4PAUA

Hypothetical protein sa1058 from s. aureus.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
124
structure length
124
Chain Sequence
RRFQETLDKIRKEEGYDFAAIAFYESNKPSSPIKWHYVSGNKNNRFKLIILRKGRGLAGTVMKTGKRMVIANVGLALGPEEKIDYPILLSESLTAVLAVPLWYKNQVYGVLLFGQRDGRPLPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein A
publication title Hypothetical protein SA1058 from S. aureus.
rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 27
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pauA00
2VJWA 4BWIA 2VKSA 4Y5FA 2M7UA 3KSHA 4DN0A 4O8GA 5HL6A 2LB5A 2O9BA 4GLQA 2B18A 2W1RA 2W3GA 4G3VA 4ETZA 1F5MA 4Z1WA 3EEAA 5DFYA 5HSQA 4Q0IA 5K5BA 4O0PA 3KSFA 3IBJA 4G3WA 3S7QA 5DFXA 4LRXC 4DMZA 3S7PA 3S7NA 4YOFA 5I5LA 2W3HA 2KOIA 4IUHA 2OOLA 4GW9A 4Y3IA 2Y79A 3IBRA 4Y2FA 4FOFA 4ME4A 3NOTC 4EU0A 4LRZE 3E98A 1VHMA 5C5KA 2XROA 4G3KA 5LBRA 3G6OA 3MF0A 4PAUA 1YSPA 5L8MA 3VV4A 3K2NA 3KSIA 2LB9A 4ETXA 2M7VA 4IJGA 4IUKA 2QYBA 3HCYA 3O5YA 3CITA 2G7UA 3OOVA 3KSGA 4Q0HA 3NOPC 3ZQ5A 2KLIA 2GX5A 2HGVA 2O99A 3BJNA 3TRCA 4CQHA 3D3OA 2W3FA 1TF1A 2W1TA 1YKDA 3KO6A 5HPFA 2XRNA 2W3DA 2W3EA 5TJJA 3R4KA 2O9CA 2ZMFA 3NOUC 2K2NA 4O01A 3LFVA 4ZRRA 1MKMA 4EUVA 2VZWA 3MMHA 3CI6A 4MN7A 5HPIA 1MC0A 2O9AA 4MMNA 1YSQA 3RFBA 2K31A 2IA2A 3S7OA 4YNRA 1ZTUA 4LRYC 4R6LA 2W1TB 1STZA 2Y8HA 3C2WA 3DBAA 3E0YA 4E04A 4MCWA 3OBFA 2XSSA 3MQ0A 2VEAA 2O0YA 1TD5A 4Q0JA 3NHQA 4MDZA 4R70A 5AJGA 3W2ZA 4QPRA 4RQ9A
chains in the Genus database with same CATH superfamily
1ZKJA 3SW1A 4Y0OA 3SZTA 4AFIA 4KG2A 1ZHHB 4QY6A 3ZNTA 1CI9A 3DAVA 5E2EA 2INWA 2EFUA 4PMAA 2H0YA 5IS1A 4KZAA 2PD7A 4UAAA 4KZ7A 4EBLA 3P98A 1BT5A 3VOLA 3IF5A 1ALQA 3WS0A 1MZUA 2G2UA 2WKHA 2FH5A 4Y3IA 5M18A 5MC7A 3IX8A 2QPNA 3VP0A 4ZAMA 1NRJA 5DF9A 4WZ5A 1XX2A 4HEFA 2GNXA 3ZFZA 1K25A 4PAUA 4MN5A 4IJGA 2KX6A 1TS8A 1IEMA 3TOIA 3G4PA 3C7UA 2ZQAA 1PZPA 3PAGA 3NOPC 4L9FA 3ZCZA 3ZDJA 4OQGA 2EWVA 5G18A 1KE4A 3TRCA 4E3JA 4BBVA 5A92A 3S1YA 1H3QA 3LR5A 1TF1A 1WE4A 3E4QA 4A5RA 3FZCA 3Q81A 3VSLA 3C4OA 1SDNA 4Y15A 1N9BA 1L0GA 3GECA 2IA2A 5HAQA 3ZVTA 2VV6A 4LV3A 3PXPA 1BLHA 4MLLA 3R7WA 4GS9B 3OPRA 4DJ3A 5CHUA 1E4DA 5GHZA 5HDDA 4DDYA 2ZC4B 3UDFA 1ZG6A 2JKTM 4DN0A 5CERA 1DP9A 4IBRA 2V1BA 1BTLA 3TW8A 4WEKA 1DRMA 5AVEA 4X1MA 3HLGA 3OPLA 5GLCA 2VV8A 4OVDA 4R0QA 3A3JA 1PI4A 1FSYA 1P97A 4KQQA 2DRWA 4NKPA 4B4ZA 4QHCA 4LRZE 2HP9A 1OJ5A 4L9EA 2L4RA 2OV5A 2JKFA 3T4TA 5L8MA 2PRFA 4X68A 3KSIA 4ZJ1A 3W8KA 4K08A 5AQBA 3IQAA 4CLCE 4JXSA 1ESIA 3UO9A 3KSGA 1OPXA 4ID4A 1OT9A 4KG6A 5AQ7A 4U0XA 1K55C 2W3FA 4EERA 4GDNA 5CGWA 1ES4A 4S2KA 5TJJA 4OPYA 3NOUC 3LFVA 3N6IA 4MBHA 4MNRA 1YSQA 4IVIA 3H82B 3B3XA 3LI9A 4L0LA 3V67A 4UHUA 3C2WA 3VMAA 1ES3A 2ZOHA 5FI6A 3Q7VA 5F68A 1AXBA 2X71A 4NETA 5FEFA 4O8GA 5CGXA 1XJ2A 5HX9A 2XDMA 3EGDC 4XT2B 4JGPA 2V0UA 3IX4A 2Z6DA 4WLAA 4IBXA 2PR6A 4Q0IA 4ZJ2A 3PBOA 3P09A 3S7PA 4IUHA 3H7WA 4GW9A 4ESPA 3VE3A 3QHYA 5A8BA 4GHIB 1HTZA 3NOTC 1FCNA 4B93A 5EOEA 4QU3A 5J4EA 2WGWA 1I5QA 3BFDA 3FWLA 2XROA 5A93A 4IHQA 1KE3A 3IWIA 1CI8A 3LGOA 5EVIB 2V1ZA 3CMZA 4LV1A 3O5YA 4NG2A 4HQAA 3T4SA 1XPBA 1JVJA 1MWRA 3CPTA 1GA9A 1JNUA 3UDIA 3T4OA 3ZQ5A 1IYQA 2KLIA 4DF6A 1ES5A 4JF4A 5F83A 3O88A 3HBRA 4CPKA 1OTAA 4DKIA 4UA9A 3KO6A 3UB6A 1XA7A 3R4KA 3HJKA 4I3AA 5L10A 3OZHA 2XA7S 3FYZA 4NEED 3TE8A 3S7OA 4YNRA 2P7JA 5HD5A 2EA9A 5KSHA 3MKEA 2O0YA 2WKEA 3I7JA 4S2NC 4PM6A 3VP1A 4BWIA 3NULA 4Y5FA 3LIEA 2B95A 1XFQA 2QJ7A 2WAFA 3ZGAB 2VK3A 1O07A 2JKGA 3LEQA 1GHPA 1SKOB 2JBFA 3F1OA 1OTDA 5FQMA 4Z9QA 3VOYA 2ZL1A 4GD8A 4EU0A 4RVAA 4WL9A 2B02A 3E98A 4H6JA 1VHMA 4EEUA 2IWBA 2ZM0A 1Z6FA 4MBFA 2ZQCA 4OH0A 2JKRI 5FDHA 2JE5A 4CLCD 4GB7A 3HCYA 5FQQA 1GCEA 1S4SA 1WYCA 1K55A 1ERQA 3AGEA 3QP2A 1X0OA 4KQOA 4EEPA 5HL1A 2RCXA 2GJ3A 4OQHA 4E6WA 1XXMA 2HGVA 3D3OA 3NC8A 4HI4A 4C6YA 5GHXA 1IYOA 2V0WA 3DTMA 1YAXA 3NDGA 4BBTA 3BFGA 1P9WA 4OLGA 1OT6A 4M3KA 2EX9A 3GQZA 4PM7A 4EBNA 3V39A 1NXYA 2CC1A 2EX2A 1L2SA 2W1TB 1STZA 2WK0A 1TS6A 3MJQA 4P85A 3A3DA 4E04A 3FKVA 5U47A 1D06A 3T12B 5KSCA 2J9PA 3HLCA 3G30A 3BW6A 2XR0A 4K0XA 3C5AA 1PYYA 4C75A 2W1RA 4DXCA 3UB8A 3P01A 4CJNA 5GLAA 1YT4A 5FL3A 3OPHA 4WELA 2CMNA 2Y2OA 3RJUA 1FCMA 4X55A 3G35A 4FSFA 3C7VA 3LIFA 2KOIA 1Y28A 3CHWP 5J7EA 4HHDA 1EW0A 2P74A 3BFEA 1W8YA 2Y2NA 4KZ3A 4FTXA 4II7A 4YINA 3FC7A 2NUTC 3G6OA 4MN6A 1T1BA 2Y2QA 1XKZA 2YKHA 5FAOA 3F1PA 3GMWA 3VOZA 5EM0A 1FILA 2GDNA 2A3UA 3O86A 1HZOA 3N8SA 5G4ZA 1Q2QA 2XLNA 3BWLA 3V3RA 1V9YA 3LO7A 4BD0A 1KGFA 4WEJA 2WGIA 4QJGA 3BJNA 4BMWA 2VX8A 3HL9A 3ZG9B 4OQIA 2HJEA 1MKIA 3F1NB 1LI9A 4WYYA 3C8CA 1QMEA 2K2NA 4WMCD 2H28A 1MKMA 2ZC7A 4KZ9A 4MN7A 3PBNA 5HPIA 3ZHHA 4UA6A 1W79A 4PM8A 1H0MA 2NUPC 4S2NA 3IH9A 4CLCC 1S4RA 3ZG5A 4LPZA 2XA7M 3DBAA 5DTSA 1OTEA 3NJAA 3DW0A 5FI7A 1TVFA 3LIAA 4R70A 2K7SA 5FDSA 4O7DA 2PBYA 4E6XA 2VGLM 1K4FA 4KQRA 4B88A 2V9AA 3WS1A 1PWCA 3EWKA 4HP4A 2A24B 4BBUA 4KZ8A 2ACGA 2D01A 5TBMA 3IHBA 1V9ZA 4Y0UA 4R3JA 3HVFA 3LYXA 2JHEA 1ONGA 2ZM2A 3IX3A 3T1QB 4FH2A 3NBLA 3BQAA 5A91A 3CZDA 4D2OA 4OPQA 4ETXA 3KX0X 2PHYA 4EW7A 3P7NA 1K6SA 3PBTA 4IVKA 4LLOB 4KQDA 4NXEA 1YMSA 3KYEA 1UWPX 3Q7ZA 4K0WA 3QNBA 1VEUA 5HPFA 2P9VB 1OMEA 4HH2A 3CG5A 3S4XA 4ZRRA 2QWSA 4EUVA 1KE0A 5HFOA 1S0WA 1PFLA 2B5RA 1FR1A 1ZTUA 4HJ4A 3PAEA 1DP6A 1G6AA 1MWTA 1CEFA 3OCNA 3SH9A 3DTKA 2Y2PA 3NI9A 4NXGA 3OPPA 2XD5A 4BL3A 5HDSA 3DWZA 3IS2B 4HOIA 4ARZB 1AWIA 1GSWA 5DFXA 4F3LA 3S7NA 2EX8A 3HUOA 2V20A 5L09A 3NECA 3QP5A 3LY4A 2HZ5A 5FEGA 1T1CA 1I2WA 4RYEA 4JPMA 4JF6A 1D1JA 3WRTA 2ZC3B 3PYPA 3T1XA 3V5MA 2HDRA 4GOGA 3O87A 3SH7A 5AQAA 1SDEA 4S2MA 3WS5A 5FAQA 2ZMAA 3JVVA 2M1CA 3A0RA 5FQIA 3N7WA 5GLBA 2FFFB 1LSXA 4R4RA 4DJ2A 1PIOA 1W8QA 4NK3A 4Y7PA 1UGUA 1J3WA 2V8CA 2I9VA 4R1GA 1YKDA 3W4QA 3B47A 4ZBEA 2W3DA 3G32A 4CLCA 1QMFA 4LCLA 4WF0A 1G5UA 3PHYA 1VETA 3QP4A 4JGQA 4HBTA 5F1FA 2WZXA 4OOYA 1FQGA 1XP4A 4JBFA 5EVID 3NHQA 2EX6A 5DJTA 3VFHA 3EGXC 1S1ZA 3RXXA 2O9BA 5HW3A 1MBLA 2W3GA 2Y2HA 3GR2A 4RA7A 4KUKA 4O0PA 3KYZA 4PHTA 1DJCA 3DWKA 5JYOA 3BY8A 3GDIA 4FOFA 1MWUA 3BY9A 4PPRA 2P04A 1K0KA 1SHVA 3UB7A 5HWWA 2AVXA 1FCOA 2OLVA 4KZ5A 5HARA 2PU2A 5EE8A 4U3TA 2LB9A 3ZG7B 1K57A 2PAVP 3CJMA 4R38A 4EV4A 1YQSA 2WKQA 1CEGA 3CUEA 4Q0HA 5A90A 2ZQ7A 4Y13A 3FPWA 1OTBA 2WYXA 4KG5A 1KGEA 3LI8A 1BLCA 5DKKA 4CQHA 4KUOA 3T4JA 1HLUP 1N4OA 1LL9A 4NXFA 3BQ8A 4FCFA 1N9NA 1FIKA 1J9MA 3BECA 1KVLA 2XRNA 5CHMA 2ZBBA 2Z2MB 2OSUA 3HLFA 4BD1A 1GSXA 4DE2A 5EM1A 4EXOA 1F9IA 5CHJA 4Q8IA 3GSGA 4JF5A 3VFFA 2ZLYA 1ZC2A 4BLMA 3IF6B 3K3DA 3NCKA 1N9OA 4E3MA 3E0YA 3E2LA 3OBFA 1S67L 3MQQA 2DNSA 4R23A 3FV7A 3M6HA 4PKYA 3TSGA 4RQ9A 4N9LA 1S6RA 5E2HA 1L0EA 3KSHA 4WMCA 3D4FA 4B9OA 3T50A 1H5XA 1F5MA 4I3IA 5CTMA 3FKWA 2HV1A 2W27A 4GKUA 5DF8A 2IWDA 4JGOA 1BYWA 3ULFA 2VGLS 3W4PA 4DE0A 1MPLA 1PWGA 2QZ6A 3T4QA 4LCMA 1PW8A 5EVIC 3G2YA 1YLJA 4YWZA 2QHKA 1LSWA 3B33A 4I5SA 3UY6A 3LIDA 4BENA 3MSHA 5J3WA 2QMIA 3T4LA 4S2OA 1W63Q 1CQAA 3TG9A 3RTYA 2QYBA 2R9XA 1W63M 2BASA 1K4EA 2V2FF 4KZBA 3IXDA 4HH3A 4OQ0A 1ODVA 1MY8A 3OOVA 3PR6A 1A0KA 3UPOA 1GHMA 5EVLA 4M4XA 1SCWA 1K6RA 4HESA 4R4SA 4F94A 3T1SA 4WZ4A 3UMEA 4GCZA 1SZVA 5M1AA 2Y55A 4GS9A 4N9KA 4DE3A 2H10A 2OWHA 2HDSA 3CI6A 4NXBA 4HP9A 1IYPA 4P6ZM 2C6WB 5DJUA 2J3TD 1WYBA 4LRYC 2A2LA 1BLSA 5FATA 2QKPA 5M19A 4WN5A 3LIBA 4WM9A 4WUJA 1DJBA 2PD8A 1JWZA 5FQ9A 3UMDA 3UPPA 5E2GA 3H9WA 4PM9A 1PNEA 1NZOA 3BLSA 1YLWA 4ETZA 3LCEA 3Q82A 4EESA 1F2KA 2Z6CA 5HSQA 1W7FA 4QB8A 5DVAA 5GHYA 3R7WB 3C38A 5CEDA 4YFMA 2OAQ1 1K56D 4N92A 2PDRA 3MFDA 2ZOIA 4PKYG 1DJAA 5EV0A 3N4IA 4OOMA 1ERMA 3ZYTA 4ME4A 1RGZA 2V8FA 3LY3A 1YLTA 4MBKA 2EXBA 3VE4A 3N8LA 5CECA 3A3EA 3SS3A 1G28A 2Y91A 4E3LA 4L9GA 3HUNA 4DRTA 5EECA 3O3VA 4GJ4A 2V1AA 2XD1A 2JKRM 5AVFA 3TJZC 2J9OA 1S1YA 4QY5A 2G2WA 1VQQA 5FQJA 3H82A 2WAEA 1NRFA 1YLZA 3L7HA 1E25A 4JKTA 3CWFA 1NYYA 2A49A 4UA7A 4U0TA 2K31A 5FQKA 4BJPA 3SS4A 4XT2A 2VLGA 2H0TA 2P08A 3OLOA 4QPRA 2VKSA 3QNCA 4PM5A 1M40A 1PRQA 2XH9A 4GHIA 2R9WA 3EEHA 4Z1WA 5CGSA 3Q7VB 2JC7A 3G34A 3A3IA 1LL8A 2J3TC 4YOFA 5EVIA 5FSRA 3HLDA 2OOLA 4HBUA 5J8XA 3S22A 1EWZA 1NWZA 1VM1A 3GTCA 4X53A 3MQOA 2XK1A 3MF0A 3K2NA 2HP5A 4LV2A 1NZUA 3UNWA 2WKRA 3H7WB 3UDXA 1EI5A 2WGVA 5EOOA 2WGWB 1P9RA 3UE1A 5L2FA 2FZ0A 2WKIA 1FR6A 2UV0E 1O7EA 3HREA 5BOHA 3HLBA 4OONA 1Z09A 1I2SA 3CPTB 3C4PA 3MXQA 1PWDA 2XF3A 3MXRA 1KDSA 4EETB 3VP3A 4MMNA 2JN7A 1K57C 1GA0A 3LEZA 1T18A 3CAXA 1HD8A 1PI5A 3ZG0A 4EBPA 2JKTI 3CUEC 4P6BA 2ZQDA 3BYDA 3MQ0A 4MDZA 2HPBA 5TFQA 4HY8A 3SH8A 1SKOA 2XEPA 5DKLA 3LR4A 1CF0A 1XJ4A 2LB5A 5FI2A 4GLQA 5GLDA 4DDSA 3PBQA 5DFYA 2Y2LA 1H8YA 3EQUA 2X02A 3HJIA 4HJ3A 3IBJA 1K38A 2OLUA 3QP6A 1ZG4A 3V50A 4X56A 4I38A 3MZDA 4K91A 5CTNA 2BLSA 3VSKA 5C5KA 4FH4A 2UWXA 4OPZA 4G3KA 3WS2A 3MZEA 1YLPA 4N1HA 1XFNA 3N8RA 2ZD8A 1YSPA 3VV4A 3F1OB 2OAP1 5HWVA 3FPVA 5F6AA 3DTEA 1IKGA 2ZL1B 4H6JB 3BM6A 1W5DA 1VB6A 1XA1A 2GX5A 1TDGA 1P0ZA 4GZBA 2E8JA 3GRJA 4EQ1A 3OC2A 2W1TA 1K54A 3GV9A 1TS0A 3D9YA 2O9CA 2ZJ9A 4QWOA 1RCJA 2VZWA 1FSWA 2WADA 1N9LA 4R3BA 2O9AA 3LR3A 4JGRA 3BEBA 2QJ5A 5F5YA 2Y8HA 2E8IA 2XSSA 2BG1A 1TD5A 3E2KA 5AJGA 4P6ZS 3VP2A 4RX2A 4OKPA 2X01A 4I39A 5F1GA 3UE3A 3IXGA 5HL6A 2HF6A 2Q0OA 4E3IA 4G3VA 5F69A 3IWOA 3U4LP 4Y17A 4BQMA 2EFXA 2Q9MA 5HAPA 1JWPA 1Y54A 4DMZA 5FA7A 1WA9A 5EUAA 4IEDA 3C30A 1G6OA 1KOUA 2H5SA 2ZQ8A 1JWVA 1SKFA 5DTKA 2KDKA 2HJ9C 1BULA 1CK3A 5G4YA 4I3JA 1XGIA 1RP5A 2Z2LB 3UB5P 2M7VA 5CXWA 1K56A 5EPHA 3F1NA 2HP6A 4E3OA 1NY0A 1TS7A 2Y4AA 3ICYA 5JYPA 2OWJA 3E4PA 1E3UD 3UN7A 4DXBA 4UQIS 1LSVA 4ZDXA 3F1PB 3LUQA 2J80A 1JTGA 2WZZA 4MEZA 5GL9A 5F82A 1L0FA 1LT0A 1YPRA 4C3QA 4B4XA 3G31A 4WBGA 3LR0A 4FUWA 2Q9NA 2VGKA 1IYSA 1Q2PA 2PU4A 1L0DA 2J7VA 3WRZA 2VEAA 1YMXA 4QD4A 1BLPA 3IH8A 3W2ZA 2A24A 3HUMA 3VP4A 3MBZA 2M7UA 4HNBA 5EVEA 5FASA 4XUXA 4JXWA 5HAIA 4UEYA 1T19A 3EEAA 4HIAA 5K5BA 2VGJA 1NJ4A 1PZOA 3FG8A 3IHAA 3S7QA 4S2LA 2Y2IA 3A3FA 1EROA 1LHYA 2Y79A 2PBDP 4LENA 2HDQA 4OP5A 3MFXA 5DF7A 3UE0A 2D02A 2J8YA 3DTIA 1G68A 1OJGA 2PR5A 2VV7A 2DCFA 2ZMVA 5TBMB 4X6TA 3HLWA 1XJ6A 2P9VA 5HZHA 3K3CA 3W4OA 3MXSA 3PBSA 4X1LA 3M2JA 2Y2GA 3EOIA 4LGWA 2O99A 2BTFP 2J3WA 3UB9A 4GDBA 4OLDA 3D72A 3M2KA 1KDWA 5IT5A 3AGDA 3V3SA 1NLYA 1DY6A 1T1AA 4OOLA 2YKFA 4O01A 4ZJ3A 2ZMFA 3UPNA 3ZNYA 3IF6C 2VA0A 4JLFA 4KZ6A 1JTDA 5HWTA 1ESUA 1XGJA 3IS2A 5KIZA 2ZC5B 4RX3A 1H8MA 3ITBA 1VEUB 2Y2MA 4S2JA 4ARZA 1UWNX 1OTIA 5TR7A 3IWQA 3MKFA 3JVUA 1H8ZA 4GN2A 3Q07A 3WWXA 5TGFA 3UE6A 1LI0A 3NY4A 2C5WB 5CEBA 4E3NA 1PW1A 4D60A 2JCHA 2W0NA 3EQVA 4KENB 5HD3A 3KSFA 1TEMA 1ES2A 1KGGA 4H8RA 4JXVA 1ACFA 4XUZA 2W3HA 4OPRA 4P87A 2Y2JA 4OP8A 3HLEA 4E3KA 3IBRA 3BRMA 3T1RA 5LBRA 1MXOA 5L07A 4F3LB 3CLOA 1U60A 3QP8A 5KZHA 1GHIA 1BSGA 4IUKA 4WZ5C 3BLMA 3G2ZA 3MS6A 3CITA 1LLBA 2G7UA 1DP8A 4R3AA 2L1MA 3WS4A 3T4KA 1NLZA 5IU1A 1M6KA 4EUZA 5IHVA 5AQ9A 2Y2KA 5CRFA 4ZTKA 4UQIM 4Y0TA 4GD6A 5E2FA 2W3EA 3JYIA 2XFTA 4P0MA 4HJ6A 2IWCA 3MMHA 5EFWA 1Y4OA 1MC0A 2R78A 3RFBA 2L0WA 3B42A 4R6LA 1CJFA 2HDUA 4S2PA 3M6BA 1IFQA 3IXBA 4MCWA 3ITAA 4CLCB 2PYRA 3OCLA 2VJWA 2ZM8A 3KYQA 1GSVA 1VETB 5FAPA 2XFSA 3RH8B 1K54C 2XGNA 3JPUA 1IOUA 2PYPA 2B18A 3ZVWA 1C3BA 4EWFA 3QP1A 2GZAA 4G3WA 1IELA 5KMWA 1ONHA 1XJ3A 3Q1FA 4LRXC 4BL2A 5I5LA 4EQIA 2ZC6B 3AGFA 1RGYA 4FD8A 2DMWA 2I72A 3E4OA 4Y2FA 4JXGA 3IXHA 2RL3A 1D7EA 3NIAA 3LICA 2WUQA 1IKIA 1YLYA 3BFCA 5DTTA 4LV0A 1BZAA 1NYMA 4N1XA 4S2IA 3IT9A 2PT7A 3L9KA 5CX7A 3MR0A 2FFYA 4LFUA 2EXAA 4X25A 1TDLA 1KVMA 3U2AA 1S66L 1BUEA 2MJ6A 3A0SA 3SS5A 3IF6A 5HDCA 4XXRA 1LL5A 3BFFA 3ISGA 1YM1A 2Y59A 1FOFA 1F98A 3MZFA 5E43A 5I94A 2XQZA 3PTEA 3ZG8B 3GVBA 2EWWA 4X69A 3SOIA 2WKPA 2ZQ9A 4KZ4A 1HVBA 3A0VA 3PBRA 4DE1A 1E3UA 1MWSA 4GNUA 3NDEA 1L3LA 4Q0JA 5D3OA 3RXWA
chains in the Genus database with same CATH topology
3SW1A 4I39A 3KSHA 3BW6A 3UE3A 4AFIA 5HL6A 1ZHHB 2HF6A 4B9OA 2W1RA 3T50A 3UB8A 4G3VA 5F69A 3P01A 1F5MA 2INWA 4I3IA 5FL3A 2HV1A 2W27A 4WELA 2CMNA 5IS1A 2PD7A 4DMZA 4JGOA 4FSFA 1BYWA 1WA9A 3ULFA 3C30A 3LIFA 2KOIA 3VOLA 1Y28A 2VGLS 1G6OA 1KOUA 5J7EA 1MZUA 4HHDA 4Y3IA 2FH5A 5MC7A 2KDKA 1EW0A 3T4QA 2HJ9C 1NRJA 4II7A 5G4YA 4YWZA 5DF9A 2QHKA 3FC7A 4I3JA 1LSWA 3B33A 2NUTC 2GNXA 4I5SA 3G6OA 4MN6A 3LIDA 1T1BA 4PAUA 5J3WA 2YKHA 3T4LA 4MN5A 1W63Q 3F1PA 2M7VA 4IJGA 2KX6A 3RTYA 1TS8A 2QYBA 1W63M 2BASA 3F1NA 4HH3A 5G4ZA 1ODVA 3BWLA 3OOVA 1V9YA 1TS7A 3PR6A 3ICYA 4L9FA 3NOPC 2OWJA 3E4PA 4WEJA 4UQIS 4M4XA 2EWVA 1LSVA 3BJNA 3TRCA 4BBVA 4BMWA 1H3QA 3UMEA 2VX8A 3F1PB 3LUQA 2J80A 3LR5A 4GCZA 1TF1A 3E4QA 2HJEA 3F1NB 1LT0A 3C8CA 4GS9A 2K2NA 2H28A 1MKMA 2OWHA 3CI6A 4MN7A 3PBNA 5HPIA 4NXBA 4HP9A 4P6ZM 3LR0A 5DJUA 2J3TD 3GECA 2IA2A 2NUPC 4CLCC 4LRYC 2A2LA 2VV6A 3PXPA 2QKPA 1S4RA 4WN5A 4LPZA 2XA7M 3DBAA 3LIBA 4WUJA 1OTEA 2PD8A 2VEAA 3R7WA 4GS9B 3NJAA 3LIAA 4R70A 4DJ3A 3UMDA 3W2ZA 2A24A 2K7SA 5HDDA 2M7UA 4HNBA 3H9WA 2JKTM 4DN0A 1DP9A 2V1BA 2VGLM 4ETZA 3TW8A 2V9AA 4UEYA 4EESA 1T19A 2Z6CA 3EEAA 4HIAA 4WEKA 1DRMA 5AVEA 5HSQA 5K5BA 3R7WB 3C38A 3EWKA 3FG8A 4HP4A 2A24B 2OAQ1 3S7QA 4BBUA 2VV8A 2D01A 2PDRA 5TBMA 1V9ZA 2ZOIA 4PKYG 1P97A 4OOMA 4NKPA 3LYXA 2JHEA 3ZYTA 2Y79A 4ME4A 4LRZE 1OJ5A 4L9EA 3MFXA 2L4RA 3VE4A 2D02A 1OJGA 2PR5A 3BQAA 2VV7A 1G28A 3T4TA 5L8MA 2ZMVA 3KSIA 5TBMB 4ETXA 4K08A 3KX0X 2PHYA 4EW7A 1XJ6A 4CLCE 5HZHA 3K3CA 3P7NA 4L9GA 3PBTA 4GJ4A 2V1AA 3PBSA 2JKRM 5AVFA 3KSGA 1OPXA 3TJZC 1OT9A 4LLOB 1S1YA 3EOIA 4KQDA 4NXEA 3H82A 2O99A 2J3WA 3UB9A 3D72A 2W3FA 1UWPX 4EERA 5IT5A 5HPFA 4HH2A 1NLYA 4OOLA 1T1AA 3CWFA 2YKFA 5TJJA 4O01A 2ZMFA 3NOUC 3LFVA 2VA0A 4ZRRA 2QWSA 4EUVA 1YSQA 3H82B 2K31A 5HWTA 3LI9A 4L0LA 3IS2A 1ZTUA 4HJ4A 5KIZA 3V67A 4BJPA 2VLGA 4XT2A 1DP6A 1H8MA 2P08A 3C2WA 4ARZA 3OCNA 1UWNX 2ZOHA 5F68A 1OTIA 3OLOA 4QPRA 3JVUA 2VKSA 4NXGA 4O8GA 5HDSA 1XJ2A 3UE6A 3IS2B 4HOIA 3EGDC 4XT2B 4JGPA 2V0UA 4GHIA 4ARZB 2Z6DA 3EEHA 4WLAA 4Z1WA 2PR6A 1GSWA 4Q0IA 2W0NA 3EQVA 5HD3A 3KSFA 3PBOA 5DFXA 4F3LA 1LL8A 3S7PA 3S7NA 2J3TC 4YOFA 2W3HA 4IUHA 3H7WA 2OOLA 4GW9A 3VE3A 1T1CA 5A8BA 3IBRA 4GHIB 3NOTC 4B93A 5J4EA 1NWZA 2XROA 3PYPA 4IHQA 5LBRA 3MQOA 3MF0A 4F3LB 3K2NA 3CLOA 2WKRA 3H7WB 4IUKA 3O5YA 3CITA 3T4SA 4HQAA 3JVVA 2M1CA 2G7UA 3A0RA 1DP8A 1P9RA 4R3AA 1JNUA 3T4OA 3ZQ5A 2KLIA 2L1MA 2FZ0A 3T4KA 1NLZA 1LSXA 5IU1A 4DJ2A 1OTAA 1UGUA 2I9VA 4UQIM 1YKDA 3KO6A 3UB6A 3B47A 2W3DA 2W3EA 3R4KA 3HJKA 3MXQA 4CLCA 4I3AA 4HJ6A 3MMHA 5EFWA 4EETB 1MC0A 4WF0A 2R78A 3PHYA 4MMNA 2JN7A 3RFBA 2XA7S 4NEED 4JGQA 1T18A 3TE8A 3CAXA 3S7OA 2L0WA 4YNRA 3B42A 2P7JA 4R6LA 5HD5A 2EA9A 1IFQA 2JKTI 5KSHA 3CUEC 4MCWA 3MQ0A 2O0YA 4CLCB 3NHQA 4MDZA 4HY8A 2PYRA 5DJTA 3OCLA 2VJWA 4BWIA 4Y5FA 3KYQA 1GSVA 5DKLA 3EGXC 3LIEA 3RH8B 3LR4A 1XJ4A 1S1ZA 1XFQA 2LB5A 2O9BA 2QJ7A 4GLQA 1IOUA 2PYPA 2B18A 2W3GA 3PBQA 5DFYA 4KUKA 4O0PA 3KYZA 3EQUA 4PHTA 2GZAA 3HJIA 4HJ3A 3IBJA 4G3WA 1XJ3A 4LRXC 3F1OA 5I5LA 1OTDA 2DMWA 4I38A 3BY8A 3E4OA 3GDIA 4Y2FA 4FOFA 4EU0A 4WL9A 2B02A 3BY9A 3E98A 4H6JA 1VHMA 1D7EA 5C5KA 4EEUA 2P04A 3LICA 4G3KA 3UB7A 5HWWA 1XFNA 1YSPA 3VV4A 3F1OB 2JKRI 2LB9A 2OAP1 5HWVA 3FPVA 4CLCD 2PT7A 5CX7A 3HCYA 3MR0A 5F6AA 4R38A 1S4SA 2WKQA 4H6JB 3CUEA 1VB6A 3U2AA 4Q0HA 1X0OA 4KQOA 1S66L 3FPWA 1OTBA 4EEPA 2GX5A 3LI8A 2GJ3A 1P0ZA 2MJ6A 5DKKA 2HGVA 3A0SA 4KUOA 4CQHA 3T4JA 3D3OA 4HI4A 5HDCA 4NXFA 3BQ8A 4EQ1A 3OC2A 1N9NA 2W1TA 1F98A 2XRNA 1TS0A 2V0WA 2ZBBA 1YAXA 2EWWA 2O9CA 4BBTA 2WKPA 1GSXA 2VZWA 1P9WA 4EXOA 1N9LA 1OT6A 1F9IA 2O9AA 3LR3A 4JGRA 3A0VA 3PBRA 3K3DA 2QJ5A 5F5YA 2W1TB 1STZA 1N9OA 2Y8HA 1TS6A 3MJQA 3E0YA 4E04A 3OBFA 2XSSA 1S67L 3MQQA 1TD5A 4Q0JA 5AJGA 4PKYA 1D06A 4RQ9A 4P6ZS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJW A;  4BWI A;  2VKS A;  4Y5F A;  2M7U A;  3KSH A;  4DN0 A;  4O8G A;  5HL6 A;  2LB5 A;  2O9B A;  4GLQ A;  2B18 A;  2W1R A;  2W3G A;  4G3V A;  4ETZ A;  1F5M A;  4Z1W A;  3EEA A;  5DFY A;  5HSQ A;  4Q0I A;  5K5B A;  4O0P A;  3KSF A;  3IBJ A;  4G3W A;  3S7Q A;  5DFX A;  4LRX C;  4DMZ A;  3S7P A;  3S7N A;  4YOF A;  5I5L A;  2W3H A;  2KOI A;  4IUH A;  2OOL A;  4GW9 A;  4Y3I A;  2Y79 A;  3IBR A;  4Y2F A;  4FOF A;  4ME4 A;  3NOT C;  4EU0 A;  4LRZ E;  3E98 A;  1VHM A;  5C5K A;  2XRO A;  4G3K A;  5LBR A;  3G6O A;  3MF0 A;  4PAU A;  1YSP A;  5L8M A;  3VV4 A;  3K2N A;  3KSI A;  2LB9 A;  4ETX A;  2M7V A;  4IJG A;  4IUK A;  2QYB A;  3HCY A;  3O5Y A;  3CIT A;  2G7U A;  3OOV A;  3KSG A;  4Q0H A;  3NOP C;  3ZQ5 A;  2KLI A;  2GX5 A;  2HGV A;  2O99 A;  3BJN A;  3TRC A;  4CQH A;  3D3O A;  2W3F A;  1TF1 A;  2W1T A;  1YKD A;  3KO6 A;  5HPF A;  2XRN A;  2W3D A;  2W3E A;  5TJJ A;  3R4K A;  2O9C A;  2ZMF A;  3NOU C;  2K2N A;  4O01 A;  3LFV A;  4ZRR A;  1MKM A;  4EUV A;  2VZW A;  3MMH A;  3CI6 A;  4MN7 A;  5HPI A;  1MC0 A;  2O9A A;  4MMN A;  1YSQ A;  3RFB A;  2K31 A;  2IA2 A;  3S7O A;  4YNR A;  1ZTU A;  4LRY C;  4R6L A;  2W1T B;  1STZ A;  2Y8H A;  3C2W A;  3DBA A;  3E0Y A;  4E04 A;  4MCW A;  3OBF A;  2XSS A;  3MQ0 A;  2VEA A;  2O0Y A;  1TD5 A;  4Q0J A;  3NHQ A;  4MDZ A;  4R70 A;  5AJG A;  3W2Z A;  4QPR A;  4RQ9 A; 
#chains in the Genus database with same CATH topology
 1ZKJ A;  3SW1 A;  4Y0O A;  3SZT A;  4AFI A;  4KG2 A;  1ZHH B;  4QY6 A;  3ZNT A;  1CI9 A;  3DAV A;  5E2E A;  2INW A;  2EFU A;  4PMA A;  2H0Y A;  5IS1 A;  4KZA A;  2PD7 A;  4UAA A;  4KZ7 A;  4EBL A;  3P98 A;  1BT5 A;  3VOL A;  3IF5 A;  1ALQ A;  3WS0 A;  1MZU A;  2G2U A;  2WKH A;  2FH5 A;  4Y3I A;  5M18 A;  5MC7 A;  3IX8 A;  2QPN A;  3VP0 A;  4ZAM A;  1NRJ A;  5DF9 A;  4WZ5 A;  1XX2 A;  4HEF A;  2GNX A;  3ZFZ A;  1K25 A;  4PAU A;  4MN5 A;  4IJG A;  2KX6 A;  1TS8 A;  1IEM A;  3TOI A;  3G4P A;  3C7U A;  2ZQA A;  1PZP A;  3PAG A;  3NOP C;  4L9F A;  3ZCZ A;  3ZDJ A;  4OQG A;  2EWV A;  5G18 A;  1KE4 A;  3TRC A;  4E3J A;  4BBV A;  5A92 A;  3S1Y A;  1H3Q A;  3LR5 A;  1TF1 A;  1WE4 A;  3E4Q A;  4A5R A;  3FZC A;  3Q81 A;  3VSL A;  3C4O A;  1SDN A;  4Y15 A;  1N9B A;  1L0G A;  3GEC A;  2IA2 A;  5HAQ A;  3ZVT A;  2VV6 A;  4LV3 A;  3PXP A;  1BLH A;  4MLL A;  3R7W A;  4GS9 B;  3OPR A;  4DJ3 A;  5CHU A;  1E4D A;  5GHZ A;  5HDD A;  4DDY A;  2ZC4 B;  3UDF A;  1ZG6 A;  2JKT M;  4DN0 A;  5CER A;  1DP9 A;  4IBR A;  2V1B A;  1BTL A;  3TW8 A;  4WEK A;  1DRM A;  5AVE A;  4X1M A;  3HLG A;  3OPL A;  5GLC A;  2VV8 A;  4OVD A;  4R0Q A;  3A3J A;  1PI4 A;  1FSY A;  1P97 A;  4KQQ A;  2DRW A;  4NKP A;  4B4Z A;  4QHC A;  4LRZ E;  2HP9 A;  1OJ5 A;  4L9E A;  2L4R A;  2OV5 A;  2JKF A;  3T4T A;  5L8M A;  2PRF A;  4X68 A;  3KSI A;  4ZJ1 A;  3W8K A;  4K08 A;  5AQB A;  3IQA A;  4CLC E;  4JXS A;  1ESI A;  3UO9 A;  3KSG A;  1OPX A;  4ID4 A;  1OT9 A;  4KG6 A;  5AQ7 A;  4U0X A;  1K55 C;  2W3F A;  4EER A;  4GDN A;  5CGW A;  1ES4 A;  4S2K A;  5TJJ A;  4OPY A;  3NOU C;  3LFV A;  3N6I A;  4MBH A;  4MNR A;  1YSQ A;  4IVI A;  3H82 B;  3B3X A;  3LI9 A;  4L0L A;  3V67 A;  4UHU A;  3C2W A;  3VMA A;  1ES3 A;  2ZOH A;  5FI6 A;  3Q7V A;  5F68 A;  1AXB A;  2X71 A;  4NET A;  5FEF A;  4O8G A;  5CGX A;  1XJ2 A;  5HX9 A;  2XDM A;  3EGD C;  4XT2 B;  4JGP A;  2V0U A;  3IX4 A;  2Z6D A;  4WLA A;  4IBX A;  2PR6 A;  4Q0I A;  4ZJ2 A;  3PBO A;  3P09 A;  3S7P A;  4IUH A;  3H7W A;  4GW9 A;  4ESP A;  3VE3 A;  3QHY A;  5A8B A;  4GHI B;  1HTZ A;  3NOT C;  1FCN A;  4B93 A;  5EOE A;  4QU3 A;  5J4E A;  2WGW A;  1I5Q A;  3BFD A;  3FWL A;  2XRO A;  5A93 A;  4IHQ A;  1KE3 A;  3IWI A;  1CI8 A;  3LGO A;  5EVI B;  2V1Z A;  3CMZ A;  4LV1 A;  3O5Y A;  4NG2 A;  4HQA A;  3T4S A;  1XPB A;  1JVJ A;  1MWR A;  3CPT A;  1GA9 A;  1JNU A;  3UDI A;  3T4O A;  3ZQ5 A;  1IYQ A;  2KLI A;  4DF6 A;  1ES5 A;  4JF4 A;  5F83 A;  3O88 A;  3HBR A;  4CPK A;  1OTA A;  4DKI A;  4UA9 A;  3KO6 A;  3UB6 A;  1XA7 A;  3R4K A;  3HJK A;  4I3A A;  5L10 A;  3OZH A;  2XA7 S;  3FYZ A;  4NEE D;  3TE8 A;  3S7O A;  4YNR A;  2P7J A;  5HD5 A;  2EA9 A;  5KSH A;  3MKE A;  2O0Y A;  2WKE A;  3I7J A;  4S2N C;  4PM6 A;  3VP1 A;  4BWI A;  3NUL A;  4Y5F A;  3LIE A;  2B95 A;  1XFQ A;  2QJ7 A;  2WAF A;  3ZGA B;  2VK3 A;  1O07 A;  2JKG A;  3LEQ A;  1GHP A;  1SKO B;  2JBF A;  3F1O A;  1OTD A;  5FQM A;  4Z9Q A;  3VOY A;  2ZL1 A;  4GD8 A;  4EU0 A;  4RVA A;  4WL9 A;  2B02 A;  3E98 A;  4H6J A;  1VHM A;  4EEU A;  2IWB A;  2ZM0 A;  1Z6F A;  4MBF A;  2ZQC A;  4OH0 A;  2JKR I;  5FDH A;  2JE5 A;  4CLC D;  4GB7 A;  3HCY A;  5FQQ A;  1GCE A;  1S4S A;  1WYC A;  1K55 A;  1ERQ A;  3AGE A;  3QP2 A;  1X0O A;  4KQO A;  4EEP A;  5HL1 A;  2RCX A;  2GJ3 A;  4OQH A;  4E6W A;  1XXM A;  2HGV A;  3D3O A;  3NC8 A;  4HI4 A;  4C6Y A;  5GHX A;  1IYO A;  2V0W A;  3DTM A;  1YAX A;  3NDG A;  4BBT A;  3BFG A;  1P9W A;  4OLG A;  1OT6 A;  4M3K A;  2EX9 A;  3GQZ A;  4PM7 A;  4EBN A;  3V39 A;  1NXY A;  2CC1 A;  2EX2 A;  1L2S A;  2W1T B;  1STZ A;  2WK0 A;  1TS6 A;  3MJQ A;  4P85 A;  3A3D A;  4E04 A;  3FKV A;  5U47 A;  1D06 A;  3T12 B;  5KSC A;  2J9P A;  3HLC A;  3G30 A;  3BW6 A;  2XR0 A;  4K0X A;  3C5A A;  1PYY A;  4C75 A;  2W1R A;  4DXC A;  3UB8 A;  3P01 A;  4CJN A;  5GLA A;  1YT4 A;  5FL3 A;  3OPH A;  4WEL A;  2CMN A;  2Y2O A;  3RJU A;  1FCM A;  4X55 A;  3G35 A;  4FSF A;  3C7V A;  3LIF A;  2KOI A;  1Y28 A;  3CHW P;  5J7E A;  4HHD A;  1EW0 A;  2P74 A;  3BFE A;  1W8Y A;  2Y2N A;  4KZ3 A;  4FTX A;  4II7 A;  4YIN A;  3FC7 A;  2NUT C;  3G6O A;  4MN6 A;  1T1B A;  2Y2Q A;  1XKZ A;  2YKH A;  5FAO A;  3F1P A;  3GMW A;  3VOZ A;  5EM0 A;  1FIL A;  2GDN A;  2A3U A;  3O86 A;  1HZO A;  3N8S A;  5G4Z A;  1Q2Q A;  2XLN A;  3BWL A;  3V3R A;  1V9Y A;  3LO7 A;  4BD0 A;  1KGF A;  4WEJ A;  2WGI A;  4QJG A;  3BJN A;  4BMW A;  2VX8 A;  3HL9 A;  3ZG9 B;  4OQI A;  2HJE A;  1MKI A;  3F1N B;  1LI9 A;  4WYY A;  3C8C A;  1QME A;  2K2N A;  4WMC D;  2H28 A;  1MKM A;  2ZC7 A;  4KZ9 A;  4MN7 A;  3PBN A;  5HPI A;  3ZHH A;  4UA6 A;  1W79 A;  4PM8 A;  1H0M A;  2NUP C;  4S2N A;  3IH9 A;  4CLC C;  1S4R A;  3ZG5 A;  4LPZ A;  2XA7 M;  3DBA A;  5DTS A;  1OTE A;  3NJA A;  3DW0 A;  5FI7 A;  1TVF A;  3LIA A;  4R70 A;  2K7S A;  5FDS A;  4O7D A;  2PBY A;  4E6X A;  2VGL M;  1K4F A;  4KQR A;  4B88 A;  2V9A A;  3WS1 A;  1PWC A;  3EWK A;  4HP4 A;  2A24 B;  4BBU A;  4KZ8 A;  2ACG A;  2D01 A;  5TBM A;  3IHB A;  1V9Z A;  4Y0U A;  4R3J A;  3HVF A;  3LYX A;  2JHE A;  1ONG A;  2ZM2 A;  3IX3 A;  3T1Q B;  4FH2 A;  3NBL A;  3BQA A;  5A91 A;  3CZD A;  4D2O A;  4OPQ A;  4ETX A;  3KX0 X;  2PHY A;  4EW7 A;  3P7N A;  1K6S A;  3PBT A;  4IVK A;  4LLO B;  4KQD A;  4NXE A;  1YMS A;  3KYE A;  1UWP X;  3Q7Z A;  4K0W A;  3QNB A;  1VEU A;  5HPF A;  2P9V B;  1OME A;  4HH2 A;  3CG5 A;  3S4X A;  4ZRR A;  2QWS A;  4EUV A;  1KE0 A;  5HFO A;  1S0W A;  1PFL A;  2B5R A;  1FR1 A;  1ZTU A;  4HJ4 A;  3PAE A;  1DP6 A;  1G6A A;  1MWT A;  1CEF A;  3OCN A;  3SH9 A;  3DTK A;  2Y2P A;  3NI9 A;  4NXG A;  3OPP A;  2XD5 A;  4BL3 A;  5HDS A;  3DWZ A;  3IS2 B;  4HOI A;  4ARZ B;  1AWI A;  1GSW A;  5DFX A;  4F3L A;  3S7N A;  2EX8 A;  3HUO A;  2V20 A;  5L09 A;  3NEC A;  3QP5 A;  3LY4 A;  2HZ5 A;  5FEG A;  1T1C A;  1I2W A;  4RYE A;  4JPM A;  4JF6 A;  1D1J A;  3WRT A;  2ZC3 B;  3PYP A;  3T1X A;  3V5M A;  2HDR A;  4GOG A;  3O87 A;  3SH7 A;  5AQA A;  1SDE A;  4S2M A;  3WS5 A;  5FAQ A;  2ZMA A;  3JVV A;  2M1C A;  3A0R A;  5FQI A;  3N7W A;  5GLB A;  2FFF B;  1LSX A;  4R4R A;  4DJ2 A;  1PIO A;  1W8Q A;  4NK3 A;  4Y7P A;  1UGU A;  1J3W A;  2V8C A;  2I9V A;  4R1G A;  1YKD A;  3W4Q A;  3B47 A;  4ZBE A;  2W3D A;  3G32 A;  4CLC A;  1QMF A;  4LCL A;  4WF0 A;  1G5U A;  3PHY A;  1VET A;  3QP4 A;  4JGQ A;  4HBT A;  5F1F A;  2WZX A;  4OOY A;  1FQG A;  1XP4 A;  4JBF A;  5EVI D;  3NHQ A;  2EX6 A;  5DJT A;  3VFH A;  3EGX C;  1S1Z A;  3RXX A;  2O9B A;  5HW3 A;  1MBL A;  2W3G A;  2Y2H A;  3GR2 A;  4RA7 A;  4KUK A;  4O0P A;  3KYZ A;  4PHT A;  1DJC A;  3DWK A;  5JYO A;  3BY8 A;  3GDI A;  4FOF A;  1MWU A;  3BY9 A;  4PPR A;  2P04 A;  1K0K A;  1SHV A;  3UB7 A;  5HWW A;  2AVX A;  1FCO A;  2OLV A;  4KZ5 A;  5HAR A;  2PU2 A;  5EE8 A;  4U3T A;  2LB9 A;  3ZG7 B;  1K57 A;  2PAV P;  3CJM A;  4R38 A;  4EV4 A;  1YQS A;  2WKQ A;  1CEG A;  3CUE A;  4Q0H A;  5A90 A;  2ZQ7 A;  4Y13 A;  3FPW A;  1OTB A;  2WYX A;  4KG5 A;  1KGE A;  3LI8 A;  1BLC A;  5DKK A;  4CQH A;  4KUO A;  3T4J A;  1HLU P;  1N4O A;  1LL9 A;  4NXF A;  3BQ8 A;  4FCF A;  1N9N A;  1FIK A;  1J9M A;  3BEC A;  1KVL A;  2XRN A;  5CHM A;  2ZBB A;  2Z2M B;  2OSU A;  3HLF A;  4BD1 A;  1GSX A;  4DE2 A;  5EM1 A;  4EXO A;  1F9I A;  5CHJ A;  4Q8I A;  3GSG A;  4JF5 A;  3VFF A;  2ZLY A;  1ZC2 A;  4BLM A;  3IF6 B;  3K3D A;  3NCK A;  1N9O A;  4E3M A;  3E0Y A;  3E2L A;  3OBF A;  1S67 L;  3MQQ A;  2DNS A;  4R23 A;  3FV7 A;  3M6H A;  4PKY A;  3TSG A;  4RQ9 A;  4N9L A;  1S6R A;  5E2H A;  1L0E A;  3KSH A;  4WMC A;  3D4F A;  4B9O A;  3T50 A;  1H5X A;  1F5M A;  4I3I A;  5CTM A;  3FKW A;  2HV1 A;  2W27 A;  4GKU A;  5DF8 A;  2IWD A;  4JGO A;  1BYW A;  3ULF A;  2VGL S;  3W4P A;  4DE0 A;  1MPL A;  1PWG A;  2QZ6 A;  3T4Q A;  4LCM A;  1PW8 A;  5EVI C;  3G2Y A;  1YLJ A;  4YWZ A;  2QHK A;  1LSW A;  3B33 A;  4I5S A;  3UY6 A;  3LID A;  4BEN A;  3MSH A;  5J3W A;  2QMI A;  3T4L A;  4S2O A;  1W63 Q;  1CQA A;  3TG9 A;  3RTY A;  2QYB A;  2R9X A;  1W63 M;  2BAS A;  1K4E A;  2V2F F;  4KZB A;  3IXD A;  4HH3 A;  4OQ0 A;  1ODV A;  1MY8 A;  3OOV A;  3PR6 A;  1A0K A;  3UPO A;  1GHM A;  5EVL A;  4M4X A;  1SCW A;  1K6R A;  4HES A;  4R4S A;  4F94 A;  3T1S A;  4WZ4 A;  3UME A;  4GCZ A;  1SZV A;  5M1A A;  2Y55 A;  4GS9 A;  4N9K A;  4DE3 A;  2H10 A;  2OWH A;  2HDS A;  3CI6 A;  4NXB A;  4HP9 A;  1IYP A;  4P6Z M;  2C6W B;  5DJU A;  2J3T D;  1WYB A;  4LRY C;  2A2L A;  1BLS A;  5FAT A;  2QKP A;  5M19 A;  4WN5 A;  3LIB A;  4WM9 A;  4WUJ A;  1DJB A;  2PD8 A;  1JWZ A;  5FQ9 A;  3UMD A;  3UPP A;  5E2G A;  3H9W A;  4PM9 A;  1PNE A;  1NZO A;  3BLS A;  1YLW A;  4ETZ A;  3LCE A;  3Q82 A;  4EES A;  1F2K A;  2Z6C A;  5HSQ A;  1W7F A;  4QB8 A;  5DVA A;  5GHY A;  3R7W B;  3C38 A;  5CED A;  4YFM A;  2OAQ 1;  1K56 D;  4N92 A;  2PDR A;  3MFD A;  2ZOI A;  4PKY G;  1DJA A;  5EV0 A;  3N4I A;  4OOM A;  1ERM A;  3ZYT A;  4ME4 A;  1RGZ A;  2V8F A;  3LY3 A;  1YLT A;  4MBK A;  2EXB A;  3VE4 A;  3N8L A;  5CEC A;  3A3E A;  3SS3 A;  1G28 A;  2Y91 A;  4E3L A;  4L9G A;  3HUN A;  4DRT A;  5EEC A;  3O3V A;  4GJ4 A;  2V1A A;  2XD1 A;  2JKR M;  5AVF A;  3TJZ C;  2J9O A;  1S1Y A;  4QY5 A;  2G2W A;  1VQQ A;  5FQJ A;  3H82 A;  2WAE A;  1NRF A;  1YLZ A;  3L7H A;  1E25 A;  4JKT A;  3CWF A;  1NYY A;  2A49 A;  4UA7 A;  4U0T A;  2K31 A;  5FQK A;  4BJP A;  3SS4 A;  4XT2 A;  2VLG A;  2H0T A;  2P08 A;  3OLO A;  4QPR A;  2VKS A;  3QNC A;  4PM5 A;  1M40 A;  1PRQ A;  2XH9 A;  4GHI A;  2R9W A;  3EEH A;  4Z1W A;  5CGS A;  3Q7V B;  2JC7 A;  3G34 A;  3A3I A;  1LL8 A;  2J3T C;  4YOF A;  5EVI A;  5FSR A;  3HLD A;  2OOL A;  4HBU A;  5J8X A;  3S22 A;  1EWZ A;  1NWZ A;  1VM1 A;  3GTC A;  4X53 A;  3MQO A;  2XK1 A;  3MF0 A;  3K2N A;  2HP5 A;  4LV2 A;  1NZU A;  3UNW A;  2WKR A;  3H7W B;  3UDX A;  1EI5 A;  2WGV A;  5EOO A;  2WGW B;  1P9R A;  3UE1 A;  5L2F A;  2FZ0 A;  2WKI A;  1FR6 A;  2UV0 E;  1O7E A;  3HRE A;  5BOH A;  3HLB A;  4OON A;  1Z09 A;  1I2S A;  3CPT B;  3C4P A;  3MXQ A;  1PWD A;  2XF3 A;  3MXR A;  1KDS A;  4EET B;  3VP3 A;  4MMN A;  2JN7 A;  1K57 C;  1GA0 A;  3LEZ A;  1T18 A;  3CAX A;  1HD8 A;  1PI5 A;  3ZG0 A;  4EBP A;  2JKT I;  3CUE C;  4P6B A;  2ZQD A;  3BYD A;  3MQ0 A;  4MDZ A;  2HPB A;  5TFQ A;  4HY8 A;  3SH8 A;  1SKO A;  2XEP A;  5DKL A;  3LR4 A;  1CF0 A;  1XJ4 A;  2LB5 A;  5FI2 A;  4GLQ A;  5GLD A;  4DDS A;  3PBQ A;  5DFY A;  2Y2L A;  1H8Y A;  3EQU A;  2X02 A;  3HJI A;  4HJ3 A;  3IBJ A;  1K38 A;  2OLU A;  3QP6 A;  1ZG4 A;  3V50 A;  4X56 A;  4I38 A;  3MZD A;  4K91 A;  5CTN A;  2BLS A;  3VSK A;  5C5K A;  4FH4 A;  2UWX A;  4OPZ A;  4G3K A;  3WS2 A;  3MZE A;  1YLP A;  4N1H A;  1XFN A;  3N8R A;  2ZD8 A;  1YSP A;  3VV4 A;  3F1O B;  2OAP 1;  5HWV A;  3FPV A;  5F6A A;  3DTE A;  1IKG A;  2ZL1 B;  4H6J B;  3BM6 A;  1W5D A;  1VB6 A;  1XA1 A;  2GX5 A;  1TDG A;  1P0Z A;  4GZB A;  2E8J A;  3GRJ A;  4EQ1 A;  3OC2 A;  2W1T A;  1K54 A;  3GV9 A;  1TS0 A;  3D9Y A;  2O9C A;  2ZJ9 A;  4QWO A;  1RCJ A;  2VZW A;  1FSW A;  2WAD A;  1N9L A;  4R3B A;  2O9A A;  3LR3 A;  4JGR A;  3BEB A;  2QJ5 A;  5F5Y A;  2Y8H A;  2E8I A;  2XSS A;  2BG1 A;  1TD5 A;  3E2K A;  5AJG A;  4P6Z S;  3VP2 A;  4RX2 A;  4OKP A;  2X01 A;  4I39 A;  5F1G A;  3UE3 A;  3IXG A;  5HL6 A;  2HF6 A;  2Q0O A;  4E3I A;  4G3V A;  5F69 A;  3IWO A;  3U4L P;  4Y17 A;  4BQM A;  2EFX A;  2Q9M A;  5HAP A;  1JWP A;  1Y54 A;  4DMZ A;  5FA7 A;  1WA9 A;  5EUA A;  4IED A;  3C30 A;  1G6O A;  1KOU A;  2H5S A;  2ZQ8 A;  1JWV A;  1SKF A;  5DTK A;  2KDK A;  2HJ9 C;  1BUL A;  1CK3 A;  5G4Y A;  4I3J A;  1XGI A;  1RP5 A;  2Z2L B;  3UB5 P;  2M7V A;  5CXW A;  1K56 A;  5EPH A;  3F1N A;  2HP6 A;  4E3O A;  1NY0 A;  1TS7 A;  2Y4A A;  3ICY A;  5JYP A;  2OWJ A;  3E4P A;  1E3U D;  3UN7 A;  4DXB A;  4UQI S;  1LSV A;  4ZDX A;  3F1P B;  3LUQ A;  2J80 A;  1JTG A;  2WZZ A;  4MEZ A;  5GL9 A;  5F82 A;  1L0F A;  1LT0 A;  1YPR A;  4C3Q A;  4B4X A;  3G31 A;  4WBG A;  3LR0 A;  4FUW A;  2Q9N A;  2VGK A;  1IYS A;  1Q2P A;  2PU4 A;  1L0D A;  2J7V A;  3WRZ A;  2VEA A;  1YMX A;  4QD4 A;  1BLP A;  3IH8 A;  3W2Z A;  2A24 A;  3HUM A;  3VP4 A;  3MBZ A;  2M7U A;  4HNB A;  5EVE A;  5FAS A;  4XUX A;  4JXW A;  5HAI A;  4UEY A;  1T19 A;  3EEA A;  4HIA A;  5K5B A;  2VGJ A;  1NJ4 A;  1PZO A;  3FG8 A;  3IHA A;  3S7Q A;  4S2L A;  2Y2I A;  3A3F A;  1ERO A;  1LHY A;  2Y79 A;  2PBD P;  4LEN A;  2HDQ A;  4OP5 A;  3MFX A;  5DF7 A;  3UE0 A;  2D02 A;  2J8Y A;  3DTI A;  1G68 A;  1OJG A;  2PR5 A;  2VV7 A;  2DCF A;  2ZMV A;  5TBM B;  4X6T A;  3HLW A;  1XJ6 A;  2P9V A;  5HZH A;  3K3C A;  3W4O A;  3MXS A;  3PBS A;  4X1L A;  3M2J A;  2Y2G A;  3EOI A;  4LGW A;  2O99 A;  2BTF P;  2J3W A;  3UB9 A;  4GDB A;  4OLD A;  3D72 A;  3M2K A;  1KDW A;  5IT5 A;  3AGD A;  3V3S A;  1NLY A;  1DY6 A;  1T1A A;  4OOL A;  2YKF A;  4O01 A;  4ZJ3 A;  2ZMF A;  3UPN A;  3ZNY A;  3IF6 C;  2VA0 A;  4JLF A;  4KZ6 A;  1JTD A;  5HWT A;  1ESU A;  1XGJ A;  3IS2 A;  5KIZ A;  2ZC5 B;  4RX3 A;  1H8M A;  3ITB A;  1VEU B;  2Y2M A;  4S2J A;  4ARZ A;  1UWN X;  1OTI A;  5TR7 A;  3IWQ A;  3MKF A;  3JVU A;  1H8Z A;  4GN2 A;  3Q07 A;  3WWX A;  5TGF A;  3UE6 A;  1LI0 A;  3NY4 A;  2C5W B;  5CEB A;  4E3N A;  1PW1 A;  4D60 A;  2JCH A;  2W0N A;  3EQV A;  4KEN B;  5HD3 A;  3KSF A;  1TEM A;  1ES2 A;  1KGG A;  4H8R A;  4JXV A;  1ACF A;  4XUZ A;  2W3H A;  4OPR A;  4P87 A;  2Y2J A;  4OP8 A;  3HLE A;  4E3K A;  3IBR A;  3BRM A;  3T1R A;  5LBR A;  1MXO A;  5L07 A;  4F3L B;  3CLO A;  1U60 A;  3QP8 A;  5KZH A;  1GHI A;  1BSG A;  4IUK A;  4WZ5 C;  3BLM A;  3G2Z A;  3MS6 A;  3CIT A;  1LLB A;  2G7U A;  1DP8 A;  4R3A A;  2L1M A;  3WS4 A;  3T4K A;  1NLZ A;  5IU1 A;  1M6K A;  4EUZ A;  5IHV A;  5AQ9 A;  2Y2K A;  5CRF A;  4ZTK A;  4UQI M;  4Y0T A;  4GD6 A;  5E2F A;  2W3E A;  3JYI A;  2XFT A;  4P0M A;  4HJ6 A;  2IWC A;  3MMH A;  5EFW A;  1Y4O A;  1MC0 A;  2R78 A;  3RFB A;  2L0W A;  3B42 A;  4R6L A;  1CJF A;  2HDU A;  4S2P A;  3M6B A;  1IFQ A;  3IXB A;  4MCW A;  3ITA A;  4CLC B;  2PYR A;  3OCL A;  2VJW A;  2ZM8 A;  3KYQ A;  1GSV A;  1VET B;  5FAP A;  2XFS A;  3RH8 B;  1K54 C;  2XGN A;  3JPU A;  1IOU A;  2PYP A;  2B18 A;  3ZVW A;  1C3B A;  4EWF A;  3QP1 A;  2GZA A;  4G3W A;  1IEL A;  5KMW A;  1ONH A;  1XJ3 A;  3Q1F A;  4LRX C;  4BL2 A;  5I5L A;  4EQI A;  2ZC6 B;  3AGF A;  1RGY A;  4FD8 A;  2DMW A;  2I72 A;  3E4O A;  4Y2F A;  4JXG A;  3IXH A;  2RL3 A;  1D7E A;  3NIA A;  3LIC A;  2WUQ A;  1IKI A;  1YLY A;  3BFC A;  5DTT A;  4LV0 A;  1BZA A;  1NYM A;  4N1X A;  4S2I A;  3IT9 A;  2PT7 A;  3L9K A;  5CX7 A;  3MR0 A;  2FFY A;  4LFU A;  2EXA A;  4X25 A;  1TDL A;  1KVM A;  3U2A A;  1S66 L;  1BUE A;  2MJ6 A;  3A0S A;  3SS5 A;  3IF6 A;  5HDC A;  4XXR A;  1LL5 A;  3BFF A;  3ISG A;  1YM1 A;  2Y59 A;  1FOF A;  1F98 A;  3MZF A;  5E43 A;  5I94 A;  2XQZ A;  3PTE A;  3ZG8 B;  3GVB A;  2EWW A;  4X69 A;  3SOI A;  2WKP A;  2ZQ9 A;  4KZ4 A;  1HVB A;  3A0V A;  3PBR A;  4DE1 A;  1E3U A;  1MWS A;  4GNU A;  3NDE A;  1L3L A;  4Q0J A;  5D3O A;  3RXW A; 
#chains in the Genus database with same CATH homology
 3SW1 A;  4I39 A;  3KSH A;  3BW6 A;  3UE3 A;  4AFI A;  5HL6 A;  1ZHH B;  2HF6 A;  4B9O A;  2W1R A;  3T50 A;  3UB8 A;  4G3V A;  5F69 A;  3P01 A;  1F5M A;  2INW A;  4I3I A;  5FL3 A;  2HV1 A;  2W27 A;  4WEL A;  2CMN A;  5IS1 A;  2PD7 A;  4DMZ A;  4JGO A;  4FSF A;  1BYW A;  1WA9 A;  3ULF A;  3C30 A;  3LIF A;  2KOI A;  3VOL A;  1Y28 A;  2VGL S;  1G6O A;  1KOU A;  5J7E A;  1MZU A;  4HHD A;  4Y3I A;  2FH5 A;  5MC7 A;  2KDK A;  1EW0 A;  3T4Q A;  2HJ9 C;  1NRJ A;  4II7 A;  5G4Y A;  4YWZ A;  5DF9 A;  2QHK A;  3FC7 A;  4I3J A;  1LSW A;  3B33 A;  2NUT C;  2GNX A;  4I5S A;  3G6O A;  4MN6 A;  3LID A;  1T1B A;  4PAU A;  5J3W A;  2YKH A;  3T4L A;  4MN5 A;  1W63 Q;  3F1P A;  2M7V A;  4IJG A;  2KX6 A;  3RTY A;  1TS8 A;  2QYB A;  1W63 M;  2BAS A;  3F1N A;  4HH3 A;  5G4Z A;  1ODV A;  3BWL A;  3OOV A;  1V9Y A;  1TS7 A;  3PR6 A;  3ICY A;  4L9F A;  3NOP C;  2OWJ A;  3E4P A;  4WEJ A;  4UQI S;  4M4X A;  2EWV A;  1LSV A;  3BJN A;  3TRC A;  4BBV A;  4BMW A;  1H3Q A;  3UME A;  2VX8 A;  3F1P B;  3LUQ A;  2J80 A;  3LR5 A;  4GCZ A;  1TF1 A;  3E4Q A;  2HJE A;  3F1N B;  1LT0 A;  3C8C A;  4GS9 A;  2K2N A;  2H28 A;  1MKM A;  2OWH A;  3CI6 A;  4MN7 A;  3PBN A;  5HPI A;  4NXB A;  4HP9 A;  4P6Z M;  3LR0 A;  5DJU A;  2J3T D;  3GEC A;  2IA2 A;  2NUP C;  4CLC C;  4LRY C;  2A2L A;  2VV6 A;  3PXP A;  2QKP A;  1S4R A;  4WN5 A;  4LPZ A;  2XA7 M;  3DBA A;  3LIB A;  4WUJ A;  1OTE A;  2PD8 A;  2VEA A;  3R7W A;  4GS9 B;  3NJA A;  3LIA A;  4R70 A;  4DJ3 A;  3UMD A;  3W2Z A;  2A24 A;  2K7S A;  5HDD A;  2M7U A;  4HNB A;  3H9W A;  2JKT M;  4DN0 A;  1DP9 A;  2V1B A;  2VGL M;  4ETZ A;  3TW8 A;  2V9A A;  4UEY A;  4EES A;  1T19 A;  2Z6C A;  3EEA A;  4HIA A;  4WEK A;  1DRM A;  5AVE A;  5HSQ A;  5K5B A;  3R7W B;  3C38 A;  3EWK A;  3FG8 A;  4HP4 A;  2A24 B;  2OAQ 1;  3S7Q A;  4BBU A;  2VV8 A;  2D01 A;  2PDR A;  5TBM A;  1V9Z A;  2ZOI A;  4PKY G;  1P97 A;  4OOM A;  4NKP A;  3LYX A;  2JHE A;  3ZYT A;  2Y79 A;  4ME4 A;  4LRZ E;  1OJ5 A;  4L9E A;  3MFX A;  2L4R A;  3VE4 A;  2D02 A;  1OJG A;  2PR5 A;  3BQA A;  2VV7 A;  1G28 A;  3T4T A;  5L8M A;  2ZMV A;  3KSI A;  5TBM B;  4ETX A;  4K08 A;  3KX0 X;  2PHY A;  4EW7 A;  1XJ6 A;  4CLC E;  5HZH A;  3K3C A;  3P7N A;  4L9G A;  3PBT A;  4GJ4 A;  2V1A A;  3PBS A;  2JKR M;  5AVF A;  3KSG A;  1OPX A;  3TJZ C;  1OT9 A;  4LLO B;  1S1Y A;  3EOI A;  4KQD A;  4NXE A;  3H82 A;  2O99 A;  2J3W A;  3UB9 A;  3D72 A;  2W3F A;  1UWP X;  4EER A;  5IT5 A;  5HPF A;  4HH2 A;  1NLY A;  4OOL A;  1T1A A;  3CWF A;  2YKF A;  5TJJ A;  4O01 A;  2ZMF A;  3NOU C;  3LFV A;  2VA0 A;  4ZRR A;  2QWS A;  4EUV A;  1YSQ A;  3H82 B;  2K31 A;  5HWT A;  3LI9 A;  4L0L A;  3IS2 A;  1ZTU A;  4HJ4 A;  5KIZ A;  3V67 A;  4BJP A;  2VLG A;  4XT2 A;  1DP6 A;  1H8M A;  2P08 A;  3C2W A;  4ARZ A;  3OCN A;  1UWN X;  2ZOH A;  5F68 A;  1OTI A;  3OLO A;  4QPR A;  3JVU A;  2VKS A;  4NXG A;  4O8G A;  5HDS A;  1XJ2 A;  3UE6 A;  3IS2 B;  4HOI A;  3EGD C;  4XT2 B;  4JGP A;  2V0U A;  4GHI A;  4ARZ B;  2Z6D A;  3EEH A;  4WLA A;  4Z1W A;  2PR6 A;  1GSW A;  4Q0I A;  2W0N A;  3EQV A;  5HD3 A;  3KSF A;  3PBO A;  5DFX A;  4F3L A;  1LL8 A;  3S7P A;  3S7N A;  2J3T C;  4YOF A;  2W3H A;  4IUH A;  3H7W A;  2OOL A;  4GW9 A;  3VE3 A;  1T1C A;  5A8B A;  3IBR A;  4GHI B;  3NOT C;  4B93 A;  5J4E A;  1NWZ A;  2XRO A;  3PYP A;  4IHQ A;  5LBR A;  3MQO A;  3MF0 A;  4F3L B;  3K2N A;  3CLO A;  2WKR A;  3H7W B;  4IUK A;  3O5Y A;  3CIT A;  3T4S A;  4HQA A;  3JVV A;  2M1C A;  2G7U A;  3A0R A;  1DP8 A;  1P9R A;  4R3A A;  1JNU A;  3T4O A;  3ZQ5 A;  2KLI A;  2L1M A;  2FZ0 A;  3T4K A;  1NLZ A;  1LSX A;  5IU1 A;  4DJ2 A;  1OTA A;  1UGU A;  2I9V A;  4UQI M;  1YKD A;  3KO6 A;  3UB6 A;  3B47 A;  2W3D A;  2W3E A;  3R4K A;  3HJK A;  3MXQ A;  4CLC A;  4I3A A;  4HJ6 A;  3MMH A;  5EFW A;  4EET B;  1MC0 A;  4WF0 A;  2R78 A;  3PHY A;  4MMN A;  2JN7 A;  3RFB A;  2XA7 S;  4NEE D;  4JGQ A;  1T18 A;  3TE8 A;  3CAX A;  3S7O A;  2L0W A;  4YNR A;  3B42 A;  2P7J A;  4R6L A;  5HD5 A;  2EA9 A;  1IFQ A;  2JKT I;  5KSH A;  3CUE C;  4MCW A;  3MQ0 A;  2O0Y A;  4CLC B;  3NHQ A;  4MDZ A;  4HY8 A;  2PYR A;  5DJT A;  3OCL A;  2VJW A;  4BWI A;  4Y5F A;  3KYQ A;  1GSV A;  5DKL A;  3EGX C;  3LIE A;  3RH8 B;  3LR4 A;  1XJ4 A;  1S1Z A;  1XFQ A;  2LB5 A;  2O9B A;  2QJ7 A;  4GLQ A;  1IOU A;  2PYP A;  2B18 A;  2W3G A;  3PBQ A;  5DFY A;  4KUK A;  4O0P A;  3KYZ A;  3EQU A;  4PHT A;  2GZA A;  3HJI A;  4HJ3 A;  3IBJ A;  4G3W A;  1XJ3 A;  4LRX C;  3F1O A;  5I5L A;  1OTD A;  2DMW A;  4I38 A;  3BY8 A;  3E4O A;  3GDI A;  4Y2F A;  4FOF A;  4EU0 A;  4WL9 A;  2B02 A;  3BY9 A;  3E98 A;  4H6J A;  1VHM A;  1D7E A;  5C5K A;  4EEU A;  2P04 A;  3LIC A;  4G3K A;  3UB7 A;  5HWW A;  1XFN A;  1YSP A;  3VV4 A;  3F1O B;  2JKR I;  2LB9 A;  2OAP 1;  5HWV A;  3FPV A;  4CLC D;  2PT7 A;  5CX7 A;  3HCY A;  3MR0 A;  5F6A A;  4R38 A;  1S4S A;  2WKQ A;  4H6J B;  3CUE A;  1VB6 A;  3U2A A;  4Q0H A;  1X0O A;  4KQO A;  1S66 L;  3FPW A;  1OTB A;  4EEP A;  2GX5 A;  3LI8 A;  2GJ3 A;  1P0Z A;  2MJ6 A;  5DKK A;  2HGV A;  3A0S A;  4KUO A;  4CQH A;  3T4J A;  3D3O A;  4HI4 A;  5HDC A;  4NXF A;  3BQ8 A;  4EQ1 A;  3OC2 A;  1N9N A;  2W1T A;  1F98 A;  2XRN A;  1TS0 A;  2V0W A;  2ZBB A;  1YAX A;  2EWW A;  2O9C A;  4BBT A;  2WKP A;  1GSX A;  2VZW A;  1P9W A;  4EXO A;  1N9L A;  1OT6 A;  1F9I A;  2O9A A;  3LR3 A;  4JGR A;  3A0V A;  3PBR A;  3K3D A;  2QJ5 A;  5F5Y A;  2W1T B;  1STZ A;  1N9O A;  2Y8H A;  1TS6 A;  3MJQ A;  3E0Y A;  4E04 A;  3OBF A;  2XSS A;  1S67 L;  3MQQ A;  1TD5 A;  4Q0J A;  5AJG A;  4PKY A;  1D06 A;  4RQ9 A;  4P6Z S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...