4PA9A

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa9A00
3K0GA 2ITDC 3SYAA 5KUKA 2EIJC 4MVUA 4MW8A 4JTCB 4PDMA 2X6AA 3F7VC 3SPCA 3AG3C 1S5HC 2X6CA 3SPGA 2HVKC 2WLKA 5B1AC 3ASNC 4RO2A 3FB8C 4X8AA 5CBHA 3SJQC 2DYSC 2Q69A 2W0FC 2DYRC 4MTFA 2IH3C 4PA3A 2EIMC 3LDEA 1M56C 4R6ZA 3AG1C 3FB7C 4OXSA 2H8PC 3K0DA 4XDKA 1OCRC 2DWDC 4HYOA 4MVRA 2WLIB 3E8BA 5B1BC 3SYOA 2ITCC 2AHZA 3K06A 2BOCC 3OUFA 3FB6C 4H37A 4PA7A 5EK0A 3E8GA 4ZBMA 3SPIA 3JYCA 3E86A 4MW3A 4PDRA 4QE7A 4XDLA 1M57C 3E83A 5EBWC 4MVSA 2IH1C 1BL8A 4MS2A 3SYCA 5IY5C 3E8HA 3WG7C 1R3IC 5KUMA 4J9ZB 3SPHA 1QLEC 1K4DC 3SYPA 2WLMA 5J9PC 5E1AC 3PJSK 4GX2A 4MVMA 1K4CC 3AG4C 2EINC 3ABMC 3ABKC 2NLJC 3HPLC 2HJFC 3E89A 2X6BA 3K08A 4I9WA 4H33A 1OCZC 3RVZA 3VOUA 4F4LA 4PDLA 5EBMC 3OGCC 4BW5A 3ZJZA 4R50A 1XL6A 2R9RB 2QKSA 2OCCC 4P9PA 3SYQA 4MTGA 1XL4A 1R3JC 2A9HA 3UM7A 4WFHA 4JTAB 2ZXWC 4P9OA 5CBFA 1ZWIC 4UUJC 4DXWA 1KKDA 1OCOC 2WLNA 5EC2C 2KB1A 4JTDB 3T2MA 1ORQC 4HZ3A 2Y69C 3OR6C 2A79B 4RUEA 3K04A 2Q6AA 5BZBA 4X88A 3SPJA 3TCUA 1OCCC 2BOBC 3OUSA 4WFEA 3TETA 3OR7C 5EC1C 1R3LC 2A0LA 4P30A 4TWKA 4GX1A 3T4DA 2HVJC 1G4YB 4X89A 3KG2A 2DWEC 4LP8A 2WLJA 4RUFA 3LDDA 4MSWC 1J95A 2Q67A 4EKWA 4RAIA 1R3KC 4WFGA 2WLLA 3E8FA 2AHYA 4R7CA 3LDCA 2EILC 4LCUC 4QNHB 3IGAC 1LNQA 3K03A 3LNMB 4GX0A 4KFMA 3STZC 3T1CA 3ABLC 2HG5C 3X2QC 3RW0A 4QE9A 4MVOA 5EBLC 4PA4A 4CBCA 2EIKC 2JK5C 4MVQA 2YEVA 4PA6A 3LUTB 3F5WC 2ATKC 3RBZA 3UKMA 4PA9A 3ASOC 4PDVA 4MVZA 4XDJA 3ZRSA 1P7BA 3RVYA 4WFFA 5CBGA 4LBEC 4P2ZA 1JVMA 2P7TC 3FB5C 3IFXA 5B3SC 2HFEC 4GX5A 3F7YC 3STLC 4G28B 3R65A 2WLLB 4MTOA 3GB7C 4R8CA 3BEHA 1V54C 2ZD9A 2QTOA 3AG2C 3T4ZA 3EFFK 2Q68A 4G27B 1V55C 2WLIA 2WLHA 2K1EA 4J9YB
chains in the Genus database with same CATH superfamily
1K8AW 3RYIA 4PDMA 1XNRO 3CC4V 5KX5B 3LSSA 1KC8W 3C90A 2Q5ZA 2UUCO 3LNNA 2QA4V 4X9QA 1SRYA 2W0FC 5LGTA 3J81N 4R6ZA 1VF7A 3OEHG 1QLNA 2D3OW 3O9OA 1XNRB 2IJKA 3CCEV 4DR2B 3OMAB 2ADQB 2OIGA 2E3CA 2IJJA 3TGUH 3SPHA 3QF7A 3K9SA 2YIAA 4X65O 3ABKC 4UCVA 3CRCA 1GN4A 1I94B 4YIOA 2AXTZ 2C2AA 4PD4F 5C8YA 1VQ4V 5C93A 2E5LB 4UVCA 5IYCO 3G6EV 1IBLB 4AQYB 4WFHA 4JTAB 1N36O 1ZWIC 4X62O 4UUJC 5KMGA 3TJTA 3I55V 4RUEA 2IU0A 3GVMA 3D36A 3G4SV 2P4VA 2GTAA 2GV9A 5IT9N 1A32A 2A0LA 4TWKA 4GX1A 5BXZA 2DYSB 2ZIOA 2EIMB 1HR0B 3OD4A 5JWPA 1X59A 1WP8A 4K3AA 4RAIA 1TVKB 1F4NA 3FFQA 3HKCA 4DV6B 4ZOLB 5EZYB 1I5XA 3CHXA 3JALB 4JI3O 3JD0A 4QNHB 1H2NA 1KP2A 1H38A 3SJBC 3QO8A 2F4VO 3JATB 4GZRB 4DUYB 5B1NA 2P7TC 4X1YA 4GLXA 2A7WA 1CXZB 4I55B 2CAZC 4OGQB 3A8TA 1W2BU 5F2VO 1KU9A 3SPCA 5KHGA 3HKDB 5JQGB 2P90A 2GTSA 3UT5B 2QR4A 2EIMC 2H8PC 1YXBA 3K0DA 1YTFB 2YXLA 2CE4A 3E8BA 4C7UA 4B3RB 5LXTB 5LL6Y 2YEVB 4TQDA 4PDRA 1GM7A 2XAGA 1BL8A 1R6NA 3G6BA 5L3FA 4I50B 1R6KA 3T1HB 5J9PC 1EN6A 5H6QA 1EN4A 1NT2B 1NTMH 4CS2A 2B1GA 3JCZA 3JAMN 3ZHVA 3JARA 1N8RW 1XEQA 3E35A 4JASA 2YC0A 4ABMA 4DYLA 2WLNA 3DTUB 5DECA 2AW9A 4JI4B 1Q6UA 1NBMG 4H13B 3H1IH 3ZHUA 5JJJB 3T4DA 2Q8VA 2ZM6O 5DN6G 2CTPA 4Q6GA 2N74A 3CSXA 1HP8A 4F6RA 4LNUA 3K9AA 4PHZA 4X1IB 3E8FA 2JGDA 1DK1A 3JD1A 3CRMA 4YHHO 1P84F 3K03A 2QKCA 2HG5C 1YDXA 1QLEB 4KXRA 3SDLA 4LFAO 3AG7A 3C3SA 3CCVV 1Y67A 3IC9A 4WBNA 5FL7G 2WSSG 2UXBO 1DF5A 4J9YB 2ZCEA 3HKBB 2Y69B 2OIEA 2E5LO 1S76D 2OT5A 3ZRWA 5BMVB 2VQEO 4O2AA 3VQYA 2HP8A 4LF7B 3ZHRA 4X65B 3FB8C 3B77A 3FYEB 3M7MX 3O65A 5L3CA 4UCSA 3FAVB 4HYOA 4DR2O 4J7JA 1VARA 4MVSA 5IY5C 2GSMB 2RN9A 1KBHA 2BSKA 1K4DC 2A3QA 2EINC 4DV3B 4I9WA 5LP6C 2WAMA 5EBMC 2QKSA 2OCCC 2H3OA 3UM7A 3UO3A 4AQYO 4OX9B 1N0NA 2X7RB 3DGEA 3JD4A 2QJ1A 3FX7A 1KYOF 3EXAA 4FLTA 5J2UA 4JI0B 3OFNG 1VQ8V 4WFEA 3FKSG 1RM1C 4QPJA 4I4TB 1BE3H 3AEIA 1BHAA 3LDDA 5LBQA 2EJ7A 4IYIA 2YXHA 1R3KC 5IYZA 4DV3O 1XMQO 4RWUA 1Y76A 4GX0A 1LNQA 3HR0A 1R1BA 3Q4HB 4KFMA 4JI3B 4O4JB 5H2FZ 5EBLC 4JI5B 3CE2A 4JZGA 3CJHA 1F23A 4WFFA 4CH6A 2AZ0A 1EBOA 2BTQB 4R8CA 3B40A 3JSLA 3AG2C 2CDYA 1Y74B 1FYJA 4DRXA 3H1KH 2UXDB 3L73H 5KX5A 3D36C 2IBZH 3L71H 4FZ1A 2EIJC 3ZRXA 2B5UA 4U7NA 4U3FH 1PP9H 1IBMB 5IYDO 4JV5O 5B1AC 1L0LH 4X8AA 4BIUA 3RFRA 1FAFA 2N04A 2CH7A 5FNVA 4DW0A 2QWPB 5LOVA 5FLXN 2Y0PA 1TUBA 1PV0A 4U3JA 1F4MA 3J7AU 2EZPA 3E8GA 3KZIZ 3N2GA 4W4LA 1OJHA 2JEXA 2BSKB 2CH7B 2Q7GA 4DO2A 1K3EA 5B3SB 2XAHA 1ENVA 2FL4A 4DR4O 4P9PA 1K7DA 5B1OA 2OYQA 4BW9A 3D3QA 1D5AA 5CMUA 2XOKG 4CZZA 2YIBD 3AG3B 1H8EG 1FXKC 1OCCC 1IVSA 5B1AB 4X20B 2E75B 4DR3O 5BY1A 3IC7A 3RYCA 3ZHSA 1YI2V 1JPXA 1PL0A 2UXXA 1BZKA 1M57B 3IGAC 1FXHA 2QEXV 2P4KA 2QWNB 3T1CA 1XMOB 2EIKC 3ZCCA 4X1KA 5JVDA 4MVZA 4J41A 5BR8O 1URFA 1QCEA 2EULA 2QGNA 1OCZB 3T1YO 2HFEC 3F7YC 5JCOC 3GB7C 1AI7A 4UFZA 1H8HG 2CUGA 2ZXWB 5LHIA 5IYBO 4G27B 2WLHA 3H9VA 2K1EA 1IZ3A 3CCUV 3ZHQA 4O2BA 2X6AA 1SESA 4EFEA 2RDCA 1N32B 4UB6Z 3KCXA 4JYAB 4ASUG 2XAFA 4K8ZA 3W7SA 1DGSA 4MVRA 5KHHA 5GONA 2QM8A 1MABG 4MW3A 1M5IA 1BT8A 1VQOV 3OTOB 2L6LA 4D7SA 1UFIA 1AP6A 1O9HA 3JD2A 3MHHC 3CCRV 1QU7A 3ABMC 4J80A 1RSOA 4LC1A 5L3GA 2PZSA 3JASA 3OGCC 4JI2O 4JV5B 4R50A 4LFBO 2Z0AA 1Q82W 1WA8A 5DM6V 3ZRVA 2PUSA 4DUZO 2GUZB 2KB1A 4QPKA 5LA6B 4JI1O 1NR7A 4JAAA 3P32A 2FTKA 2GUZA 3BABA 5B5EZ 4J10A 5L3EA 1N33O 4U3JB 1M90W 1ZAUA 4DV1B 5CN0A 3K5NA 2M6YA 5EYPB 4X89A 5GTHZ 2YI9A 1NQTA 3RWRD 4UCTA 5IYZB 1JFFB 4JI5O 1HNZO 3P3NA 3ABUA 3QTCA 1YTFD 2AHYA 2JIZG 3M99B 4KL1A 4FFBB 4FFKA 2NNUA 2JDIG 5ITZA 3X2QC 3M8AA 2QM7A 3JATA 3HB3B 5JJNB 1TUBB 1GKFA 1XDCA 3WB0A 5LP6A 1Q81W 3W7WA 2BTQA 2X0LA 3FB5C 3IFXA 1NZ6A 5LMUO 1Y6XA 2R9AA 1K97A 4I55A 1FS0G 3GWOA 1ZTEA 2QWOB 4O2BB 1ZUQA 2JJ1G 1E79G 5KAIZ 1OV9A 3APOA 3HKEA 4NXMO 4JI8O 1S5JA 4UCUA 2X6CA 2HVKC 5IJ9B 4JI0O 4DV1O 1SKVA 4DV0B 2UXCB 1SQQH 3ZBHA 1H2KA 3RYHA 1CPYA 1EM1A 4FZ0A 2WA4A 3D3IA 4MS2A 5LXTA 5H5NA 1EFRG 1XMOO 2ZDIA 2ODMA 3CYOA 4DR5B 1R73A 5J2TA 4I0XB 1LUVA 2HJFC 2Q0OC 2X6BA 3K08A 3UO2A 1W0KG 5KHJA 3E2EA 1TGOA 4X1KB 5LYJA 1AI6A 2F23A 2DMXA 2QM4A 4N21A 4DR3B 4LNUB 3W7UA 1AILA 1P49A 3T2MA 1T5EA 4JAVA 1MSDA 2VQFB 3SJAC 3FAVA 4DK1A 3C3TA 1KD1W 4DR4B 4JF3A 3H1JH 4O2AB 2EZOA 2Y48A 1JQ0A 2ZINA 3N2KB 4LF8O 1KUQA 3QO5A 1VMGA 3HKCB 3LSQA 1XQ8A 3ZS8C 1IXMA 5LHGA 4AHCA 3ZMZA 1SZTA 3ASOC 4YIPA 3AG4B 1F51A 1G6UA 4I50A 2ZM6B 4HAMA 2N05A 2RJZA 3VQXA 3EFFK 1QR8A 1K73W 5KAFZ 2EBOA 1KMIZ 1E1RG 2WA3A 4TSFG 3B2EE 3OMIB 1U97A 3MDSA 4KUMA 3K57A 2LQTA 1PL4A 2XUMA 2RQ6A 2QWQB 4GKJO 5CB4B 1BQ0A 1OHHG 3G80A 2EILB 5D5PA 3OW2U 2D2CB 1B04A 3WB2A 4X1YB 4ZKIA 1TAEA 1ZL8B 1EN5A 3JARB 3N2KA 1FFXB 4Q20A 3L70H 1QVFU 1FFTB 2CTRA 4WCEV 2VWKA 2M7WA 1V55B 4FLXA 4YJ3B 3AK2A 3VQVA 4UCRA 2O57A 1Q6HA 4BIOA 2ZE7A 5LGNA 2HHHO 2VS0A 4JZ2A 3OR7C 2L35A 1YZBA 2MK3A 1G4YB 3ZMUA 2DW4A 1VQ6V 1CEZA 2K9PA 1OCRB 2WLLA 1FD9A 2EILC 1M1KW 5C8YB 4DV2O 5A9GA 2V7QG 2GBOA 1Q86W 4DK0A 1KB9F 4LF5B 4F6EA 4GYCB 4YJ3A 4LBEC 2HEPA 3HKDA 5JQGA 4TUYB 2EX3A 3ZIAG 1XNQB 4DV2B 4JAUA 3CCLV 4K0KO 4IIJB 4O4HB 4J7KA 1R6TA 1SETA 1PNKA 4O4HA 1AR1B 1FXKB 1GH6A 5CA1A 3CEIA 2Q69A 1Y4MA 4JI1B 1L8DA 3ZN0A 3U10A 1JCHA 2WLIB 3BRCA 3JSNA 4ZBMA 3K06A 2BOCC 4LFBB 1K34A 1M57C 2ADPA 4EFBA 1SA0A 4EB6A 3FYIB 1JMKC 4I0XA 1S3JA 4FFBA 2DE0X 3CRAA 3CRRA 2ZNIA 2LGQA 2HR3A 1V54B 1MG1A 2PI5A 2ZDIC 2ZXWC 3FD9A 3RT3C 4BAYA 4YXWG 1KKDA 1B06A 2DOSA 3ZMVA 1BSMA 3N2GB 5H9CA 3OR6C 4ZI7A 3OM3B 5BZBA 4NYKA 3IAYA 4CH3A 3AK3A 2KG7A 3QG5A 5FPRA 2QE7G 2XAJA 2JGUA 4LFCB 1Q6IA 4RUFA 1US6A 1PNLA 4DV5O 3APQA 3S3XA 2ZE5A 3T1YB 2PI4A 3STZC 4DUZB 1FFXA 5IDJA 2YEVA 1VQ7V 1IDSA 3ZHTA 1LUWA 3ABMB 3ZRSA 1P7BA 4DR1B 1JR9A 4P2ZA 1W0JG 3BY6A 1K33A 3STLC 1NH2B 2E76B 4DV7B 4ZOLA 5EZYA 2KSDA 2BTOA 3K5MA 2YXYA 1Q5OA 2P22C 3BVOA 5CB4A 5IWAO 1FJGB 3CMEV 1AI5A 1MSWD 4JTCB 3AG3C 3SPGA 5IJ0B 3BPZA 4HNAB 2OTLV 2P67A 4RQFA 4QIWF 2IH3C 4JI4O 2A06H 1M56C 4LF4B 1AR4A 2DWDC 3RYHB 4PA7A 1P4RA 3SPIA 1WN7A 2YIBA 3K5OA 5JVDB 1K5QA 2ZIMA 1VQ9V 1W59A 2IU3A 3X2QB 5KUMA 1DF4A 1Q7YW 1EZJA 1QVGU 4DV6O 4H33A 1OCZC 1MMMA 4NXNO 3T1HO 3L9DA 3JCUZ 2YI8A 3VBBA 4GUNA 1Q90D 2R9RB 1VF6A 2YICA 4NB5A 1GM8A 1GN6A 1G1XB 1AP5A 2YDEA 4Z1VA 5EC2C 2H94A 2KKWA 1OZ0A 2E74B 4TV9A 4U7OA 5EC1C 4P30A 2XAQA 3DXRA 1BGYH 2ZNJA 3MAQA 5LHHA 1HWYA 3RYIB 2UXDO 1M56B 4PJ0Z 1KP3A 4WFAV 1I94O 1ZLZA 1N4CA 2LJ2A 4R7CA 1M9NA 4QE9A 4CBCA 4UB8Z 3CX5F 1H2SB 2ATKC 2LFSA 3BAAA 2FKXA 1SS3A 3I56V 2F93B 4NKGB 4WBNB 3SGIA 4LF6B 3D8CA 1MA1A 1YVWA 4GX5A 3ETQA 4MTOA 3IJ4A 4FK5C 2OWOA 3T4ZA 4FVMA 3JD3A 2UUCB 2ITCC 2QKAA 1NJIW 4O4IB 3CCQV 3K0GA 2ITDC 2ETNA 1CP9A 1SC5B 2YUAA 1NKDA 3KCYA 4RO2A 1ZL8A 2ZKOA 2DYRC 2PGGA 4B3TO 1ROPA 1X4TA 1HW7A 3EVKA 1XHZA 3ZMTA 4OX9O 1N36B 2AGAA 2CGOA 3E22B 3E83A 1N33B 4FM0A 1SQBH 1S77D 1NI8A 2RNBA 3SYPA 2WLMA 4DRXB 1Y76B 3A2FA 5JH7B 1GK9A 2OTJV 1LR1A 2XTAA 3K79A 3ZJZA 4JI2B 4QJFB 3K58A 1IXBA 3S3WA 1OCOC 5HFMA 4FM2A 2VRZA 2UU9B 1GRJA 3RN4A 1COWG 4B3SO 4JYAO 3TETA 1V9PA 1R3LC 2MW2B 2Z3YA 2DYRB 1GAXA 3DXRB 2JS3A 3L74H 3CD6V 4EKWA 3RYCB 2DQ0A 4WFBV 1N32O 3LDCA 5IY5B 4D7TA 1I5YA 1J5EO 1VP7A 2UUBB 5KHKA 1Z5VA 1JX9A 2EINB 4LWSB 2QSAA 4DV4O 1WP7A 4LH7A 2Q4PA 3OGIB 2IJIA 2WPDG 4FJCC 1PNMA 4JI7O 1BCCH 4J9ZB 4YJ2B 4LF6O 5LMNB 4OPAA 2LGWA 3ZMSA 4MW8A 3BA8A 4LR3A 5K1XA 4NTXA 4CH5A 2GHYA 3LSUA 1QQCA 4ZIBA 3LDEA 3ICXA 3AG1C 1FPOA 2NN4A 1XREA 2VQEB 5B1BC 3SYOA 3U0ZA 2AHZA 2F43G 5JCOA 3H01A 5EBWC 4XDLA 2P6JA 4JYYA 1KKCA 1AR5A 5GTIZ 4LF4O 1QLEC 4TUYA 1AJNA 3AG4C 4JI6B 1NU1H 1TA8A 4IHJA 5EIBC 2PTMA 4X1IA 3OE7G 1L0NH 3B8NA 4J7ZA 1O9GA 2ILMA 4IL6Z 4DR6B 1YIJV 5IE9A 2DN9A 4IT5A 3GWKC 1MZFA 4BR6A 2HJDA 1G8MA 4X20A 2P06A 1GM9A 1K5SA 1FKAO 4LP8A 4X66O 3ZN1A 1IX9A 1PKXA 4GT1A 3ZEDA 3LNMB 2YSUB 1SQFA 4WF9V 1WNSA 5LP6B 1VF6C 2YS8A 3VQWA 4X64B 2OCCB 3A0BZ 3NR7A 1B3QA 4I5SA 1SZXA 2Q68A 4TOIA 1V55C 1SERA 1N34O 1MNGA 2ZE8A 3SYAA 1NTZH 5KUKA 4MVUA 1THZA 3F7VC 5LMNO 1OCCB 1SQXH 3G71V 1XMQB 1NTKH 1VF5B 4NXNB 3UCSC 2UXCO 4FMTA 4MTFA 3TXSA 5E79Z 1OCRC 2W0XA 4BIZA 1JJ2U 4DV5B 4JI8B 1AROP 2VWJA 3OUFA 5EK0A 1YSCA 4K35A 4W4KA 4TV8A 4JYCA 4LFCO 2KG7B 3SYCA 2ZT9B 1JA8A 3ABLB 3ZRWB 5AG2A 1J5EB 4UXNA 5E1AC 1XUQA 4GX2A 3HKBA 4JPRA 2ZE6A 4H44B 4LF9B 3A0RA 1QBZA 4FLUA 4CS4A 3AG2B 2A9HA 2UXNA 1L1FA 5CBFA 1Z5WA 4YY3O 3DC6A 2BCCH 3WU2Z 4DXWA 4MTXA 1RFYA 4B3SB 2A79B 3OMNB 4LH6A 4PELA 4IIJA 1N0JA 3JALA 3OT7A 2Q7HA 3K3WA 1GO3F 2XT9A 2XNDG 1SA0B 3A0HZ 4CH4A 3K5LA 1D5NA 5KA6A 5KLVH 4FLZA 2Q67A 1WPXA 4RQEA 4WFGA 5FNVB 3CCMV 2UXBB 1NR1A 4PI0A 4LCUC 1MZEA 2Y0IA 1UPGA 2QDOA 1H2MA 3ABLC 1Z2GA 4X62B 4X66B 2JK5C 3F5WC 3BA9A 3UKMA 2DQ3A 3ABKB 4XDJA 1S5LZ 2Z5UA 1BQZA 4NR1A 5CA3A 1KQSU 3P3PA 2HHHB 4G28B 1Q8IA 4I7ZB 4B7KA 2XHBA 3BEHA 1V54C 2ZD9A 2PYJA 4K0KB 4UV9A 4YHHB 1IURA 5A2QN 3CPWU 1FXKA 3CMAV 3RYFB 2QTSA 2IW5A 2FYUH 4LF5O 3ETGA 4XBFA 3W7XA 4TQFA 4KHPB 4FPPA 2CTQA 1VQKV 4LF8B 5CBHA 1Q43A 4PA3A 4LF9O 3ABTA 1AB3A 1F7YA 1DTOA 1I0HA 2PYLA 3R66A 1ZX3A 3CXCU 1YEWA 2VQFO 1B6QA 3WG7C 1R3IC 3UQ8A 1XOUA 5L3DA 2EIKB 1Y66A 3BFRA 3I5DA 4MVMA 2Y4TA 2JRIA 2NLJC 3SJCC 1MOFA 4DR7B 4A5UB 3RVZA 4F4LA 1YJ9V 1GN2A 1AI4A 5HFLA 2ARHA 2B1IA 4BWAA 5K1PA 4UCOA 4AILC 4F6RB 1TUEB 4GCZA 2LW7A 3L75H 4FIPC 2WWWA 2Q6AA 3SPJA 1M4UA 3OUSA 5EYPA 2F66C 4JGSA 2HVJC 4FM1A 3KKYA 3E22A 1NS1A 4GKKB 2V4DA 1DLBA 4B7EA 1J95A 4N23A 5LA6A 3W7TA 4DR7O 5DEDA 4Z1MG 1VQNV 4B3MO 1Y74A 4B08A 4L8JA 3WG7B 1UJWB 5B66Z 2JVDA 5ITZB 4MVQA 3LUTB 5D5QA 3ETDA 5LYJB 1QNMA 5JJEB 4DUYO 3JAKB 4E2LA 1YF2A 4J42A 3ZX6A 1QR9A 2JS5A 2IJHA 3OAAG 1JJOA 1YITV 1SQGA 2ZR3A 4FLYA 3RYFA 2PF4E 1K9MW 5LGUA 3TXQA 4GKKO 4I9QA 1HR0O 4G2KA 1XI1A 4LFAB 1S5HC 4EB6B 1D2DA 5IWAB 1FJGO 2WLKA 1H2GA 1PPJH 2RMKB 2DYSC 2JGDB 5J2TB 4IYHA 2ZR2A 1HNZB 4JI6O 3U11A 2NR5A 1IBMO 2W6IG 1BHBA 1AVMA 4CS3A 4H37A 1WB8A 2IM9A 4DR1O 3CB2A 1EZVH 3DSQA 3E8HA 2CGNA 4B3TB 2UUAB 5CA0A 3PJSK 4GKJB 3CRQA 2B9ZA 3E89A 2AZ2A 1NVPD 4NTYA 4NXMB 1VIBA 3CS5A 3OEEG 2F95B 1VQLV 4TV8B 2V1DA 2R72A 5GW7A 4JTDB 3J80N 2Y69C 2YIDA 3TCUA 3OTOO 4JI7B 4DR5O 2RCVA 4K8XA 5EIBD 4JYBA 3ASNB 3H1LH 2LO1A 3KG2A 2G38A 2WLJA 5FPOA 1YCIA 2GDSA 5B1BB 5KMGB 4B3RO 4O4LA 4E4EA 3ML0A 4D6TH 2HKOA 3BHPA 3NXSA 5L3BA 4PA6A 1RP3B 4Z2WA 3RBZA 1BMFG 2Q7EA 1S72V 3P30A 4LWSA 1RPOA 1AJPA 3R65A 3N27A 1WPBA 1OCOB 2JJ2G 3SR2C 1WB7A 1I7FA 3AK1A 3ETEA 3L72H 2F4VB 1N34B 3PN1A 4NVPA 4EEQA 2Y4UA 1RM1B 3ASNC 3SJQC 3QO7A 1YJNV 2XASA 4LF7O 1AJQA 1XNQO 3FB7C 2FMLA 4FLVA 1VQ5V 4O4JA 3FB6C 3OTFA 4QE7A 4YY3B 1VQMV 4TT3G 1VEWA 5TISZ 1BS3A 1YJWV 2Q0AA 1HNXO 3UT5A 5H6RA 3ASOB 3CCJV 3CC2V 3HPLC 1K92A 3VOUA 5JH7A 1WA8B 2ZQMA 1HNWB 1FXVA 1XL4A 2R70A 3THOA 2EJRA 4HBNA 1SQPH 1SQVH 1ORQC 5CA1B 2HLDG 3K04A 3CC7V 4X88A 4DW1A 2BOBC 1P7GA 4UV8A 4ZHQA 1IBKB 5LMUB 2DWEC 4AI8A 4MT8A 4DR6O 3AG1B 3G67A 4YJ2A 4MSWC 5IJ9A 3K59A 4IHJB 3WB1A 1RSOB 1WAZA 1TVKA 3H1HH 3JAWA 4X64O 3Q4HA 4PV1B 1GTOA 1JVMA 5B3SC 3CP1A 1S0VA 2WLLB 5KHIA 4O4LB 2QTOA 3EHBB 2LW1A 1PM9A 2UUAO 4CC6A 5KA5A 4ZHQB 2Q73A 4J11A 5BR8B 3WFVA 3B4SA 3TK1A 4ICGA 1JFFA 3HKEB 2BE3A 5BMVA 1M93A 1H2LA 4KP4A 1RPRA 4OXSA 4XDKA 3JAWB 3RGBA 3BCCH 4UVBA 4TV9B 1IBKO 2P5OA 4DV4B 2F1MA 3JYCA 3E86A 3B8MA 3MD0A 3QNEA 1QHTA 4NTWA 2IH1C 1XBLA 2UUBO 2CTWA 1HNWO 2DJVA 4HNAA 4QGPA 3QVNA 2FB5A 1PD3A 1K4CC 5LOVB 4L87A 5CA0B 3JASB 1XHXA 2JEUA 2R9IA 1HNXB 1VQPV 2CK3G 2PY5A 4PDLA 4BW5A 1XL6A 2LFRA 3CJHB 3SYQA 4MTGA 1R3JC 3JAKA 4P9OA 2LP7A 4IGGA 1JOYA 4HZ3A 4B3MB 1I08A 1NH2D 2EIJB 2Q9LA 4KHPO 2W6JG 5GONB 2UU9O 4CC5A 4DV7O 4H0LB 1NVPB 3CXHF 3CCSV 4I4TA 4O4IA 1ZSPA 1HDJA 1Q3EA 1U96A 2QWRB 3MHSC 5J2UB 4UVAA 3B09A 4OPHA 2KQXA 3RW0A 4MVOA 4FLWA 3F5TA 3CWBH 4PA4A 1IBLO 1KECA 4PA9A 1WLEA 1SF9A 3DC5A 4PDVA 3RVYA 5CBGA 4ZI7B 2OCHA 4PI2A 1YHQV 5IJ0A 1XILA 4DV0O 1GMGA 1E1QG 2WLIA 1WJZA 1GN3A
chains in the Genus database with same CATH topology
3CPWU 1K8AW 1FXKA 3CMEV 1AI5A 3CMAV 1MSWD 4JTCB 4PDMA 2X6AA 2IW5A 3AG3C 3CC4V 1SESA 3LSSA 3SPGA 1KC8W 3ETGA 4XBFA 3W7XA 2OTLV 2P67A 4RQFA 4FPPA 2QA4V 1VQKV 5CBHA 4QIWF 1SRYA 2W0FC 4ASUG 5LGTA 2IH3C 4PA3A 2XAFA 1M56C 3ABTA 4R6ZA 3OEHG 1DTOA 3W7SA 2DWDC 4MVRA 1QLNA 2D3OW 4PA7A 1P4RA 2IJKA 3CXCU 3SPIA 2QM8A 1MABG 4MW3A 3CCEV 1K5QA 3OMAB 1VQ9V 1B6QA 3WG7C 1R3IC 2IU3A 1VQOV 3X2QB 2IJJA 5KUMA 5L3DA 3SPHA 2EIKB 1DF4A 1Q7YW 1EZJA 3JD2A 1Y66A 3MHHC 3CCRV 4MVMA 3ABMC 3ABKC 2NLJC 1QVGU 1MOFA 4H33A 4LC1A 5L3GA 1OCZC 3RVZA 4F4LA 1YJ9V 3VBBA 3OGCC 2C2AA 4R50A 2R9RB 5C93A 1VQ4V 1AI4A 4UVCA 5HFLA 5IYCO 3G6EV 1Q82W 1GM8A 4WFHA 2B1IA 4JTAB 3ZRVA 5DM6V 1ZWIC 4UUJC 1TUEB 4GCZA 5EC2C 2KB1A 4QPKA 3I55V 2H94A 1NR7A 4FIPC 1OZ0A 4RUEA 3P32A 2WWWA 2FTKA 2Q6AA 3SPJA 2IU0A 5L3EA 3D36A 4U7OA 3OUSA 3G4SV 1M90W 5EC1C 2A0LA 4JGSA 5CN0A 4P30A 2XAQA 4GX1A 4TWKA 2HVJC 5LHHA 1HWYA 4X89A 2DYSB 2EIMB 1M56B 1NQTA 1KP3A 1DLBA 1J95A 4N23A 4RAIA 4WFAV 1F4NA 3W7TA 3ABUA 1YTFD 2AHYA 4R7CA 2JIZG 3M99B 4Z1MG 1VQNV 1I5XA 4QNHB 3JD0A 2NNUA 2JDIG 3WG7B 1KP2A 3X2QC 1M9NA 4QE9A 1UJWB 2QM7A 4CBCA 1H38A 3HB3B 4MVQA 1GKFA 3LUTB 2ATKC 3ETDA 2LFSA 3QO8A 1Q81W 3W7WA 4E2LA 2X0LA 3I56V 5B1NA 2P7TC 3FB5C 3IFXA 1QR9A 4GX5A 2IJHA 1K97A 4MTOA 3OAAG 1FS0G 4FK5C 3GWOA 1YITV 3T4ZA 3JD3A 2ZR3A 2ITCC 1NJIW 3CCQV 3K0GA 1W2BU 5LGUA 1K9MW 2ITDC 2JJ1G 1E79G 1CP9A 3SPCA 4G2KA 1S5HC 2X6CA 2HVKC 1NKDA 2WLKA 4RO2A 2P90A 1H2GA 2DYSC 2DYRC 2ZR2A 2EIMC 1ROPA 2H8PC 3K0DA 1YTFB 2W6IG 3ZMTA 3E8BA 1CPYA 1BHBA 4H37A 2YEVB 4PDRA 3D3IA 1GM7A 3E83A 2XAGA 1BL8A 1R6NA 4MS2A 3E8HA 5L3FA 1S77D 1EFRG 1R6KA 2ZDIA 3SYPA 2WLMA 5J9PC 3PJSK 5H6QA 3CYOA 1R73A 2B1GA 3JCZA 2HJFC 3E89A 1GK9A 2X6BA 3K08A 1NVPD 2OTJV 3E2EA 1W0KG 3K79A 3ZJZA 1N8RW 4QJFB 3OEEG 1VQLV 2V1DA 1AI6A 4N21A 3E35A 4JASA 1OCOC 3W7UA 5GW7A 2WLNA 4JTDB 3T2MA 5HFMA 2Y69C 3DTUB 4JAVA 1COWG 3TCUA 1NBMG 3TETA 1R3LC 4JYBA 3ASNB 3T4DA 2Z3YA 5DN6G 3KG2A 2DYRB 1KD1W 4JF3A 2WLJA 3CD6V 2EZOA 5B1BB 4EKWA 2Y48A 3K9AA 1JQ0A 2DQ0A 4WFBV 3E8FA 3JD1A 3LDCA 3QO5A 3ML0A 5IY5B 3K03A 3LSQA 2HG5C 2HKOA 1I5YA 1QLEB 3NXSA 5L3BA 1IXMA 4PA6A 5LHGA 3RBZA 3ZMZA 1SZTA 3ASOC 1BMFG 3AG4B 1JX9A 2EINB 3CCVV 1F51A 1S72V 4HAMA 3P30A 1RPOA 1AJPA 3R65A 2IJIA 5FL7G 2WPDG 4FJCC 1PNMA 2WSSG 3EFFK 1QR8A 1OCOB 1DF5A 2JJ2G 4J9ZB 4J9YB 2EBOA 1K73W 2Y69B 1S76D 2OT5A 3ZMSA 4MW8A 1E1RG 3ETEA 4TSFG 3OMIB 3ZRWA 1RM1B 4KUMA 3CCUV 3ASNC 3FB8C 3B77A 2GHYA 3SJQC 3QO7A 1YJNV 3FYEB 3LDEA 2XASA 1AJQA 3AG1C 3FB7C 5L3CA 4HYOA 5B1BC 1VQ5V 3SYOA 2AHZA 2F43G 3FB6C 3H01A 1OHHG 5EBWC 4QE7A 4XDLA 2P6JA 2EILB 4MVSA 5IY5C 1VQMV 4TT3G 3OW2U 2GSMB 1YJWV 1K4DC 1QLEC 4ZKIA 1AJNA 5H6RA 3ASOB 3CCJV 3AG4C 2EINC 3CC2V 3HPLC 1K92A 3OE7G 4I9WA 4Q20A 3VOUA 2WAMA 3B8NA 1QVFU 5EBMC 2ZQMA 2QKSA 2OCCC 1YIJV 1FXVA 1XL4A 3UM7A 1FFTB 2EJRA 4WCEV 2M7WA 2X7RB 3DGEA 3JD4A 1V55B 1ORQC 2HLDG 3K04A 3CC7V 5LGNA 4X88A 3OFNG 1G8MA 1GM9A 1VQ8V 1K5SA 2BOBC 4UV8A 3FKSG 4WFEA 3OR7C 1RM1C 4QPJA 3AEIA 2MK3A 1BHAA 1G4YB 2DWEC 2DW4A 3ZMUA 4MT8A 4LP8A 3AG1B 3ZN1A 1VQ6V 3LDDA 4MSWC 5LBQA 1CEZA 1OCRB 1PKXA 4GT1A 1R3KC 2WLLA 2EILC 3LNMB 1LNQA 4GX0A 4KFMA 1M1KW 2YSUB 5EBLC 4WF9V 2V7QG 1Q86W 1F23A 4WFFA 4LBEC 1GTOA 1JVMA 5B3SC 3CP1A 1EBOA 1S0VA 2WLLB 4R8CA 3ZIAG 2OCCB 2QTOA 4JAUA 3AG2C 3CCLV 3EHBB 4I5SA 2Q68A 1V55C 5KA5A 1SERA 1SETA 1PNKA 3SYAA 3ZRXA 5KUKA 2EIJC 4MVUA 2B5UA 1THZA 3F7VC 4U7NA 1AR1B 1FXKB 3WFVA 1OCCB 3TK1A 5IYDO 3G71V 5B1AC 4X8AA 4BIUA 2Q69A 1Y4MA 4FMTA 4MTFA 4KP4A 1RPRA 3ZN0A 4OXSA 4XDKA 1JCHA 1OCRC 2WLIB 4BIZA 4UVBA 1F4MA 1JJ2U 1AROP 3K06A 2BOCC 3OUFA 1YSCA 5EK0A 4ZBMA 2EZPA 3E8GA 3JYCA 3E86A 3B8MA 1K34A 3MD0A 3QNEA 1M57C 4JYCA 2IH1C 3SYCA 3ABLB 3ZRWB 3FYIB 4UXNA 1S3JA 5E1AC 1PD3A 2JEXA 4GX2A 1K4CC 4DO2A 4JPRA 4L87A 1K3EA 2JEUA 2R9IA 1VQPV 3A0RA 1QBZA 2CK3G 2XAHA 1ENVA 5B3SB 4PDLA 4BW5A 1XL6A 2LFRA 2HR3A 1V54B 4P9PA 3SYQA 4MTGA 3AG2B 1K7DA 1R3JC 2A9HA 2UXNA 1MG1A 5B1OA 1L1FA 2ZDIC 2ZXWC 4P9OA 5CBFA 2PI5A 4BAYA 4YXWG 2LP7A 4DXWA 1KKDA 3ZMVA 4MTXA 1JOYA 4HZ3A 5H9CA 3OR6C 2A79B 3OMNB 2XOKG 5CMUA 2EIJB 3OM3B 4CZZA 4PELA 1NH2D 5BZBA 2W6JG 3AG3B 1H8EG 1FXKC 3K3WA 1OCCC 1GO3F 2XNDG 5B1AB 1NVPB 2QE7G 2XAJA 3CCSV 3IC7A 1YI2V 5KA6A 1JPXA 4RUFA 1PNLA 2Q67A 1WPXA 4RQEA 1PL0A 4WFGA 2UXXA 3CCMV 3MHSC 1NR1A 1M57B 4LCUC 4UVAA 2PI4A 3IGAC 3STZC 1FXHA 2QEXV 3T1CA 3ABLC 3RW0A 4MVOA 4PA4A 2EIKC 5IDJA 2JK5C 2YEVA 1VQ7V 1KECA 3F5WC 3UKMA 2DQ3A 1WLEA 4PA9A 3ZCCA 3ABMB 3ABKB 4MVZA 4PDVA 4XDJA 3ZRSA 2Z5UA 1P7BA 3RVYA 5CBGA 1QCEA 4P2ZA 1W0JG 3BY6A 1K33A 1OCZB 5CA3A 1YHQV 1KQSU 2HFEC 3F7YC 3STLC 4G28B 1NH2B 3GB7C 1AI7A 3BEHA 1V54C 2ZD9A 1H8HG 4UV9A 1GMGA 2ZXWB 1E1QG 5LHIA 5IYBO 4G27B 2WLIA 2WLHA 2K1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0G A;  2ITD C;  3SYA A;  5KUK A;  2EIJ C;  4MVU A;  4MW8 A;  4JTC B;  4PDM A;  2X6A A;  3F7V C;  3SPC A;  3AG3 C;  1S5H C;  2X6C A;  3SPG A;  2HVK C;  2WLK A;  5B1A C;  3ASN C;  4RO2 A;  3FB8 C;  4X8A A;  5CBH A;  3SJQ C;  2DYS C;  2Q69 A;  2W0F C;  2DYR C;  4MTF A;  2IH3 C;  4PA3 A;  2EIM C;  3LDE A;  1M56 C;  4R6Z A;  3AG1 C;  3FB7 C;  4OXS A;  2H8P C;  3K0D A;  4XDK A;  1OCR C;  2DWD C;  4HYO A;  4MVR A;  2WLI B;  3E8B A;  5B1B C;  3SYO A;  2ITC C;  2AHZ A;  3K06 A;  2BOC C;  3OUF A;  3FB6 C;  4H37 A;  4PA7 A;  5EK0 A;  3E8G A;  4ZBM A;  3SPI A;  3JYC A;  3E86 A;  4MW3 A;  4PDR A;  4QE7 A;  4XDL A;  1M57 C;  3E83 A;  5EBW C;  4MVS A;  2IH1 C;  1BL8 A;  4MS2 A;  3SYC A;  5IY5 C;  3E8H A;  3WG7 C;  1R3I C;  5KUM A;  4J9Z B;  3SPH A;  1QLE C;  1K4D C;  3SYP A;  2WLM A;  5J9P C;  5E1A C;  3PJS K;  4GX2 A;  4MVM A;  1K4C C;  3AG4 C;  2EIN C;  3ABM C;  3ABK C;  2NLJ C;  3HPL C;  2HJF C;  3E89 A;  2X6B A;  3K08 A;  4I9W A;  4H33 A;  1OCZ C;  3RVZ A;  3VOU A;  4F4L A;  4PDL A;  5EBM C;  3OGC C;  4BW5 A;  3ZJZ A;  4R50 A;  1XL6 A;  2R9R B;  2QKS A;  2OCC C;  4P9P A;  3SYQ A;  4MTG A;  1XL4 A;  1R3J C;  2A9H A;  3UM7 A;  4WFH A;  4JTA B;  2ZXW C;  4P9O A;  5CBF A;  1ZWI C;  4UUJ C;  4DXW A;  1KKD A;  1OCO C;  2WLN A;  5EC2 C;  2KB1 A;  4JTD B;  3T2M A;  1ORQ C;  4HZ3 A;  2Y69 C;  3OR6 C;  2A79 B;  4RUE A;  3K04 A;  2Q6A A;  5BZB A;  4X88 A;  3SPJ A;  3TCU A;  1OCC C;  2BOB C;  3OUS A;  4WFE A;  3TET A;  3OR7 C;  5EC1 C;  1R3L C;  2A0L A;  4P30 A;  4TWK A;  4GX1 A;  3T4D A;  2HVJ C;  1G4Y B;  4X89 A;  3KG2 A;  2DWE C;  4LP8 A;  2WLJ A;  4RUF A;  3LDD A;  4MSW C;  1J95 A;  2Q67 A;  4EKW A;  4RAI A;  1R3K C;  4WFG A;  2WLL A;  3E8F A;  2AHY A;  4R7C A;  3LDC A;  2EIL C;  4LCU C;  4QNH B;  3IGA C;  1LNQ A;  3K03 A;  3LNM B;  4GX0 A;  4KFM A;  3STZ C;  3T1C A;  3ABL C;  2HG5 C;  3X2Q C;  3RW0 A;  4QE9 A;  4MVO A;  5EBL C;  4PA4 A;  4CBC A;  2EIK C;  2JK5 C;  4MVQ A;  2YEV A;  4PA6 A;  3LUT B;  3F5W C;  2ATK C;  3RBZ A;  3UKM A;  4PA9 A;  3ASO C;  4PDV A;  4MVZ A;  4XDJ A;  3ZRS A;  1P7B A;  3RVY A;  4WFF A;  5CBG A;  4LBE C;  4P2Z A;  1JVM A;  2P7T C;  3FB5 C;  3IFX A;  5B3S C;  2HFE C;  4GX5 A;  3F7Y C;  3STL C;  4G28 B;  3R65 A;  2WLL B;  4MTO A;  3GB7 C;  4R8C A;  3BEH A;  1V54 C;  2ZD9 A;  2QTO A;  3AG2 C;  3T4Z A;  3EFF K;  2Q68 A;  4G27 B;  1V55 C;  2WLI A;  2WLH A;  2K1E A;  4J9Y B; 
#chains in the Genus database with same CATH topology
 1K8A W;  3RYI A;  4PDM A;  1XNR O;  3CC4 V;  5KX5 B;  3LSS A;  1KC8 W;  3C90 A;  2Q5Z A;  2UUC O;  3LNN A;  2QA4 V;  4X9Q A;  1SRY A;  2W0F C;  5LGT A;  3J81 N;  4R6Z A;  1VF7 A;  3OEH G;  1QLN A;  2D3O W;  3O9O A;  1XNR B;  2IJK A;  3CCE V;  4DR2 B;  3OMA B;  2ADQ B;  2OIG A;  2E3C A;  2IJJ A;  3TGU H;  3SPH A;  3QF7 A;  3K9S A;  2YIA A;  4X65 O;  3ABK C;  4UCV A;  3CRC A;  1GN4 A;  1I94 B;  4YIO A;  2AXT Z;  2C2A A;  4PD4 F;  5C8Y A;  1VQ4 V;  5C93 A;  2E5L B;  4UVC A;  5IYC O;  3G6E V;  1IBL B;  4AQY B;  4WFH A;  4JTA B;  1N36 O;  1ZWI C;  4X62 O;  4UUJ C;  5KMG A;  3TJT A;  3I55 V;  4RUE A;  2IU0 A;  3GVM A;  3D36 A;  3G4S V;  2P4V A;  2GTA A;  2GV9 A;  5IT9 N;  1A32 A;  2A0L A;  4TWK A;  4GX1 A;  5BXZ A;  2DYS B;  2ZIO A;  2EIM B;  1HR0 B;  3OD4 A;  5JWP A;  1X59 A;  1WP8 A;  4K3A A;  4RAI A;  1TVK B;  1F4N A;  3FFQ A;  3HKC A;  4DV6 B;  4ZOL B;  5EZY B;  1I5X A;  3CHX A;  3JAL B;  4JI3 O;  3JD0 A;  4QNH B;  1H2N A;  1KP2 A;  1H38 A;  3SJB C;  3QO8 A;  2F4V O;  3JAT B;  4GZR B;  4DUY B;  5B1N A;  2P7T C;  4X1Y A;  4GLX A;  2A7W A;  1CXZ B;  4I55 B;  2CAZ C;  4OGQ B;  3A8T A;  1W2B U;  5F2V O;  1KU9 A;  3SPC A;  5KHG A;  3HKD B;  5JQG B;  2P90 A;  2GTS A;  3UT5 B;  2QR4 A;  2EIM C;  2H8P C;  1YXB A;  3K0D A;  1YTF B;  2YXL A;  2CE4 A;  3E8B A;  4C7U A;  4B3R B;  5LXT B;  5LL6 Y;  2YEV B;  4TQD A;  4PDR A;  1GM7 A;  2XAG A;  1BL8 A;  1R6N A;  3G6B A;  5L3F A;  4I50 B;  1R6K A;  3T1H B;  5J9P C;  1EN6 A;  5H6Q A;  1EN4 A;  1NT2 B;  1NTM H;  4CS2 A;  2B1G A;  3JCZ A;  3JAM N;  3ZHV A;  3JAR A;  1N8R W;  1XEQ A;  3E35 A;  4JAS A;  2YC0 A;  4ABM A;  4DYL A;  2WLN A;  3DTU B;  5DEC A;  2AW9 A;  4JI4 B;  1Q6U A;  1NBM G;  4H13 B;  3H1I H;  3ZHU A;  5JJJ B;  3T4D A;  2Q8V A;  2ZM6 O;  5DN6 G;  2CTP A;  4Q6G A;  2N74 A;  3CSX A;  1HP8 A;  4F6R A;  4LNU A;  3K9A A;  4PHZ A;  4X1I B;  3E8F A;  2JGD A;  1DK1 A;  3JD1 A;  3CRM A;  4YHH O;  1P84 F;  3K03 A;  2QKC A;  2HG5 C;  1YDX A;  1QLE B;  4KXR A;  3SDL A;  4LFA O;  3AG7 A;  3C3S A;  3CCV V;  1Y67 A;  3IC9 A;  4WBN A;  5FL7 G;  2WSS G;  2UXB O;  1DF5 A;  4J9Y B;  2ZCE A;  3HKB B;  2Y69 B;  2OIE A;  2E5L O;  1S76 D;  2OT5 A;  3ZRW A;  5BMV B;  2VQE O;  4O2A A;  3VQY A;  2HP8 A;  4LF7 B;  3ZHR A;  4X65 B;  3FB8 C;  3B77 A;  3FYE B;  3M7M X;  3O65 A;  5L3C A;  4UCS A;  3FAV B;  4HYO A;  4DR2 O;  4J7J A;  1VAR A;  4MVS A;  5IY5 C;  2GSM B;  2RN9 A;  1KBH A;  2BSK A;  1K4D C;  2A3Q A;  2EIN C;  4DV3 B;  4I9W A;  5LP6 C;  2WAM A;  5EBM C;  2QKS A;  2OCC C;  2H3O A;  3UM7 A;  3UO3 A;  4AQY O;  4OX9 B;  1N0N A;  2X7R B;  3DGE A;  3JD4 A;  2QJ1 A;  3FX7 A;  1KYO F;  3EXA A;  4FLT A;  5J2U A;  4JI0 B;  3OFN G;  1VQ8 V;  4WFE A;  3FKS G;  1RM1 C;  4QPJ A;  4I4T B;  1BE3 H;  3AEI A;  1BHA A;  3LDD A;  5LBQ A;  2EJ7 A;  4IYI A;  2YXH A;  1R3K C;  5IYZ A;  4DV3 O;  1XMQ O;  4RWU A;  1Y76 A;  4GX0 A;  1LNQ A;  3HR0 A;  1R1B A;  3Q4H B;  4KFM A;  4JI3 B;  4O4J B;  5H2F Z;  5EBL C;  4JI5 B;  3CE2 A;  4JZG A;  3CJH A;  1F23 A;  4WFF A;  4CH6 A;  2AZ0 A;  1EBO A;  2BTQ B;  4R8C A;  3B40 A;  3JSL A;  3AG2 C;  2CDY A;  1Y74 B;  1FYJ A;  4DRX A;  3H1K H;  2UXD B;  3L73 H;  5KX5 A;  3D36 C;  2IBZ H;  3L71 H;  4FZ1 A;  2EIJ C;  3ZRX A;  2B5U A;  4U7N A;  4U3F H;  1PP9 H;  1IBM B;  5IYD O;  4JV5 O;  5B1A C;  1L0L H;  4X8A A;  4BIU A;  3RFR A;  1FAF A;  2N04 A;  2CH7 A;  5FNV A;  4DW0 A;  2QWP B;  5LOV A;  5FLX N;  2Y0P A;  1TUB A;  1PV0 A;  4U3J A;  1F4M A;  3J7A U;  2EZP A;  3E8G A;  3KZI Z;  3N2G A;  4W4L A;  1OJH A;  2JEX A;  2BSK B;  2CH7 B;  2Q7G A;  4DO2 A;  1K3E A;  5B3S B;  2XAH A;  1ENV A;  2FL4 A;  4DR4 O;  4P9P A;  1K7D A;  5B1O A;  2OYQ A;  4BW9 A;  3D3Q A;  1D5A A;  5CMU A;  2XOK G;  4CZZ A;  2YIB D;  3AG3 B;  1H8E G;  1FXK C;  1OCC C;  1IVS A;  5B1A B;  4X20 B;  2E75 B;  4DR3 O;  5BY1 A;  3IC7 A;  3RYC A;  3ZHS A;  1YI2 V;  1JPX A;  1PL0 A;  2UXX A;  1BZK A;  1M57 B;  3IGA C;  1FXH A;  2QEX V;  2P4K A;  2QWN B;  3T1C A;  1XMO B;  2EIK C;  3ZCC A;  4X1K A;  5JVD A;  4MVZ A;  4J41 A;  5BR8 O;  1URF A;  1QCE A;  2EUL A;  2QGN A;  1OCZ B;  3T1Y O;  2HFE C;  3F7Y C;  5JCO C;  3GB7 C;  1AI7 A;  4UFZ A;  1H8H G;  2CUG A;  2ZXW B;  5LHI A;  5IYB O;  4G27 B;  2WLH A;  3H9V A;  2K1E A;  1IZ3 A;  3CCU V;  3ZHQ A;  4O2B A;  2X6A A;  1SES A;  4EFE A;  2RDC A;  1N32 B;  4UB6 Z;  3KCX A;  4JYA B;  4ASU G;  2XAF A;  4K8Z A;  3W7S A;  1DGS A;  4MVR A;  5KHH A;  5GON A;  2QM8 A;  1MAB G;  4MW3 A;  1M5I A;  1BT8 A;  1VQO V;  3OTO B;  2L6L A;  4D7S A;  1UFI A;  1AP6 A;  1O9H A;  3JD2 A;  3MHH C;  3CCR V;  1QU7 A;  3ABM C;  4J80 A;  1RSO A;  4LC1 A;  5L3G A;  2PZS A;  3JAS A;  3OGC C;  4JI2 O;  4JV5 B;  4R50 A;  4LFB O;  2Z0A A;  1Q82 W;  1WA8 A;  5DM6 V;  3ZRV A;  2PUS A;  4DUZ O;  2GUZ B;  2KB1 A;  4QPK A;  5LA6 B;  4JI1 O;  1NR7 A;  4JAA A;  3P32 A;  2FTK A;  2GUZ A;  3BAB A;  5B5E Z;  4J10 A;  5L3E A;  1N33 O;  4U3J B;  1M90 W;  1ZAU A;  4DV1 B;  5CN0 A;  3K5N A;  2M6Y A;  5EYP B;  4X89 A;  5GTH Z;  2YI9 A;  1NQT A;  3RWR D;  4UCT A;  5IYZ B;  1JFF B;  4JI5 O;  1HNZ O;  3P3N A;  3ABU A;  3QTC A;  1YTF D;  2AHY A;  2JIZ G;  3M99 B;  4KL1 A;  4FFB B;  4FFK A;  2NNU A;  2JDI G;  5ITZ A;  3X2Q C;  3M8A A;  2QM7 A;  3JAT A;  3HB3 B;  5JJN B;  1TUB B;  1GKF A;  1XDC A;  3WB0 A;  5LP6 A;  1Q81 W;  3W7W A;  2BTQ A;  2X0L A;  3FB5 C;  3IFX A;  1NZ6 A;  5LMU O;  1Y6X A;  2R9A A;  1K97 A;  4I55 A;  1FS0 G;  3GWO A;  1ZTE A;  2QWO B;  4O2B B;  1ZUQ A;  2JJ1 G;  1E79 G;  5KAI Z;  1OV9 A;  3APO A;  3HKE A;  4NXM O;  4JI8 O;  1S5J A;  4UCU A;  2X6C A;  2HVK C;  5IJ9 B;  4JI0 O;  4DV1 O;  1SKV A;  4DV0 B;  2UXC B;  1SQQ H;  3ZBH A;  1H2K A;  3RYH A;  1CPY A;  1EM1 A;  4FZ0 A;  2WA4 A;  3D3I A;  4MS2 A;  5LXT A;  5H5N A;  1EFR G;  1XMO O;  2ZDI A;  2ODM A;  3CYO A;  4DR5 B;  1R73 A;  5J2T A;  4I0X B;  1LUV A;  2HJF C;  2Q0O C;  2X6B A;  3K08 A;  3UO2 A;  1W0K G;  5KHJ A;  3E2E A;  1TGO A;  4X1K B;  5LYJ A;  1AI6 A;  2F23 A;  2DMX A;  2QM4 A;  4N21 A;  4DR3 B;  4LNU B;  3W7U A;  1AIL A;  1P49 A;  3T2M A;  1T5E A;  4JAV A;  1MSD A;  2VQF B;  3SJA C;  3FAV A;  4DK1 A;  3C3T A;  1KD1 W;  4DR4 B;  4JF3 A;  3H1J H;  4O2A B;  2EZO A;  2Y48 A;  1JQ0 A;  2ZIN A;  3N2K B;  4LF8 O;  1KUQ A;  3QO5 A;  1VMG A;  3HKC B;  3LSQ A;  1XQ8 A;  3ZS8 C;  1IXM A;  5LHG A;  4AHC A;  3ZMZ A;  1SZT A;  3ASO C;  4YIP A;  3AG4 B;  1F51 A;  1G6U A;  4I50 A;  2ZM6 B;  4HAM A;  2N05 A;  2RJZ A;  3VQX A;  3EFF K;  1QR8 A;  1K73 W;  5KAF Z;  2EBO A;  1KMI Z;  1E1R G;  2WA3 A;  4TSF G;  3B2E E;  3OMI B;  1U97 A;  3MDS A;  4KUM A;  3K57 A;  2LQT A;  1PL4 A;  2XUM A;  2RQ6 A;  2QWQ B;  4GKJ O;  5CB4 B;  1BQ0 A;  1OHH G;  3G80 A;  2EIL B;  5D5P A;  3OW2 U;  2D2C B;  1B04 A;  3WB2 A;  4X1Y B;  4ZKI A;  1TAE A;  1ZL8 B;  1EN5 A;  3JAR B;  3N2K A;  1FFX B;  4Q20 A;  3L70 H;  1QVF U;  1FFT B;  2CTR A;  4WCE V;  2VWK A;  2M7W A;  1V55 B;  4FLX A;  4YJ3 B;  3AK2 A;  3VQV A;  4UCR A;  2O57 A;  1Q6H A;  4BIO A;  2ZE7 A;  5LGN A;  2HHH O;  2VS0 A;  4JZ2 A;  3OR7 C;  2L35 A;  1YZB A;  2MK3 A;  1G4Y B;  3ZMU A;  2DW4 A;  1VQ6 V;  1CEZ A;  2K9P A;  1OCR B;  2WLL A;  1FD9 A;  2EIL C;  1M1K W;  5C8Y B;  4DV2 O;  5A9G A;  2V7Q G;  2GBO A;  1Q86 W;  4DK0 A;  1KB9 F;  4LF5 B;  4F6E A;  4GYC B;  4YJ3 A;  4LBE C;  2HEP A;  3HKD A;  5JQG A;  4TUY B;  2EX3 A;  3ZIA G;  1XNQ B;  4DV2 B;  4JAU A;  3CCL V;  4K0K O;  4IIJ B;  4O4H B;  4J7K A;  1R6T A;  1SET A;  1PNK A;  4O4H A;  1AR1 B;  1FXK B;  1GH6 A;  5CA1 A;  3CEI A;  2Q69 A;  1Y4M A;  4JI1 B;  1L8D A;  3ZN0 A;  3U10 A;  1JCH A;  2WLI B;  3BRC A;  3JSN A;  4ZBM A;  3K06 A;  2BOC C;  4LFB B;  1K34 A;  1M57 C;  2ADP A;  4EFB A;  1SA0 A;  4EB6 A;  3FYI B;  1JMK C;  4I0X A;  1S3J A;  4FFB A;  2DE0 X;  3CRA A;  3CRR A;  2ZNI A;  2LGQ A;  2HR3 A;  1V54 B;  1MG1 A;  2PI5 A;  2ZDI C;  2ZXW C;  3FD9 A;  3RT3 C;  4BAY A;  4YXW G;  1KKD A;  1B06 A;  2DOS A;  3ZMV A;  1BSM A;  3N2G B;  5H9C A;  3OR6 C;  4ZI7 A;  3OM3 B;  5BZB A;  4NYK A;  3IAY A;  4CH3 A;  3AK3 A;  2KG7 A;  3QG5 A;  5FPR A;  2QE7 G;  2XAJ A;  2JGU A;  4LFC B;  1Q6I A;  4RUF A;  1US6 A;  1PNL A;  4DV5 O;  3APQ A;  3S3X A;  2ZE5 A;  3T1Y B;  2PI4 A;  3STZ C;  4DUZ B;  1FFX A;  5IDJ A;  2YEV A;  1VQ7 V;  1IDS A;  3ZHT A;  1LUW A;  3ABM B;  3ZRS A;  1P7B A;  4DR1 B;  1JR9 A;  4P2Z A;  1W0J G;  3BY6 A;  1K33 A;  3STL C;  1NH2 B;  2E76 B;  4DV7 B;  4ZOL A;  5EZY A;  2KSD A;  2BTO A;  3K5M A;  2YXY A;  1Q5O A;  2P22 C;  3BVO A;  5CB4 A;  5IWA O;  1FJG B;  3CME V;  1AI5 A;  1MSW D;  4JTC B;  3AG3 C;  3SPG A;  5IJ0 B;  3BPZ A;  4HNA B;  2OTL V;  2P67 A;  4RQF A;  4QIW F;  2IH3 C;  4JI4 O;  2A06 H;  1M56 C;  4LF4 B;  1AR4 A;  2DWD C;  3RYH B;  4PA7 A;  1P4R A;  3SPI A;  1WN7 A;  2YIB A;  3K5O A;  5JVD B;  1K5Q A;  2ZIM A;  1VQ9 V;  1W59 A;  2IU3 A;  3X2Q B;  5KUM A;  1DF4 A;  1Q7Y W;  1EZJ A;  1QVG U;  4DV6 O;  4H33 A;  1OCZ C;  1MMM A;  4NXN O;  3T1H O;  3L9D A;  3JCU Z;  2YI8 A;  3VBB A;  4GUN A;  1Q90 D;  2R9R B;  1VF6 A;  2YIC A;  4NB5 A;  1GM8 A;  1GN6 A;  1G1X B;  1AP5 A;  2YDE A;  4Z1V A;  5EC2 C;  2H94 A;  2KKW A;  1OZ0 A;  2E74 B;  4TV9 A;  4U7O A;  5EC1 C;  4P30 A;  2XAQ A;  3DXR A;  1BGY H;  2ZNJ A;  3MAQ A;  5LHH A;  1HWY A;  3RYI B;  2UXD O;  1M56 B;  4PJ0 Z;  1KP3 A;  4WFA V;  1I94 O;  1ZLZ A;  1N4C A;  2LJ2 A;  4R7C A;  1M9N A;  4QE9 A;  4CBC A;  4UB8 Z;  3CX5 F;  1H2S B;  2ATK C;  2LFS A;  3BAA A;  2FKX A;  1SS3 A;  3I56 V;  2F93 B;  4NKG B;  4WBN B;  3SGI A;  4LF6 B;  3D8C A;  1MA1 A;  1YVW A;  4GX5 A;  3ETQ A;  4MTO A;  3IJ4 A;  4FK5 C;  2OWO A;  3T4Z A;  4FVM A;  3JD3 A;  2UUC B;  2ITC C;  2QKA A;  1NJI W;  4O4I B;  3CCQ V;  3K0G A;  2ITD C;  2ETN A;  1CP9 A;  1SC5 B;  2YUA A;  1NKD A;  3KCY A;  4RO2 A;  1ZL8 A;  2ZKO A;  2DYR C;  2PGG A;  4B3T O;  1ROP A;  1X4T A;  1HW7 A;  3EVK A;  1XHZ A;  3ZMT A;  4OX9 O;  1N36 B;  2AGA A;  2CGO A;  3E22 B;  3E83 A;  1N33 B;  4FM0 A;  1SQB H;  1S77 D;  1NI8 A;  2RNB A;  3SYP A;  2WLM A;  4DRX B;  1Y76 B;  3A2F A;  5JH7 B;  1GK9 A;  2OTJ V;  1LR1 A;  2XTA A;  3K79 A;  3ZJZ A;  4JI2 B;  4QJF B;  3K58 A;  1IXB A;  3S3W A;  1OCO C;  5HFM A;  4FM2 A;  2VRZ A;  2UU9 B;  1GRJ A;  3RN4 A;  1COW G;  4B3S O;  4JYA O;  3TET A;  1V9P A;  1R3L C;  2MW2 B;  2Z3Y A;  2DYR B;  1GAX A;  3DXR B;  2JS3 A;  3L74 H;  3CD6 V;  4EKW A;  3RYC B;  2DQ0 A;  4WFB V;  1N32 O;  3LDC A;  5IY5 B;  4D7T A;  1I5Y A;  1J5E O;  1VP7 A;  2UUB B;  5KHK A;  1Z5V A;  1JX9 A;  2EIN B;  4LWS B;  2QSA A;  4DV4 O;  1WP7 A;  4LH7 A;  2Q4P A;  3OGI B;  2IJI A;  2WPD G;  4FJC C;  1PNM A;  4JI7 O;  1BCC H;  4J9Z B;  4YJ2 B;  4LF6 O;  5LMN B;  4OPA A;  2LGW A;  3ZMS A;  4MW8 A;  3BA8 A;  4LR3 A;  5K1X A;  4NTX A;  4CH5 A;  2GHY A;  3LSU A;  1QQC A;  4ZIB A;  3LDE A;  3ICX A;  3AG1 C;  1FPO A;  2NN4 A;  1XRE A;  2VQE B;  5B1B C;  3SYO A;  3U0Z A;  2AHZ A;  2F43 G;  5JCO A;  3H01 A;  5EBW C;  4XDL A;  2P6J A;  4JYY A;  1KKC A;  1AR5 A;  5GTI Z;  4LF4 O;  1QLE C;  4TUY A;  1AJN A;  3AG4 C;  4JI6 B;  1NU1 H;  1TA8 A;  4IHJ A;  5EIB C;  2PTM A;  4X1I A;  3OE7 G;  1L0N H;  3B8N A;  4J7Z A;  1O9G A;  2ILM A;  4IL6 Z;  4DR6 B;  1YIJ V;  5IE9 A;  2DN9 A;  4IT5 A;  3GWK C;  1MZF A;  4BR6 A;  2HJD A;  1G8M A;  4X20 A;  2P06 A;  1GM9 A;  1K5S A;  1FKA O;  4LP8 A;  4X66 O;  3ZN1 A;  1IX9 A;  1PKX A;  4GT1 A;  3ZED A;  3LNM B;  2YSU B;  1SQF A;  4WF9 V;  1WNS A;  5LP6 B;  1VF6 C;  2YS8 A;  3VQW A;  4X64 B;  2OCC B;  3A0B Z;  3NR7 A;  1B3Q A;  4I5S A;  1SZX A;  2Q68 A;  4TOI A;  1V55 C;  1SER A;  1N34 O;  1MNG A;  2ZE8 A;  3SYA A;  1NTZ H;  5KUK A;  4MVU A;  1THZ A;  3F7V C;  5LMN O;  1OCC B;  1SQX H;  3G71 V;  1XMQ B;  1NTK H;  1VF5 B;  4NXN B;  3UCS C;  2UXC O;  4FMT A;  4MTF A;  3TXS A;  5E79 Z;  1OCR C;  2W0X A;  4BIZ A;  1JJ2 U;  4DV5 B;  4JI8 B;  1ARO P;  2VWJ A;  3OUF A;  5EK0 A;  1YSC A;  4K35 A;  4W4K A;  4TV8 A;  4JYC A;  4LFC O;  2KG7 B;  3SYC A;  2ZT9 B;  1JA8 A;  3ABL B;  3ZRW B;  5AG2 A;  1J5E B;  4UXN A;  5E1A C;  1XUQ A;  4GX2 A;  3HKB A;  4JPR A;  2ZE6 A;  4H44 B;  4LF9 B;  3A0R A;  1QBZ A;  4FLU A;  4CS4 A;  3AG2 B;  2A9H A;  2UXN A;  1L1F A;  5CBF A;  1Z5W A;  4YY3 O;  3DC6 A;  2BCC H;  3WU2 Z;  4DXW A;  4MTX A;  1RFY A;  4B3S B;  2A79 B;  3OMN B;  4LH6 A;  4PEL A;  4IIJ A;  1N0J A;  3JAL A;  3OT7 A;  2Q7H A;  3K3W A;  1GO3 F;  2XT9 A;  2XND G;  1SA0 B;  3A0H Z;  4CH4 A;  3K5L A;  1D5N A;  5KA6 A;  5KLV H;  4FLZ A;  2Q67 A;  1WPX A;  4RQE A;  4WFG A;  5FNV B;  3CCM V;  2UXB B;  1NR1 A;  4PI0 A;  4LCU C;  1MZE A;  2Y0I A;  1UPG A;  2QDO A;  1H2M A;  3ABL C;  1Z2G A;  4X62 B;  4X66 B;  2JK5 C;  3F5W C;  3BA9 A;  3UKM A;  2DQ3 A;  3ABK B;  4XDJ A;  1S5L Z;  2Z5U A;  1BQZ A;  4NR1 A;  5CA3 A;  1KQS U;  3P3P A;  2HHH B;  4G28 B;  1Q8I A;  4I7Z B;  4B7K A;  2XHB A;  3BEH A;  1V54 C;  2ZD9 A;  2PYJ A;  4K0K B;  4UV9 A;  4YHH B;  1IUR A;  5A2Q N;  3CPW U;  1FXK A;  3CMA V;  3RYF B;  2QTS A;  2IW5 A;  2FYU H;  4LF5 O;  3ETG A;  4XBF A;  3W7X A;  4TQF A;  4KHP B;  4FPP A;  2CTQ A;  1VQK V;  4LF8 B;  5CBH A;  1Q43 A;  4PA3 A;  4LF9 O;  3ABT A;  1AB3 A;  1F7Y A;  1DTO A;  1I0H A;  2PYL A;  3R66 A;  1ZX3 A;  3CXC U;  1YEW A;  2VQF O;  1B6Q A;  3WG7 C;  1R3I C;  3UQ8 A;  1XOU A;  5L3D A;  2EIK B;  1Y66 A;  3BFR A;  3I5D A;  4MVM A;  2Y4T A;  2JRI A;  2NLJ C;  3SJC C;  1MOF A;  4DR7 B;  4A5U B;  3RVZ A;  4F4L A;  1YJ9 V;  1GN2 A;  1AI4 A;  5HFL A;  2ARH A;  2B1I A;  4BWA A;  5K1P A;  4UCO A;  4AIL C;  4F6R B;  1TUE B;  4GCZ A;  2LW7 A;  3L75 H;  4FIP C;  2WWW A;  2Q6A A;  3SPJ A;  1M4U A;  3OUS A;  5EYP A;  2F66 C;  4JGS A;  2HVJ C;  4FM1 A;  3KKY A;  3E22 A;  1NS1 A;  4GKK B;  2V4D A;  1DLB A;  4B7E A;  1J95 A;  4N23 A;  5LA6 A;  3W7T A;  4DR7 O;  5DED A;  4Z1M G;  1VQN V;  4B3M O;  1Y74 A;  4B08 A;  4L8J A;  3WG7 B;  1UJW B;  5B66 Z;  2JVD A;  5ITZ B;  4MVQ A;  3LUT B;  5D5Q A;  3ETD A;  5LYJ B;  1QNM A;  5JJE B;  4DUY O;  3JAK B;  4E2L A;  1YF2 A;  4J42 A;  3ZX6 A;  1QR9 A;  2JS5 A;  2IJH A;  3OAA G;  1JJO A;  1YIT V;  1SQG A;  2ZR3 A;  4FLY A;  3RYF A;  2PF4 E;  1K9M W;  5LGU A;  3TXQ A;  4GKK O;  4I9Q A;  1HR0 O;  4G2K A;  1XI1 A;  4LFA B;  1S5H C;  4EB6 B;  1D2D A;  5IWA B;  1FJG O;  2WLK A;  1H2G A;  1PPJ H;  2RMK B;  2DYS C;  2JGD B;  5J2T B;  4IYH A;  2ZR2 A;  1HNZ B;  4JI6 O;  3U11 A;  2NR5 A;  1IBM O;  2W6I G;  1BHB A;  1AVM A;  4CS3 A;  4H37 A;  1WB8 A;  2IM9 A;  4DR1 O;  3CB2 A;  1EZV H;  3DSQ A;  3E8H A;  2CGN A;  4B3T B;  2UUA B;  5CA0 A;  3PJS K;  4GKJ B;  3CRQ A;  2B9Z A;  3E89 A;  2AZ2 A;  1NVP D;  4NTY A;  4NXM B;  1VIB A;  3CS5 A;  3OEE G;  2F95 B;  1VQL V;  4TV8 B;  2V1D A;  2R72 A;  5GW7 A;  4JTD B;  3J80 N;  2Y69 C;  2YID A;  3TCU A;  3OTO O;  4JI7 B;  4DR5 O;  2RCV A;  4K8X A;  5EIB D;  4JYB A;  3ASN B;  3H1L H;  2LO1 A;  3KG2 A;  2G38 A;  2WLJ A;  5FPO A;  1YCI A;  2GDS A;  5B1B B;  5KMG B;  4B3R O;  4O4L A;  4E4E A;  3ML0 A;  4D6T H;  2HKO A;  3BHP A;  3NXS A;  5L3B A;  4PA6 A;  1RP3 B;  4Z2W A;  3RBZ A;  1BMF G;  2Q7E A;  1S72 V;  3P30 A;  4LWS A;  1RPO A;  1AJP A;  3R65 A;  3N27 A;  1WPB A;  1OCO B;  2JJ2 G;  3SR2 C;  1WB7 A;  1I7F A;  3AK1 A;  3ETE A;  3L72 H;  2F4V B;  1N34 B;  3PN1 A;  4NVP A;  4EEQ A;  2Y4U A;  1RM1 B;  3ASN C;  3SJQ C;  3QO7 A;  1YJN V;  2XAS A;  4LF7 O;  1AJQ A;  1XNQ O;  3FB7 C;  2FML A;  4FLV A;  1VQ5 V;  4O4J A;  3FB6 C;  3OTF A;  4QE7 A;  4YY3 B;  1VQM V;  4TT3 G;  1VEW A;  5TIS Z;  1BS3 A;  1YJW V;  2Q0A A;  1HNX O;  3UT5 A;  5H6R A;  3ASO B;  3CCJ V;  3CC2 V;  3HPL C;  1K92 A;  3VOU A;  5JH7 A;  1WA8 B;  2ZQM A;  1HNW B;  1FXV A;  1XL4 A;  2R70 A;  3THO A;  2EJR A;  4HBN A;  1SQP H;  1SQV H;  1ORQ C;  5CA1 B;  2HLD G;  3K04 A;  3CC7 V;  4X88 A;  4DW1 A;  2BOB C;  1P7G A;  4UV8 A;  4ZHQ A;  1IBK B;  5LMU B;  2DWE C;  4AI8 A;  4MT8 A;  4DR6 O;  3AG1 B;  3G67 A;  4YJ2 A;  4MSW C;  5IJ9 A;  3K59 A;  4IHJ B;  3WB1 A;  1RSO B;  1WAZ A;  1TVK A;  3H1H H;  3JAW A;  4X64 O;  3Q4H A;  4PV1 B;  1GTO A;  1JVM A;  5B3S C;  3CP1 A;  1S0V A;  2WLL B;  5KHI A;  4O4L B;  2QTO A;  3EHB B;  2LW1 A;  1PM9 A;  2UUA O;  4CC6 A;  5KA5 A;  4ZHQ B;  2Q73 A;  4J11 A;  5BR8 B;  3WFV A;  3B4S A;  3TK1 A;  4ICG A;  1JFF A;  3HKE B;  2BE3 A;  5BMV A;  1M93 A;  1H2L A;  4KP4 A;  1RPR A;  4OXS A;  4XDK A;  3JAW B;  3RGB A;  3BCC H;  4UVB A;  4TV9 B;  1IBK O;  2P5O A;  4DV4 B;  2F1M A;  3JYC A;  3E86 A;  3B8M A;  3MD0 A;  3QNE A;  1QHT A;  4NTW A;  2IH1 C;  1XBL A;  2UUB O;  2CTW A;  1HNW O;  2DJV A;  4HNA A;  4QGP A;  3QVN A;  2FB5 A;  1PD3 A;  1K4C C;  5LOV B;  4L87 A;  5CA0 B;  3JAS B;  1XHX A;  2JEU A;  2R9I A;  1HNX B;  1VQP V;  2CK3 G;  2PY5 A;  4PDL A;  4BW5 A;  1XL6 A;  2LFR A;  3CJH B;  3SYQ A;  4MTG A;  1R3J C;  3JAK A;  4P9O A;  2LP7 A;  4IGG A;  1JOY A;  4HZ3 A;  4B3M B;  1I08 A;  1NH2 D;  2EIJ B;  2Q9L A;  4KHP O;  2W6J G;  5GON B;  2UU9 O;  4CC5 A;  4DV7 O;  4H0L B;  1NVP B;  3CXH F;  3CCS V;  4I4T A;  4O4I A;  1ZSP A;  1HDJ A;  1Q3E A;  1U96 A;  2QWR B;  3MHS C;  5J2U B;  4UVA A;  3B09 A;  4OPH A;  2KQX A;  3RW0 A;  4MVO A;  4FLW A;  3F5T A;  3CWB H;  4PA4 A;  1IBL O;  1KEC A;  4PA9 A;  1WLE A;  1SF9 A;  3DC5 A;  4PDV A;  3RVY A;  5CBG A;  4ZI7 B;  2OCH A;  4PI2 A;  1YHQ V;  5IJ0 A;  1XIL A;  4DV0 O;  1GMG A;  1E1Q G;  2WLI A;  1WJZ A;  1GN3 A; 
#chains in the Genus database with same CATH homology
 3CPW U;  1K8A W;  1FXK A;  3CME V;  1AI5 A;  3CMA V;  1MSW D;  4JTC B;  4PDM A;  2X6A A;  2IW5 A;  3AG3 C;  3CC4 V;  1SES A;  3LSS A;  3SPG A;  1KC8 W;  3ETG A;  4XBF A;  3W7X A;  2OTL V;  2P67 A;  4RQF A;  4FPP A;  2QA4 V;  1VQK V;  5CBH A;  4QIW F;  1SRY A;  2W0F C;  4ASU G;  5LGT A;  2IH3 C;  4PA3 A;  2XAF A;  1M56 C;  3ABT A;  4R6Z A;  3OEH G;  1DTO A;  3W7S A;  2DWD C;  4MVR A;  1QLN A;  2D3O W;  4PA7 A;  1P4R A;  2IJK A;  3CXC U;  3SPI A;  2QM8 A;  1MAB G;  4MW3 A;  3CCE V;  1K5Q A;  3OMA B;  1VQ9 V;  1B6Q A;  3WG7 C;  1R3I C;  2IU3 A;  1VQO V;  3X2Q B;  2IJJ A;  5KUM A;  5L3D A;  3SPH A;  2EIK B;  1DF4 A;  1Q7Y W;  1EZJ A;  3JD2 A;  1Y66 A;  3MHH C;  3CCR V;  4MVM A;  3ABM C;  3ABK C;  2NLJ C;  1QVG U;  1MOF A;  4H33 A;  4LC1 A;  5L3G A;  1OCZ C;  3RVZ A;  4F4L A;  1YJ9 V;  3VBB A;  3OGC C;  2C2A A;  4R50 A;  2R9R B;  5C93 A;  1VQ4 V;  1AI4 A;  4UVC A;  5HFL A;  5IYC O;  3G6E V;  1Q82 W;  1GM8 A;  4WFH A;  2B1I A;  4JTA B;  3ZRV A;  5DM6 V;  1ZWI C;  4UUJ C;  1TUE B;  4GCZ A;  5EC2 C;  2KB1 A;  4QPK A;  3I55 V;  2H94 A;  1NR7 A;  4FIP C;  1OZ0 A;  4RUE A;  3P32 A;  2WWW A;  2FTK A;  2Q6A A;  3SPJ A;  2IU0 A;  5L3E A;  3D36 A;  4U7O A;  3OUS A;  3G4S V;  1M90 W;  5EC1 C;  2A0L A;  4JGS A;  5CN0 A;  4P30 A;  2XAQ A;  4GX1 A;  4TWK A;  2HVJ C;  5LHH A;  1HWY A;  4X89 A;  2DYS B;  2EIM B;  1M56 B;  1NQT A;  1KP3 A;  1DLB A;  1J95 A;  4N23 A;  4RAI A;  4WFA V;  1F4N A;  3W7T A;  3ABU A;  1YTF D;  2AHY A;  4R7C A;  2JIZ G;  3M99 B;  4Z1M G;  1VQN V;  1I5X A;  4QNH B;  3JD0 A;  2NNU A;  2JDI G;  3WG7 B;  1KP2 A;  3X2Q C;  1M9N A;  4QE9 A;  1UJW B;  2QM7 A;  4CBC A;  1H38 A;  3HB3 B;  4MVQ A;  1GKF A;  3LUT B;  2ATK C;  3ETD A;  2LFS A;  3QO8 A;  1Q81 W;  3W7W A;  4E2L A;  2X0L A;  3I56 V;  5B1N A;  2P7T C;  3FB5 C;  3IFX A;  1QR9 A;  4GX5 A;  2IJH A;  1K97 A;  4MTO A;  3OAA G;  1FS0 G;  4FK5 C;  3GWO A;  1YIT V;  3T4Z A;  3JD3 A;  2ZR3 A;  2ITC C;  1NJI W;  3CCQ V;  3K0G A;  1W2B U;  5LGU A;  1K9M W;  2ITD C;  2JJ1 G;  1E79 G;  1CP9 A;  3SPC A;  4G2K A;  1S5H C;  2X6C A;  2HVK C;  1NKD A;  2WLK A;  4RO2 A;  2P90 A;  1H2G A;  2DYS C;  2DYR C;  2ZR2 A;  2EIM C;  1ROP A;  2H8P C;  3K0D A;  1YTF B;  2W6I G;  3ZMT A;  3E8B A;  1CPY A;  1BHB A;  4H37 A;  2YEV B;  4PDR A;  3D3I A;  1GM7 A;  3E83 A;  2XAG A;  1BL8 A;  1R6N A;  4MS2 A;  3E8H A;  5L3F A;  1S77 D;  1EFR G;  1R6K A;  2ZDI A;  3SYP A;  2WLM A;  5J9P C;  3PJS K;  5H6Q A;  3CYO A;  1R73 A;  2B1G A;  3JCZ A;  2HJF C;  3E89 A;  1GK9 A;  2X6B A;  3K08 A;  1NVP D;  2OTJ V;  3E2E A;  1W0K G;  3K79 A;  3ZJZ A;  1N8R W;  4QJF B;  3OEE G;  1VQL V;  2V1D A;  1AI6 A;  4N21 A;  3E35 A;  4JAS A;  1OCO C;  3W7U A;  5GW7 A;  2WLN A;  4JTD B;  3T2M A;  5HFM A;  2Y69 C;  3DTU B;  4JAV A;  1COW G;  3TCU A;  1NBM G;  3TET A;  1R3L C;  4JYB A;  3ASN B;  3T4D A;  2Z3Y A;  5DN6 G;  3KG2 A;  2DYR B;  1KD1 W;  4JF3 A;  2WLJ A;  3CD6 V;  2EZO A;  5B1B B;  4EKW A;  2Y48 A;  3K9A A;  1JQ0 A;  2DQ0 A;  4WFB V;  3E8F A;  3JD1 A;  3LDC A;  3QO5 A;  3ML0 A;  5IY5 B;  3K03 A;  3LSQ A;  2HG5 C;  2HKO A;  1I5Y A;  1QLE B;  3NXS A;  5L3B A;  1IXM A;  4PA6 A;  5LHG A;  3RBZ A;  3ZMZ A;  1SZT A;  3ASO C;  1BMF G;  3AG4 B;  1JX9 A;  2EIN B;  3CCV V;  1F51 A;  1S72 V;  4HAM A;  3P30 A;  1RPO A;  1AJP A;  3R65 A;  2IJI A;  5FL7 G;  2WPD G;  4FJC C;  1PNM A;  2WSS G;  3EFF K;  1QR8 A;  1OCO B;  1DF5 A;  2JJ2 G;  4J9Z B;  4J9Y B;  2EBO A;  1K73 W;  2Y69 B;  1S76 D;  2OT5 A;  3ZMS A;  4MW8 A;  1E1R G;  3ETE A;  4TSF G;  3OMI B;  3ZRW A;  1RM1 B;  4KUM A;  3CCU V;  3ASN C;  3FB8 C;  3B77 A;  2GHY A;  3SJQ C;  3QO7 A;  1YJN V;  3FYE B;  3LDE A;  2XAS A;  1AJQ A;  3AG1 C;  3FB7 C;  5L3C A;  4HYO A;  5B1B C;  1VQ5 V;  3SYO A;  2AHZ A;  2F43 G;  3FB6 C;  3H01 A;  1OHH G;  5EBW C;  4QE7 A;  4XDL A;  2P6J A;  2EIL B;  4MVS A;  5IY5 C;  1VQM V;  4TT3 G;  3OW2 U;  2GSM B;  1YJW V;  1K4D C;  1QLE C;  4ZKI A;  1AJN A;  5H6R A;  3ASO B;  3CCJ V;  3AG4 C;  2EIN C;  3CC2 V;  3HPL C;  1K92 A;  3OE7 G;  4I9W A;  4Q20 A;  3VOU A;  2WAM A;  3B8N A;  1QVF U;  5EBM C;  2ZQM A;  2QKS A;  2OCC C;  1YIJ V;  1FXV A;  1XL4 A;  3UM7 A;  1FFT B;  2EJR A;  4WCE V;  2M7W A;  2X7R B;  3DGE A;  3JD4 A;  1V55 B;  1ORQ C;  2HLD G;  3K04 A;  3CC7 V;  5LGN A;  4X88 A;  3OFN G;  1G8M A;  1GM9 A;  1VQ8 V;  1K5S A;  2BOB C;  4UV8 A;  3FKS G;  4WFE A;  3OR7 C;  1RM1 C;  4QPJ A;  3AEI A;  2MK3 A;  1BHA A;  1G4Y B;  2DWE C;  2DW4 A;  3ZMU A;  4MT8 A;  4LP8 A;  3AG1 B;  3ZN1 A;  1VQ6 V;  3LDD A;  4MSW C;  5LBQ A;  1CEZ A;  1OCR B;  1PKX A;  4GT1 A;  1R3K C;  2WLL A;  2EIL C;  3LNM B;  1LNQ A;  4GX0 A;  4KFM A;  1M1K W;  2YSU B;  5EBL C;  4WF9 V;  2V7Q G;  1Q86 W;  1F23 A;  4WFF A;  4LBE C;  1GTO A;  1JVM A;  5B3S C;  3CP1 A;  1EBO A;  1S0V A;  2WLL B;  4R8C A;  3ZIA G;  2OCC B;  2QTO A;  4JAU A;  3AG2 C;  3CCL V;  3EHB B;  4I5S A;  2Q68 A;  1V55 C;  5KA5 A;  1SER A;  1SET A;  1PNK A;  3SYA A;  3ZRX A;  5KUK A;  2EIJ C;  4MVU A;  2B5U A;  1THZ A;  3F7V C;  4U7N A;  1AR1 B;  1FXK B;  3WFV A;  1OCC B;  3TK1 A;  5IYD O;  3G71 V;  5B1A C;  4X8A A;  4BIU A;  2Q69 A;  1Y4M A;  4FMT A;  4MTF A;  4KP4 A;  1RPR A;  3ZN0 A;  4OXS A;  4XDK A;  1JCH A;  1OCR C;  2WLI B;  4BIZ A;  4UVB A;  1F4M A;  1JJ2 U;  1ARO P;  3K06 A;  2BOC C;  3OUF A;  1YSC A;  5EK0 A;  4ZBM A;  2EZP A;  3E8G A;  3JYC A;  3E86 A;  3B8M A;  1K34 A;  3MD0 A;  3QNE A;  1M57 C;  4JYC A;  2IH1 C;  3SYC A;  3ABL B;  3ZRW B;  3FYI B;  4UXN A;  1S3J A;  5E1A C;  1PD3 A;  2JEX A;  4GX2 A;  1K4C C;  4DO2 A;  4JPR A;  4L87 A;  1K3E A;  2JEU A;  2R9I A;  1VQP V;  3A0R A;  1QBZ A;  2CK3 G;  2XAH A;  1ENV A;  5B3S B;  4PDL A;  4BW5 A;  1XL6 A;  2LFR A;  2HR3 A;  1V54 B;  4P9P A;  3SYQ A;  4MTG A;  3AG2 B;  1K7D A;  1R3J C;  2A9H A;  2UXN A;  1MG1 A;  5B1O A;  1L1F A;  2ZDI C;  2ZXW C;  4P9O A;  5CBF A;  2PI5 A;  4BAY A;  4YXW G;  2LP7 A;  4DXW A;  1KKD A;  3ZMV A;  4MTX A;  1JOY A;  4HZ3 A;  5H9C A;  3OR6 C;  2A79 B;  3OMN B;  2XOK G;  5CMU A;  2EIJ B;  3OM3 B;  4CZZ A;  4PEL A;  1NH2 D;  5BZB A;  2W6J G;  3AG3 B;  1H8E G;  1FXK C;  3K3W A;  1OCC C;  1GO3 F;  2XND G;  5B1A B;  1NVP B;  2QE7 G;  2XAJ A;  3CCS V;  3IC7 A;  1YI2 V;  5KA6 A;  1JPX A;  4RUF A;  1PNL A;  2Q67 A;  1WPX A;  4RQE A;  1PL0 A;  4WFG A;  2UXX A;  3CCM V;  3MHS C;  1NR1 A;  1M57 B;  4LCU C;  4UVA A;  2PI4 A;  3IGA C;  3STZ C;  1FXH A;  2QEX V;  3T1C A;  3ABL C;  3RW0 A;  4MVO A;  4PA4 A;  2EIK C;  5IDJ A;  2JK5 C;  2YEV A;  1VQ7 V;  1KEC A;  3F5W C;  3UKM A;  2DQ3 A;  1WLE A;  4PA9 A;  3ZCC A;  3ABM B;  3ABK B;  4MVZ A;  4PDV A;  4XDJ A;  3ZRS A;  2Z5U A;  1P7B A;  3RVY A;  5CBG A;  1QCE A;  4P2Z A;  1W0J G;  3BY6 A;  1K33 A;  1OCZ B;  5CA3 A;  1YHQ V;  1KQS U;  2HFE C;  3F7Y C;  3STL C;  4G28 B;  1NH2 B;  3GB7 C;  1AI7 A;  3BEH A;  1V54 C;  2ZD9 A;  1H8H G;  4UV9 A;  1GMG A;  2ZXW B;  1E1Q G;  5LHI A;  5IYB O;  4G27 B;  2WLI A;  2WLH A;  2K1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...