CXZ B;  5KA6 A;  4X66 O;  3BA8 A;  1SRY A;  5KHI A;  3AG2 B;  4TQD A;  2N05 A;  5IWA O;  5EBL C;  4GUN A;  2XAG A;  2QKC A;  1VQ4 V;  5KA5 A;  2DWE C;  2CAZ C;  1IBK O;  3OEE G;  2PF4 E;  2YID A;  1AI4 A;  2NLJ C;  4ZHQ A;  4ABM A;  1QHT A;  1L0L H;  1DF4 A;  1B04 A;  1KBH A;  1T5E A;  2YI9 A;  1FFX B;  4TSF G;  5CA3 A;  1CP9 A;  1V54 C;  2IH1 C;  5EZY A;  2DW4 A;  2BTQ B;  5BMV A;  1WA8 A;  3CCU V;  2UUB O;  1HR0 O;  2QA4 V;  2JK5 C;  1YJW V;  3M8A A;  3QNE A;  1H2K A;  4JTC B;  1SQQ H;  1TAE A;  2UXN A;  1BS3 A;  1JR9 A;  1SKV A;  2WA3 A;  2DE0 X;  1AJQ A;  3H1K H;  1WP8 A;  2ZXW B;  1R3J C;  2ZIO A;  5CBG A;  5IJ9 A;  2R9I A;  2EZO A;  5LA6 A;  3KCY A;  3PN1 A;  1EFR G;  5ITZ A;  1QBZ A;  1ZWI C;  4PHZ A;  4I50 A;  2Q9L A;  5JH7 B;  2UXC B;  1Y76 A;  4WBN A;  3SJQ C;  3LSQ A;  2ADQ B;  4LH6 A;  5IYZ B;  3UT5 B;  1XMQ B;  3MD0 A;  2ZE5 A;  3K79 A;  4PJ0 Z;  5LBQ A;  1SQP H;  2YIB D;  4X9Q A;  3RYF B;  4JI3 O;  4KFM A;  1NT2 B;  3CRR A;  5KX5 B;  1FPO A;  4DV1 B;  3WB2 A;  3CC4 V;  3IJ4 A;  5E1A C;  3SYO A;  4PA4 A;  2BTO A;  1SQF A;  4H37 A;  1YJ9 V;  5DEC A;  4YIP A;  2LW7 A;  1UJW B;  1H2M A;  4FVM A;  3ZHQ A;  4TV8 B;  3GWO A;  3HB3 B;  4FM0 A;  2OCC B;  5IE9 A;  4FLV A;  1F4M A;  2WLK A;  4RUF A;  1IZ3 A;  4K0K B;  5D5P A;  4B3M O;  4JI8 O;  3SPI A;  3OUS A;  3K58 A;  4KHP B;  1EN4 A;  3QF7 A;  4B3T O;  1BQ0 A;  3WB0 A;  3E8F A;  1HP8 A;  2UU9 O;  2V4D A;  2ZE6 A;  5CMU A;  4O2A A;  4OPA A;  4NVP A;  1US6 A;  1G4Y B;  1IBL O;  1YXB A;  4GKK O;  2ZIN A;  5H6R A;  1Q82 W;  2M6Y A;  4PA3 A;  4OPH A;  4DR4 O;  2MW2 B;  2XAS A;  4CS3 A;  4EFE A;  3AK2 A;  3F5T A;  3MHH C;  3L73 H;  4DV3 O;  5CA1 A;  1JMK C;  5BZB A;  3RBZ A;  3Q4H B;  4JAS A;  5L3E A;  3MDS A;  4JAA A;  1PP9 H;  2PGG A;  1VP7 A;  1OCO C;  1R6T A;  4LC1 A;  3H1I H;  1FXV A;  3S3W A;  5KHJ A;  2DJV A;  2WAM A;  5H5N A;  3W7X A;  1RM1 B;  4DR3 O;  1CEZ A;  1WPX A;  3ASO C;  2Q7G A;  4ZHQ B;  1BQZ A;  2FB5 A;  5FLX N;  3LNN A;  3CC7 V;  3ZN0 A;  1TUE B;  3FAV B;  4LFB O;  2EIN C;  4GX0 A;  3B2E E;  2LGQ A;  5EZY B;  1K33 A;  5LP6 A;  2QWR B;  2EZP A;  1HNZ B;  5KHK A;  4F6E A;  4O4I A;  4NXM B;  2L6L A;  1AB3 A;  3NXS A;  5FL7 G;  3ZX6 A;  2A9H A;  3CCQ V;  2KSD A;  4X20 B;  4I55 A;  4TV9 A;  4LF8 O;  1E1Q G;  2IU3 A;  2DOS A;  5C8Y B;  2BCC H;  3N2K A;  1YVW A;  4BIU A;  5IJ9 B;  5IJ0 A;  2F66 C;  2EX3 A;  4Z1V A;  4R6Z A;  1XHZ A;  1HWY A;  4UB8 Z;  5ITZ B;  5IYB O;  3QVN A;  3W7T A;  4WBN B;  4F4L A;  2R9A A;  4X89 A;  2DN9 A;  1UFI A;  4DUZ O;  4JYC A;  3FFQ A;  2GTA A;  1BCC H;  2OTL V;  1NI8 A;  4TT3 G;  4CH4 A;  4DR1 O;  1R3I C;  2Q67 A;  1F51 A;  3K5L A;  2JS3 A;  3ZHS A;  2WLL A;  1SQG A;  1Y4M A;  3JD0 A;  4UCR A;  3AG1 B;  1PV0 A;  2P22 C;  3K5N A;  4CS4 A;  2UUB B;  1HR0 B;  2YUA A;  5BXZ A;  1RFY A;  4JTD B;  3RYI A;  3F7Y C;  4BWA A;  1YCI A;  1MG1 A;  4MSW C;  4DV5 O;  2A79 B;  5DN6 G;  1OCC B;  3TET A;  1I5Y A;  4JI5 B;  3LSU A;  1JJO A;  1H38 A;  4LR3 A;  5CB4 B;  2ZIM A;  4ZKI A;  4J9Z B;  5LMU B;  1XHX A;  2A06 H;  4R50 A;  1YEW A;  1YIT V;  5LOV B;  3THO A;  2BSK A;  5LGN A;  4ASU G;  4DV7 O;  1GO3 F;  4PD4 F;  2HVJ C;  3SPH A;  3UCS C;  4YHH O;  1M56 C;  1XNR O;  1K97 A;  4LH7 A;  1E79 G;  1OCZ C;  3CXH F;  1NTK H;  4U3J A;  3H1J H;  3BFR A;  4JI2 O;  2B9Z A;  3SYP A;  1L8D A;  2W0F C;  4HNA A;  3K5M A;  2Q7H A;  2ITC C;  2MK3 A;  2CUG A;  4QPJ A;  3OFN G;  3SDL A;  4LF7 O;  4OX9 O;  5FPR A;  1KUQ A;  3D36 C;  2W6J G;  4CZZ A;  3CP1 A;  4QE9 A;  4FFB A;  2F1M A;  2ILM A;  2QWQ B;  2OTJ V;  1MZF A;  5CA1 B;  3TCU A;  3EFF K;  1YHQ V;  1YI2 V;  1ORQ C;  3CRQ A;  3RYH B;  3FB6 C;  5JCO A;  3GWK C;  4H33 A;  2AHY A;  3R65 A;  3SPJ A;  5JVD B;  4JYY A;  3CCL V;  1SQX H;  4JI1 B;  2OIE A;  3BRC A;  5GTI Z;  1Z2G A;  3ABM B;  4PA9 A;  4J7K A;  2UU9 B;  5IYD O;  4LF9 O;  2Y0I A;  4DR6 B;  4UUJ C;  1NJI W;  3G67 A;  3CHX A;  3U11 A;  1IBL B;  1U96 A;  3DC5 A;  4YY3 O;  5LP6 B;  2CGO A;  2Z0A A;  5JJN B;  1DK1 A;  5HFM A;  4X62 O;  4IYI A;  4O4I B;  4X65 B;  3BHP A;  2P4K A;  5D5Q A;  4UCV A;  1VQK V;  3IAY A;  3T4D A;  1G6U A;  3F5W C;  3JAW B;  4I55 B;  4TV9 B;  3LSS A;  1L1F A;  1K4D C;  2F4V B;  1DTO A;  4GX2 A;  1V55 C;  4KL1 A;  3SJA C;  1FYJ A;  2WWW A;  1CPY A;  1DLB A;  3QO5 A;  5FNV B;  1VQ9 V;  1XQ8 A;  2P5O A;  3HR0 A;  2LGW A;  2ZDI C;  1S5H C;  3FKS G;  4IIJ A;  4P30 A;  2FYU H;  2E5L O;  1D2D A;  3L71 H;  5H6Q A;  3TXS A;  4U7N A;  1EZJ A;  3A8T A;  3IGA C;  1QVF U;  1Q5O A;  4N23 A;  5JH7 A;  2WLL B;  4J80 A;  4DR2 B;  3OR7 C;  5IYZ A;  3H01 A;  4J9Y B;  1FFT B;  3HKE B;  2IW5 A;  1FD9 A;  3RYI B;  2ZKO A;  2AGA A;  1S0V A;  5LL6 Y;  2JEU A;  4D6T H;  1PKX A;  3RYF A;  1K7D A;  4UVB A;  1R3L C;  2D2C B;  4I5S A;  1OCR C;  1N32 O;  2WLN A;  2YS8 A;  5L3C A;  2DYR C;  5LHI A;  3CMA V;  1GK9 A;  1SZT A;  4GX1 A;  2NNU A;  3ABT A;  1NTM H;  1AJP A;  3P3P A;  4WFB V;  5K1X A;  3AG3 C;  1Y66 A;  3KG2 A;  2A0L A;  1NR7 A;  1Y6X A;  4UCU A;  3P3N A;  1XRE A;  2JVD A;  1I7F A;  4MW3 A;  2G38 A;  5JWP A;  4MTG A;  3AK3 A;  4JPR A;  4U3J B;  3OUF A;  1AI7 A;  4FZ0 A;  2ZNI A;  5B1N A;  2PZS A;  3APO A;  4LP8 A;  2FML A;  1Y67 A;  4G2K A;  4DR5 O;  1IXM A;  4HNA B;  4HAM A;  4X8A A;  4LBE C;  1MNG A;  5B1B B;  3WG7 C;  1N36 O;  1M9N A;  2UXD O;  5FPO A;  4J7Z A;  4KXR A;  3DSQ A;  1FXK A;  4MTO A;  3T1C A;  1R6K A;  4RQE A;  5F2V O;  4DV0 O;  1AR4 A;  3K0D A;  4DV7 B;  1JVM A;  1K34 A;  4X64 O;  1B3Q A;  1GMG A;  1XL6 A;  1SA0 B;  1X4T A;  5AG2 A;  2N04 A;  1N34 O;  2JGD B;  4F6R B;  3BY6 A;  4O4J A;  2GTS A;  3RT3 C;  1AJN A;  4JI2 B;  3HPL C;  2Y4U A;  5B1A C;  4Z1M G;  1XBL A;  1AR5 A;  4WFF A;  3SPG A;  1Q7Y W;  4CH3 A;  1W0J G;  5IY5 C;  3JAL B;  1MSD A;  4CBC A;  4LF7 B;  4CH6 A;  2QWN B;  4OX9 B;  2ZE8 A;  3SJC C;  2Q6A A;  4NTW A;  1Y74 A;  4BAY A;  2QM8 A;  4MVU A;  3SYQ A;  2VQF O;  3CXC U;  2K1E A;  4ZOL B;  3FAV A;  2XHB A;  1WP7 A;  2LO1 A;  3OT7 A;  2DYS C;  3AG4 C;  1GAX A;  2UUC O;  2A7W A;  3D3Q A;  2ZD9 A;  4DW1 A;  1QLE C;  3ETQ A;  1GN3 A;  4NXN B;  3L70 H;  4LF4 B;  3RWR D;  4X20 A;  4JAU A;  1R3K C;  3J80 N;  2R72 A;  3OD4 A;  1ZUQ A;  4J42 A;  4H44 B;  5C8Y A;  3LNM B;  4IIJ B;  5EYP B;  3ML0 A;  3I56 V;  3U10 A;  1QU7 A;  4TUY A;  3JAT A;  4FM2 A;  2JJ2 G;  3SR2 C;  1O9G A;  1HDJ A;  1VQ7 V;  4ZIB A;  2BOC C;  4N21 A;  3QO8 A;  3ABL C;  1AR1 B;  2DQ0 A;  3P32 A;  4PDR A;  2Y69 C;  4JI0 O;  1XUQ A;  2RDC A;  4JI7 B;  2RNB A;  1NBM G;  4PA6 A;  2PI5 A;  5LMN O;  2QR4 A;  4FLX A;  3TXQ A;  4O4L A;  4OGQ B;  1XMO O;  3E83 A;  4LFA B;  1K5S A;  1PL0 A;  3ZMS A;  5LGU A;  1IVS A;  1PNL A;  4RWU A;  3P30 A;  2Q69 A;  1KD1 W;  3ABK C;  2DQ3 A;  3QG5 A;  5CB4 A;  1WPB A;  1NVP D;  3ZHV A;  3JCZ A;  4Q20 A;  5LOV A;  3BVO A;  3K0G A;  1HNW B;  3SJB C;  4B3R B;  1FJG O;  5K1P A;  5HFL A;  3VQY A;  1B06 A;  4JYA O;  3T1H O;  4DV2 B;  3AG2 C;  2WLI A;  2WLM A;  1NS1 A;  3J81 N;  2XT9 A;  4MTX A;  3OR6 C;  2IU0 A;  3CCV V;  4K8Z A;  4UCO A;  3K9A A;  2OCH A;  2RMK B;  4XBF A;  2V1D A;  2ZM6 B;  3OAA G;  1FXK B;  4MVS A;  2UUA O;  5GON B;  3UM7 A;  4WF9 V;  4X1Y A;  3R66 A;  4QE7 A;  3LDC A;  1NVP B;  1OHH G;  1VF6 A;  1IBM O;  4PA7 A;  3OTF A;  1I0H A;  3E86 A;  2AHZ A;  5J2T A;  1MA1 A;  4O4H B;  3GB7 C;  4YJ2 A;  4ZBM A;  1QNM A;  4O4J B;  3L72 H;  1VEW A;  3RYH A;  2EIM C;  2WA4 A;  4U7O A;  3E89 A;  2YI8 A;  1XEQ A;  1VQ5 V;  2ZXW C;  1YSC A;  5JVD A;  2RCV A;  2GBO A;  4LCU C;  4DR5 B;  2OYQ A;  1J5E O;  1G1X B;  5JJE B;  4AQY O;  3RGB A;  1Y74 B;  3CX5 F;  2UXD B;  2BOB C;  3ASN B;  2LFR A;  3ZMT A;  1HNX O;  5B1O A;  4JV5 O;  3O65 A;  4HBN A;  3APQ A;  2FL4 A;  1OCZ B;  4E4E A;  3JYC A;  1N0J A;  4B3S O;  2B1I A;  1YF2 A;  4GCZ A;  4K8X A;  4FIP C;  2P6J A;  4X1I A;  3E35 A;  3OMN B;  3JAW A;  3ZHR A;  4JTA B;  4I9Q A;  1N34 B;  1BL8 A;  4I7Z B;  5JJJ B;  5KHH A;  1ZAU A;  4DV6 O;  3K9S A;  4X66 B;  1ARO P;  1NR1 A;  4GX5 A;  3SPC A;  4RO2 A;  4TUY B;  5IWA B;  3JAT B;  2EIL C;  5FNV A;  2RJZ A;  2OCC C;  5EIB D;  1IBK B;  2VWJ A;  3W7U A;  2Y0P A;  3ZMV A;  5B3S C;  2Q0O C;  3CJH A;  5JQG B;  1XNQ O;  1IXB A;  2VWK A;  1K92 A;  3B40 A;  3X2Q C;  1F4N A;  1SQV H;  1VQO V;  1Q81 W;  2XAF A;  4JZ2 A;  1FS0 G;  3HKE A;  4O4L B;  4UVA A;  4IHJ A;  1NTZ H;  4K35 A;  1ROP A;  2Q8V A;  1N33 O;  4W4K A;  1H2L A;  3UO2 A;  4DXW A;  4J41 A;  1P49 A;  1L0N H;  1WB8 A;  2YIC A;  1AI5 A;  2VRZ A;  2KG7 B;  1TGO A;  5IDJ A;  4ICG A;  5L3D A;  2Q5Z A;  1H8E G;  3N2G A;  2EJ7 A;  3RVZ A;  3D8C A;  3TJT A;  4P2Z A;  2GSM B;  4DUY O;  3G6B A;  2LJ2 A;  2EJR A;  2YEV B;  2GDS A;  2XTA A;  3E22 A;  3HKC B;  1QCE A;  3M7M X;  2WLI B;  2JEX A;  1GM8 A;  2FKX A;  5BY1 A;  2Q68 A;  4DR7 O;  3VQV A;  1B6Q A;  1W2B U;  1FXH A;  4JI3 B;  2EIJ C;  4I9W A;  2P4V A;  3G80 A;  3SYC A;  4MW8 A;  2H8P C;  5LMN B;  1JJ2 U;  1BSM A;  4PDL A;  5LHG A;  1XMO B;  1HW7 A;  3WFV A;  2YSU B;  4X1Y B;  1K73 W;  1GH6 A;  1WLE A;  2ZNJ A;  2BE3 A;  1M93 A;  1N4C A;  5IT9 N;  1MAB G;  5J2T B;  4QJF B;  4NYK A;  4JGS A;  1KP2 A;  4YJ2 B;  4BIZ A;  4JZG A;  3ETE A;  4JYB A;  2Q4P A;  3CSX A;  3OE7 G;  3H9V A;  1S5L Z;  2IH3 C;  4B3M B;  4I4T B;  4JI8 B;  4R7C A;  4DV4 O;  1Z5W A;  1M57 B;  2HR3 A;  4JYA B;  4B3T B;  2W6I G;  3DGE A;  3ZRW B;  1SA0 A;  2JGD A;  4F6R A;  2B5U A;  3CCJ V;  3AG3 B;  2WPD G;  1AP6 A;  4DRX A;  3T2M A;  2QDO A;  2XOK G;  1NU1 H;  3RFR A;  1P7B A;  4GKK B;  4MS2 A;  3RW0 A;  1M90 W;  3K04 A;  3GVM A;  3JAL A;  4DR4 B;  4UXN A;  1F7Y A;  3FX7 A;  1IBM B;  1KKD A;  3EVK A;  1SS3 A;  4DV3 B;  3AG1 C;  4YJ3 A;  4X1I B;  3K5O A;  4ZOL A;  4FLU A;  4UCS A;  1GTO A;  2ARH A;  2Y4T A;  3L74 H;  1MZE A;  1LNQ A;  4FLY A;  2HHH O;  2LP7 A;  1XMQ O;  5KMG A;  2HVK C;  5CBF A;  2Y48 A;  1ZX3 A;  2EIK B;  2XAJ A;  3MAQ A;  3A0B Z;  4EKW A;  4W4L A;  4DR3 B;  3ETD A;  3CJH B;  2IJH A;  5EYP A;  4B7E A;  3S3X A;  1JFF A;  4WFH A;  3E2E A;  1HNX B;  4LFB B;  1RPO A;  2IJK A;  3BEH A;  5E79 Z;  3CWB H;  3C90 A;  4I0X A;  1K9M W;  1KMI Z;  2Q7E A;  2YXY A;  2AXT Z;  4IHJ B;  5DM6 V;  3ZBH A;  4FMT A;  1TUB A;  4GKJ O;  5IY5 B;  4LF8 B;  2GUZ B;  4K0K O;  1PL4 A;  2YXH A;  1S76 D;  3OMI B;  4KHP O;  3STL C;  1KP3 A;  3N2G B;  2UXX A;  3CPW U;  1V54 B;  2DYS B;  1GN6 A;  1WAZ A;  4MTF A;  1K4C C;  4G27 B;  1QLE B;  2QKA A;  4PDM A;  2F43 G;  2CDY A;  3E22 B;  3OMA B;  4DUZ B;  2X0L A;  2DWD C;  1OJH A;  3T4Z A;  1TA8 A;  4BIO A;  4DR1 B;  3I55 V;  2PYJ A;  4B08 A;  2VQE O;  3ABM C;  1Q90 D;  3TK1 A;  3UKM A;  4CC6 A;  1EN5 A;  2HEP A;  1EM1 A;  2R70 A;  2Q0A A;  4JF3 A;  1XI1 A;  3B8M A;  1NQT A;  1VIB A;  1KC8 W;  4DV5 B;  4WCE V;  3JAK B;  3OTO O;  2AW9 A;  5LP6 C;  3NR7 A;  4TOI A;  5J9P C;  4L8J A;  4D7T A;  1SES A;  4FJC C;  4X88 A;  4BW9 A;  1EBO A;  4GYC B;  5GON A;  2X6B A;  1AVM A;  3CB2 A;  2Y69 B;  3KZI Z;  2HJF C;  3N27 A;  3BAA A;  3CEI A;  4Z2W A;  4DUY B;  1GN2 A;  4GZR B;  2HFE C;  4AI8 A;  4YHH B;  2R9R B;  1XNR B;  3DXR B;  4O4H A;  2PTM A;  3CYO A;  2QWP B;  2OWO A;  1HNZ O;  4DRX B;  4CC5 A;  4AIL C;  2B1G A;  2L35 A;  1SER A;  4X1K B;  4NXM O;  4H0L B;  1NKD A;  3JAR A;  1BZK A;  1Q6H A;  1XDC A;  1KQS U;  3WU2 Z;  1BHA A;  4QGP A;  3F7V C;  1K5Q A;  2PYL A;  4YJ3 B;  3CE2 A;  2QE7 G;  5EBM C;  4FK5 C;  3ZS8 C;  3K3W A;  1FAF A;  1G8M A;  3H1L H;  2FTK A;  1PPJ H;  5KMG B;  4PEL A;  1QQC A;  1BGY H;  2D3O W;  4DV4 B;  5CA0 B;  4FZ1 A;  1QLN A;  1QVG U;  4LFC O;  3WB1 A;  3L75 H;  3FB8 C;  3D36 A;  3JAM N;  2X6C A;  4LF9 B;  2DMX A;  1JFF B;  2QEX V;  1JCH A;  3CD6 V;  2HKO A;  1VQP V;  3OGC C;  2AZ2 A;  4XDK A;  1GKF A;  2OT5 A;  3UO3 A;  3AG7 A;  4CS2 A;  2X6A A;  3JD4 A;  4UV8 A;  4YY3 B;  5TIS Z;  2XAH A;  2EIM B;  3HKD B;  4X62 B;  4JI5 O;  4LNU B;  4I0X B;  1OCO B;  4MVM A;  4PI2 A;  2NN4 A;  4AHC A;  5JQG A;  3FYI B;  2ZE7 A;  1AP5 A;  1DGS A;  1ZL8 A;  4NKG B;  5LMU O;  4BW5 A;  1DF5 A;  1KU9 A;  3JSN A;  4P9P A;  1TUB B;  1SZX A;  3CRM A;  5EBW C;  1ENV A;  1PD3 A;  3M99 B;  3ASO B;  1KB9 F;  3K06 A;  4IYH A;  2QWO B;  5B1B C;  1E1R G;  1N8R W;  2F23 A;  2HHH B;  2QTS A;  2EIN B;  3ZHT A;  5BR8 O;  2ZT9 B;  4J7J A;  3ZMU A;  1FKA O;  1M4U A;  1W0K G;  1YTF D;  2P06 A;  2RQ6 A;  1JQ0 A;  3JAS A;  3K03 A;  4HZ3 A; 
#chains in the Genus database with same CATH homology
 1PNK A;  5IYD O;  2OCC C;  2WLH A;  4RQF A;  3W7U A;  3ZMV A;  4UUJ C;  5B3S C;  1NJI W;  3CME V;  1VQN V;  4QPK A;  4E2L A;  4RAI A;  2C2A A;  5HFM A;  4GT1 A;  2PI4 A;  2EIK C;  3K08 A;  2YEV A;  1JX9 A;  1K92 A;  3ABK B;  2EIL B;  2Z3Y A;  1VQK V;  1R73 A;  3T4D A;  1F4N A;  3X2Q C;  2EBO A;  3F5W C;  5EK0 A;  1VQL V;  3SYA A;  1VQO V;  3LSS A;  5L3F A;  1L1F A;  2ZDI A;  2XAF A;  1Q81 W;  1K4D C;  1FS0 G;  3JD2 A;  5B3S B;  2QKS A;  4UVA A;  2XND G;  1DTO A;  2X7R B;  3E8G A;  4GX2 A;  1V55 C;  4XDJ A;  3ZJZ A;  1ROP A;  2WWW A;  3ABU A;  3CCM V;  4WFA V;  1CPY A;  2P67 A;  4DXW A;  2QM7 A;  1DLB A;  1QR8 A;  5CBH A;  1YTF B;  3QO5 A;  3LDE A;  1VQ9 V;  5KA6 A;  1AI5 A;  1SRY A;  5IDJ A;  3AG2 B;  3X2Q B;  2ZDI C;  5LGT A;  5EBL C;  5L3D A;  1S5H C;  2XAG A;  2IJJ A;  3FYE B;  1VQ4 V;  1H8E G;  3FKS G;  5KA5 A;  2DWE C;  4P30 A;  2WLJ A;  3RVZ A;  4HYO A;  1PNM A;  4MVQ A;  2CK3 G;  3W7S A;  3OEE G;  4P2Z A;  5H6Q A;  2GSM B;  4U7N A;  1AI4 A;  1MOF A;  1EZJ A;  3D3I A;  3ZN1 A;  2NLJ C;  3IGA C;  2EJR A;  1QVF U;  2YEV B;  4N23 A;  2WLL B;  1DF4 A;  1QCE A;  2WLI B;  1R6N A;  1K3E A;  2JEX A;  1GM8 A;  2M7W A;  2Q68 A;  3OR7 C;  3G4S V;  3H01 A;  4TSF G;  4J9Y B;  1FFT B;  1COW G;  5CA3 A;  3STZ C;  1CP9 A;  1V54 C;  1B6Q A;  1SET A;  2IH1 C;  2DW4 A;  1W2B U;  1FXH A;  2IW5 A;  3CCU V;  2EIJ C;  4I9W A;  3ZRW A;  1S0V A;  2JEU A;  3SYC A;  2QA4 V;  2JK5 C;  4MW8 A;  1PKX A;  1YJW V;  2H8P C;  1JJ2 U;  1K7D A;  4UVB A;  3QNE A;  4JTC B;  2UXN A;  1R3L C;  4PDL A;  5LHG A;  4I5S A;  3WFV A;  1M56 B;  2YSU B;  3E8H A;  1OCR C;  1K73 W;  1WLE A;  1AJQ A;  2WLN A;  1VQM V;  5L3C A;  2DYR C;  1F23 A;  3FB5 C;  2ZXW B;  1R3J C;  5CBG A;  5LHI A;  1GK9 A;  3CMA V;  2R9I A;  1AI6 A;  1MAB G;  1SZT A;  4GX1 A;  4QJF B;  2EZO A;  2NNU A;  3ABT A;  1AJP A;  4JGS A;  4UV9 A;  2ZR2 A;  1EFR G;  1KP2 A;  4PDV A;  4WFB V;  1QBZ A;  3AG3 C;  1Y66 A;  1ZWI C;  2EIJ B;  4BIZ A;  3KG2 A;  2A0L A;  3ETE A;  4JYB A;  1S77 D;  2H94 A;  1VQ6 V;  4QIW F;  3OE7 G;  3SJQ C;  1NR7 A;  1H2G A;  2IH3 C;  3LSQ A;  4MVR A;  4L87 A;  4R7C A;  3MD0 A;  4MW3 A;  1M57 B;  4MTG A;  3K79 A;  4QNH B;  1Q86 W;  2HR3 A;  5LBQ A;  4JPR A;  3OUF A;  1AI7 A;  2W6I G;  3DGE A;  3ZRV A;  3JD3 A;  5B1N A;  3ZRW B;  4LP8 A;  4WFG A;  5EC2 C;  5LHH A;  3IC7 A;  2B5U A;  3ZRS A;  3CCJ V;  4G2K A;  3AG3 B;  2WPD G;  1IXM A;  4G28 B;  4HAM A;  4X8A A;  3T2M A;  4KFM A;  4LBE C;  1QR9 A;  1OZ0 A;  2XOK G;  2ZR3 A;  5B1B B;  3WG7 C;  1P7B A;  1M9N A;  3LUT B;  4P9O A;  4MS2 A;  3RW0 A;  1M90 W;  3CC4 V;  3K04 A;  2JIZ G;  5E1A C;  3SYO A;  4PA4 A;  2JJ1 G;  4H37 A;  1YJ9 V;  4UXN A;  1FXK A;  3CC2 V;  4MTO A;  3T1C A;  1R6K A;  1UJW B;  4RQE A;  1KKD A;  2QTO A;  3AG1 C;  2HG5 C;  3GWO A;  3HB3 B;  2OCC B;  1F4M A;  2WLK A;  3K0D A;  4RUF A;  1JVM A;  1K34 A;  3IFX A;  1GTO A;  3A0R A;  1GMG A;  1FXK C;  2JDI G;  1XL6 A;  1LNQ A;  2ITD C;  3QO7 A;  2LP7 A;  3OUS A;  3SPI A;  2HVK C;  3BY6 A;  3OM3 B;  5CBF A;  2Y48 A;  2EIK B;  2XAJ A;  1AJN A;  4EKW A;  3E8F A;  1JOY A;  3HPL C;  3ETD A;  2IJH A;  5B1A C;  4Z1M G;  4WFF A;  3SPG A;  5CMU A;  1Q7Y W;  1W0J G;  5IY5 C;  4WFH A;  1V55 B;  4CBC A;  3E2E A;  1S3J A;  1G4Y B;  1GM7 A;  2Q6A A;  3OW2 U;  4UVC A;  4XDL A;  4BAY A;  2QM8 A;  4MVU A;  4MVO A;  3SYQ A;  3PJS K;  3AEI A;  5H6R A;  1RPO A;  1Q82 W;  3FB7 C;  3CXC U;  2K1E A;  4PA3 A;  2IJK A;  3BEH A;  2XAS A;  4FPP A;  1K9M W;  3MHH C;  2DYS C;  3AG4 C;  5DM6 V;  1RM1 C;  4FMT A;  2ZD9 A;  1QLE C;  5H9C A;  5BZB A;  3RBZ A;  5IY5 B;  5L3G A;  3ASN C;  4JAS A;  5L3E A;  3E8B A;  1M1K W;  4OXS A;  4JAU A;  1R3K C;  1OCO C;  1S76 D;  4LC1 A;  3OMI B;  1FXV A;  4KUM A;  3STL C;  1KP3 A;  3LNM B;  2UXX A;  1K8A W;  3ML0 A;  3I56 V;  3CPW U;  3CCS V;  1V54 B;  2WAM A;  2DYS B;  4MTF A;  3W7X A;  1K4C C;  1RM1 B;  1CEZ A;  1WPX A;  4G27 B;  1QLE B;  3ASO C;  4PDM A;  2F43 G;  3OMA B;  2JJ2 G;  2X0L A;  3LDD A;  2DWD C;  2ZQM A;  3T4Z A;  3CC7 V;  3ZN0 A;  1TUE B;  2EIN C;  4GX0 A;  1OCR B;  1VQ7 V;  3I55 V;  2BOC C;  1K33 A;  4N21 A;  3QO8 A;  3ABL C;  2DYR B;  2EZP A;  1AR1 B;  3ABM C;  1GM9 A;  2DQ0 A;  3TK1 A;  3UKM A;  3P32 A;  4PDR A;  2Y69 C;  4JF3 A;  3NXS A;  3B8M A;  5FL7 G;  2GHY A;  1NQT A;  2A9H A;  3CCQ V;  3DTU B;  1KC8 W;  1NBM G;  4PA6 A;  4WCE V;  3CCE V;  1E1Q G;  2PI5 A;  1XL4 A;  2IU3 A;  3OEH G;  4BIU A;  1MSW D;  5J9P C;  3E83 A;  1K5S A;  1PL0 A;  1BMF G;  5KUM A;  3ZMS A;  5LGU A;  1PNL A;  2V7Q G;  4KP4 A;  1HWY A;  4R6Z A;  1SES A;  3VOU A;  5C93 A;  3ETG A;  3P30 A;  2Q69 A;  4FJC C;  5IYB O;  1KD1 W;  4X88 A;  3ABK C;  4DO2 A;  2DQ3 A;  1EBO A;  3B77 A;  2X6B A;  2Y69 B;  4TWK A;  3W7T A;  2IJI A;  2ATK C;  1NVP D;  4F4L A;  3ZRX A;  2HJF C;  3JCZ A;  4X89 A;  4Q20 A;  3B8N A;  3WG7 B;  2HFE C;  3K0G A;  4JYC A;  5GW7 A;  2R9R B;  1OCC C;  2OTL V;  4TT3 G;  1YIJ V;  2LFS A;  1J95 A;  1KEC A;  1R3I C;  2Q67 A;  3CYO A;  5HFL A;  1F51 A;  1I5X A;  1THZ A;  2WLL A;  1Y4M A;  3AG2 C;  2WLI A;  3JD0 A;  2WLM A;  1NH2 D;  4WFE A;  2B1G A;  3AG1 B;  4MTX A;  3OR6 C;  1SER A;  1BHB A;  4JAV A;  2IU0 A;  3CCV V;  4JTD B;  3K9A A;  1NKD A;  3F7Y C;  3RVY A;  4MVZ A;  1MG1 A;  4MSW C;  2A79 B;  5CN0 A;  4XBF A;  2V1D A;  5DN6 G;  1OCC B;  3OAA G;  1FXK B;  1I5Y A;  4MVS A;  3TET A;  1KQS U;  1BHA A;  1H8H G;  1H38 A;  3UM7 A;  4WF9 V;  3F7V C;  1K5Q A;  4ZKI A;  3EHB B;  4J9Z B;  4QE7 A;  3LDC A;  1NVP B;  3VBB A;  1OHH G;  4R50 A;  2QE7 G;  1YIT V;  1JPX A;  1RPR A;  4PA7 A;  2Z5U A;  5EBM C;  4FK5 C;  3E86 A;  2AHZ A;  3K3W A;  5KUK A;  5B1A B;  1G8M A;  5LGN A;  2FTK A;  3GB7 C;  4ASU G;  4ZBM A;  1GO3 F;  4PEL A;  2HVJ C;  3SPH A;  2D3O W;  3MHS C;  3ZCC A;  1M56 C;  2EIM C;  1K97 A;  4U7O A;  3E89 A;  4YXW G;  1E79 G;  1YJN V;  1QLN A;  1QVG U;  4R8C A;  1NH2 B;  1VQ5 V;  2ZXW C;  3ZMZ A;  1YSC A;  1OCZ C;  3FB8 C;  3D36 A;  4LCU C;  2X6C A;  3AG4 B;  2QEX V;  2HLD G;  1JCH A;  1VQ8 V;  2HKO A;  5L3B A;  1VQP V;  3OGC C;  3CD6 V;  4XDK A;  3SYP A;  1GKF A;  2OT5 A;  4RUE A;  2W0F C;  2X6A A;  3JD4 A;  4UV8 A;  2BOB C;  2ITC C;  2MK3 A;  2LFR A;  3ASN B;  4QPJ A;  3ZMT A;  3OFN G;  2XAH A;  2EIM B;  5B1O A;  3G71 V;  1M57 C;  2P7T C;  1OCO B;  4MVM A;  2XAQ A;  2W6J G;  3FYI B;  3CP1 A;  4QE9 A;  4CZZ A;  2P90 A;  3W7W A;  1OCZ B;  1S72 V;  5EC1 C;  2OTJ V;  3JYC A;  4BW5 A;  1DF5 A;  4P9P A;  3TCU A;  3EFF K;  1YHQ V;  1YI2 V;  1ORQ C;  3CCR V;  2B1I A;  2WSS G;  5EBW C;  1ENV A;  1PD3 A;  3M99 B;  3ASO B;  4GCZ A;  3FB6 C;  3K06 A;  4FIP C;  2P6J A;  5B1B C;  3E35 A;  1E1R G;  3OMN B;  4MT8 A;  1N8R W;  2KB1 A;  4H33 A;  2AHY A;  4JTA B;  3ZIA G;  1BL8 A;  3R65 A;  2EIN B;  3JD1 A;  5IYC O;  3SPJ A;  3CCL V;  3ZMU A;  3ABL B;  1ARO P;  1NR1 A;  4GX5 A;  3SPC A;  4RO2 A;  3ABM B;  1W0K G;  1YTF D;  4PA9 A;  1JQ0 A;  3G6E V;  2EIL C;  1P4R A;  3K03 A;  4HZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...