4PA9A

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa9A00
4MVRA 2WLNA 2BOBC 4MVZA 1OCCC 2DYRC 3WG7C 3ABLC 2EIJC 5E1AC 4MTOA 2EIMC 4ZBMA 2DWEC 4GX2A 3LUTB 3K03A 4GX5A 3KG2A 4RUFA 4PA9A 4G28B 2WLIA 2AHYA 4MTFA 3K08A 4MW3A 3SJQC 3E8GA 3E89A 2W0FC 2ITCC 4RUEA 3TETA 2WLKA 2Q6AA 5CBHA 2WLHA 3JYCA 4LBEC 2AHZA 4MW8A 3K0DA 2QKSA 4X8AA 4PDVA 3BEHA 3FB7C 4LP8A 2Q67A 2DYSC 4MVQA 4RO2A 4I9WA 2HJFC 5EBWC 1G4YB 2DWDC 2HG5C 3IFXA 1JVMA 4JTCB 4QNHB 1J95A 3OGCC 3T1CA 1OCOC 4CBCA 3ZRSA 3X2QC 4TWKA 5CBGA 3SYPA 1V54C 3F7YC 3OUSA 4PA4A 3STZC 3E83A 2WLMA 3FB6C 3UKMA 2HFEC 4G27B 4MS2A 2EILC 4WFHA 2P7TC 2YEVA 4X88A 1ZWIC 3SPJA 4RAIA 4GX1A 4P9OA 5EBMC 3RBZA 5EC1C 1V55C 3F5WC 3FB5C 3RVYA 4UUJC 3SYCA 4H37A 3K06A 3AG4C 4HZ3A 3E86A 4F4LA 5KUKA 2A0LA 3LDDA 4J9YB 3HPLC 3LDCA 4WFFA 1KKDA 3GB7C 3SYOA 4P30A 4PA3A 3E8FA 4PDRA 4WFEA 3FB8C 1LNQA 1R3LC 1OCZC 4JTAB 3SPIA 4XDLA 3OR6C 5B1AC 2HVKC 5EC2C 3AG1C 3ZJZA 4R8CA 1OCRC 2ITDC 4R6ZA 2WLIB 2WLJA 2H8PC 3OR7C 4PA7A 3SYAA 5BZBA 2X6CA 3EFFK 4KFMA 4XDJA 3UM7A 5EBLC 3ASNC 4MSWC 2K1EA 2X6AA 4MVOA 4R50A 2EIKC 3LNMB 1ORQC 1R3KC 2Y69C 3AG2C 3R65A 2IH3C 3VOUA 4GX0A 4HYOA 3K0GA 4BW5A 2X6BA 2NLJC 3RVZA 3F7VC 2Q69A 5J9PC 1S5HC 4PDLA 3LDEA 3SPGA 3K04A 4XDKA 3ABKC 1M56C 3ASOC 4PDMA 1M57C 3SPCA 2ZD9A 5B3SC 2EINC 4H33A 1P7BA 1K4DC 2R9RB 4J9ZB 2OCCC 2WLLB 1QLEC 2KB1A 1XL4A 2JK5C 4MVSA 4MVMA 2IH1C 4MTGA 4OXSA 4P9PA 4QE7A 3RW0A 3T2MA 1R3IC 3OUFA 2HVJC 5EK0A 2A79B 4JTDB 3PJSK 4P2ZA 3SPHA 1BL8A 1XL6A 2Q68A 3E8HA 3IGAC 3T4DA 2QTOA 2A9HA 4LCUC 3TCUA 5IY5C 2WLLA 4DXWA 3E8BA 3AG3C 4PA6A 4QE9A 4EKWA 4X89A 4MVUA 5CBFA 3STLC 1R3JC 5KUMA 1K4CC 2ATKC 2ZXWC 3SYQA 5B1BC 4WFGA 4R7CA 3T4ZA 3ABMC 2BOCC
chains in the Genus database with same CATH superfamily
4BIUA 2Z0AA 2GSMB 1N32B 2YIDA 4GX5A 1K33A 3ASNB 4K3AA 2AHYA 4YIPA 4K0KO 1AROP 3VQVA 1NH2D 5ITZA 3SJCC 4RUEA 2AHZA 4DV5O 4IL6Z 5LMUB 4HBNA 4OX9B 2F43G 1UJWB 5L3GA 5J2UA 1BGYH 1OCCB 3B2EE 3ABLB 3JSNA 1SQVH 4UCTA 1XEQA 2P90A 4LNUB 2BTQA 1PL4A 4NXMB 4DR7O 3CCRV 4N23A 3RYCB 4K0KB 2NR5A 3C3TA 1BCCH 4JZ2A 3SYOA 4DV1O 4P30A 2P4VA 3OFNG 1WPBA 1JR9A 2E76B 2QSAA 1Q43A 5B1AC 2EIJB 5KHIA 3U0ZA 4X1KA 3CCJV 3OR7C 4AILC 3HKDA 2DOSA 1T5EA 4R50A 4JAUA 4GKJB 4LF8O 4LF4O 4BW5A 3WB1A 4JI7B 1Y66A 2L6LA 5B3SC 1OV9A 1GM9A 1UPGA 1AJPA 4O2AB 4LFBB 4UCUA 3L72H 4JI8O 3GWOA 3JARB 4B7EA 3G6BA 3JAKB 3RFRA 2ILMA 3UT5A 3AG3C 4CS4A 1JFFB 2Y69B 4I50A 1K73W 1R3JC 5KUMA 4FZ0A 1EFRG 3CCQV 3ABKB 3K9AA 1L1FA 3N2GA 3K03A 1US6A 2HKOA 4QPJA 1FYJA 4WFBV 3OAAG 3MAQA 1FJGB 1IBLO 3TETA 1FFTB 4CS2A 4WF9V 3JYCA 4DR7B 2BE3A 4E2LA 1YJWV 3K5MA 1AJNA 3CRQA 1FXHA 2KQXA 2PY5A 4I4TB 3T1CA 1AR5A 1OCRB 2UXDO 1B06A 3F7YC 2D3OW 1F4MA 2Q0OC 2HFEC 3ZMSA 1NI8A 2UUAB 2FMLA 2R72A 1CP9A 2DE0X 4FLVA 3G4SV 4B3MB 2Y4UA 2ZNJA 1Q81W 2FKXA 4EEQA 4F4LA 4HZ3A 3HB3B 3T1YB 4GUNA 1ZTEA 2M7WA 5JVDB 3E8FA 4U7OA 3J80N 1H2SB 4EB6A 2PUSA 1EN4A 3AG1C 5JQGB 2UUCO 2ITDC 2BSKA 3U10A 3ASNC 4QGPA 3TK1A 2XOKG 4X62B 1PP9H 4UV9A 1NBMG 2CH7A 1YXBA 3O9OA 3WB0A 1PPJH 3F7VC 1R6TA 4UFZA 3VBBA 4DR1B 1QLNA 2YIBD 4KXRA 2YDEA 5LXTA 2R9RB 3HKBB 4YY3O 3RWRD 4J7JA 3GVMA 1VQ9V 1I7FA 1MSDA 3E35A 4JYCA 2O57A 4PI2A 1KYOF 2YC0A 3JASB 3AG4B 4DV3O 1KU9A 1YEWA 2ZE6A 4TQDA 4U3JA 3K79A 2G38A 1H2GA 3RYFB 3CD6V 1XQ8A 5DEDA 5LGNA 3FD9A 2HJDA 4YJ2A 1TAEA 1BS3A 1IX9A 4GX2A 1XMOB 4RUFA 1NQTA 2N04A 1KD1W 1DGSA 4XBFA 4WBNB 3E8GA 5IJ0B 4PJ0Z 4HNAB 2ITCC 2OWOA 2OYQA 2WA3A 1SQGA 4J7ZA 1HNWO 1M90W 4LP8A 4JI3O 1OCZB 4FZ1A 5EBWC 1MG1A 1FS0G 1HNZB 3FB6C 2PI5A 2ZCEA 2PI4A 2JIZG 5CA1A 1Z2GA 4TV8A 5IY5B 1B04A 1NJIW 3H1KH 1G6UA 5KX5B 1Q82W 4WFFA 1W2BU 1PM9A 1WB8A 4O4HB 3OMAB 1KP2A 4QPKA 4O4JB 3L71H 4BIZA 1MA1A 1IBMO 1O9HA 4CC5A 3S3WA 1Y4MA 1D5NA 4O2BA 4QIWF 4CS3A 1AILA 3CYOA 2YI8A 1GMGA 3ZHTA 4YXWG 4DK0A 2Y4TA 2EULA 2GUZA 1EBOA 4JYAB 3C3SA 3F5TA 4P9PA 1XL4A 4FLUA 3CXCU 2HVJC 4FMTA 5EK0A 4I7ZB 2UXCO 1Q8IA 3E8HA 1XMOO 3MD0A 3BCCH 3ZHRA 1U96A 4QE9A 1VF6A 4KL1A 1IBKO 4JI5B 4JI8B 5DECA 1SQQH 1GN6A 1V9PA 1Q6HA 3K5OA 1HNWB 1QVGU 3WU2Z 2ZM6O 4IGGA 4UXNA 5LA6A 2F23A 5LHIA 3G71V 1VQOV 4PA9A 4G28B 1QCEA 2UXCB 1KMIZ 4MW3A 3SJQC 2EIKB 2F95B 1YVWA 4LR3A 3AG3B 3M8AA 4LBEC 1L0LH 4MW8A 2XAQA 3JD0A 1F7YA 4NTXA 5KA6A 3IFXA 1S76D 4X1YA 4PA4A 1NTMH 1XHZA 2N74A 2KG7A 2HEPA 4X88A 2IW5A 4GX1A 5LA6B 1GO3F 3P32A 1N36O 3AG4C 2F93B 1X4TA 2GTAA 2JVDA 1QR9A 3CMEV 2UUAO 1AI7A 3B8NA 2WLIB 3B09A 2CAZC 2X6CA 4X1YB 4UVBA 1E1QG 1M9NA 3OD4A 4HYOA 5JJNB 2X6BA 1SF9A 3CC4V 4DV1B 4PDMA 4U3JB 2P5OA 2WWWA 2JK5C 3HR0A 1S5JA 4O2BB 3ZN0A 1VQKV 5E79Z 4JTDB 4ZOLA 4P2ZA 4DR1O 4E4EA 3S3XA 4EKWA 4DR4B 3FX7A 1NZ6A 3T4ZA 1KQSU 1VQ4V 1DF5A 2DYRC 1ZX3A 2RQ6A 3WG7C 3ML0A 1XOUA 1PNLA 1SQFA 4JI2B 4NXNO 4UCRA 2QWNB 2WLIA 3THOA 3K57A 2AZ0A 2QJ1A 3K0DA 5LMNB 3FB7C 2Q5ZA 4IYIA 3Q4HA 2HJFC 2V1DA 4PHZA 4DYLA 1I5XA 4JI1B 3T1HB 4G27B 1LUWA 1N34B 2QGNA 5CN0A 1Q5OA 4W4LA 2M6YA 1E1RG 2ZINA 3LDDA 4O4HA 4DRXB 1P4RA 1WB7A 2P06A 1SS3A 2A7WA 2HR3A 1I08A 4MTXA 1UFIA 2OIGA 1DLBA 4B3TO 1P49A 2WLJA 2LP7A 4MSWC 2XAHA 3D3IA 4FM2A 5IE9A 4J42A 4DV7O 2IH3C 5LXTB 4GX0A 2OTLV 2IU3A 2OT5A 3CCSV 1O9GA 2AGAA 2DMXA 1FD9A 4J9ZB 4TSFG 3ZMUA 2CH7B 2E75B 1EN5A 1CEZA 3JAKA 1HR0B 2UXBO 2L35A 1P7GA 1XNRB 3IGAC 3JARA 4YJ2B 4UVCA 5J2TB 4CH6A 3J7AU 1YF2A 5JQGA 3TJTA 2VQFB 4J7KA 2F4VO 3OTOB 2YS8A 3M7MX 4Z2WA 2GV9A 4CH5A 1MOFA 2N05A 4ZBMA 1JA8A 4FIPC 5TISZ 2GBOA 1HR0O 2DW4A 2X0LA 1SETA 5L3CA 1N8RW 3HKBA 5BR8O 1XNRO 2AXTZ 5L3DA 4ZI7B 2PGGA 3W7XA 5DN6G 1X59A 3C90A 4H44B 2VQFO 4LWSA 1H2LA 1N32O 3B4SA 1EZJA 1G4YB 1VEWA 4LH6A 1E79G 3SYPA 1ZUQA 4MT8A 1QHTA 4LNUA 1ZWIC 3SPJA 5K1XA 1XBLA 4B3TB 3RVYA 3F5WC 4OX9O 5KMGB 3H1JH 1WA8A 2UXXA 3K3WA 4J9YB 4DR2O 2UU9O 4PA3A 4CZZA 1H8HG 4JTAB 5IJ9B 1J5EO 1PD3A 1ENVA 1N0NA 2FB5A 4UVAA 2H3OA 3KZIZ 3O65A 4R6ZA 4ASUG 1IXMA 4WBNA 4JI6B 1YZBA 2YI9A 3UO2A 3CB2A 4LF5B 3LNMB 1NR7A 4OGQB 2E3CA 3AK1A 5FPRA 4HAMA 1THZA 4O2AA 2VQEO 2ZE7A 1SZXA 3ASOC 1VQMV 3CCEV 2ZIMA 2EINC 4H33A 4J80A 4GYCB 2WLLB 5B1AB 2IU0A 4FJCC 2ADQB 1LR1A 3A0HZ 3HKDB 1VF5B 4LF4B 1CPYA 3N2KA 5KAIZ 5IY5C 5GTIZ 1VQ7V 2W0XA 4NR1A 1Z5VA 4TV9B 3K59A 1VQPV 3ZBHA 4D6TH 4JI4O 3CXHF 2Q7HA 5B1NA 5IT9N 3QVNA 2Q0AA 1OCCC 2YICA 1F23A 3AG1B 4I0XB 5H9CA 3H1LH 3LUTB 1AVMA 3NXSA 1SQBH 2F66C 3CCVV 4EB6B 5FNVA 4O4IB 5FLXN 1GN2A 1TVKA 3AG2B 1FFXA 1WLEA 2OTJV 3DSQA 1M57B 1M56B 4RO2A 2DYRB 3WG7B 2JGDB 2EIMB 2ZE5A 4IHJB 2EZPA 4JASA 5H6RA 2WA4A 5FPOA 3H9VA 4P9OA 4GKJO 5LYJB 3FB5C 4PI0A 1NR1A 4WCEV 3SGIA 5KUKA 2A0LA 2UXNA 3VQYA 3ZMZA 3FB8C 2Q7GA 1VP7A 1AR1B 4XDLA 1QQCA 1G1XB 1JMKC 4D7TA 4DV0B 4PA7A 5IWAB 5BY1A 2QWOB 5EBLC 2JJ2G 2K1EA 3LNNA 2EIKC 1R3KC 3EHBB 4GT1A 2IJIA 1R6NA 3K04A 3ABKC 1GAXA 5IDJA 2NN4A 5IYZA 3APQA 1P7BA 1NTZH 5ITZB 3ETGA 5GONB 4OXSA 2QWPB 3RW0A 3QF7A 1R3IC 2QKCA 4Z1MG 3LSQA 3E22A 4BAYA 5L3FA 2XAJA 4DK1A 4PA6A 5GONA 5CBFA 3QO5A 4JV5O 3BRCA 4FFBA 5EYPB 4WFGA 4K8XA 4JZGA 5EIBC 3CRMA 3DTUB 3A0RA 4JYYA 1IZ3A 1JJOA 4GKKO 2ZQMA 4X1IB 3FYEB 5CA3A 2PZSA 1FPOA 1Q90D 4BIOA 1PL0A 2XASA 1L8DA 2EJRA 1YJNV 5LGUA 1VQ6V 3OM3B 1G8MA 2DQ3A 2RJZA 4TQFA 2IBZH 1XI1A 4DUZB 3JATA 4LFAO 3OE7G 3QO8A 4JTCB 2XT9A 4CBCA 2Q73A 4GKKB 2HHHO 5IYDO 2YEVB 2BTQB 5IYBO 4LF9B 1SA0B 2X7RB 4MS2A 5K1PA 3U11A 2BTOA 4IHJA 1BHAA 5JH7B 1KBHA 3SYCA 2VS0A 3JAWA 5IWAO 2D2CB 4FLYA 1Q6UA 2E5LB 4DR3B 3FYIB 4TOIA 4DUZO 1YTFD 3OR6C 4L8JA 2RCVA 2YXYA 4O4IA 3ZJZA 2EX3A 2H8PC 3PN1A 3UM7A 2IJJA 1ZSPA 4DV3B 3L70H 4BWAA 1XDCA 3ZCCA 4I0XA 2MK3A 1BHBA 3VQWA 1VIBA 3H1IH 1BE3H 3JATB 1NVPD 5DM6V 1NT2B 1R6KA 1FXKB 3CRCA 1MMMA 5BMVB 1M57C 4JI6O 4B3SB 2PYLA 4QE7A 1JX9A 3OUFA 5KLVH 1QNMA 2DQ0A 2EILB 1YIJV 5B5EZ 3RGBA 1D5AA 4X64B 5L3BA 4MVUA 1BQZA 4U7NA 1K4CC 2ATKC 1XNQB 3SYQA 5B1BC 2FYUH 4B08A 2BOCC 1TUBA 5LYJA 1KUQA 1N4CA 1VMGA 4UCOA 1M1KW 4ZKIA 3CRRA 3ETEA 3BVOA 1A32A 4D7SA 2JGDA 1WN7A 4DR2B 2UU9B 1RSOB 4FLWA 3QG5A 4RQFA 2CGNA 1XREA 1K8AW 3UCSC 2DYSC 1H38A 2RDCA 1FFXB 1XMQB 1TVKB 3JAWB 1S72V 3OTFA 3X2QC 3STZC 2JEXA 1B3QA 1WPXA 4IIJB 4WFHA 3W7TA 1YJ9V 2NNUA 2YEVA 4IYHA 3RBZA 4YJ3B 4JI0B 2DJVA 3DXRB 5KA5A 3HPLC 4N21A 4JI7O 1FXVA 4ZI7A 2QWRB 4LH7A 3N2KB 3SYAA 4B3SO 2V4DA 1JJ2U 4AI8A 4F6RB 1PNKA 4X1IA 1V55B 2ETNA 3AK2A 1QVFU 3JALB 2W6JG 1SESA 4JAAA 5EYPA 3SPGA 4DR6B 4I5SA 2GDSA 2RNBA 1K3EA 4NTWA 2KKWA 2OCCC 4MVSA 2XAFA 3CE2A 2EJ7A 2A79B 1WJZA 3ZRWB 3L75H 3FKSG 2E74B 4GZRB 1RP3B 4LF5O 4G2KA 1GN3A 4YIOA 3OW2U 3CEIA 5IYZB 3B77A 5EZYB 1TGOA 1AP5A 4TV9A 1RPRA 3ETQA 2B1IA 5E1AC 2EIMC 4UV8A 2DWEC 5LP6B 1AI4A 2IJHA 3WFVA 1BT8A 1N0JA 3EXAA 2W0FC 1I94B 4NKGB 2JJ1G 5CBHA 4AQYO 1ZLZA 1YDXA 4IT5A 3ZHQA 4LWSB 1BZKA 3QNEA 3ASOB 3ZRVA 2YXLA 4MVQA 3N27A 4DRXA 2CGOA 1VF6C 2DWDC 4EFBA 3CP1A 2PTMA 1JCHA 1FJGO 2WLMA 4DW1A 3CJHA 5C93A 2GTSA 4RAIA 3OMNB 3G80A 4H37A 1FKAO 5IJ9A 1EM1A 3Q4HB 4QJFB 4X65O 3GB7C 4O4LB 3W7WA 3G67A 3IC9A 4WFEA 3W7SA 4FLXA 2A06H 2ZT9B 2HVKC 1H2NA 1TUEB 3CC2V 5J2TA 1V54B 2YIBA 3CWBH 2X6AA 3T1YO 1SERA 1SKVA 3AG2C 3B40A 3CCLV 1R73A 5CB4A 3LDEA 3BA8A 3KKYA 2Q8VA 1M56C 3ABMB 4TT3G 4FM0A 1Y76A 2CTWA 3M99B 4X62O 1Q86W 1W59A 3BABA 1BSMA 2QTOA 4LCUC 2R70A 2XAGA 2WLLA 4DXWA 3ZHVA 1Y74B 3JD4A 1KKCA 1YITV 1M93A 4YY3B 1K7DA 3K9SA 2ADPA 4UB8Z 2WLNA 1QLEB 1QR8A 1YCIA 4LF9O 5JJEB 2LJ2A 1Z5WA 2OIEA 5IYCO 4A5UB 1SRYA 4LF6O 4C7UA 4RQEA 1ZL8A 1I0HA 4K35A 4DR3O 3IAYA 5LL6Y 3L74H 1MSWD 2QKSA 4X8AA 2HLDG 3BEHA 3NR7A 1VQLV 4RWUA 4JV5B 1WA8B 2AW9A 3AEIA 5KMGA 3K5NA 4DR5B 2A3QA 3CS5A 3OEEG 3JCUZ 3ZEDA 1QBZA 3ZN1A 5JCOC 1RFYA 4J11A 3HKEA 2FL4A 5LHHA 3D8CA 4ZHQA 1F51A 1IBMB 1IVSA 4UUJC 3BY6A 4X66B 1PKXA 1K9MW 1NH2B 3APOA 1GKFA 3OT7A 4PDRA 2DYSB 2RMKB 4X20A 3H01A 5L3EA 4W4KA 2EBOA 2UXBB 5LP6C 4JYAO 4XDJA 4KFMA 3ZHUA 4MVOA 3I55V 3SJBC 1RPOA 1SQXH 3I56V 4DV2O 2JEUA 2QM4A 4DO2A 1J5EB 5JWPA 2ZXWB 3OMIB 3E2EA 3D3QA 2P22C 3SPCA 4MTGA 2JRIA 1MZEA 3PJSK 1CXZB 3SPHA 1BL8A 3T4DA 5KHHA 3E8BA 1K97A 3W7UA 2CTPA 3ABUA 4DV4O 2B5UA 3CX5F 4NTYA 5HFMA 3BFRA 4MVRA 4J41A 1M4UA 3ABLC 4GCZA 3A2FA 4ZOLB 4LF7O 3KG2A 4DUYB 3ETDA 3CC7V 2CUGA 4JI5O 1D2DA 3SJAC 4X64O 2LFSA 1FXKC 4I55B 5H5NA 4PDVA 3CCUV 4X66O 4I55A 3TXQA 4QNHB 1J95A 4TWKA 1BMFG 3LSUA 4TV8B 5CA1B 4ICGA 1I94O 1M5IA 4KP4A 1HWYA 3CSXA 2C2AA 5D5PA 4PV1B 5EBMC 5EC1C 1TA8A 1V55C 2QDOA 2VQEB 3K5LA 1IBLB 3UQ8A 1XHXA 3D36A 5B3SB 2EZOA 4DV2B 2EINB 2LQTA 4B3RB 2PF4E 2QE7G 3ZMVA 2CTRA 1XMQO 2Y48A 1OCOB 1ZL8B 1WNSA 1Y67A 1N33O 1R1BA 2BCCH 1HP8A 2OCHA 1ORQC 2WSSG 2Y69C 1JPXA 3P3NA 4XDKA 1S77D 2KSDA 4DV0O 3X2QB 2Z3YA 5B1OA 3T2MA 4Z1VA 3FAVA 3FAVB 1HNXO 1N33B 2A9HA 4JI2O 2JGUA 4O4JA 5D5QA 1Y76B 4GLXA 4X20B 4X9QA 3SR2C 1Q6IA 2XTAA 2LFRA 2VWKA 5CB4B 4R7CA 1I5YA 3ABMC 3MHHC 4J10A 2BOBC 5KX5A 1F4NA 4PD4F 4MTOA 1SQPH 2VRZA 4FLTA 2VWJA 1JQ0A 1K5SA 3JAMN 1MABG 4DR4O 1QU7A 2QM7A 1HNXB 1JOYA 3E89A 3T1HO 5CMUA 2WLKA 4X65B 1DTOA 5KHJA 2GUZB 4NYKA 4PELA 4B3MO 3P3PA 5KAFZ 2H94A 4JAVA 1IDSA 2P6JA 2UUBO 2IM9A 2ZIOA 1Y6XA 4NXNB 1JVMA 3OGCC 3JD2A 4KUMA 1GTOA 3CHXA 3OUSA 3E83A 4JPRA 1VQ5V 2KG7B 4KHPB 3G6EV 3CJHB 4BW9A 2WAMA 2UUCB 1XILA 3ZX6A 5BXZA 3LDCA 3RYFA 2V7QG 2HHHB 5B1BB 4JI3B 5AG2A 3A0BZ 2GHYA 4JGSA 1GK9A 2UUBB 1N34O 3EVKA 1EZVH 4YHHB 3WB2A 3HKEB 3ZIAG 3EFFK 3GWKC 2MW2B 1OJHA 4NB5A 3CPWU 3AG7A 3R65A 3VOUA 2Z5UA 1IURA 3N2GB 2ZKOA 3RVZA 3DC5A 1H8EG 5B66Z 2R9AA 5HFLA 3QO7A 3JCZA 4I50B 1K4DC 2KB1A 2Y0IA 3UT5B 2QA4V 1SC5B 1FAFA 4DV7B 1H2KA 4LFCO 3BHPA 2QEXV 2BSKB 4CH3A 3BA9A 2QR4A 3RT3C 3H1HH 2HP8A 1K34A 2YSUB 2QM8A 4X89A 1EN6A 4DV5B 3IJ4A 2P67A 2XHBA 4FLZA 1W0KG 2DN9A 2ZXWC 1AR4A 2B9ZA 2EIJC 4FK5C 3TGUH 4DV4B 3CRAA 3IC7A 1XNQO 2XUMA 2ZDIA 4Q6GA 1NU1H 5GW7A 3SDLA 1Q3EA 4CH4A 2ODMA 1HW7A 3VQXA 2ARHA 4ZHQB 4YJ3A 1DK1A 5BR8B 5EIBD 2WPDG 4FVMA 2B1GA 1PNMA 3JSLA 4K8ZA 2LGWA 3K06A 3E86A 5J2UB 4UB6Z 1AP6A 4NVPA 5JVDA 4DV6O 4O4LA 2ZNIA 4ZIBA 4UCSA 1R3LC 2ZR2A 2CK3G 4HNAA 1JFFA 1NS1A 3I5DA 5IJ0A 4R8CA 1WP8A 3J81N 1ROPA 1YHQV 3RN4A 3ZRWA 2XNDG 2Q9LA 1TUBB 1N36B 2NLJC 1PV0A 3JD3A 4AHCA 3B8MA 1L0NH 5CA0B 3D36C 4B3RO 1OZ0A 4DV6B 1Y74A 1K5QA 3JASA 1S5LZ 4U3FH 4LF7B 5A9GA 5LBQA 1S0VA 2ZM6B 4ABMA 2Y0PA 3RYIA 4DW0A 3OEHG 1KB9F 4L87A 3STLC 5EZYA 1FXKA 5F2VO 3ZS8C 5LMUO 2YXHA 4EFEA 1AI6A 3DXRA 1DF4A 5C8YA 1AI5A 4MTFA 1ZAUA 3K08A 4JI0O 5H2FZ 4JI4B 3AK3A 2WLHA 4NXMO 1WAZA 2IJKA 2AZ2A 5H6QA 1S3JA 1WP7A 2Q67A 1GN4A 4OPHA 3P30A 1GM8A 1VQNV 2F1MA 1XUQA 4I9WA 1OCOC 5JH7A 2Q7EA 4BR6A 3FFQA 2EILC 4AQYB 1SA0A 1HDJA 1BQ0A 1GH6A 2FTKA 3R66A 4DUYO 1RM1C 5LOVB 2W6IG 4I4TA 3ZRXA 5GTHZ 4DR6O 1MZFA 3ZHSA 1KKDA 4H0LB 1NKDA 2YUAA 1K92A 3MDSA 4JYBA 2LW1A 5FL7G 1KC8W 1KECA 2OCCB 3DGEA 3BPZA 3RYCA 1OCRC 5JJJB 5BZBA 4IIJA 4JI1O 1GRJA 5LP6A 3MHSC 3K0GA 2Q69A 1S5HC 2P4KA 4TUYB 4YHHO 1VQ8V 1RSOA 3L73H 3HKCB 3UKMA 3ICXA 4MVMA 5A2QN 1W0JG 4LC1A 1COWG 1VARA 3E22B 5JCOA 1XL6A 2Q68A 3UO3A 3CMAV 3QTCA 3HKCA 1LUVA 1MNGA 3JALA 3K58A 2QTSA 4MVZA 5LMNO 2ZDIC 1HNZO 4LFCB 3OGIB 4KHPO 4LFAB 4F6RA 1H2MA 1NVPB 3RYHA 2CE4A 4X1KB 2UXDB 2Q4PA 2QWQB 4B7KA 1B6QA 2Q6AA 5BMVA 2F4VB 2HG5C 3ZRSA 5CBGA 3ABTA 1V54C 2R9IA 4FFKA 2JDIG 2LGQA 5LOVA 1YTFB 1OHHG 3RYHB 2QKAA 2P7TC 5KHGA 2LW7A 1NTKH 1AB3A 2CTQA 4H13B 4WFAV 2CDYA 4DR5O 2LO1A 3KCXA 2JS3A 1SZTA 4FFBB 1LNQA 1OCZC 3SPIA 1YI2V 2ZE8A 2YIAA 3TXSA 5EC2C 1Q7YW 5FNVB 3BAAA 5C8YB 3LSSA 2ZR3A 3JD1A 2E5LO 1P84F 2RN9A 1KP3A 3DC6A 2K9PA 4I9QA 4F6EA 3L9DA 3CCMV 2JS5A 1IBKB 3KCYA 5LGTA 1YSCA 4JF3A 5J9PC 4PDLA 5KHKA 4OPAA 4TUYA 1GM7A 1U97A 2ZD9A 2PYJA 3OTOO 1QLEC 3RYIB 2IH1C 1URFA 4LF6B 4LF8B 3ZMTA 5LHGA 3TCUA 1RM1B 1VF7A 4Q20A 4FPPA 1AJQA 4LFBO 4CC6A 3A8TA 1IXBA 4UCVA 5CA0A 4FM1A
chains in the Genus database with same CATH topology
1VQ4V 1DF5A 2BOBC 4BIUA 2DYRC 3WG7C 3ML0A 1F4NA 4MTOA 2GSMB 1JQ0A 1PNLA 1K5SA 4GX5A 1K33A 3ASNB 1M1KW 2WLIA 2AHYA 1MABG 4ZKIA 3ETEA 2QM7A 1AROP 1NH2D 3E89A 1JOYA 5CMUA 4RUEA 2WLKA 1DTOA 2AHZA 4PELA 3K0DA 4RQFA 3FB7C 1K8AW 2F43G 2DYSC 2H94A 4JAVA 1H38A 2P6JA 1UJWB 2HJFC 5L3GA 1JVMA 2V1DA 3OGCC 1S72V 1OCCB 3JD2A 4KUMA 3X2QC 3ABLB 1GTOA 1I5XA 3OUSA 3STZC 3E83A 4JPRA 2JEXA 1VQ5V 2P90A 1WPXA 4G27B 3G6EV 4WFHA 3W7TA 1YJ9V 2NNUA 2WAMA 2YEVA 3CCRV 5CN0A 3MHHC 4N23A 3RBZA 5KA5A 1E1RG 3LDDA 3HPLC 3LDCA 1P4RA 3SYOA 4P30A 2V7QG 5B1BB 2HR3A 3OFNG 4N21A 2GHYA 4MTXA 1FXVA 4JGSA 1GK9A 2EIJB 5B1AC 1DLBA 3CCJV 3SYAA 2WLJA 3OR7C 3ZIAG 3EFFK 1JJ2U 2LP7A 4MSWC 2XAHA 3D3IA 4R50A 1PNKA 4JAUA 1V55B 3CPWU 3R65A 2IH3C 3VOUA 1QVFU 2Z5UA 4GX0A 2OTLV 4BW5A 2W6JG 1SESA 2IU3A 2OT5A 3RVZA 1H8EG 5HFLA 3SPGA 3CCSV 3QO7A 1Y66A 4I5SA 5B3SC 1GM9A 3JCZA 1AJPA 1K3EA 1K4DC 4J9ZB 2OCCC 4MVSA 2KB1A 4TSFG 3ZMUA 2XAFA 2QA4V 3GWOA 1CEZA 2A79B 3ZRWB 2QEXV 3IGAC 3FKSG 4UVCA 3AG3C 4G2KA 1K34A 2Y69B 2QM8A 2YSUB 4X89A 2P67A 3OW2U 1W0KG 1K73W 1R3JC 3B77A 5KUMA 2ZXWC 3CCQV 1EFRG 3ABKB 3K9AA 1RPRA 1L1FA 2B1IA 2EIJC 1MOFA 5E1AC 4FK5C 2EIMC 4UV8A 4ZBMA 2DWEC 3K03A 4FIPC 1AI4A 2IJHA 2HKOA 3WFVA 4QPJA 2DW4A 4WFBV 2X0LA 1SETA 3IC7A 5L3CA 1N8RW 3OAAG 2W0FC 5L3DA 3W7XA 2ZDIA 5DN6G 3TETA 1FFTB 2JJ1G 5CBHA 3JYCA 4WF9V 5GW7A 4E2LA 3QNEA 3ASOB 1YJWV 3ZRVA 1AJNA 1FXHA 4MVQA 1EZJA 1G4YB 2DWDC 3T1CA 1OCRB 3CP1A 1E79G 3SYPA 1JCHA 3F7YC 2D3OW 1F4MA 2WLMA 2WPDG 2HFEC 3ZMSA 4MT8A 2B1GA 1PNMA 1CP9A 5C93A 1ZWIC 3SPJA 3G4SV 4RAIA 3RVYA 3F5WC 3OMNB 1Q81W 4H37A 3K06A 4F4LA 4HZ3A 3E86A 3HB3B 2UXXA 3K3WA 4J9YB 4QJFB 3GB7C 2M7WA 3W7WA 4PA3A 3E8FA 4CZZA 4U7OA 4WFEA 1H8HG 1R3LC 4JTAB 2ZR2A 1PD3A 1ENVA 3W7SA 2CK3G 2HVKC 4UVAA 1TUEB 3AG1C 4R8CA 2ITDC 4R6ZA 1ROPA 4ASUG 1YHQV 1IXMA 3CC2V 1V54B 3ZRWA 2XNDG 3ASNC 3TK1A 1SERA 2X6AA 2XOKG 3LNMB 1NR7A 3AG2C 4UV9A 1NBMG 4HAMA 1THZA 3CCLV 1R73A 2NLJC 3F7VC 3JD3A 3B8MA 3LDEA 3VBBA 1QLNA 1OZ0A 1M56C 3ASOC 3ABMB 4TT3G 3CCEV 1VQMV 2EINC 4H33A 1K5QA 2R9RB 2WLLB 5B1AB 2IU0A 3M99B 4FJCC 5LBQA 1S0VA 1Q86W 1VQ9V 3E35A 4JYCA 1CPYA 2QTOA 4LCUC 5IY5C 2XAGA 2WLLA 4DXWA 3AG4B 1VQ7V 3JD4A 3OEHG 1VQPV 4L87A 3STLC 1YITV 3K79A 1K7DA 1H2GA 1FXKA 5B1NA 3CD6V 2WLNA 1OCCC 1AI6A 5LGNA 1F23A 1QLEB 1QR8A 3AG1B 5H9CA 4GX2A 1DF4A 3LUTB 5IYCO 4RUFA 1NQTA 1KD1W 1SRYA 4XBFA 1AI5A 4MTFA 3NXSA 3K08A 3E8GA 4RQEA 3CCVV 2ITCC 3AG2B 2WLHA 1MSWD 2QKSA 1M90W 2IJKA 4X8AA 2HLDG 3BEHA 1S3JA 4LP8A 5H6QA 1WLEA 1VQLV 2Q67A 2OTJV 1M57B 3P30A 1OCZB 1GM8A 1M56B 1VQNV 4RO2A 4I9WA 5EBWC 3AEIA 1MG1A 1OCOC 2DYRB 3WG7B 1FS0G 3OEEG 2EIMB 4R7CA 1QBZA 3ZN1A 2EZPA 4JASA 3FB6C 2EILC 2PI5A 5H6RA 5LHHA 2JIZG 2PI4A 2FTKA 1RM1C 4P9OA 1F51A 3FB5C 2W6IG 4UUJC 3ZRXA 5IY5B 3BY6A 1NJIW 1NR1A 4WCEV 1PKXA 5KUKA 2A0LA 1K9MW 1NH2B 2UXNA 1Q82W 1KKDA 4WFFA 1W2BU 1NKDA 1GKFA 1K92A 4JYBA 4PDRA 3ZMZA 3FB8C 2DYSB 5FL7G 1KC8W 1AR1B 3OMAB 4XDLA 1KECA 2OCCB 3DGEA 3H01A 5L3EA 1KP2A 4QPKA 1OCRC 4BIZA 2EBOA 5BZBA 4PA7A 4XDJA 4KFMA 5EBLC 2JJ2G 2K1EA 4MVOA 1Y4MA 2EIKC 3I55V 4QIWF 1R3KC 1RPOA 3EHBB 3I56V 3CYOA 4GT1A 2JEUA 2IJIA 3MHSC 4DO2A 1R6NA 3K0GA 1GMGA 2Q69A 2ZXWB 4YXWG 1S5HC 3K04A 3ABKC 5IDJA 3OMIB 1VQ8V 3E2EA 1EBOA 1P7BA 3UKMA 3ETGA 1XL4A 4MVMA 4OXSA 4MTGA 4P9PA 3SPCA 3CXCU 3RW0A 1W0JG 1R3IC 4LC1A 2HVJC 4FMTA 1COWG 5EK0A 4Z1MG 3LSQA 3PJSK 3SPHA 4BAYA 1BL8A 1XL6A 2Q68A 3E8HA 5L3FA 3T4DA 2XAJA 3MD0A 3E8BA 1K97A 4PA6A 3W7UA 3ABUA 4QE9A 3CMAV 2B5UA 5CBFA 3QO5A 4WFGA 3DTUB 3A0RA 5HFMA 4MVRA 2ZQMA 4MVZA 1QVGU 2ZDIC 3FYEB 3ABLC 4GCZA 5CA3A 4UXNA 5LHIA 3G71V 3KG2A 1PL0A 1VQOV 4PA9A 2XASA 1QCEA 4G28B 3ETDA 2EJRA 1NVPB 1YJNV 3CC7V 5LGUA 4MW3A 3SJQC 1VQ6V 3OM3B 1G8MA 2DQ3A 2EIKB 1B6QA 2Q6AA 3AG3B 4LBEC 4MW8A 2LFSA 2XAQA 1FXKC 3JD0A 4PDVA 3CCUV 3OE7G 5KA6A 3IFXA 2HG5C 3QO8A 4JTCB 4QNHB 1J95A 4CBCA 1S76D 3ZRSA 4TWKA 1BMFG 3ABTA 5CBGA 5IYDO 1V54C 2R9IA 4PA4A 2YEVB 2JDIG 1YTFB 1OHHG 5IYBO 4KP4A 2X7RB 4MS2A 2P7TC 1HWYA 4X88A 1BHAA 2C2AA 2IW5A 4GX1A 5EBMC 3SYCA 5EC1C 1V55C 1GO3F 3P32A 3AG4C 4WFAV 3FYIB 1SZTA 3D36A 1YTFD 5B3SB 2EZOA 1LNQA 1OCZC 2EINB 3SPIA 1YI2V 1QR9A 3OR6C 3CMEV 2QE7G 3ZMVA 5EC2C 1Q7YW 3ZJZA 2Y48A 1OCOB 1AI7A 3B8NA 2WLIB 2H8PC 2X6CA 3LSSA 2ZR3A 3JD1A 3UM7A 2IJJA 1KP3A 4UVBA 1ORQC 3ZCCA 1E1QG 2MK3A 2WSSG 2Y69C 1BHBA 1M9NA 3CCMV 4HYOA 2X6BA 5LGTA 1JPXA 1NVPD 1YSCA 5DM6V 1R6KA 1FXKB 4JF3A 4PDLA 5J9PC 3CC4V 4XDKA 1S77D 1GM7A 4PDMA 1M57C 2ZD9A 3X2QB 1QLEC 2WWWA 2JK5C 2Z3YA 5B1OA 2IH1C 4QE7A 1JX9A 3T2MA 3ZN0A 3OUFA 1VQKV 2DQ0A 4JTDB 4P2ZA 3ZMTA 2EILB 1YIJV 2A9HA 3TCUA 5LHGA 1RM1B 4Q20A 4EKWA 4FPPA 5L3BA 4MVUA 4U7NA 1AJQA 1K4CC 2ATKC 3SYQA 5B1BC 2LFRA 1I5YA 3T4ZA 3ABMC 1KQSU 2BOCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVR A;  2WLN A;  2BOB C;  4MVZ A;  1OCC C;  2DYR C;  3WG7 C;  3ABL C;  2EIJ C;  5E1A C;  4MTO A;  2EIM C;  4ZBM A;  2DWE C;  4GX2 A;  3LUT B;  3K03 A;  4GX5 A;  3KG2 A;  4RUF A;  4PA9 A;  4G28 B;  2WLI A;  2AHY A;  4MTF A;  3K08 A;  4MW3 A;  3SJQ C;  3E8G A;  3E89 A;  2W0F C;  2ITC C;  4RUE A;  3TET A;  2WLK A;  2Q6A A;  5CBH A;  2WLH A;  3JYC A;  4LBE C;  2AHZ A;  4MW8 A;  3K0D A;  2QKS A;  4X8A A;  4PDV A;  3BEH A;  3FB7 C;  4LP8 A;  2Q67 A;  2DYS C;  4MVQ A;  4RO2 A;  4I9W A;  2HJF C;  5EBW C;  1G4Y B;  2DWD C;  2HG5 C;  3IFX A;  1JVM A;  4JTC B;  4QNH B;  1J95 A;  3OGC C;  3T1C A;  1OCO C;  4CBC A;  3ZRS A;  3X2Q C;  4TWK A;  5CBG A;  3SYP A;  1V54 C;  3F7Y C;  3OUS A;  4PA4 A;  3STZ C;  3E83 A;  2WLM A;  3FB6 C;  3UKM A;  2HFE C;  4G27 B;  4MS2 A;  2EIL C;  4WFH A;  2P7T C;  2YEV A;  4X88 A;  1ZWI C;  3SPJ A;  4RAI A;  4GX1 A;  4P9O A;  5EBM C;  3RBZ A;  5EC1 C;  1V55 C;  3F5W C;  3FB5 C;  3RVY A;  4UUJ C;  3SYC A;  4H37 A;  3K06 A;  3AG4 C;  4HZ3 A;  3E86 A;  4F4L A;  5KUK A;  2A0L A;  3LDD A;  4J9Y B;  3HPL C;  3LDC A;  4WFF A;  1KKD A;  3GB7 C;  3SYO A;  4P30 A;  4PA3 A;  3E8F A;  4PDR A;  4WFE A;  3FB8 C;  1LNQ A;  1R3L C;  1OCZ C;  4JTA B;  3SPI A;  4XDL A;  3OR6 C;  5B1A C;  2HVK C;  5EC2 C;  3AG1 C;  3ZJZ A;  4R8C A;  1OCR C;  2ITD C;  4R6Z A;  2WLI B;  2WLJ A;  2H8P C;  3OR7 C;  4PA7 A;  3SYA A;  5BZB A;  2X6C A;  3EFF K;  4KFM A;  4XDJ A;  3UM7 A;  5EBL C;  3ASN C;  4MSW C;  2K1E A;  2X6A A;  4MVO A;  4R50 A;  2EIK C;  3LNM B;  1ORQ C;  1R3K C;  2Y69 C;  3AG2 C;  3R65 A;  2IH3 C;  3VOU A;  4GX0 A;  4HYO A;  3K0G A;  4BW5 A;  2X6B A;  2NLJ C;  3RVZ A;  3F7V C;  2Q69 A;  5J9P C;  1S5H C;  4PDL A;  3LDE A;  3SPG A;  3K04 A;  4XDK A;  3ABK C;  1M56 C;  3ASO C;  4PDM A;  1M57 C;  3SPC A;  2ZD9 A;  5B3S C;  2EIN C;  4H33 A;  1P7B A;  1K4D C;  2R9R B;  4J9Z B;  2OCC C;  2WLL B;  1QLE C;  2KB1 A;  1XL4 A;  2JK5 C;  4MVS A;  4MVM A;  2IH1 C;  4MTG A;  4OXS A;  4P9P A;  4QE7 A;  3RW0 A;  3T2M A;  1R3I C;  3OUF A;  2HVJ C;  5EK0 A;  2A79 B;  4JTD B;  3PJS K;  4P2Z A;  3SPH A;  1BL8 A;  1XL6 A;  2Q68 A;  3E8H A;  3IGA C;  3T4D A;  2QTO A;  2A9H A;  4LCU C;  3TCU A;  5IY5 C;  2WLL A;  4DXW A;  3E8B A;  3AG3 C;  4PA6 A;  4QE9 A;  4EKW A;  4X89 A;  4MVU A;  5CBF A;  3STL C;  1R3J C;  5KUM A;  1K4C C;  2ATK C;  2ZXW C;  3SYQ A;  5B1B C;  4WFG A;  4R7C A;  3T4Z A;  3ABM C;  2BOC C; 
#chains in the Genus database with same CATH topology
 4BIU A;  2Z0A A;  2GSM B;  1N32 B;  2YID A;  4GX5 A;  1K33 A;  3ASN B;  4K3A A;  2AHY A;  4YIP A;  4K0K O;  1ARO P;  3VQV A;  1NH2 D;  5ITZ A;  3SJC C;  4RUE A;  2AHZ A;  4DV5 O;  4IL6 Z;  5LMU B;  4HBN A;  4OX9 B;  2F43 G;  1UJW B;  5L3G A;  5J2U A;  1BGY H;  1OCC B;  3B2E E;  3ABL B;  3JSN A;  1SQV H;  4UCT A;  1XEQ A;  2P90 A;  4LNU B;  2BTQ A;  1PL4 A;  4NXM B;  4DR7 O;  3CCR V;  4N23 A;  3RYC B;  4K0K B;  2NR5 A;  3C3T A;  1BCC H;  4JZ2 A;  3SYO A;  4DV1 O;  4P30 A;  2P4V A;  3OFN G;  1WPB A;  1JR9 A;  2E76 B;  2QSA A;  1Q43 A;  5B1A C;  2EIJ B;  5KHI A;  3U0Z A;  4X1K A;  3CCJ V;  3OR7 C;  4AIL C;  3HKD A;  2DOS A;  1T5E A;  4R50 A;  4JAU A;  4GKJ B;  4LF8 O;  4LF4 O;  4BW5 A;  3WB1 A;  4JI7 B;  1Y66 A;  2L6L A;  5B3S C;  1OV9 A;  1GM9 A;  1UPG A;  1AJP A;  4O2A B;  4LFB B;  4UCU A;  3L72 H;  4JI8 O;  3GWO A;  3JAR B;  4B7E A;  3G6B A;  3JAK B;  3RFR A;  2ILM A;  3UT5 A;  3AG3 C;  4CS4 A;  1JFF B;  2Y69 B;  4I50 A;  1K73 W;  1R3J C;  5KUM A;  4FZ0 A;  1EFR G;  3CCQ V;  3ABK B;  3K9A A;  1L1F A;  3N2G A;  3K03 A;  1US6 A;  2HKO A;  4QPJ A;  1FYJ A;  4WFB V;  3OAA G;  3MAQ A;  1FJG B;  1IBL O;  3TET A;  1FFT B;  4CS2 A;  4WF9 V;  3JYC A;  4DR7 B;  2BE3 A;  4E2L A;  1YJW V;  3K5M A;  1AJN A;  3CRQ A;  1FXH A;  2KQX A;  2PY5 A;  4I4T B;  3T1C A;  1AR5 A;  1OCR B;  2UXD O;  1B06 A;  3F7Y C;  2D3O W;  1F4M A;  2Q0O C;  2HFE C;  3ZMS A;  1NI8 A;  2UUA B;  2FML A;  2R72 A;  1CP9 A;  2DE0 X;  4FLV A;  3G4S V;  4B3M B;  2Y4U A;  2ZNJ A;  1Q81 W;  2FKX A;  4EEQ A;  4F4L A;  4HZ3 A;  3HB3 B;  3T1Y B;  4GUN A;  1ZTE A;  2M7W A;  5JVD B;  3E8F A;  4U7O A;  3J80 N;  1H2S B;  4EB6 A;  2PUS A;  1EN4 A;  3AG1 C;  5JQG B;  2UUC O;  2ITD C;  2BSK A;  3U10 A;  3ASN C;  4QGP A;  3TK1 A;  2XOK G;  4X62 B;  1PP9 H;  4UV9 A;  1NBM G;  2CH7 A;  1YXB A;  3O9O A;  3WB0 A;  1PPJ H;  3F7V C;  1R6T A;  4UFZ A;  3VBB A;  4DR1 B;  1QLN A;  2YIB D;  4KXR A;  2YDE A;  5LXT A;  2R9R B;  3HKB B;  4YY3 O;  3RWR D;  4J7J A;  3GVM A;  1VQ9 V;  1I7F A;  1MSD A;  3E35 A;  4JYC A;  2O57 A;  4PI2 A;  1KYO F;  2YC0 A;  3JAS B;  3AG4 B;  4DV3 O;  1KU9 A;  1YEW A;  2ZE6 A;  4TQD A;  4U3J A;  3K79 A;  2G38 A;  1H2G A;  3RYF B;  3CD6 V;  1XQ8 A;  5DED A;  5LGN A;  3FD9 A;  2HJD A;  4YJ2 A;  1TAE A;  1BS3 A;  1IX9 A;  4GX2 A;  1XMO B;  4RUF A;  1NQT A;  2N04 A;  1KD1 W;  1DGS A;  4XBF A;  4WBN B;  3E8G A;  5IJ0 B;  4PJ0 Z;  4HNA B;  2ITC C;  2OWO A;  2OYQ A;  2WA3 A;  1SQG A;  4J7Z A;  1HNW O;  1M90 W;  4LP8 A;  4JI3 O;  1OCZ B;  4FZ1 A;  5EBW C;  1MG1 A;  1FS0 G;  1HNZ B;  3FB6 C;  2PI5 A;  2ZCE A;  2PI4 A;  2JIZ G;  5CA1 A;  1Z2G A;  4TV8 A;  5IY5 B;  1B04 A;  1NJI W;  3H1K H;  1G6U A;  5KX5 B;  1Q82 W;  4WFF A;  1W2B U;  1PM9 A;  1WB8 A;  4O4H B;  3OMA B;  1KP2 A;  4QPK A;  4O4J B;  3L71 H;  4BIZ A;  1MA1 A;  1IBM O;  1O9H A;  4CC5 A;  3S3W A;  1Y4M A;  1D5N A;  4O2B A;  4QIW F;  4CS3 A;  1AIL A;  3CYO A;  2YI8 A;  1GMG A;  3ZHT A;  4YXW G;  4DK0 A;  2Y4T A;  2EUL A;  2GUZ A;  1EBO A;  4JYA B;  3C3S A;  3F5T A;  4P9P A;  1XL4 A;  4FLU A;  3CXC U;  2HVJ C;  4FMT A;  5EK0 A;  4I7Z B;  2UXC O;  1Q8I A;  3E8H A;  1XMO O;  3MD0 A;  3BCC H;  3ZHR A;  1U96 A;  4QE9 A;  1VF6 A;  4KL1 A;  1IBK O;  4JI5 B;  4JI8 B;  5DEC A;  1SQQ H;  1GN6 A;  1V9P A;  1Q6H A;  3K5O A;  1HNW B;  1QVG U;  3WU2 Z;  2ZM6 O;  4IGG A;  4UXN A;  5LA6 A;  2F23 A;  5LHI A;  3G71 V;  1VQO V;  4PA9 A;  4G28 B;  1QCE A;  2UXC B;  1KMI Z;  4MW3 A;  3SJQ C;  2EIK B;  2F95 B;  1YVW A;  4LR3 A;  3AG3 B;  3M8A A;  4LBE C;  1L0L H;  4MW8 A;  2XAQ A;  3JD0 A;  1F7Y A;  4NTX A;  5KA6 A;  3IFX A;  1S76 D;  4X1Y A;  4PA4 A;  1NTM H;  1XHZ A;  2N74 A;  2KG7 A;  2HEP A;  4X88 A;  2IW5 A;  4GX1 A;  5LA6 B;  1GO3 F;  3P32 A;  1N36 O;  3AG4 C;  2F93 B;  1X4T A;  2GTA A;  2JVD A;  1QR9 A;  3CME V;  2UUA O;  1AI7 A;  3B8N A;  2WLI B;  3B09 A;  2CAZ C;  2X6C A;  4X1Y B;  4UVB A;  1E1Q G;  1M9N A;  3OD4 A;  4HYO A;  5JJN B;  2X6B A;  1SF9 A;  3CC4 V;  4DV1 B;  4PDM A;  4U3J B;  2P5O A;  2WWW A;  2JK5 C;  3HR0 A;  1S5J A;  4O2B B;  3ZN0 A;  1VQK V;  5E79 Z;  4JTD B;  4ZOL A;  4P2Z A;  4DR1 O;  4E4E A;  3S3X A;  4EKW A;  4DR4 B;  3FX7 A;  1NZ6 A;  3T4Z A;  1KQS U;  1VQ4 V;  1DF5 A;  2DYR C;  1ZX3 A;  2RQ6 A;  3WG7 C;  3ML0 A;  1XOU A;  1PNL A;  1SQF A;  4JI2 B;  4NXN O;  4UCR A;  2QWN B;  2WLI A;  3THO A;  3K57 A;  2AZ0 A;  2QJ1 A;  3K0D A;  5LMN B;  3FB7 C;  2Q5Z A;  4IYI A;  3Q4H A;  2HJF C;  2V1D A;  4PHZ A;  4DYL A;  1I5X A;  4JI1 B;  3T1H B;  4G27 B;  1LUW A;  1N34 B;  2QGN A;  5CN0 A;  1Q5O A;  4W4L A;  2M6Y A;  1E1R G;  2ZIN A;  3LDD A;  4O4H A;  4DRX B;  1P4R A;  1WB7 A;  2P06 A;  1SS3 A;  2A7W A;  2HR3 A;  1I08 A;  4MTX A;  1UFI A;  2OIG A;  1DLB A;  4B3T O;  1P49 A;  2WLJ A;  2LP7 A;  4MSW C;  2XAH A;  3D3I A;  4FM2 A;  5IE9 A;  4J42 A;  4DV7 O;  2IH3 C;  5LXT B;  4GX0 A;  2OTL V;  2IU3 A;  2OT5 A;  3CCS V;  1O9G A;  2AGA A;  2DMX A;  1FD9 A;  4J9Z B;  4TSF G;  3ZMU A;  2CH7 B;  2E75 B;  1EN5 A;  1CEZ A;  3JAK A;  1HR0 B;  2UXB O;  2L35 A;  1P7G A;  1XNR B;  3IGA C;  3JAR A;  4YJ2 B;  4UVC A;  5J2T B;  4CH6 A;  3J7A U;  1YF2 A;  5JQG A;  3TJT A;  2VQF B;  4J7K A;  2F4V O;  3OTO B;  2YS8 A;  3M7M X;  4Z2W A;  2GV9 A;  4CH5 A;  1MOF A;  2N05 A;  4ZBM A;  1JA8 A;  4FIP C;  5TIS Z;  2GBO A;  1HR0 O;  2DW4 A;  2X0L A;  1SET A;  5L3C A;  1N8R W;  3HKB A;  5BR8 O;  1XNR O;  2AXT Z;  5L3D A;  4ZI7 B;  2PGG A;  3W7X A;  5DN6 G;  1X59 A;  3C90 A;  4H44 B;  2VQF O;  4LWS A;  1H2L A;  1N32 O;  3B4S A;  1EZJ A;  1G4Y B;  1VEW A;  4LH6 A;  1E79 G;  3SYP A;  1ZUQ A;  4MT8 A;  1QHT A;  4LNU A;  1ZWI C;  3SPJ A;  5K1X A;  1XBL A;  4B3T B;  3RVY A;  3F5W C;  4OX9 O;  5KMG B;  3H1J H;  1WA8 A;  2UXX A;  3K3W A;  4J9Y B;  4DR2 O;  2UU9 O;  4PA3 A;  4CZZ A;  1H8H G;  4JTA B;  5IJ9 B;  1J5E O;  1PD3 A;  1ENV A;  1N0N A;  2FB5 A;  4UVA A;  2H3O A;  3KZI Z;  3O65 A;  4R6Z A;  4ASU G;  1IXM A;  4WBN A;  4JI6 B;  1YZB A;  2YI9 A;  3UO2 A;  3CB2 A;  4LF5 B;  3LNM B;  1NR7 A;  4OGQ B;  2E3C A;  3AK1 A;  5FPR A;  4HAM A;  1THZ A;  4O2A A;  2VQE O;  2ZE7 A;  1SZX A;  3ASO C;  1VQM V;  3CCE V;  2ZIM A;  2EIN C;  4H33 A;  4J80 A;  4GYC B;  2WLL B;  5B1A B;  2IU0 A;  4FJC C;  2ADQ B;  1LR1 A;  3A0H Z;  3HKD B;  1VF5 B;  4LF4 B;  1CPY A;  3N2K A;  5KAI Z;  5IY5 C;  5GTI Z;  1VQ7 V;  2W0X A;  4NR1 A;  1Z5V A;  4TV9 B;  3K59 A;  1VQP V;  3ZBH A;  4D6T H;  4JI4 O;  3CXH F;  2Q7H A;  5B1N A;  5IT9 N;  3QVN A;  2Q0A A;  1OCC C;  2YIC A;  1F23 A;  3AG1 B;  4I0X B;  5H9C A;  3H1L H;  3LUT B;  1AVM A;  3NXS A;  1SQB H;  2F66 C;  3CCV V;  4EB6 B;  5FNV A;  4O4I B;  5FLX N;  1GN2 A;  1TVK A;  3AG2 B;  1FFX A;  1WLE A;  2OTJ V;  3DSQ A;  1M57 B;  1M56 B;  4RO2 A;  2DYR B;  3WG7 B;  2JGD B;  2EIM B;  2ZE5 A;  4IHJ B;  2EZP A;  4JAS A;  5H6R A;  2WA4 A;  5FPO A;  3H9V A;  4P9O A;  4GKJ O;  5LYJ B;  3FB5 C;  4PI0 A;  1NR1 A;  4WCE V;  3SGI A;  5KUK A;  2A0L A;  2UXN A;  3VQY A;  3ZMZ A;  3FB8 C;  2Q7G A;  1VP7 A;  1AR1 B;  4XDL A;  1QQC A;  1G1X B;  1JMK C;  4D7T A;  4DV0 B;  4PA7 A;  5IWA B;  5BY1 A;  2QWO B;  5EBL C;  2JJ2 G;  2K1E A;  3LNN A;  2EIK C;  1R3K C;  3EHB B;  4GT1 A;  2IJI A;  1R6N A;  3K04 A;  3ABK C;  1GAX A;  5IDJ A;  2NN4 A;  5IYZ A;  3APQ A;  1P7B A;  1NTZ H;  5ITZ B;  3ETG A;  5GON B;  4OXS A;  2QWP B;  3RW0 A;  3QF7 A;  1R3I C;  2QKC A;  4Z1M G;  3LSQ A;  3E22 A;  4BAY A;  5L3F A;  2XAJ A;  4DK1 A;  4PA6 A;  5GON A;  5CBF A;  3QO5 A;  4JV5 O;  3BRC A;  4FFB A;  5EYP B;  4WFG A;  4K8X A;  4JZG A;  5EIB C;  3CRM A;  3DTU B;  3A0R A;  4JYY A;  1IZ3 A;  1JJO A;  4GKK O;  2ZQM A;  4X1I B;  3FYE B;  5CA3 A;  2PZS A;  1FPO A;  1Q90 D;  4BIO A;  1PL0 A;  2XAS A;  1L8D A;  2EJR A;  1YJN V;  5LGU A;  1VQ6 V;  3OM3 B;  1G8M A;  2DQ3 A;  2RJZ A;  4TQF A;  2IBZ H;  1XI1 A;  4DUZ B;  3JAT A;  4LFA O;  3OE7 G;  3QO8 A;  4JTC B;  2XT9 A;  4CBC A;  2Q73 A;  4GKK B;  2HHH O;  5IYD O;  2YEV B;  2BTQ B;  5IYB O;  4LF9 B;  1SA0 B;  2X7R B;  4MS2 A;  5K1P A;  3U11 A;  2BTO A;  4IHJ A;  1BHA A;  5JH7 B;  1KBH A;  3SYC A;  2VS0 A;  3JAW A;  5IWA O;  2D2C B;  4FLY A;  1Q6U A;  2E5L B;  4DR3 B;  3FYI B;  4TOI A;  4DUZ O;  1YTF D;  3OR6 C;  4L8J A;  2RCV A;  2YXY A;  4O4I A;  3ZJZ A;  2EX3 A;  2H8P C;  3PN1 A;  3UM7 A;  2IJJ A;  1ZSP A;  4DV3 B;  3L70 H;  4BWA A;  1XDC A;  3ZCC A;  4I0X A;  2MK3 A;  1BHB A;  3VQW A;  1VIB A;  3H1I H;  1BE3 H;  3JAT B;  1NVP D;  5DM6 V;  1NT2 B;  1R6K A;  1FXK B;  3CRC A;  1MMM A;  5BMV B;  1M57 C;  4JI6 O;  4B3S B;  2PYL A;  4QE7 A;  1JX9 A;  3OUF A;  5KLV H;  1QNM A;  2DQ0 A;  2EIL B;  1YIJ V;  5B5E Z;  3RGB A;  1D5A A;  4X64 B;  5L3B A;  4MVU A;  1BQZ A;  4U7N A;  1K4C C;  2ATK C;  1XNQ B;  3SYQ A;  5B1B C;  2FYU H;  4B08 A;  2BOC C;  1TUB A;  5LYJ A;  1KUQ A;  1N4C A;  1VMG A;  4UCO A;  1M1K W;  4ZKI A;  3CRR A;  3ETE A;  3BVO A;  1A32 A;  4D7S A;  2JGD A;  1WN7 A;  4DR2 B;  2UU9 B;  1RSO B;  4FLW A;  3QG5 A;  4RQF A;  2CGN A;  1XRE A;  1K8A W;  3UCS C;  2DYS C;  1H38 A;  2RDC A;  1FFX B;  1XMQ B;  1TVK B;  3JAW B;  1S72 V;  3OTF A;  3X2Q C;  3STZ C;  2JEX A;  1B3Q A;  1WPX A;  4IIJ B;  4WFH A;  3W7T A;  1YJ9 V;  2NNU A;  2YEV A;  4IYH A;  3RBZ A;  4YJ3 B;  4JI0 B;  2DJV A;  3DXR B;  5KA5 A;  3HPL C;  4N21 A;  4JI7 O;  1FXV A;  4ZI7 A;  2QWR B;  4LH7 A;  3N2K B;  3SYA A;  4B3S O;  2V4D A;  1JJ2 U;  4AI8 A;  4F6R B;  1PNK A;  4X1I A;  1V55 B;  2ETN A;  3AK2 A;  1QVF U;  3JAL B;  2W6J G;  1SES A;  4JAA A;  5EYP A;  3SPG A;  4DR6 B;  4I5S A;  2GDS A;  2RNB A;  1K3E A;  4NTW A;  2KKW A;  2OCC C;  4MVS A;  2XAF A;  3CE2 A;  2EJ7 A;  2A79 B;  1WJZ A;  3ZRW B;  3L75 H;  3FKS G;  2E74 B;  4GZR B;  1RP3 B;  4LF5 O;  4G2K A;  1GN3 A;  4YIO A;  3OW2 U;  3CEI A;  5IYZ B;  3B77 A;  5EZY B;  1TGO A;  1AP5 A;  4TV9 A;  1RPR A;  3ETQ A;  2B1I A;  5E1A C;  2EIM C;  4UV8 A;  2DWE C;  5LP6 B;  1AI4 A;  2IJH A;  3WFV A;  1BT8 A;  1N0J A;  3EXA A;  2W0F C;  1I94 B;  4NKG B;  2JJ1 G;  5CBH A;  4AQY O;  1ZLZ A;  1YDX A;  4IT5 A;  3ZHQ A;  4LWS B;  1BZK A;  3QNE A;  3ASO B;  3ZRV A;  2YXL A;  4MVQ A;  3N27 A;  4DRX A;  2CGO A;  1VF6 C;  2DWD C;  4EFB A;  3CP1 A;  2PTM A;  1JCH A;  1FJG O;  2WLM A;  4DW1 A;  3CJH A;  5C93 A;  2GTS A;  4RAI A;  3OMN B;  3G80 A;  4H37 A;  1FKA O;  5IJ9 A;  1EM1 A;  3Q4H B;  4QJF B;  4X65 O;  3GB7 C;  4O4L B;  3W7W A;  3G67 A;  3IC9 A;  4WFE A;  3W7S A;  4FLX A;  2A06 H;  2ZT9 B;  2HVK C;  1H2N A;  1TUE B;  3CC2 V;  5J2T A;  1V54 B;  2YIB A;  3CWB H;  2X6A A;  3T1Y O;  1SER A;  1SKV A;  3AG2 C;  3B40 A;  3CCL V;  1R73 A;  5CB4 A;  3LDE A;  3BA8 A;  3KKY A;  2Q8V A;  1M56 C;  3ABM B;  4TT3 G;  4FM0 A;  1Y76 A;  2CTW A;  3M99 B;  4X62 O;  1Q86 W;  1W59 A;  3BAB A;  1BSM A;  2QTO A;  4LCU C;  2R70 A;  2XAG A;  2WLL A;  4DXW A;  3ZHV A;  1Y74 B;  3JD4 A;  1KKC A;  1YIT V;  1M93 A;  4YY3 B;  1K7D A;  3K9S A;  2ADP A;  4UB8 Z;  2WLN A;  1QLE B;  1QR8 A;  1YCI A;  4LF9 O;  5JJE B;  2LJ2 A;  1Z5W A;  2OIE A;  5IYC O;  4A5U B;  1SRY A;  4LF6 O;  4C7U A;  4RQE A;  1ZL8 A;  1I0H A;  4K35 A;  4DR3 O;  3IAY A;  5LL6 Y;  3L74 H;  1MSW D;  2QKS A;  4X8A A;  2HLD G;  3BEH A;  3NR7 A;  1VQL V;  4RWU A;  4JV5 B;  1WA8 B;  2AW9 A;  3AEI A;  5KMG A;  3K5N A;  4DR5 B;  2A3Q A;  3CS5 A;  3OEE G;  3JCU Z;  3ZED A;  1QBZ A;  3ZN1 A;  5JCO C;  1RFY A;  4J11 A;  3HKE A;  2FL4 A;  5LHH A;  3D8C A;  4ZHQ A;  1F51 A;  1IBM B;  1IVS A;  4UUJ C;  3BY6 A;  4X66 B;  1PKX A;  1K9M W;  1NH2 B;  3APO A;  1GKF A;  3OT7 A;  4PDR A;  2DYS B;  2RMK B;  4X20 A;  3H01 A;  5L3E A;  4W4K A;  2EBO A;  2UXB B;  5LP6 C;  4JYA O;  4XDJ A;  4KFM A;  3ZHU A;  4MVO A;  3I55 V;  3SJB C;  1RPO A;  1SQX H;  3I56 V;  4DV2 O;  2JEU A;  2QM4 A;  4DO2 A;  1J5E B;  5JWP A;  2ZXW B;  3OMI B;  3E2E A;  3D3Q A;  2P22 C;  3SPC A;  4MTG A;  2JRI A;  1MZE A;  3PJS K;  1CXZ B;  3SPH A;  1BL8 A;  3T4D A;  5KHH A;  3E8B A;  1K97 A;  3W7U A;  2CTP A;  3ABU A;  4DV4 O;  2B5U A;  3CX5 F;  4NTY A;  5HFM A;  3BFR A;  4MVR A;  4J41 A;  1M4U A;  3ABL C;  4GCZ A;  3A2F A;  4ZOL B;  4LF7 O;  3KG2 A;  4DUY B;  3ETD A;  3CC7 V;  2CUG A;  4JI5 O;  1D2D A;  3SJA C;  4X64 O;  2LFS A;  1FXK C;  4I55 B;  5H5N A;  4PDV A;  3CCU V;  4X66 O;  4I55 A;  3TXQ A;  4QNH B;  1J95 A;  4TWK A;  1BMF G;  3LSU A;  4TV8 B;  5CA1 B;  4ICG A;  1I94 O;  1M5I A;  4KP4 A;  1HWY A;  3CSX A;  2C2A A;  5D5P A;  4PV1 B;  5EBM C;  5EC1 C;  1TA8 A;  1V55 C;  2QDO A;  2VQE B;  3K5L A;  1IBL B;  3UQ8 A;  1XHX A;  3D36 A;  5B3S B;  2EZO A;  4DV2 B;  2EIN B;  2LQT A;  4B3R B;  2PF4 E;  2QE7 G;  3ZMV A;  2CTR A;  1XMQ O;  2Y48 A;  1OCO B;  1ZL8 B;  1WNS A;  1Y67 A;  1N33 O;  1R1B A;  2BCC H;  1HP8 A;  2OCH A;  1ORQ C;  2WSS G;  2Y69 C;  1JPX A;  3P3N A;  4XDK A;  1S77 D;  2KSD A;  4DV0 O;  3X2Q B;  2Z3Y A;  5B1O A;  3T2M A;  4Z1V A;  3FAV A;  3FAV B;  1HNX O;  1N33 B;  2A9H A;  4JI2 O;  2JGU A;  4O4J A;  5D5Q A;  1Y76 B;  4GLX A;  4X20 B;  4X9Q A;  3SR2 C;  1Q6I A;  2XTA A;  2LFR A;  2VWK A;  5CB4 B;  4R7C A;  1I5Y A;  3ABM C;  3MHH C;  4J10 A;  2BOB C;  5KX5 A;  1F4N A;  4PD4 F;  4MTO A;  1SQP H;  2VRZ A;  4FLT A;  2VWJ A;  1JQ0 A;  1K5S A;  3JAM N;  1MAB G;  4DR4 O;  1QU7 A;  2QM7 A;  1HNX B;  1JOY A;  3E89 A;  3T1H O;  5CMU A;  2WLK A;  4X65 B;  1DTO A;  5KHJ A;  2GUZ B;  4NYK A;  4PEL A;  4B3M O;  3P3P A;  5KAF Z;  2H94 A;  4JAV A;  1IDS A;  2P6J A;  2UUB O;  2IM9 A;  2ZIO A;  1Y6X A;  4NXN B;  1JVM A;  3OGC C;  3JD2 A;  4KUM A;  1GTO A;  3CHX A;  3OUS A;  3E83 A;  4JPR A;  1VQ5 V;  2KG7 B;  4KHP B;  3G6E V;  3CJH B;  4BW9 A;  2WAM A;  2UUC B;  1XIL A;  3ZX6 A;  5BXZ A;  3LDC A;  3RYF A;  2V7Q G;  2HHH B;  5B1B B;  4JI3 B;  5AG2 A;  3A0B Z;  2GHY A;  4JGS A;  1GK9 A;  2UUB B;  1N34 O;  3EVK A;  1EZV H;  4YHH B;  3WB2 A;  3HKE B;  3ZIA G;  3EFF K;  3GWK C;  2MW2 B;  1OJH A;  4NB5 A;  3CPW U;  3AG7 A;  3R65 A;  3VOU A;  2Z5U A;  1IUR A;  3N2G B;  2ZKO A;  3RVZ A;  3DC5 A;  1H8E G;  5B66 Z;  2R9A A;  5HFL A;  3QO7 A;  3JCZ A;  4I50 B;  1K4D C;  2KB1 A;  2Y0I A;  3UT5 B;  2QA4 V;  1SC5 B;  1FAF A;  4DV7 B;  1H2K A;  4LFC O;  3BHP A;  2QEX V;  2BSK B;  4CH3 A;  3BA9 A;  2QR4 A;  3RT3 C;  3H1H H;  2HP8 A;  1K34 A;  2YSU B;  2QM8 A;  4X89 A;  1EN6 A;  4DV5 B;  3IJ4 A;  2P67 A;  2XHB A;  4FLZ A;  1W0K G;  2DN9 A;  2ZXW C;  1AR4 A;  2B9Z A;  2EIJ C;  4FK5 C;  3TGU H;  4DV4 B;  3CRA A;  3IC7 A;  1XNQ O;  2XUM A;  2ZDI A;  4Q6G A;  1NU1 H;  5GW7 A;  3SDL A;  1Q3E A;  4CH4 A;  2ODM A;  1HW7 A;  3VQX A;  2ARH A;  4ZHQ B;  4YJ3 A;  1DK1 A;  5BR8 B;  5EIB D;  2WPD G;  4FVM A;  2B1G A;  1PNM A;  3JSL A;  4K8Z A;  2LGW A;  3K06 A;  3E86 A;  5J2U B;  4UB6 Z;  1AP6 A;  4NVP A;  5JVD A;  4DV6 O;  4O4L A;  2ZNI A;  4ZIB A;  4UCS A;  1R3L C;  2ZR2 A;  2CK3 G;  4HNA A;  1JFF A;  1NS1 A;  3I5D A;  5IJ0 A;  4R8C A;  1WP8 A;  3J81 N;  1ROP A;  1YHQ V;  3RN4 A;  3ZRW A;  2XND G;  2Q9L A;  1TUB B;  1N36 B;  2NLJ C;  1PV0 A;  3JD3 A;  4AHC A;  3B8M A;  1L0N H;  5CA0 B;  3D36 C;  4B3R O;  1OZ0 A;  4DV6 B;  1Y74 A;  1K5Q A;  3JAS A;  1S5L Z;  4U3F H;  4LF7 B;  5A9G A;  5LBQ A;  1S0V A;  2ZM6 B;  4ABM A;  2Y0P A;  3RYI A;  4DW0 A;  3OEH G;  1KB9 F;  4L87 A;  3STL C;  5EZY A;  1FXK A;  5F2V O;  3ZS8 C;  5LMU O;  2YXH A;  4EFE A;  1AI6 A;  3DXR A;  1DF4 A;  5C8Y A;  1AI5 A;  4MTF A;  1ZAU A;  3K08 A;  4JI0 O;  5H2F Z;  4JI4 B;  3AK3 A;  2WLH A;  4NXM O;  1WAZ A;  2IJK A;  2AZ2 A;  5H6Q A;  1S3J A;  1WP7 A;  2Q67 A;  1GN4 A;  4OPH A;  3P30 A;  1GM8 A;  1VQN V;  2F1M A;  1XUQ A;  4I9W A;  1OCO C;  5JH7 A;  2Q7E A;  4BR6 A;  3FFQ A;  2EIL C;  4AQY B;  1SA0 A;  1HDJ A;  1BQ0 A;  1GH6 A;  2FTK A;  3R66 A;  4DUY O;  1RM1 C;  5LOV B;  2W6I G;  4I4T A;  3ZRX A;  5GTH Z;  4DR6 O;  1MZF A;  3ZHS A;  1KKD A;  4H0L B;  1NKD A;  2YUA A;  1K92 A;  3MDS A;  4JYB A;  2LW1 A;  5FL7 G;  1KC8 W;  1KEC A;  2OCC B;  3DGE A;  3BPZ A;  3RYC A;  1OCR C;  5JJJ B;  5BZB A;  4IIJ A;  4JI1 O;  1GRJ A;  5LP6 A;  3MHS C;  3K0G A;  2Q69 A;  1S5H C;  2P4K A;  4TUY B;  4YHH O;  1VQ8 V;  1RSO A;  3L73 H;  3HKC B;  3UKM A;  3ICX A;  4MVM A;  5A2Q N;  1W0J G;  4LC1 A;  1COW G;  1VAR A;  3E22 B;  5JCO A;  1XL6 A;  2Q68 A;  3UO3 A;  3CMA V;  3QTC A;  3HKC A;  1LUV A;  1MNG A;  3JAL A;  3K58 A;  2QTS A;  4MVZ A;  5LMN O;  2ZDI C;  1HNZ O;  4LFC B;  3OGI B;  4KHP O;  4LFA B;  4F6R A;  1H2M A;  1NVP B;  3RYH A;  2CE4 A;  4X1K B;  2UXD B;  2Q4P A;  2QWQ B;  4B7K A;  1B6Q A;  2Q6A A;  5BMV A;  2F4V B;  2HG5 C;  3ZRS A;  5CBG A;  3ABT A;  1V54 C;  2R9I A;  4FFK A;  2JDI G;  2LGQ A;  5LOV A;  1YTF B;  1OHH G;  3RYH B;  2QKA A;  2P7T C;  5KHG A;  2LW7 A;  1NTK H;  1AB3 A;  2CTQ A;  4H13 B;  4WFA V;  2CDY A;  4DR5 O;  2LO1 A;  3KCX A;  2JS3 A;  1SZT A;  4FFB B;  1LNQ A;  1OCZ C;  3SPI A;  1YI2 V;  2ZE8 A;  2YIA A;  3TXS A;  5EC2 C;  1Q7Y W;  5FNV B;  3BAA A;  5C8Y B;  3LSS A;  2ZR3 A;  3JD1 A;  2E5L O;  1P84 F;  2RN9 A;  1KP3 A;  3DC6 A;  2K9P A;  4I9Q A;  4F6E A;  3L9D A;  3CCM V;  2JS5 A;  1IBK B;  3KCY A;  5LGT A;  1YSC A;  4JF3 A;  5J9P C;  4PDL A;  5KHK A;  4OPA A;  4TUY A;  1GM7 A;  1U97 A;  2ZD9 A;  2PYJ A;  3OTO O;  1QLE C;  3RYI B;  2IH1 C;  1URF A;  4LF6 B;  4LF8 B;  3ZMT A;  5LHG A;  3TCU A;  1RM1 B;  1VF7 A;  4Q20 A;  4FPP A;  1AJQ A;  4LFB O;  4CC6 A;  3A8T A;  1IXB A;  4UCV A;  5CA0 A;  4FM1 A; 
#chains in the Genus database with same CATH homology
 1VQ4 V;  1DF5 A;  2BOB C;  4BIU A;  2DYR C;  3WG7 C;  3ML0 A;  1F4N A;  4MTO A;  2GSM B;  1JQ0 A;  1PNL A;  1K5S A;  4GX5 A;  1K33 A;  3ASN B;  1M1K W;  2WLI A;  2AHY A;  1MAB G;  4ZKI A;  3ETE A;  2QM7 A;  1ARO P;  1NH2 D;  3E89 A;  1JOY A;  5CMU A;  4RUE A;  2WLK A;  1DTO A;  2AHZ A;  4PEL A;  3K0D A;  4RQF A;  3FB7 C;  1K8A W;  2F43 G;  2DYS C;  2H94 A;  4JAV A;  1H38 A;  2P6J A;  1UJW B;  2HJF C;  5L3G A;  1JVM A;  2V1D A;  3OGC C;  1S72 V;  1OCC B;  3JD2 A;  4KUM A;  3X2Q C;  3ABL B;  1GTO A;  1I5X A;  3OUS A;  3STZ C;  3E83 A;  4JPR A;  2JEX A;  1VQ5 V;  2P90 A;  1WPX A;  4G27 B;  3G6E V;  4WFH A;  3W7T A;  1YJ9 V;  2NNU A;  2WAM A;  2YEV A;  3CCR V;  5CN0 A;  3MHH C;  4N23 A;  3RBZ A;  5KA5 A;  1E1R G;  3LDD A;  3HPL C;  3LDC A;  1P4R A;  3SYO A;  4P30 A;  2V7Q G;  5B1B B;  2HR3 A;  3OFN G;  4N21 A;  2GHY A;  4MTX A;  1FXV A;  4JGS A;  1GK9 A;  2EIJ B;  5B1A C;  1DLB A;  3CCJ V;  3SYA A;  2WLJ A;  3OR7 C;  3ZIA G;  3EFF K;  1JJ2 U;  2LP7 A;  4MSW C;  2XAH A;  3D3I A;  4R50 A;  1PNK A;  4JAU A;  1V55 B;  3CPW U;  3R65 A;  2IH3 C;  3VOU A;  1QVF U;  2Z5U A;  4GX0 A;  2OTL V;  4BW5 A;  2W6J G;  1SES A;  2IU3 A;  2OT5 A;  3RVZ A;  1H8E G;  5HFL A;  3SPG A;  3CCS V;  3QO7 A;  1Y66 A;  4I5S A;  5B3S C;  1GM9 A;  3JCZ A;  1AJP A;  1K3E A;  1K4D C;  4J9Z B;  2OCC C;  4MVS A;  2KB1 A;  4TSF G;  3ZMU A;  2XAF A;  2QA4 V;  3GWO A;  1CEZ A;  2A79 B;  3ZRW B;  2QEX V;  3IGA C;  3FKS G;  4UVC A;  3AG3 C;  4G2K A;  1K34 A;  2Y69 B;  2QM8 A;  2YSU B;  4X89 A;  2P67 A;  3OW2 U;  1W0K G;  1K73 W;  1R3J C;  3B77 A;  5KUM A;  2ZXW C;  3CCQ V;  1EFR G;  3ABK B;  3K9A A;  1RPR A;  1L1F A;  2B1I A;  2EIJ C;  1MOF A;  5E1A C;  4FK5 C;  2EIM C;  4UV8 A;  4ZBM A;  2DWE C;  3K03 A;  4FIP C;  1AI4 A;  2IJH A;  2HKO A;  3WFV A;  4QPJ A;  2DW4 A;  4WFB V;  2X0L A;  1SET A;  3IC7 A;  5L3C A;  1N8R W;  3OAA G;  2W0F C;  5L3D A;  3W7X A;  2ZDI A;  5DN6 G;  3TET A;  1FFT B;  2JJ1 G;  5CBH A;  3JYC A;  4WF9 V;  5GW7 A;  4E2L A;  3QNE A;  3ASO B;  1YJW V;  3ZRV A;  1AJN A;  1FXH A;  4MVQ A;  1EZJ A;  1G4Y B;  2DWD C;  3T1C A;  1OCR B;  3CP1 A;  1E79 G;  3SYP A;  1JCH A;  3F7Y C;  2D3O W;  1F4M A;  2WLM A;  2WPD G;  2HFE C;  3ZMS A;  4MT8 A;  2B1G A;  1PNM A;  1CP9 A;  5C93 A;  1ZWI C;  3SPJ A;  3G4S V;  4RAI A;  3RVY A;  3F5W C;  3OMN B;  1Q81 W;  4H37 A;  3K06 A;  4F4L A;  4HZ3 A;  3E86 A;  3HB3 B;  2UXX A;  3K3W A;  4J9Y B;  4QJF B;  3GB7 C;  2M7W A;  3W7W A;  4PA3 A;  3E8F A;  4CZZ A;  4U7O A;  4WFE A;  1H8H G;  1R3L C;  4JTA B;  2ZR2 A;  1PD3 A;  1ENV A;  3W7S A;  2CK3 G;  2HVK C;  4UVA A;  1TUE B;  3AG1 C;  4R8C A;  2ITD C;  4R6Z A;  1ROP A;  4ASU G;  1YHQ V;  1IXM A;  3CC2 V;  1V54 B;  3ZRW A;  2XND G;  3ASN C;  3TK1 A;  1SER A;  2X6A A;  2XOK G;  3LNM B;  1NR7 A;  3AG2 C;  4UV9 A;  1NBM G;  4HAM A;  1THZ A;  3CCL V;  1R73 A;  2NLJ C;  3F7V C;  3JD3 A;  3B8M A;  3LDE A;  3VBB A;  1QLN A;  1OZ0 A;  1M56 C;  3ASO C;  3ABM B;  4TT3 G;  3CCE V;  1VQM V;  2EIN C;  4H33 A;  1K5Q A;  2R9R B;  2WLL B;  5B1A B;  2IU0 A;  3M99 B;  4FJC C;  5LBQ A;  1S0V A;  1Q86 W;  1VQ9 V;  3E35 A;  4JYC A;  1CPY A;  2QTO A;  4LCU C;  5IY5 C;  2XAG A;  2WLL A;  4DXW A;  3AG4 B;  1VQ7 V;  3JD4 A;  3OEH G;  1VQP V;  4L87 A;  3STL C;  1YIT V;  3K79 A;  1K7D A;  1H2G A;  1FXK A;  5B1N A;  3CD6 V;  2WLN A;  1OCC C;  1AI6 A;  5LGN A;  1F23 A;  1QLE B;  1QR8 A;  3AG1 B;  5H9C A;  4GX2 A;  1DF4 A;  3LUT B;  5IYC O;  4RUF A;  1NQT A;  1KD1 W;  1SRY A;  4XBF A;  1AI5 A;  4MTF A;  3NXS A;  3K08 A;  3E8G A;  4RQE A;  3CCV V;  2ITC C;  3AG2 B;  2WLH A;  1MSW D;  2QKS A;  1M90 W;  2IJK A;  4X8A A;  2HLD G;  3BEH A;  1S3J A;  4LP8 A;  5H6Q A;  1WLE A;  1VQL V;  2Q67 A;  2OTJ V;  1M57 B;  3P30 A;  1OCZ B;  1GM8 A;  1M56 B;  1VQN V;  4RO2 A;  4I9W A;  5EBW C;  3AEI A;  1MG1 A;  1OCO C;  2DYR B;  3WG7 B;  1FS0 G;  3OEE G;  2EIM B;  4R7C A;  1QBZ A;  3ZN1 A;  2EZP A;  4JAS A;  3FB6 C;  2EIL C;  2PI5 A;  5H6R A;  5LHH A;  2JIZ G;  2PI4 A;  2FTK A;  1RM1 C;  4P9O A;  1F51 A;  3FB5 C;  2W6I G;  4UUJ C;  3ZRX A;  5IY5 B;  3BY6 A;  1NJI W;  1NR1 A;  4WCE V;  1PKX A;  5KUK A;  2A0L A;  1K9M W;  1NH2 B;  2UXN A;  1Q82 W;  1KKD A;  4WFF A;  1W2B U;  1NKD A;  1GKF A;  1K92 A;  4JYB A;  4PDR A;  3ZMZ A;  3FB8 C;  2DYS B;  5FL7 G;  1KC8 W;  1AR1 B;  3OMA B;  4XDL A;  1KEC A;  2OCC B;  3DGE A;  3H01 A;  5L3E A;  1KP2 A;  4QPK A;  1OCR C;  4BIZ A;  2EBO A;  5BZB A;  4PA7 A;  4XDJ A;  4KFM A;  5EBL C;  2JJ2 G;  2K1E A;  4MVO A;  1Y4M A;  2EIK C;  3I55 V;  4QIW F;  1R3K C;  1RPO A;  3EHB B;  3I56 V;  3CYO A;  4GT1 A;  2JEU A;  2IJI A;  3MHS C;  4DO2 A;  1R6N A;  3K0G A;  1GMG A;  2Q69 A;  2ZXW B;  4YXW G;  1S5H C;  3K04 A;  3ABK C;  5IDJ A;  3OMI B;  1VQ8 V;  3E2E A;  1EBO A;  1P7B A;  3UKM A;  3ETG A;  1XL4 A;  4MVM A;  4OXS A;  4MTG A;  4P9P A;  3SPC A;  3CXC U;  3RW0 A;  1W0J G;  1R3I C;  4LC1 A;  2HVJ C;  4FMT A;  1COW G;  5EK0 A;  4Z1M G;  3LSQ A;  3PJS K;  3SPH A;  4BAY A;  1BL8 A;  1XL6 A;  2Q68 A;  3E8H A;  5L3F A;  3T4D A;  2XAJ A;  3MD0 A;  3E8B A;  1K97 A;  4PA6 A;  3W7U A;  3ABU A;  4QE9 A;  3CMA V;  2B5U A;  5CBF A;  3QO5 A;  4WFG A;  3DTU B;  3A0R A;  5HFM A;  4MVR A;  2ZQM A;  4MVZ A;  1QVG U;  2ZDI C;  3FYE B;  3ABL C;  4GCZ A;  5CA3 A;  4UXN A;  5LHI A;  3G71 V;  3KG2 A;  1PL0 A;  1VQO V;  4PA9 A;  2XAS A;  1QCE A;  4G28 B;  3ETD A;  2EJR A;  1NVP B;  1YJN V;  3CC7 V;  5LGU A;  4MW3 A;  3SJQ C;  1VQ6 V;  3OM3 B;  1G8M A;  2DQ3 A;  2EIK B;  1B6Q A;  2Q6A A;  3AG3 B;  4LBE C;  4MW8 A;  2LFS A;  2XAQ A;  1FXK C;  3JD0 A;  4PDV A;  3CCU V;  3OE7 G;  5KA6 A;  3IFX A;  2HG5 C;  3QO8 A;  4JTC B;  4QNH B;  1J95 A;  4CBC A;  1S76 D;  3ZRS A;  4TWK A;  1BMF G;  3ABT A;  5CBG A;  5IYD O;  1V54 C;  2R9I A;  4PA4 A;  2YEV B;  2JDI G;  1YTF B;  1OHH G;  5IYB O;  4KP4 A;  2X7R B;  4MS2 A;  2P7T C;  1HWY A;  4X88 A;  1BHA A;  2C2A A;  2IW5 A;  4GX1 A;  5EBM C;  3SYC A;  5EC1 C;  1V55 C;  1GO3 F;  3P32 A;  3AG4 C;  4WFA V;  3FYI B;  1SZT A;  3D36 A;  1YTF D;  5B3S B;  2EZO A;  1LNQ A;  1OCZ C;  2EIN B;  3SPI A;  1YI2 V;  1QR9 A;  3OR6 C;  3CME V;  2QE7 G;  3ZMV A;  5EC2 C;  1Q7Y W;  3ZJZ A;  2Y48 A;  1OCO B;  1AI7 A;  3B8N A;  2WLI B;  2H8P C;  2X6C A;  3LSS A;  2ZR3 A;  3JD1 A;  3UM7 A;  2IJJ A;  1KP3 A;  4UVB A;  1ORQ C;  3ZCC A;  1E1Q G;  2MK3 A;  2WSS G;  2Y69 C;  1BHB A;  1M9N A;  3CCM V;  4HYO A;  2X6B A;  5LGT A;  1JPX A;  1NVP D;  1YSC A;  5DM6 V;  1R6K A;  1FXK B;  4JF3 A;  4PDL A;  5J9P C;  3CC4 V;  4XDK A;  1S77 D;  1GM7 A;  4PDM A;  1M57 C;  2ZD9 A;  3X2Q B;  1QLE C;  2WWW A;  2JK5 C;  2Z3Y A;  5B1O A;  2IH1 C;  4QE7 A;  1JX9 A;  3T2M A;  3ZN0 A;  3OUF A;  1VQK V;  2DQ0 A;  4JTD B;  4P2Z A;  3ZMT A;  2EIL B;  1YIJ V;  2A9H A;  3TCU A;  5LHG A;  1RM1 B;  4Q20 A;  4EKW A;  4FPP A;  5L3B A;  4MVU A;  4U7N A;  1AJQ A;  1K4C C;  2ATK C;  3SYQ A;  5B1B C;  2LFR A;  1I5Y A;  3T4Z A;  3ABM C;  1KQS U;  2BOC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...