4PB5A

D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with l-erythro-3-hydroxyaspartate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNAACATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate.
pubmed doi rcsb
source organism Delftia sp.
molecule tags Lyase
molecule keywords D-threo-3-hydroxyaspartate dehydratase
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4pb5A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4pb5A02
1D7KA 4DYJA 5BWAA 4PB5A 3N2BA 2RJGA 2NV9A 1BD0A 1VFSA 4WR3A 2J66A 4AIBA 3HURA 3KW3A 1W8GA 1B54A 3CPGA 1TWIA 4BEQA 2SFPA 5GJNA 1L6FA 1F3TA 1CT5A 1XQKA 3N2OA 4LUTB 3SY1A 3HA1A 2O0TA 1SZRA 3WQCA 3N29A 1KNWA 2ODOA 3S46A 3WQDA 3AWNA 4XG1A 4PB3A 2VD8A 2YXXA 4ECLA 1TUFA 3R79A 3CO8A 5GJMA 3B8WA 1KO0A 3VABA 3NZPA 2QGHA 4KBXA 3AWOA 2OO0A 1QU4A 2PLKA 3B8TA 3UW6A 7ODCA 3WQGA 1SFTA 3WQEA 1VFHA 3ANUA 1RCQA 1HKVA 4Y2WA 4DZAA 4ZGYA 2PLJA 3MT1A 4XBJA 5IRPA 3ANVA 2DY3A 1VFTA 2NVAA 2TODA 2VD9A 4PB4A 4LUYA 5FACA 3E5PA 3B8UA 5FAGA 3WQFA 1EPVA 1FTXA 3C5QA 3GWQA 2RJHA 3B8VA 3LLXA 1XQLA 4FS9A 3NZQA 1XFCA 1HKWA 4BEUA 1NIUA 4QHRA 4LUSA 3OO2A 4LUTA 5FAJA 4BHYA 3BTNA 5GJPA 2ON3A 1L6GA 4ILSA 4BF5A 2P3EA 1NJJA 4V15A 4A3QA 3E6EA 4LUSB
chains in the Genus database with same CATH superfamily
1AD4A 2WM1A 5K4ZA 4BI7A 5D37A 4BA0A 1UG6A 4IL0A 4KESA 1A4LA 3KM8A 4WSHA 4H6EA 3SI9A 4XX6A 1XBZA 1EJVC 2VO5A 4P8VA 4OBTA 3WL1A 5A2BA 2NT1A 2G3JA 4MWAE 2CFFA 5DMNA 3SDOA 1Q6QA 4C1LA 4J5NA 5M3WA 2X42A 3W29A 5BMWA 1XH1A 4GYJA 5A6LA 5AC6A 3QGAC 4DB7A 3OVRA 1YTKA 1RK6A 2X0HA 4DO6A 2A1YA 3ERPA 3ITOA 5C71A 5CC3A 4CVWA 3M0XA 3W9ZA 2CLMA 4RLIA 2YW3A 2WVTA 4WQ6A 1Q85A 4XAPA 4M6QA 3MZ2A 1Y7VA 3TN3A 2HE8A 4ZENA 2OT1A 2E5BA 2UY4A 3F03K 3LX9A 4FA3A 4Z2JA 1R2SA 4BEUA 2BP1A 4IPLA 4Q7BA 2PLMA 3NURA 2OZ8A 3BTNA 3HZ3A 3KWSA 3B05A 2X2YA 2IXVA 3QY7A 2JF6A 5D8WA 1GKRA 4LS1A 5ABEA 1VIWA 5ECVA 1ESWA 2OGYA 4Q7IA 2ZYFA 4JIHA 3FW6A 5C54A 1O4UA 1MYRA 1QNRA 1TPWA 4JHOA 2ZZ3A 4PUJA 5LHEA 2C18A 1BYCA 1I2PA 4IISA 1OGGA 3N2OA 3T05A 2ZRXA 4CVUA 2E6DA 3PUOA 5EY5A 3WQDA 1GZJA 3WLNA 3THUA 2Z6IA 3SJNA 5G1TA 2NLYA 2WVUA 4DM2A 5ABFA 3E0IA 3UQNA 4MFEA 4IMAA 3D3FA 2PWUA 1F9CA 1IWAA 2WVVA 1EHNA 1HTIA 1DBTA 2YL9A 1N8FA 1PCWA 4DWSB 2O4MA 3TFXA 4AZIA 1QNVA 2BX7A 3RX4A 1V6TA 3TWBA 2EF9A 2BY0A 3CUJA 2HK1A 2QCDB 1GVYA 3NQ2A 4H6RA 2OODA 4PSRA 4K68A 3H2FA 3RJXA 2P53A 2DIKA 2V5LA 3GWQA 4REQB 1BRLB 1W5PA 3A9BA 2J88A 1PBGA 2RUSA 3ABOA 3WDQA 1EKOA 2PDIA 1R3WA 1REQB 3BPWA 3UXAA 4XO7A 1FWIC 4HPNA 3EMZA 3VIFA 4V15A 1R47A 3DAQA 3EXTA 3POCA 1WYIA 2ZUNA 4DY1A 3W7DA 1TJPA 5I09A 2QV4A 3KLKA 3UJFA 5MF5A 2B0MA 4QJ3B 3AQUA 3P0WA 1OT2A 4GUHA 3W7HA 3M0IA 1V0NA 4JGDA 1FBAA 4H4IA 1VD6A 2EKCA 2GVGA 2A3AA 3N6HA 3NO5A 4NAFA 5C6MA 1W3NA 3C0LA 5TD4A 2C16A 4RDZA 3U0HA 3GD6A 3S5SA 1KM0A 3VD7A 1KBKA 1R5YA 3VZYA 4IM4A 8XIAA 2PRHA 5KZMA 2BBFA 4KEUA 1JAEA 1XX1A 3HPFA 1UA3A 4LEQA 4JTLA 2Z1BA 4IOTA 4E2BA 1ECEA 4F79A 2WBGA 1LM1A 4RJEA 4PCNA 1AW2A 1V6XA 3DI0A 1TV2A 5EPDA 1SZGA 3M0LA 1M41A 4AVFA 2QMJA 3QHMA 1R2TA 2VD9A 3MP3A 2PTDA 4KIEA 3L7RA 4WOQA 1AG1O 4POCA 1YNPA 3MTWA 4N0RA 2Z1KA 2CBJA 2FLIA 1H1ZA 2PGEA 1K8YA 3L2IA 3V7PA 1OX4B 3SRHA 1AD1A 3BK0A 3CUIA 2CZDA 4UQ9A 1V3LA 2WMKA 3AI0A 2XU2A 3H6OA 5E0FA 1NF0A 4GK8A 1LQ2A 3N2XA 1OBAA 4QFUA 1HUVA 1ZAIA 3CZKA 1IXPA 3PBGA 4FIQA 4TMCA 3TTEA 3UCQA 2CKRA 3PPFA 4X63A 3FJ6A 4RDVA 3WNLA 1E72M 3GXDA 4MWAD 4UOJA 2VR5A 1SM9A 4XO6A 1TV5A 2CIPA 5F4SA 3MUCA 4WY0A 3WZ0E 1OC6A 4LUTB 4CN1A 1O5XA 2NQ5A 3UT0A 1KNWA 1TPDA 3NYDA 3GHRA 3V1PA 4AD1A 4FK9A 1Q8AA 1PSCA 2QCGA 1OGBA 1DIEA 4LWWA 2X16A 4WGHA 3HBLA 4XZMX 2D3LA 1C7TA 1LLZA 1VP5A 3RMJA 3EWXA 3DG3A 4QM1A 1FWNA 4JN6A 2PC4A 1LOQA 4A2RA 3LCWA 3EPNA 4PRRA 2J7CA 2BOGX 3RU6A 5G1MA 3GYCA 3DFNA 3SRFA 3UESA 4NY2A 1QI4A 4NILA 3EMCA 1TV4A 4DO4A 5D38A 1KLZA 1L6WA 1MWOA 4GUFA 4Q6XA 1RQEA 4LB4A 2PWDA 5C9UA 3O9NA 1T5AA 1U1JA 4ADUA 4EE9A 1P7TA 1P5BA 2NQHA 3GHUA 4QROA 1IHIA 2PDCA 4IFKB 3M6DA 3NDZA 1EP1A 4IWWA 5D2VA 1E5NA 2DZXA 5FF4A 3KWXA 1UMYA 2F6UA 5TNVA 1NEYA 3G1AA 4KCUA 1E1EA 3UR5A 5MKGA 1IWPA 1UJQA 3FJNA 3V16A 2TPSA 5G4EA 4IUGA 1B54A 4XBKA 3R6IA 3VIHA 4H7CA 3GHTA 3T42A 1YBQA 5DLCA 3NZRA 2ZTJA 3G2GA 3WJSA 3AXHA 1OYBA 3O05A 3BVJA 3LRLA 4GKTA 1SUXA 3A4AA 3Q67A 1KXTA 5HOSA 4XUYA 4YTUA 2O55A 3JZUA 3LQLA 4QG6A 2BWGA 1Q63A 2OYMA 1C29A 4JNYA 3WJZA 1G4PA 2WPBA 4QR6A 4D6DA 5AHNA 1UIOA 4YN5A 2ZZ6A 2ESCA 3XISA 3TFCA 1VBHA 3G1HA 5LIXX 4GYPC 1E1CA 1W5NA 4PMXA 5A6BD 1LJYA 3O7UA 3VGGA 3SN1A 4AZ6A 3BOLA 3C5QA 4DBUA 1T0OA 1EGZA 3W2MA 4J3SA 2J7EA 3RR4A 4P8WA 3TA6A 5DCEA 3ZJ7A 3JW7A 3SIZA 5E1QA 1W9VA 2XVKA 3CZ8A 3FXGA 2DZPA 3AYSA 3S42A 5EBUA 3T2QA 1M7PA 3G1YA 4ACYA 3RXZA 1XD0A 5I03A 4Z1DA 4U28A 5F1VA 2DZVA 1REQA 2AQOA 3MV01 1LLWA 3S5ZA 3UY8A 2OWWA 5CG0A 1M1BA 3PJXA 3B4YA 3BO9A 4A2SA 1DXIA 5I07A 1JR1A 1K9DA 3SM0A 1UMLA 2FYMA 4BF9A 5I02A 2WANA 1UP2A 3W38A 1NOUA 5CZKA 2PDNA 3LI0A 4HN4A 3G1FA 1E9ZB 3PAOA 4G7EA 3DEQA 1V6YA 3OYZA 1UR9A 3W1TA 3T9PA 2X1RA 5D4YA 2TSYA 3N19B 4XAFA 4Q8QA 3QV6A 3VPLA 1FHVA 1SJCA 3SBFA 4EAYA 4PZVA 1EJUC 1WKFA 4DBWA 3LV5A 4EKJA 1E43A 4NIRA 4H00A 2CXGA 5SWUA 3WEZA 3NVTA 3S2MA 2Y8VA 3O8AA 4CEXC 1Z69A 1EDQA 2QPSA 2A21A 2YL5A 3CB8A 3NJ3A 4G9PA 1DJNA 4H01A 1F05A 3THDA 1RBAA 3WJYA 2G3NA 1A0CA 5BU9A 2XISA 2E6FA 3P81A 4XKMA 3BQ6A 3IJIA 1US2A 5RUBA 3WQ8A 4NAEB 4U31A 3O6DA 2QDEA 2CCRA 2WNWA 3AS3A 4G56A 3SCUA 1JFHA 1UUQA 3Q94A 1J96A 6ENLA 2V5BA 1JD7A 4P8XA 3IAQA 5AOUA 2YL8A 1PYFA 4HCDA 3TR9A 4Y8FA 1VFSA 3GDLA 5AC5A 1ZJBA 3APYA 4ZA0A 2ZX5A 1B3YA 4GNVA 3AMGA 3N3TA 2J8GA 1JF5A 1E6QM 2CBVA 3W24A 4O8RA 3CJPA 5CH9A 5HA7A 5CCZA 1DJIA 3U7VA 1FFRA 2NX3A 1JYVA 4F0RA 2C8NA 3UW6A 2BGSA 4CD4A 3WQEA 5K9CA 3I7SA 4JN8A 3V75A 4Q4MA 3NAVA 1RA5A 4FSAA 3AS2A 1P0BA 3W07A 4K36A 5EMKA 4DAIA 3DESA 2FZNA 4U10A 3R7MA 4YYFA 4X9SA 1B3VA 1HFBA 2DSUA 3S2NA 3WFAA 3VNDA 2WC4A 4TTGA 3S1VA 4E4UA 4MSSA 2XGIA 3IS4A 3AO0A 3HG3A 4B5NA 3W76A 4O12A 1B9ZA 4UTHA 1KQZA 1EQPA 1AL8A 4EWND 3CLWA 1EBGA 4I7UA 2GGIA 4HK7A 5LNWA 4QLLA 4QTGA 2XIQA 4B5UA 4MZYA 3RHGA 2CBIA 4K8HA 5C2XA 4MTVA 4RXGA 1KFEA 3TCSA 1YPFA 3GNNA 3H12A 3BAKA 4XB3A 3TSMA 2JE8A 5CSUA 3IV3A 1ALDA 4KRZA 4G6CA 1OT1A 1TFVA 4DYEA 2ALDA 4NZJA 1VB9A 1VBGA 1EP2A 3ZZ1A 3MKVA 1JUEA 4AWEA 3NO1A 3R58A 5T91A 1G01A 4HCLA 4FNRA 1DJZA 1Y0EA 4Z2KA 3B9AA 3TE9A 4A8NA 3ZT7A 3VZZA 2NUWA 3D47A 1G7VA 1FWDC 1B90A 3ZS4A 4QDMA 3WNPA 5HJYA 4Y8EA 3L5AA 1V03A 3BV4A 2WC3A 3M4HA 2VFHA 2Y1HA 4PTNA 1VFFA 3GDRA 1OABA 3ZR4A 3T0DA 2QF7A 1R3TA 3RF9A 1S2WA 2QDGA 1TTPA 1XD1A 5B7ZA 4QGCA 4GZIA 1TTJA 1RHCA 4I9JA 5D9NA 1XCXA 2CHOA 3ZSSA 1LBMA 2VQTA 4NHVA 2IKGA 4NASA 3ABQA 5CLWA 5CLTA 3DC0A 3WD1A 4LUSA 1RPKA 3C3NA 1SR9A 3H2NA 2D69A 2AL2B 3DX5A 3U8GA 5JBEA 2DUAA 1VH7A 3F4WA 1DWJM 3V18A 4LYRA 1FP8A 1YMYA 4WDUA 1KM6A 5LA0A 4AIEA 2WV8A 1GW9A 2H8ZA 2BTMA 2F38A 2QCLA 4Z0JA 3CV6A 2BOEX 1E6PA 5AYXA 2J66A 2GQ9A 3REQA 5K3VA 3GH4A 4JHMA 2PRMA 1H09A 4GYKA 1SZNA 2R14A 2ZE0A 4GIYA 5A6MA 2RKXA 2ZWZA 2PD9A 3KVMA 3PZMA 1E40A 3B8WA 3DC8A 1XLIA 4YVVA 4GQGA 2YDQA 3CV7A 4LBUA 4A8LA 3ENLA 1WDDA 3KP1A 5B80A 2VZVA 2FGLA 4HPXA 3KBJA 4K7VA 4EPBC 1UUMA 2J24A 2VR2A 2A7NA 2YXGA 2ZX8A 1K9TA 4UWMA 4B3KA 1BG4A 3DDMA 4MJ2A 3PZUA 4WKAA 1UD4A 4R3UA 3HG5A 1A3HA 1UPPA 1M03A 3KBSA 3Q4DA 2YZRA 5LIKX 4AIOA 1XIMA 3GBDA 3UR2A 3UZJA 4BQ4A 4HZ7A 4AH7A 1ZZMA 2R82A 2DVTA 2NT0A 4WF7A 4WDXA 4D6HA 1YDYA 4CEUC 2IPGA 1A5SA 2W9MA 3AYVA 2GJXB 3L4UA 3W1UA 4D6CA 1D3HA 3B0UX 4AF0A 1VEPA 1XIDA 4ONVA 3TKFA 5H6HA 1F5ZA 1M53A 4FPSA 1R3SA 1RVGA 1JFXA 2J8TA 4ZOBA 5HR7A 1DE5A 7REQB 3HA1A 1MZHA 4MG4A 3S5OA 1XLMA 1FY6A 3EGJA 3WBAA 1CYGA 3ZQ9A 2XFYA 1GTEA 4GMEA 2Z27A 4JYEA 3TQVA 4W89A 2DT1A 1U1HA 4AWUA 2P0IA 2BFGA 2PCEA 4YHEA 5XIMA 4RV8A 1JQXA 3GLCA 3BZJA 4UMAA 2CLLA 3QZ6A 2X1UA 4ZQNA 3KBMA 2F84A 3PC0A 4H6KA 3KTSA 3H21A 4GY1A 5AYBA 3CAKA 5C2CA 3PHAA 4ZO7A 5FL0A 2Z00A 4PMJA 1H0GA 4GQRA 3GAKA 4LRSA 4M7SA 1MNSA 3G6LA 2NXIA 1W1VA 3WDIA 1ME7A 4Y9AA 3ZR6A 1ZB5A 4HA3A 3NQMA 4A8IA 3H2EA 1XBXA 2PCQA 4J3VA 3KCOA 3V0UA 5HMEA 5HR6A 2H8XA 4UXDA 1OK4A 1V5XA 3BW3A 2PP3A 3B0VC 4F0LA 4B15A 4TUFA 1X98A 1B31A 3STGA 1DJHA 3GW0A 1UHVA 2EPLX 2V0TA 3LG3A 5KEZA 4OWGA 1EOMA 1MEIA 4OFCA 3VMPA 3MSRA 4L4PA 3W25A 4KEMA 1V7AA 3UWVA 2C13A 4O53A 3PNUA 1XCFA 3CLMA 3QC3A 4CNSA 4WOZA 3HB9A 3URBA 2Z2BA 1C3FA 3WL0A 3B8IA 1MFUA 4DO7A 3SRDA 3NQCA 3GUGA 3O16A 2D2JA 4LY8A 2QGHA 4IF2A 3P82A 2QUMA 5AVHA 1ZNNA 3PTMA 1ME8A 4OUEA 4FLSA 3WLTA 2GVJA 1Q2RA 1UR1A 4H8NA 4ZXLA 4C6FA 1LYXA 5I79A 4PUEA 4KRTA 4L1WA 3VNLA 1CDGA 1DWAM 3CTTA 3DN5A 4JBRA 3BXWA 3GFZA 4GISA 2VC9A 1WXYA 1UP0A 3ITYA 1XH0A 5D8ZA 3NQAA 3BLLA 4IMDA 4N4QA 3FVMA 1E6ZA 2HS6A 2EG6A 3DG6A 2F7FA 4YVXA 2XIBA 3NZGA 1OFDA 3KE0A 5A1AA 3W7LA 4HKPA 3FA4A 5G4HC 1CGWA 1OFRA 4KQNA 3LM3A 3NXLA 1V0KA 4O14A 3RPTA 2BVYA 3WK1A 2OWXA 2BY2A 5JMUA 4AMCA 1L9WA 3B0PA 3USBA 4CCEA 3H8AA 2PF0A 1KBLA 2J27A 4M3PA 3G5EA 5CBBA 5TF0A 7PTDA 1P0NA 4G8TA 4GOAA 4PH6A 4ORIA 1JYXA 4AD3A 1EBHA 1EJXC 2IKIA 3GM8A 4XG1A 3IUIA 1A49A 3A4JA 4FIRA 4Z2GA 1DV7A 2QVHA 3SB0A 3T8QA 1SSGA 2Z7GA 3ARPA 3WUEA 1ISXA 3RM8A 1GQLA 5DQPA 3O0FA 3TOYA 3LSCA 1ZP4A 1CNVA 1QOXA 3VGHA 3OQEA 2NQ9A 3H4GA 1QNQA 1HW6A 5M5DA 2HS8A 3H70A 3TAOA 3PB0A 1DXFA 4B5TA 3GO2A 2YCLB 3GH5A 2W6RA 1AW1A 3H7VA 3W81A 2ISVA 1Z7AA 3TV8A 3WX7A 4R33A 1GJUA 5K9XA 2Z26A 1AJ2A 3EWZA 5AHEA 2BHUA 2HZGA 3CM4A 4Q4QA 4P5UA 3GR4A 2Q8ZA 2QF8A 1H7XA 2GGGA 3K1GA 2Q8XA 2FKPA 1NJJA 1GYNA 4I9AA 4E38A 3QLLA 3THQA 2IPWA 4PR4A 3R11A 3WLPA 1IXNA 1KCLA 1MO0A 1FP9A 4E2OA 3C2YA 2B7OA 3OZMA 1DYSA 4NU7A 3FX4A 4LAOA 4WKFA 4IP7A 4FB7A 4JQAA 2IQDA 2YR1A 2GLKA 2WLYA 5C8BB 5CEWA 1EO7A 5C9WA 3R13A 4YCOA 4MUPA 3AS0A 3FXYA 4AQLA 4Z1BA 4AF0B 1XRSA 3IGUA 2NX9A 5CZJA 3L23A 3B8SA 4JTEA 4WY0B 2ZICA 3OHMB 5EFDA 1F76A 2Y7GA 5CKSA 4U2ZA 1V3IA 3DYOA 3KOZA 3DGRA 3VD3A 1GVRA 3WJWA 2Z7KA 2GK1A 2GDUA 1E5JA 3W72A 2QULA 1RAKA 5A8QA 1OC5A 4KWUA 3QSTA 2BHYA 4XBJA 3O6CA 3NL6A 4UCGA 3I6TA 3H54A 1TVPA 4HOWA 1V3HA 2XVNA 3H2AA 1J12A 1UP3A 2X1IA 3C0JA 2V69A 1PX8A 1KR1A 5HK4A 1Q45A 4PC8A 2VKZG 4JX6A 4R9OA 1IR2A 3GC4A 1RY0A 5KTLA 3EX3A 4L64A 5AB3A 6PTDA 3QH2A 4IX2A 2G8ZA 1V0MA 1GVEA 1U2YA 5HATA 3TYBA 1EQCA 1KXVA 1X1ZA 1D7KA 3MO4A 4PUUA 1ISVA 1AK5A 4OV9A 4E4PA 1ZJHA 4O4VA 4BFAA 4Q8VA 1F4AA 3H7RA 3QGKC 3KOFA 1XICA 2V67A 1KFLA 5FESA 2Y24A 3FS2A 4A22A 4GACA 1OD0A 3MQTA 1LG2A 1YDVA 3KAOA 3NOEA 2ZA1A 2Z6JA 4O0ZA 4WD0A 3NOYA 3IRDA 3NQBA 3JS3A 3NUKA 4EANA 1GWJA 4JTTA 3AUJA 2HROA 4JIPA 4FXFA 3BW2A 1CBGA 4JCMA 1XUZA 1UH3A 2PWFA 1XS2A 4Y96A 4JTIA 1R9YA 1EEXA 2VX5A 4C6NA 2FMOA 4RE4A 1LBLA 2NVCA 1UQZA 1NY1A 5C55A 3O15A 4B2DA 1SSDA 1WO2A 4C6IA 5K9DA 1BFNA 2J6VA 5H8MA 1JCNA 4RW3A 3PBMA 3WLLA 3HG2A 2ATSA 2FHFA 3G6MA 3E5PA 3UXLA 1H7WA 3PZQA 3CV1A 2OFJA 3VKAA 4BCEA 3TW7A 4IMEA 1P0KA 1JPHA 1BVNP 5BMXA 3IJ9A 4ZXOA 4FNUA 3WK2A 4XUGA 1F8IA 1H5YA 3VM7A 1P4CA 5HMDA 4OKDA 3PZ9A 2PDHA 2F61A 4LNCA 4B5WA 5I3GA 4EOUA 2QDHA 1OVDA 3I3BA 3BSHA 3L9CA 3C4UA 3G1XA 1G4SA 3HPXA 3ZO9A 4AD0A 5CJNA 4IICA 4INFA 1HIZA 3ATYA 2CHRA 2A4AA 4M1BA 5IBXC 1ZAHA 2HRWA 4ZOEA 1J0ZA 1CT5A 2W4XA 7ENLA 2D1ZA 4MADA 2O0TA 1T7LA 1C8QA 3AWNA 3BAYA 4W4QA 3WQVA 1EHAA 1TMHA 3PM6A 1QCWA 8A3HA 1WX0A 3VU2A 4X2RA 2ZUTA 3VDCA 2PA6A 3TW6A 2HVMA 5HQLA 2Q3RA 3GNOA 3V0SA 3KOWA 2UWFA 2VCAA 3ARQA 4O54A 4GIAA 4PYSA 5FOOA 2WMGA 3EBVA 2RGMA 1XLCA 1QR7A 3UWWA 3W2UA 2EAWA 6XIMA 1XXXA 4MJ4A 1IWBA 3DHPA 1MW1A 4IL2A 4H9XA 3I10A 3AUOA 4NKCA 1QNSA 3TMLA 3RJYA 3I65A 3CL8A 3SCRA 3OW1A 1BTMA 2ZC8A 2NX1A 1Q8JA 5A2AA 3ARTA 3RPMA 1OM0A 3MUAA 2P8BA 1FWTA 4UOQA 4ZODA 4JTUA 3B03A 2B7NA 1PZ0A 4RDYA 1HT6A 3VIJA 2P5NA 1JPMA 1B30A 3P6LA 1W3TA 2GJLA 4UQCA 4AIBA 3QFEA 3TJ4A 4DXVA 2GSHA 3W1QA 1UWRA 1TTIA 3A4WA 1TPB1 3CPGA 1L8NA 1GKQA 2QNEA 2FZBA 2WLZA 3EA3A 4EAMA 3MCNA 1ZAJA 3MBFA 5M2FX 5AYZA 1V0LA 4M24A 4LVDA 1J0IA 3LS9A 4DLMA 1IXOA 3T0BA 1GYLA 1P0EA 3IJ7A 1RD5A 4M29A 4O50A 3NGFA 1AVAA 1F3EA 1GJPA 3OJGA 3QEZA 1RA0A 3Q65A 1CENA 1JD9A 2XPKA 1HJWA 4NJGA 3AMKA 1R38A 3H55A 2JBMA 3CWOX 3AALA 3UR7A 4UNIA 1N7KA 5E93A 1O66A 1XYCA 1Z89A 2HCVA 3P62A 3P93A 3KVJA 1J8VA 1OIFA 2YB4A 2ZDSA 1KXHA 1YXCA 3NPUA 2PBGA 1W56A 2XG9A 2Y89A 3HMCA 2ZVRA 3M64A 4U5IA 3TTQA 3LUTA 4Q32A 1VYSX 1GCYA 4RE2A 1HNYA 2KX9A 2ZIDA 3LENA 5HJLA 4WJEA 3ARRA 1BSLA 4O17A 1DVJA 4RE3A 3FEMA 2B4GA 2ZXDA 2OQHA 5G4WA 1U83A 3P80A 5C7HA 3QZAA 1RV8A 4ZB2A 4R5EA 4ORMA 5E5CA 1SQ7A 4UB9A 4V1YA 3OB8A 3WK3A 4YTQA 4HSHA 3H2MA 3HQ1A 3UD6A 3F4NA 4HSNA 5LIYX 1TR9A 2PBOA 4S23A 2ZDRA 2PS2A 3WLSA 2HXTA 2Z1WA 1E55A 1AZ2A 5BRPA 4UTWC 4QRNA 3KTCA 4E3VA 1BHGA 1KM5A 1OFBA 2VD8A 3V5OA 4QP0A 5I2UA 3TJLA 2V63A 1H1YA 1LOLA 3T4WA 1ZALA 3A5VA 3P61A 4PFMA 1W3JA 1O6IA 4LANA 4MPQA 3EDDA 2XFWA 2WNQA 4V33A 4H83A 5IHRA 3R5EA 4UIOA 2PAJA 2DH2A 4QLJA 4D71A 1PB0A 2G37A 3FGCB 2X0SA 1KCXA 2A7PA 1FWBC 5I23A 4DZAA 2W67A 4GC4A 6REQB 5FACA 3QYQA 2YKKA 3VNZA 2WXDM 5REQB 3BLDA 4R27A 5PTDA 3UA4A 3P8IA 2FZDA 1G4EA 3VCRA 1Q6OA 4K1WA 1QI3A 3GIQA 1H7RA 1RP8A 2CLIA 1ICSA 1CXKA 6TIMA 4WJ8A 4KWSA 4LUSB 3G3DA 2QZRA 1B3WA 1LRQA 4FOUA 4LAKA 3RMEA 1SU5A 1J0YA 5FF3A 1KFJA 2VEKA 2YSWA 3VGBA 1W91A 1XGZA 1W5MA 1W2VA 2DT0A 4AX6A 3DH7A 3T09A 1G0CA 3T0CA 4B9ZA 3SY1A 3A23A 4IIBA 4WUIA 4XSLA 2V5DA 4D8ZA 4C1NB 1KM2A 3PPCA 2BB0A 4QG8A 5ABTA 2IXUA 2QYGA 3GG0A 1JZ4A 4O10A 2QT3A 1FXPA 2POZA 4AW7A 4KFOA 4RNIA 2OEJA 4M8UA 3TJIA 1R85A 4C6LA 4O0KA 3PTDA 3AMCA 1XRVA 3M44A 3NPVA 4M5PA 2VXNA 4RE0A 2BG5A 2YIHA 4O0QA 1XYZA 5I3JA 2PDBA 5HINA 2J75A 1EO5A 3UEQA 1JF6A 1B9BA 1X8CA 4OVXA 4PMVA 3LPGA 3B8VA 4EF8A 4PCFA 4UC5A 3FDGA 1AJZA 1WXZA 4GABA 1I8JA 3QR0A 5H2ZA 1F4HA 3GDBA 3UVIA 4NZ1A 1NFGA 2X0YA 1BWKA 4IT1A 1WBHA 3QQ1A 4FEZA 4NG3A 2V82A 4DLFA 3N25A 1E15A 3A47A 2ZRWA 2Z0IA 3EKLA 4I7VA 1OFAA 2JEQA 1X97A 3W1RA 4O16A 1TA3A 1UB3A 1ZLPA 4HHMA 1ZU8A 3IGHX 2HE5A 3WLJA 4AZBA 2BXVA 5BOOA 3AJXA 5GJNA 4K37A 4Q7NA 2GUBA 4AZ5A 4ASTA 3DECA 2QS8A 4Z42C 2OKOA 2WCAA 1JZ2A 3EOLA 4GUIA 2UY3A 1WKDA 1GOXA 2FH8A 2ZZ7A 2O9PA 3GXNA 3MCMA 7TIMA 4KBXA 3IJ8A 2IQTA 5LIWX 3MY9A 1HO1A 2QUVA 1NP0A 4BQ2A 2HVOA 1VZWA 3EXSA 1Q6FA 4ZGYA 1A47A 2XSAA 2CNCA 3MHUA 3CHCA 4JTDA 4AYGA 1UZHA 3IARA 2IKJA 3D3AA 1IEQA 2B31A 4JTGA 5HPCA 4H19A 3C0QA 4X60A 2WVSA 3T2OA 4PTDA 1K6AA 4FS9A 3QTGA 4FZIA 1YADA 3W1AA 3DYMA 1XRTA 3MJYA 2V5CA 2WMIB 1UWUA 3M7WA 4AB4A 3MI3A 4MM1A 4H8VA 4UTIA 1E6XM 4DBSA 1TWSA 4O13A 1KLYA 2O7SA 4H1ZA 5DT7A 2DFAA 1JDAA 4HMCA 1S39A 1A5AA 3DKLA 1L0PA 5HUPA 1HP4A 1YYAA 3Q2DA 1XYFA 1PKYA 1W1A1 3H23A 4DUXA 3RCYA 5FD0A 3E02A 2WWCA 1WKEA 1XCWA 4RDWA 1K8ZA 2R1PA 4AIUA 1MUMA 3GQYA 3I4EA 4WIWA 1ISZA 1P48A 1BVZA 1C8VA 2TMDA 1SO5A 1I75A 2H9AA 1OHLA 1GJWA 1QWGA 2E8YA 3NQ7A 4TVCA 1V4YA 3GIPA 3VNMA 1Y65A 2G3FA 2GQ8A 2RDTA 4AUBA 3RX2A 4Q4PA 2XZ9A 2QJHA 4W7VA 2J7HA 3R0UA 3ZR5A 2ZX9A 5CGQA 4GVHA 3VDAA 1RPXA 5FJPA 3WQFA 4E8GA 3N2TA 1OWQA 1W9XA 4L65A 3RFAA 9XIMA 1E4NA 1XHGA 1QRQA 4LVBA 1FUYA 1NWTA 2GJNA 3B9DA 4F0KA 3VX1A 1JG9A 2BY1A 4AZCA 1RCOB 2CWNA 3WLOA 1PTAA 3R8RA 2WQPA 4RUBA 3R8HA 1K3UA 4HHPA 3TWAA 4C60A 3FA5A 4O1FA 5HNUA 3W7QA 1FH8A 2V3EA 3AFBA 2WMHA 1TZ7A 1FWWA 2QGYA 1QPKA 2QCDA 1PX4A 5HWJA 3LZ3A 3CH9A 3GBEA 3GE7A 1JUKA 4D6IA 5LNRA 4U5KA 1TWWA 5LGXA 1H2JA 3UJ2A 2ZRUA 1HKKA 1WA3A 1K8CA 2FB3A 4MB1A 3AIBA 4NRRA 4EVZA 3QKEA 1MMFA 5BZAA 2ZADA 1K03A 3M0VA 4ZO8A 4AD5A 4JPGA 3S9YA 3OU8A 3W1NA 3MANA 1ZJIA 3MMWA 3TYZA 4NZ5A 1EJSC 3M9YA 4S3GA 3U5UA 2AKZA 2DGAA 4C1NA 1FH9A 4ES4A 3WFZA 3W73A 3LXCA 3ANUA 2E40A 2Z29A 2HBVA 4HGXA 3WF3A 3QHOA 3TN6A 3E74A 2EXOA 3VDHA 2VGFA 3PP7A 4LV4A 4XQ6A 4IP5A 2FMNA 3CHDA 4DZHA 4UTWA 1AH3A 2PTZA 3U4FA 4IXXA 4ICMA 3SQSA 4RV3A 4V1XA 2X8RA 2E9LA 2PDQA 1Q6CA 4QAIA 4B2DD 2YCLA 1BAGA 3IK4A 2YL6A 3P5ZA 4YNGA 1VYRA 3AHXA 2EQDA 1HGWA 4L6OA 2VZUA 1Q6LA 3QV9A 2QV5A 1TQXA 1YXDA 3VILA 1OF6A 2CWXA 1EJ7L 1X1OA 3HURA 4GJJA 4N9BA 5G2HA 1DORA 3U5YA 1POKA 1M7XA 5A8PA 4J7RA 2VEMA 3UG4A 3O63A 1X8FA 3T2PA 1XQKA 5G1YA 5DBTA 4HPGA 1OK6A 4OTKA 6CGTA 5FEPA 1UC4A 2E5CA 4W88A 1RLDA 1S2VA 5A8OA 5AY7A 4W8LA 1ELSA 1Y5WA 4L61A 4C6DA 4DJEC 3MWAA 4PCSA 3PUGA 1X1NA 5F1UA 4HB7A 4LF1A 2XGZA 1S1RA 5DCBA 4D6JA 4PTVA 4Q4RA 4TQTA 2F2HA 3MS8A 5I06A 5AYYA 1DQWA 4KT2A 1VGAA 1BTCA 1Z3NA 4TX8A 1O95A 3A3XA 4WHBA 3W85A 2ZUUA 3L5LA 4LUYA 2WSYA 3TA9A 4I7WA 2VOMA 3TSDA 3E0LA 1EPVA 1B0IA 4ZSTA 3O07A 4LH8A 3LGDA 2CZ5A 3EOEA 4WDTA 3ZOAA 4B5VA 5DRIA 5DF0A 5LYRA 2VZOA 1JZ8A 1UOKA 4QJ5B 4HSOA 2GJRA 4QHRA 2EPOA 4K6AA 1CECA 3DCPA 2YYUA 3A12A 1S5TA 1VFUA 3HM7A 5GNZA 1WUFA 4BQ3A 3PJWA 2ACUA 1H60A 4OJYA 1XIBA 4IXHA 2WMIA 1R0MA 3UP8A 1ODZA 3ZT5A 4C65A 1EZ2A 1MZRA 3DFOA 3NQFA 4XZBA 3NZ1A 1PX3A 3QMRA 1DJGA 3UR8A 2ZZ2A 1TX0A 3PZVA 4LEFA 2OJPA 1TWIA 1TUXA 1LLOA 1GT8A 4ZFMA 4AEEA 4X2PA 3AICA 1LDCA 5D09A 4LUIA 3PUDA 3CIWA 4Q8WA 3LBMA 3UYIA 1DWFM 4HCHA 4WKHA 3SY8A 4NVTA 1E4IA 3PF3A 4IMGA 3VABA 3BJFA 3GU1A 1Y5VA 4W8AA 5HNNA 5XINA 3HMJG 3WDHA 2P50A 1TRDA 2OO0A 4LOCA 3CEUA 4L4OA 3JRKA 3WLKX 1TCDA 3WUGA 2XH7A 4JZ5A 4LT9A 4WVXA 4PL1A 1S2UA 2J7BA 3AIVA 4OHQA 3OBKA 1TCMA 1IZJA 3WNNA 1HP5A 1DIDA 1JDCA 3A3HA 3C2VA 4JIEA 3RU8X 2WKLA 3WJXA 4HNVA 4M6VA 3CPRA 2UY2A 3K8KA 1VF8A 2HK0A 4L6HA 4MMWA 1M5WA 3LCXA 2AMXA 2EPHA 4XKYA 3IVTA 4ZB5A 2FPTA 3MVTA 2NSXA 1R2RA 4O8AA 2OVLA 4KFPA 1T6MA 4Z2HA 1K8XA 3BG9A 1FWJC 1E1CB 3H4WA 1SFSA 4O57A 1PTGA 4BR1A 4LBRA 2PWEA 1IEWA 1PZ3A 1H0IA 4MKSA 1U5JA 4BI6A 3W7OA 1LWJA 4DWSD 1GKPA 4CQCA 2I5GA 1GEQA 1VAHA 4AC7C 2Y5EA 2DVUA 4CUCA 1EGVA 1Q3NA 4M7TA 1I6NA 3TR2A 4J28A 4QX4A 4MNLA 2DSZA 7CGTA 1OQFA 1S3TC 2Q09A 3DXIA 4C6KA 3CK5A 3VGEA 4HHLA 3CUXA 4PMNA 4LAZA 3EPMA 3UJEA 4S3FA 2VX7A 3S4TA 1RY8A 2ZKMX 3QV8A 1SFTA 1VR6A 4E2VA 1EF3A 3XINA 1GOOA 3WIJA 2YLLA 4R7JA 4YS1A 3K13A 1WP6A 4OECA 2WMFA 2O4QA 2Y2WA 4LAUA 2FH6A 4G7EB 3WNKA 3OQ8A 2YDAA 3DGBA 4JKMA 1KGWA 5D32A 4JNZA 4MYAA 5D30A 1UD8A 2GVEA 1TIMA 1JGMA 4A6GA 4MB3A 1EYWA 2XHYA 1XFBA 3CZGA 4UFKA 4ZL1A 3S5YA 2FVMA 4Q4OA 4RZ6A 5C9XA 1ML1A 3BZGA 3HJEA 4AZHA 3IUHA 3H26A 4FLQA 5KETA 1QHOA 5HDRA 4YWSA 4UNKA 3IAPA 4NJHA 2QEZA 2VRJA 4FOJA 4Q33A 4UR7A 3BGGA 3TC6A 1JNEA 5CPMA 1IYXA 1QO2A 3PJTA 2V3DA 4J40A 3M43A 1XJBA 2G5WA 4PGLA 3SUTA 5D02A 1EWEA 1YRRA 4J1OA 4DUVA 3GC5A 2FPVA 1OF8A 3NM3A 4PBEA 3UXKA 3KOXA 2ZXAA 1OEPA 1OINA 1TWZA 1UZDA 4RPQA 3ZIZA 2WZMA 3EB4A 5I5RA 4MFDA 2ZXQA 4ZE4A 4HP5A 1HKVA 4CD6A 3W87A 1MVYA 3SY5A 3S5NA 4UFHA 3FKKA 4H2CA 4IX0A 4L56A 4IMFA 2NXGA 4RKAA 1WZAA 3MV11 4QG9A 3WG6A 4JTFA 3LHWA 1DJXA 3GW3A 1ZGDA 4J3ZA 5LZLA 1RLCL 3IIZA 3MA8A 2J9YA 5D05A 1UASA 5LNVA 5DEZA 4NYUA 5I78A 3B4UA 4JYFA 1X6LA 1QO5A 2G50A 4CNUA 1N8IA 5DBUA 1GQIA 1GZGA 2AMGA 2FVLA 7XIMA 1ZSXA 3H53A 1DL3A 1C91A 4W85A 4PB5A 5T8GA 2RJGA 1PV8A 1MXGA 4IGSA 1SZEA 1H5VA 5HBFA 4M1RA 2R24A 1IZCA 1GOMA 1JCYA 4AD4A 2PDUA 1XLDA 1Z41A 2ABBA 3BUVA 3NQ8A 3GTNA 3N17A 2J77A 2RDWA 3AIUA 3LCHA 3UBPC 1QATA 1J6OA 4GQBA 4Q8NA 1TYGA 1Q2SA 5D9MA 3BV7A 1TPEA 1O7AA 2VC7A 3T81A 1QK0A 2Z4GA 2ISFA 3AHVA 3E96A 3GXFA 2X7VA 3P60A 1OFOA 1Y8BA 5IRPA 1Q13A 4FR1A 4QDWA 3DOPA 1UR8A 3UNDA 3EWYA 2QUNA 3G24A 2VDHA 1X96A 4QSFA 1IGWA 1YXYA 3IANA 1I4NA 2YZ5A 4XISA 2Q8LA 2QAPA 3AU2A 2OEMA 3D0CA 1XKJA 1I9CB 1JDEA 3C52A 4NYYA 5LA1A 4QAWA 4ROQA 1QT1A 4CGTA 2DZBA 3N14A 4OU1A 3FJ4A 5CGMA 3LBOA 1C92A 2RDUA 3R25A 1ZUAX 3O2LA 3SCOA 2OQYA 3W7GA 4XKYB 1E56A 4L9YA 1VLWA 3OEXA 5EYWA 4JICA 2NV9A 2JQXA 1BYBA 1A5LC 3VTRA 2WSKA 1WDSA 2OSYA 4US5D 2X1SA 1CXHA 4IHCA 3W86A 1EJWC 3TYDA 4YYCA 1RD6A 4N9DA 4CD5A 2QUTA 4RW5A 1DEDA 2X7WA 4ZO9A 4H9YA 5DN1A 3KCLA 4DJDD 1W1TA 3B0YA 3R89A 3S2JA 2GDQA 4XBSA 1GHRA 1FWEC 3PVFA 2FHBA 3IWPA 4N9EA 2GPTA 1E4LA 4KH2A 1M6JA 4HYRA 1T96A 1GHSA 1QTWA 3I6RA 3NO3A 5EBAA 3SCPA 3W7IA 3QSRA 3H2CA 4GIRA 3RK8A 3V0TA 1LUCB 3VGDA 1XLEA 1GTHA 4HBKA 1YPXA 3BARA 1SPQA 2JGYA 4S2CA 4WDWA 2V5KA 2WCSA 1U5VA 2Z25A 4UOZA 3TROA 5I0DA 4ATLA 1PDYA 1AQ0A 3GYEA 1KD0A 4N2YA 2DZWA 1DJYA 1TE6A 3ANYA 1MNZA 3TYUA 4IPNB 5LXEA 4QSHA 2LLEA 3ICJA 4GG9A 1XPGA 2WJZA 1KR0A 1XIJA 3C86A 4QEEA 1XR2A 4MDOA 1IT8A 3TJXA 3VO0A 5FJUA 4DI9A 3K1DA 1BD0A 3ARWA 4IP4A 3W7CA 4AAJA 1EIBA 3U6WA 1DJQA 4RK8A 3VOCA 4GRSA 3TQKA 1F6KA 2C0AA 2PSNA 3LSBA 2OYLA 3FJLA 3IVSA 3UU0A 3VFCA 4DUOA 4ZFCA 8TIMA 3PWIA 4IGHA 3EWDA 3EOUA 3ES7A 5AHIA 2CBUA 3V35A 4A05A 4LVFA 3M0JA 4JTAA 4ZQMA 1S2TA 2XN2A 4ZBCA 5CPNA 3MBDA 8RUCA 3VC5A 2DVXA 2GGJA 3TW9A 3V4BA 1C7SA 4M6PA 2I5QA 5BOFA 3BGJA 4NAEA 5A94A 1HZYA 1FHLA 2EPNA 3QQ0A 4ACZA 3LXAA 3GR7A 4FX6M 1SMAA 4HZMA 1S5WA 2A85A 1NDWA 1WNOA 2NLIA 4NRSA 2C91A 3OVPA 4ZR8A 3AS1A 2QHAA 4DWDA 3N3MA 2JGQA 3FYPA 4RXFA 4F0SA 2WCGA 5L9FA 1KBJA 3FN9A 4HMNA 1VFLA 4LSBA 3VCCA 1QW8A 2EHHA 4HHHA 3L4YA 1A80A 4PEKA 4LC8A 3HGSA 2DORA 2INZA 3AZRA 3VMNA 3FDKA 3HN3A 4XZWA 4HTYA 1NFPA 5C0QA 1QAPA 2AKMA 3W1PA 4Q4KA 1VBJA 3BMWA 1JDDA 1HQTA 4O1EA 2VT0A 2PLCA 4HA1A 2R1KA 4W9TA 4TU1A 4Q8MA 3H2OA 4BWLC 2VVNA 2C71A 3CO8A 3COTA 3ONBA 3W0KA 3JZEA 3LZ5A 7A3HA 3GH7A 1Q4WA 3TQPA 3HGRA 3SURA 3MKKA 1WBJA 1AH4A 3PG9A 5C9RA 3ZYZA 3CQ0A 4ZSUA 4ZEPA 1AMYA 1G67A 2R9RA 3P7YA 3WH6A 3LA4A 1FDJA 1JXJA 4CQ9A 3M0KA 4GCAA 4FHAA 1M68A 4D1JA 2VGIA 4M0XA 3NZQA 4I5XA 1UD5A 3MSDA 5D9OA 3FNDA 1C8XA 4MKNA 1UR3M 1LG1A 4S38A 5D9PA 3O0KA 2A3HA 2XM2A 1SW0A 1DTUA 4BJHA 3OA5A 4H2HA 3S1XA 2I16A 1MFVA 2FFIA 2ZVIA 4LYKA 3HIJA 2DZSA 4XTIA 2WVVB 3LRKA 5HWNA 4F2UA 4QEHA 2E67A 5JU6A 3LCFA 3K4AA 2YFNA 1OB0A 3CHEA 2BY3A 1OFQA 4P8UA 2VENA 1DJWA 5KZEA 4DJDA 1UH4A 3Q37A 4FALA 2EG7A 5TAOA 4EPEC 3DENA 2VYOA 4XZ9A 3PN8A 1W5QA 1LROA 4UMCA 2I9EA 2J25A 1JGIA 1UYQA 1ZHAA 4WSJA 1T8QA 5FJIA 5IDIA 3PK7A 4ZQPA 2NW0A 2WK2A 1L6YA 4LTSA 5M1TA 3VOJA 1VC4A 1AH0A 1SYTA 2DU2A 5EMUA 2Z1VA 2HBXA 2XVLA 4OZOA 1J5SA 1V8EA 4FF7A 1LL4A 1NTHA 1K77A 2ZE3A 4ICNA 3LHVA 4PB4A 3FYYA 3GDMA 4KEVA 2GOUA 4NZ3A 3B8UA 3I7QA 3DFPA 3HPAA 2BASA 4HNUA 3TC7A 4GUJA 1CXIA 2Y0FA 4DXXA 4CU7A 1XF0A 3CHVA 4Z2LA 3U2CA 2WHLA 1FXQA 1Q7ZA 3EEGA 4WXZA 1NF7A 4NQ1A 1UPMB 1XP3A 2YBTA 4KKXA 4GI8A 3N12A 2DV0A 1O1HA 1WQ5A 3OZPA 4U3CA 1XLAA 1EJTC 4NP7A 3ITTA 1W3HA 3LEPA 1V3JA 3RITA 4LRTA 4WJXA 3OG2A 1YQ2A 3AYTA 3FAXA 5JVLA 3AXIA 2FJUB 1UW9A 2EEXA 3G3MA 3UVAA 4JDBA 2QLYA 4HQVA 4V28A 1VQTA 2ZRZA 2VR4A 4JFVA 3CL6A 4Z1CA 3ARXA 4S3JA 5FF7A 3F5LA 3G1SA 3M0MA 2BDQA 2XN0A 1XIIA 4L9ZA 4I9TA 1YE6A 1ZPTA 4ZMGA 3STCA 5BWFA 1WDQA 3LNPA 3AIWA 3ZSTA 4CU8A 4IFRA 5ECUA 4I8YA 1E9YB 3DFQA 2XSXA 3DFYA 3D46A 3EDJA 3KS5A 3VFLA 5LHFA 5H1WA 3G22A 1S1PA 1NQKA 2VFDA 2E0PA 2J62A 1DTNA 2WSPA 4LVAA 3I7RA 2WHJA 3KXQA 3C2FA 1S5MA 2C79A 3OZOA 1FTXA 2HPMA 3N4FA 4JFWA 1DQXA 3LN3A 1XW8A 4B5XA 4PMRA 2C0HA 1UBSA 2D2GA 3RGTA 3NCOA 2XFFA 3VGFA 1VFOA 2BSLA 4AYSA 1PHQA 3URQA 4DPPA 2Y7DA 1PXGA 4CNOA 5DMLA 5EKYA 3DFHA 1OFEA 1PTDA 4PMUA 3U7BA 2FGBA 2F9RA 1QBBA 3C56A 4IPIA 4MB4A 2Q02A 4GFIA 2ZUMA 4RL3A 3L2MA 5F4XA 4JHZA 3W26A 4HNOA 1AL7A 2DSKA 3W7RA 4C6PA 3MI6A 2CXEA 2ZC1A 3MYOA 1HJXA 3SECA 3A64A 3WBEA 1R3RA 3B06A 2QJJA 4O4WA 5G5IA 1HGYA 2X09A 3VKCA 5B7YA 4DXKA 1W1ZA 3SCNA 3EOSA 3II1A 1H62A 3KTXA 3VNJA 3R79A 3QY6A 4TVDA 1IEIA 2FGZA 2WKGA 3RDKA 1BF2A 2VZSA 4LYPA 1TR1A 4LS0A 3M6YA 4WGXA 2EKGA 1QI5A 3ARVA 4XVDA 1EC7A 3MT1A 4US6A 1KA9F 4NNCA 4IQJA 1W0MA 4AY8A 1KW1A 1XIHA 3VOFA 1W37A 3I68A 4ICCX 4LS2A 1I60A 3S8HA 1VHCA 1OX5A 2AL1A 3PBWA 1O5RA 3GX9A 3VD9A 1HJUA 1LL6A 2YCJA 2I7GA 1FDZA 5HNTA 2VFFA 4LU0A 5FF2A 4YU1A 3LCLA 3M46A 1PUDA 1QI2A 4D6GA 2GVYA 1TZ9A 1KBBA 5FCZA 3VNYA 4J3WA 3IJDA 2WAGA 3WLRA 3STEA 3U4AA 5KZDA 3PG8A 4I9MA 1WUEA 2AOSA 1NOFA 4HZ6A 3FOKA 4EK7A 1KFWA 2YBUA 3A4XA 3LB0A 4UTLA 2PUZA 5AHMA 2E25A 4MWAB 3UG5A 2ACQA 1M04A 3B0XA 3VIMA 2PDGA 1GQKA 4LYQA 1UBPC 2Y62A 3APGA 1UD2A 1THFD 3NTYA 1UR2A 3BMXA 3HF3A 3MB9A 3LTYA 1MW2A 4E0CA 4D1IA 2R1LA 2GQAA 2ICSA 4J2MA 3PWAA 5C9ZA 2O92A 3IJLA 1A4MA 4ML4A 3BW4A 3DERA 3OGSA 2F6KA 1L2UA 1B4KA 1O94A 1Q6RA 2P1FA 3KX6A 1MW0A 5DELA 3FLUA 4Z08A 3SJ3A 4LV9A 4UBPC 2YLAA 3ITXA 1XLKA 3TYAA 1AZ1A 3BLKA 2FIQA 3KDOA 2EPKX 4LF2A 1NQ6A 2E7FA 4GO9A 5EMJA 3W4RA 1FCBA 1NU5A 3KHDA 3DZ1A 3WMSA 1RVKA 1P6CA 2C15A 3KP0A 3VOGA 2E77A 3GG1A 1EA9C 3WBXA 4JXCA 5EB8A 3UZXA 1XLJA 2AAAA 3OLDA 1QBAA 2DJXA 6TAAA 3VIGA 2XGBA 4YXGA 3PS7A 2ABAA 1Q5MA 4C90A 2PU0A 3MUXA 2Y61A 3IRSA 5ENLA 2VCCA 3UZ5A 1Y5XA 2Z1XA 3GTIA 1BF6A 4YJ5A 1MDLA 3UG8A 3CMJA 2XUCA 1YTEA 4S1FA 3SGGA 2W79A 4OGZA 2ZWYA 4DPQA 3HQNA 5FI8A 3BGAA 3NQVA 4BK9A 3BICA 3IPWA 4RPPA 3DU0A 4MYXA 4JFUA 2V3FA 5CC6A 3T44A 1RBOB 2BNJA 3C2RA 4JL2A 3GDKA 4NXKA 3O3RA 4TR9A 3UZZA 1RXOB 1R7AA 4MZ1A 2DQWA 5AHLA 3MDWA 3WMLA 3U2ZA 1F6PA 4JTKA 4DYJA 3QRHA 4JKLA 1GOIA 3MCOA 2CC0A 3CAWA 2GOKA 4NI3A 4H9UA 1VPQA 4AFYA 4ZOCA 2A6NA 3TZFA 1K70A 2Y85A 3AYRA 3N29A 2BV9A 3W84A 2D2OA 4Y9NA 3SFWA 1Z8AA 3WD2A 2OLHA 2VEFA 1XH2A 1IEVA 5C70A 1XPYA 2FTPA 3INPA 1OY0A 1QASA 1RSCA 5FIPA 4RZ5A 3W6MA 1CGYA 4KW2A 1ECQA 4XIAA 3W1LA 4ZTYA 2QAFA 1EWDA 1JEZA 3BWWA 1SJAA 4ZTXA 3NQDA 4DWSC 3CZJA 2D2HA 4GBUA 4PODA 4AY1A 4N9CA 4Z1YA 3VE9A 3CWNA 1XYLA 1TV7A 3QN3A 2FZ8A 3LI1A 4IGMA 1E0VA 4O52A 1K7XA 5IM51 3E0VA 4I3GA 2QCEA 4M6UA 1BRLA 2OLSA 5F2IA 4GVGA 2NQJA 3WBWA 3FGCA 3EYPA 4ERGA 4A3RA 1GQJA 2VEGA 2V6AA 3LHUA 3GRIA 2AGTA 4IGNA 1OYCA 4K3ZA 6REQA 2C3ZA 3ZXWA 2X05A 4HOXA 4R7WA 2CLEA 1N8WA 5REQA 2GUUA 5F2LA 3WLQA 2Y7FA 3W2KA 5LXXA 1X38A 4GI4A 3DIPA 4UUIA 3S1UA 4QS6A 4FNQA 4ML9A 5A8MA 3PZIA 4S3BA 3ZJKA 5H8PA 3KRBA 3HPZA 4PBGA 3UFYA 3QBUA 1E9LA 4NAFB 1M65A 1W3KA 1JDFA 2RGLA 4M51A 4N7QA 3IUDA 4ZVJA 5TBOA 3QKZA 1P6BA 3TK7A 5BROA 4ZOAA 2O56A 4H04A 4HZ8A 2DIJA 1B5TA 4IZGA 4AY7A 3WO8A 5D2TA 4HYVA 3LPOA 3R0KA 2BHZA 3NR0A 2YGYA 1LQ0A 4QITA 5HANA 4S3DA 5JXQA 9XIAA 2VX6A 3TLLA 4WK9A 3PZGA 5EFFA 3REQB 3P14A 1TJ0A 3S6OA 3C2OA 3SCVA 3MW7A 3ABXA 1G94A 1ZY9A 2YW4A 5HNRA 2WBKA 1D2KA 3GHSA 3RLUA 3TNBA 1DPMA 1CLXA 2VM8A 5F2MA 4CLMA 4IG2A 1KFCA 3BURA 4B91A 5LNSA 1C93A 1MXSA 5D04C 3KVKA 3SO7A 2DEPA 3VNIA 4CNNA 2VURA 3GSMA 1D3GA 4D8AA 1A5CA 3GNXA 4C91A 2J9XA 1A5UA 4GNJA 1FX6A 4C6BA 4NI8A 1LCOA 1J6PA 3PBUA 1W9BM 4C7DA 1N2VA 1VJIA 1PWMA 3AAMA 1BSIA 2E68A 2QPUA 3W00A 4AG0A 3NQGA 3SADA 3WY1A 3CIXA 3WMCA 3G1DA 3WF0A 3VUSA 3BG3A 1SMDA 1JULA 3WQ4A 4P7RA 1J2WA 1NVMA 4DELA 4JL1A 3IIVA 3AWOA 1A50A 3BLFA 3W7MA 3CO4A 4NNAA 3KEHA 4PEEA 3F4CA 4JYDA 1KXQA 2TAAA 2E4TA 4NT0A 1AQHA 3UJSA 2PPGA 1LOSA 4JNMA 4QE4A 4B3ZA 3TXVA 2FFCA 2WZHA 1OCQA 5HXMA 1D7FA 1B4EA 4L4MA 4QBXA 3WH8A 1GVFA 2W91A 3LPPA 1FH7A 3S1GA 4DJDC 3LLXA 2P8CA 2ZUSA 4PTMA 1XWYA 4HU0A 4QCFA 5JBFA 2Z2AA 3VKBA 3TEVA 3NIYA 1SO3A 4E5TA 1XLLA 3CB3A 1EH9A 3V1HA 5CBIA 3I4KA 4AISA 3VAVA 1NOWA 3ITCA 4BZYA 3RN6A 2WKJA 2Y4SA 1QPOA 1X7FA 4ENLA 5LKYA 2XFRA 3L4VA 1E71M 1P43A 5GVJA 3A5FA 5BWAA 3KBWA 1CTNA 5E9AA 4F3HA 4DJFD 3T6CA 1CPUA 4KFNA 3ITLA 3GIYA 2FZMA 3RAOA 3GTFA 1NAL1 2C6QA 4JTRA 1ICPA 1L6FA 2J78A 3S6TA 1TX2A 1T8XA 1JCXA 4PB3A 3AZSA 3O06A 3GXTA 3FVDA 4CQBA 3QVQA 1I2OA 3I3DA 3VOIA 1J5TA 5BNKA 1RH9A 4HTBA 2VVSA 4KCVA 2Y8KA 1UR4A 2OCZA 4GNKB 3ARYA 5HPOA 5FA5A 3G0UA 1D9EA 1EPXA 3KOYA 3WQGA 3DBNA 1CXFA 5KSWA 4Y2WA 3VIKA 4BF7A 1K1DA 2ZZ1A 1V7YA 4HPHA 4S39A 1NDYA 4S3KA 2V2HA 1U5HA 1TPVA 2NWSA 4PBFA 3H24A 3W7EA 3QQWA 4IH3A 3URAA 1IZKA 4GGBA 3CTLA 4URIA 2ZA3A 4GINA 4TVUA 1NFBA 5D2YA 1BWLA 2WPGA 5BU6A 3U48A 2WQDA 3SIMA 4GXMA 3R8GA 1K4GA 2ZFAA 5BRQA 8XIMA 1JXKA 2CESA 4B4FA 1GGOA 4FX8A 4C5YA 3SN4A 4R34A 1A53A 4MLRA 1X6NA 1E51A 5I6SA 1FVPA 2PDPA 4MAVA 3B40A 2BVDA 2O9RA 1XM3A 3TDFA 3NSXA 1FWHC 2JKEA 3HQPA 4QLKA 2D24A 2EPMX 3F5KA 5EMYA 1AW5A 3IV8A 4IPPA 4QE5A 1TSIA 3HGOA 5CG7A 4GHRA 3BCFA 3G0SA 1EL3A 1K6WA 2XWEA 5IBXA 3NFUA 4TIMA 2V68A 1IF2A 5CJ5A 3N11A 3ZVHA 3IJ6A 3F2DA 3B9NA 1XLHA 2DZAA 3TH6A 3UWEA 2BMBA 1I45A 2WZTA 2R94A 2W62A 3CGTA 2CKSA 4GJ1A 2GGEA 3CPUA 3EA1A 2E8ZA 3AXMA 2DT3A 4D8LA 1UIPA 1KM1A 1O12A 2Z2UA 3PR2A 3M41A 3YPIA 1OG6A 2DJLA 5U4NA 3LLDA 1PIIA 5TIMA 2YA0A 3W88A 1UJPA 2PZ0A 3OOQA 4KPLA 3LERA 4HOZA 2OGJA 3BCJA 3FEQA 1XIFA 3W1XA 3FYOA 1MDRA 4DAFA 2PI6A 1TG7A 4IG2B 2RH9A 4DJEA 3M5ZA 3GUWA 1GOWA 3NWRA 3GNRA 1EF2A 2V2CA 4L5ZA 2E5DA 2PGWA 3TMQA 4L1XA 1PO9A 3DI1A 1KFKA 4F9DA 2PU1A 2OOGA 3T8LA 1B57A 3AC0A 4U4MA 4H9VA 4Y9PA 2BXZA 1JUBA 4M81A 5GNYA 2WC7A 3ELFA 3DG7A 4GI6A 2MANA 3GNPA 4FNSA 3NDYA 1GG0A 2GZXA 3EKZA 3W2NA 1G5AA 1ZCCA 1YLVA 1QW9A 1S38A 1HVXA 2WZEA 4OE7A 3AHZA 1MRAA 3KL0A 4MOZA 3TNOA 3ZFHA 5CC5A 1F8MA 1UWIA 2Q6ZA 2X40A 3T0TA 1BGGA 3OVGA 3PTKA 5JIWA 2INFA 3NNTA 4HK5A 1TA3B 2YJQA 5EL1A 3ZM8A 4BI5A 1TVLA 3C0SA 4WZHA 3K2GA 4KETA 4B3LA 4WEVX 2CYGA 2Z24A 4BHYA 2J9ZA 3WCZA 1KWKA 1RZMA 3EMQA 1B3XA 1LQAA 1VCVA 4DUWA 1Q7MA 3C8FA 2XDFA 4KERA 4GX8A 3WD4A 4GUGA 2OU4A 2NVDA 1H7OA 3GXPA 2C1IA 2CHNA 2CLFA 5J04A 3GC2A 5FEXA 2WSRA 2QJNA 4AZGA 3HG4A 2O9OA 1R3YA 1A5KC 1XC4A 2A3CA 1JQVA 4JFTA 3LY0A 3LU2A 3LGGA 4HNNA 1LT7A 3AMDA 1VJSA 4FXRA 1P7TB 4A21A 3PY2A 4IFKA 1DKWA 2PODA 2Y7EA 3SUUA 4RNJA 4G2DA 1VENA 5K7JA 3WYZA 1A5BA 1CWYA 4JQ1A 4JTCA 5C7VA 1ZL1A 1ZBCA 4HJFA 2DUXA 2VFIA 3SW6A 4JOMA 2HQAA 1SJBA 3K5XA 3L4WA 4B16A 4UZUA 1LWHA 1VS1A 3EAUA 3FY1A 1BXNA 4Q8OA 4X0VA 1E4MM 2DUZA 3WH7A 1IIHA 3UGVA 2JKPA 2QCMA 1O5QA 3CZLA 1ITUA 1L6SA 1XQLA 5A2CA 3VIPA 2PDJA 1WDWA 2FVKA 2QIIA 2QW5A 3FHAA 2GDVA 2JF7A 4KWVA 4K2SA 2OTDA 1W2PA 1MQQA 3W74A 2KZHA 3QPYA 1H4PA 4H6QA 4F0MA 5DFAA 4G5DA 3MP4A 5BXSA 3CIVA 3LRMA 5I3IA 4F66A 3KW3A 4EF9A 1XKYA 1SVDA 1UOZA 1GK8A 1YE4A 2BS9A 4KEZA 4Q8TA 2YOCA 1FFQA 1QNOA 2XZ7A 4W8BA 4DO5A 1UKOA 4L80A 1KFBA 3WN6A 4IJBA 3UZWA 4BQ5A 4L7ZA 1UWAA 4GLEA 5CPQA 4NNBA 4O11A 1JCLA 5AZ0A 3QGVA 1RQHA 4E8DA 2Y70A 3P67A 3VKKA 1XBVA 1C9DA 3D6NA 2J79A 3FCPA 2ZUVA 1GW1A 3R0DA 4Z0SA 2V3GA 3MKCA 1Z42A 4O18A 3ZJ6A 5JIPA 1XRFA 1UWQA 1W5OA 2REQA 3CUHA 3VVGA 1WKYA 3GVRA 4X61A 2XTKA 3DKJA 1I1XA 3JUGA 4J9JA 3QMTA 4JX4A 3VD4A 1BPLB 2GUYA 3SEPA 5H91A 4N6EA 1ISWA 3HV9A 4NJJA 1A5OC 4DJFC 2HV5A 2ZX6A 3QY8A 4XD6A 4Q4SA 2Z28A 1IIGA 4BF5A 2W61A 3AROA 4LALA 4I90A 3WD0A 1PKMA 1LT8A 1BXCA 2ISWA 4GFSA 4GO8A 4LXFA 5CAKA 2BZNA 1BLIA 2Z1SA 4X0NA 3MHGA 1F3WA 2V9DA 4XZHA 2PFHA 3NSMA 3LBCA 4E3TA 2J7FA 1VIZA 4R7OA 4LUJA 4BKNA 1KV5A 4F4RA 4UQBA 3KDNA 2C14A 5BXTA 1DIKA 1KCZA 4JAWA 3TYCA 3TTYA 4MPKA 3CASA 3OG3A 1JYNA 1I2NA 1EX1A 1TRIA 1VCFA 2XIIA 1D8CA 5DANA 2FZ9A 3VZXA 3W27A 4GA8A 2ACSA 2VTFA 4HN8A 3KRUA 4NUWA 4MF4A 2HJPA 1UZ1A 5BYWA 2Y63A 2A79A 4EPDC 4IQLA 1HJQA 5T26A 1ADOA 4XAGA 2A0NA 3N9RA 3G8EA 4IMCA 3N6QA 1VEOA 3DBPA 4H8HA 4W7UA 3TONA 4AZ7A 4FO4A 4JQ3A 2RDXA 1HKWA 2P76A 1F73A 4GYFA 2WB5A 4XVEA 1JPIA 2CLKA 1WAWA 1GUVA 1TPFA 1TPUA 3OO2A 1R86A 4HNTA 4DI8A 1CB7B 3TYEA 5GJPA 2R91A 3SAZA 3STFA 3VD5A 4BY3A 4DQWA 1ZBKA 6XIAA 2ZTKA 2C1GA 3GR8A 3APTA 4MB5A 1VYPX 2VJXA 3UY7A 1YEYA 1EYEA 3CT7A 1JJKA 4TX6A 3H7UA 2ZBTA 3PPGA 1XG4A 2BVWA 2YX0A 3SR7A 3ARZA 3VX0A 3QJAA 3UERA 4LW7A 4LX4A 2GFTA 3KCJA 5LIUX 1QPQA 3E0WA 5IXEA 4ECLA 1HL8A 3PPHA 1H1NA 3WQWA 3EZ4A 1OIMA 2PZNA 1M9HA 4GZJA 2E9MA 3EEZA 3QOKA 4O1DA 4UR9A 3IGXA 1H49A 4X22A 4UTTA 3E2SA 1NELA 2BLEA 4W93A 3T07A 1O5KA 5BCAA 1Q4NX 4YCPA 2ALRA 3DFSA 4OT7A 4RZ4A 1VRDA 2PEVA 1QOPA 4K1GA 4F40A 3V5CA 4ZQCA 2EBNA 3S2CA 1K7FA 1YIXA 4M82A 1J0KA 3LYEA 5GPRA 1GEHA 1TV3A 1EGMA 1EX5A 1FDYA 3WMBA 3LQGA 2INEA 1E0WA 3STPA 2XVGA 3QTPA 1KQYA 3L21A 4OV4A 1UKTA 3SSZA 3N4EA 4E4FA 4DWSA 2OSXA 1E0TA 2YYTA 3VKDA 4HPJA 4UTFA 5ABHA 3IK2A 3NPXA 1UZ4A 3SUSA 1KV8A 4S2BA 3NL3A 4PRWA 4PUWA 1KC7A 3DFTA 1HN1A 1G1YA 5M03A 4GJIA 4H8UA 1W32A 3P74A 1PEZA 4G1NA 4N4PA 4FMVA 1YHTA 2PDWA 3RG6A 4JQ2A 1QFEA 1XBYA 1QJWA 2VZTA 1R87A 1H3GA 1BG9A 2BGQA 1WOBA 4TV5A 1OC7A 2YXXA 4QDPA 1RQBA 1F07A 1EDGA 2BODX 4DZ5A 2ASHA 2RFGA 3MUY1 2I5IA 3BJTA 3NXFA 3P2VA 2EG8A 1E6SM 2PLKA 3E0FA 1T99A 3WEMA 3WELA 2ZA2A 1QPRA 3UCDA 4A3YA 2AAMA 1IE7C 3IJQA 1SO4A 2FPYA 3A22A 1Q65A 2YDSA 3L65A 2OO6A 4HT3A 4DM1A 3AIQA 2P88A 3U9IA 3L67A 1H50A 1PJ9A 3ZVIA 2W0UA 1FHUA 3MVIA 4J2PA 4MUZA 1I0BA 5DMMA 3NVDA 2DZUA 1Z9AA 1PZ1A 3MMDA 1T41A 1XI3A 2REQB 4V27A 1YDNA 3L2LA 3W83A 2ZXBA 3LOTA 4OOUA 5L6UA 4L4LA 4NJKA 4JQ4A 4KWOA 1XGDA 4EACA 5A6SA 4PMOA 1IGSA 4QS5A 3CL7A 2G96A 4L6DA 4AMAA 2HSAA 3ID7A 4U2YA 3THAA 1X7IA 1VCGA 3PAJA 2J13A 3MMUA 1OX4A 5IOBA 2VGGA 3TXZA 3W70A 4DRSA 3CUFA 5KMYA 3QZEA 1FHDA 4JY8A 5CAHA 2WO5A 1SZRA 4D2JA 4R85A 3RRXA 1E0XA 1E3XA 4XTDA 2ONEA 2R1MA 1UD3A 5DCDA 3IACA 1ADSA 3EX2A 4K7YA 4EXBA 1TUFA 3W7PA 1F74A 2XH2A 2XH0A 4ZO6A 3ZLHA 3HU7A 4NSBA 3TSBA 1KKOA 2HPIA 1HKMA 1BQGA 5DMYA 3RYSA 1A5NC 3EWWA 3GG8A 2QIWA 1V02E 3MSYA 3EPOA 1HXJA 4MIMA 3B04A 3G77A 3PFRA 2L5HA 4AD2A 3C3UA 3FAWA 4GKLA 3CBWA 5CPOA 1FWCC 3LHZA 1AMKA 1GPFA 1S46A 5EMMA 5FAGA 1V6UA 3FHQA 5CXPA 4F48A 4JIRA 3E2VA 3OGVA 2D3NA 4K38A 2OX1A 3L0NA 1ZFJA 4AVNA 3LHTA 1WZLA 2PTYA 4ATDA 2CITA 4C1KA 4YTTA 3UXIA 4AEOA 1VHNA 1MSSA 4MJZA 3MUIA 2HNEA 4H9MA 3GG7A 4GPNA 7REQA 1Z44A 2OB3A 3RLVA 1CZ1A 2YPIA 5AVNA 4QNEA 3N9SA 1VLIA 4PTXA 4UZSA 4RCXA 3ARUA 4W5ZA 4UR8A 4UMBA 1NWSA 2DH3A 4AU0A 4GXPA 2JIEA 3K4DA 3E9AA 3PJUA 4WRHA 1N55A 1UCWA 4CCCA 3ES8A 4MWAC 3T40A 2DP3A 1EB3A 2DT2A 4C6EA 3EDEA 4PSPA 3H22A 3UCCA 4YTRA 1EUNA 3LGEA 3TUUA 5MKGB 1S2AA 4FX7A 4O1BA 1QNPA 4OBRA 4MY8A 4XZNX 2FB2A 3BAJA 3LHYA 2D22A 2PLJA 4WY0F 4GIEA 1OX6A 1JAKA 3QPZA 1EC9A 2G0WA 4P7OA 2BOFX 5HUOA 4W87A 1J18A 1K9EA 2W3ZA 3NQ6A 1UWSA 2CLHA 1TZZA 1QWKA 1V3KA 1EUAA 3VIIA 3WF1A 2G3MA 4W5UA 1BEUA 3MMTA 1PDZA 1HO4A 2FDSA 2WM0A 1EIXA 1YPIA 1VFMA 4MZ8A 1NWRA 1OCBA 3S2LA 5ABGA 1W1B1 1A3WA 1TPC1 3WUFA 2EO7A 3U2EA 3BC9A 3MP5A 3CYJA 2B7PA 2VL4A 5G2IA 3RM9A 1TWDA 4OIFA 1GVIA 3W28A 3GVVA 3QHNA 4Z2IA 4DIAA 1UC5A 3MHFA 3WLHA 4R53A 3ORWA 3L4ZA 1KRAC 1CGTA 2VDGA 1XLFA 4H9TA 2PC8A 4J35A 4AZCB 4RR4A 3SGUA 4U3AA 1LORA 2IPFA 3WD3A 3WNMA 2A2IA 3CZEA 4W7WA 1AFSA 1KKRA 3AJ7A 3MDUA 3BH4A 5HQEA 2UY5A 2W92A 3ANVA 2XVPA 4ZB0A 2PMQA 1PHWA 4H7VA 1ZENA 5J8LA 2G4FA 5JH2A 3WH5A 3RILA 5EA9A 3GNDA 4HIBA 2W5FA 2DSWA 3IGSA 4FLOA 1HKIA 1GVOA 3KS6A 3IIOA 4JTQA 3HFTA 1XSJA 2P0OA 2D23A 3UF9A 3C6CA 4LFYA 2PDLA 1OADA 1PAMA 2YFOA 4JEQA 5LSMA 5CPLA 1RBLA 4X3ZA 4GD0A 1E6NA 1J0JA 3N15A 3GB6A 3VMOA 3W7JA 4GVFA 1NP2A 4D9PA 4J27A 1TELA 3THCA 3NYZA 2XWDA 5M17A 3N18A 1CLKA 3ARSA 1JPKA 1GPWA 4DBDA 5AYIA 4NXSA 1XLGA 1HL2A 5GNXA 3SCWA 1C90A 3M0YA 4K8EA 2PGFA 3BLOA 4MVAA 2GQ3A 4PCPA 3G18A 4F2BA 4G1KA 3OIHA 4B90A 1M01A 3P8JA 3HO8A 1DHKA 3R10A 4UFJA 2B81A 2QQ6A 3MC5A 5FKYA 1PKNA 3BCDA 5HJXA 3RM4A 5C2GA 1WOAA 2C19A 4D6EA 5J5RA 4UFMA 3VYLA 4LAMA 2PGRA 2OLAA 2H90A 4GI9A 3TCEA 2R6OA 1IQ8A 4XIMA 3VDGA 2XIJA 4LGXA 5D2WA 3O6YX 5CPSA 2R1NA 3GTXA 1NM9A 4CN4A 1VJZA 1OSEA 4J3TA 4CD8A 2VFGA 3USZA 4CCDA 3LM7A 3F5JA 1IEXA 2VWTA 3HGJA 3NA8A 4GBDA 4NX0A 3RCNA 5I3FA 3G8RA 3DHFA 4LUTA 3S47A 3LV6A 2IPJA 3TIMA 1W1IE 1ADDA 3CHFA 1HG3A 5AC7A 3N73A 4C6JA 5HAOA 1XV8A 2OPJA 1UQYA 2FTYA 4PUMA 2V38A 3ZMRA 3VDBA 1GVQA 2FTWA 1KB3A 1FKXA 5A6TC 4KRUA 4MDPA 3WDJA 4CQ8A 3N13A 1XG3A 4J3UA 3N6JA 1ZRQA 2DZTA 1W31A 3F7JA 1NWUA 1TJ1A 5H8UA 2Q01A 2GK1B 3L5MA 1ZS2A 2O7QA 4YWIA 3K8LA 3LMZA 3BAXA 4JDYA 3M0HA 4UNLA 2IUZA 2OG9A 1QI0A 3GVGA 1M3UA 2E6AA 5AHFA 2QCHA 3VUPA 3TU9A 3U57A 3M7SA 2WWDA 3PTQA 4MNMA 1TMLA 3W22A 3GY1A 2RAGA 5IFTA 2VELA 4WLCA 3RPDA 3CAQA 3M47A 4H7ZA 3N34A 4LCSA 1F3XA 1RR2A 4GZ7A 3VM5A 3GXIA 2GL5A 2OSWA 1W9UA 3W2LA 3T08A 5G2WA 3WQ5A 1UR0A 1VKFA 1FCQA 3OVQA 1H41A 1I0DA 3V3WA 2G4JA 3GTHA 3OP2A 1EXPA 3UWYA 1ZQ5A 3OLGA 2KAUC 1EOKA 5EGRA 1SZFA 1W8SA 3M5XA 4RNFA 2H9AB 4YHGA 4EP8C 4AHPA 4LY4A 4XK2A 1F3TA 2I57A 1J01A 2AL2A 3G1VA 3QF0A 5F2GA 4Q6JA 5IDZA 1ONEA 5AN7A 1QXLA 1EJRC 5E09A 1HJVA 3W6LA 3ALFA 2Y8UA 1PZ2A 4JFSA 2V8ZA 1FWRA 2E1WA 1SGJA 2JK2A 1V79A 6A3HA 3T1GA 1ENUA 3SQLA 5E70A 1J10A 2J8FA 1R9XA 4S3CA 5CJMA 3HTWA 1ZJAA 4JY9A 1V6WA 1NARA 1H51A 4JR5A 1VFTA 5AC8A 5I7GA 1ITXA 1PS9A 3NGJA 4KCTA 4ALDA 1CLVA 5E9XA 3KUMA 1J9YA 1H11A 3FV9A 3N2MA 1OZQA 3QR1A 4NZCA 2POTA 4YVPA 4IPJA 4A8RA 3LCIA 2WJEA 5CGTA 3PWGA 3W37A 3ZVHB 1Q6EA 2DPEA 3BLIA 1Q6GA 3BDKA 3MI2A 5A8NA 5A6BA 4O1AA 2I56A 2ZZ4A 3RNDA 1P0DA 1O60A 1NDZA 8CGTA 1XSIA 1IR1A 2UZ9A 4XZIA 3E38A 1O68A 2A3EA 4DF1A 3W7KA 1RALA 4NJIA 4UTTC 5FJJA 1OFPA 2HISA 3E5BA 3W1MA 4BEQA 1KCKA 5C5YA 3LCGA 1QUMA 1BXBA 3VIOA 2HWGA 1XYMA 1JCTA 3QOMA 3S9IA 4K39A 5D2XA 4DVOA 1RJQA 2YCEA 2PP1A 4GXWA 1TJ2A 2H6RA 3VCNA 2W27A 3F2BA 1WCGA 4PUDA 1W9DM 2J6XA 1HL9A 1FOBA 3W2JA 3L66A 5I3HA 3UYCA 1EA0A 1WV2A 2NUXA 3IIXA 1B3OA 3QMSA 1RP9A 4HU4A 1QMLA 4XAYA 2PDMA 4Z1AA 2WMJA 3LPFA 3HQOA 1MEWA 4OOZA 4WXYA 4CQDA 1N82A 3BLEA 3WQ6A 3UXDA 1IV8A 1NIUA 2NZLA 2V5JA 1JL8A 2D73A 1B2YA 5FAJA 3CMGA 4NL1A 3RUBL 3RIKA 1D8WA 3KZSA 4FR6A 1AQMA 1BYAA 4ILSA 2O9TA 1PL9A 2A3LA 1KM3A 5HMSA 4NF7A 1LL7A 3TTSA 3GK0A 3AHTA 5FL1A 3K46A 4N6FA 1EFZA 5I3KA 2XYLA 1SW3A 3N2BA 5T9CE 3RO8A 3DYPA 5HQMA 1EZWA 1V77A 3AHYA 1UKPA 3LXBA 3PNZA 5A6KA 1KGUA 3QYSA 2DDXA 2GGHA 2P3ZA 3QPEA 4HNCA 4AHOA 1E1FA 1S3HA 5I24A 4HYWA 1DWIM 1FWGC 3GU9A 4XD3A 1KRMA 4P7LA 1W54A 2CEQA 3W23A 1DQUA 1LZOA 2OMAA 2PTWA 1XLBA 2A6LA 3K4WA 4EPKA 4GC3A 2PDXA 2PB1A 4FXJA 1GYMA 4CCZA 1DOSA 1OCJA 3MSGA 1MRQA 4DNMA 2VI0A 1L8PA 5E0KA 4KWWA 1S2CA 3EA2A 3RRAA 1Z32X 1E70M 3F1QA 3GZAA 2UBPC 3KRSA 4QCEA 4C6OA 4GCXA 1EP3A 3TLQA 3PZNA 1QPNA 4QJ1A 4R88A 1Q6DA 2IQ0A 3M5VA 4HMEA 1PCKA 2FDMA 3NEHA 4LQ1A 5FSEC 2TRSA 3WLMA 5LA2A 3T78A 4UTUA 3A3WA 1LF1A 3SCQA 1W1YA 4MKVA 1C8YA 3ME3A 1B1YA 3TOPA 3LK6A 1QHPA 4C7FA 3OHIA 4IIGA 2CU0A 3HFYA 2XM1A 1QHZA 4QISA 1BQCA 1LRNA 1XSKA 2I9UA 4GY0A 1TJRA 4Y9OA 3R43A 4B9YA 1K02A 2CLOA 2JKAA 1U33A 2QR6A 3OTRA 3ATZA 2VC5A 5D03A 5A8GA 1SFJA 3OPSA 3ZT6A 4UQAA 4FI4A 2OX4A 3CQJA 4LCQA 4KGJA 4E6MA 2OQLA 2Y5JA 1EXBA 4AVOA 3XIMA 3ITVA 4REQA 1UKSA 3NL2A 5DO8A 4NZFA 1TO3A 4E2DA 2CETA 4ERIA 2E6YA 4IQDA 2QKFA 4FAMA 4GQQA 5DX7A 3ABRA 4HVXA 1K9FA 2NXHA 5CC7A 1HJSA 4P7QA 4N42A 3LNMA 3PB2A 2DY3A 5I3DA 1P1MA 3S6DA 1FA2A 3BAWA 3E49A 1GZ1A 3Q45A 1XIGA 4QJ4B 1W3IA 2PURA 4B5SA 3L12A 3UG3A 4US5A 1KTNA 3JVAA 4CNPA 1CGUA 4Z17A 3R12A 4ZQOA 1XDJA 3EWBX 3MWCA 4ADSA 3PZTA 2X1TA 1PWLA 2X2GA 4Y7EA 3T7VA 3FSUA 4CKQA 3N04A 3E6EA 3W71A 2VUYA 1ZBWA 1LWIA 4K8GA 4MWAA 2VUNA 4LB3A 4YTSA 1DXEA 3MO7A 3PUEA 3IIPA 2NWRA 1ITQA 1R30A 2IW0A 5CZSA 3EX4A 2Y6ZA 3E2QA 4XAZA 4F0HA 1ONXA 3POHA 1US0A 1A0EA 1AJ0A 1R46A 1W9PA 1TQJA 3WFLA 3KLLA 4EXQA 5A5WA 1PKLA 4O1CA 2WJFA 2ISSA 3VC6A 3CV2A 2PP0A 3NL5A 2OKTA 4MJMA 4DX3A 5FF0A 1G7UA 3QR3A 2FQIA 3NDOA 5MHBA 3OLIA 4IFOA 2B7QA 2GSJA 1VFHA 1BVWA 3JR2A 3RX3A 4YLWA 3QW3A 4GY7A 2QJMA 3K8MA 1J11A 2J7GA 2PWHA 2ZCGA 1IT0A 3I3EA 2WNZA 4IIDA 4Q3MA 3BOFA 4W84A 4AHQA 4X9YA 4QQ3A 1PIGA 3M5YA 2ADAA 3C8NA 3S1WA 2RJHA 4GVIA 4HK6A 3WLIA 4KIRA 3ABZA 2VWSA 4IUOA 2AGKA 2QVNA 3FSTA 4KMQA 1OD8A 1POJA 1C9WA 2WOQA 3KVLA 2VRKA 2ZZ5A 3O1NA 2OT0A 2NUYA 4W86A 3V36A 1HX0A 1E3ZA 1LTDA 5CSSA 4PMQA 3GVQA 3T0AA 4C5ZA 4CU6A 1AQFA 1G69A 4CD7A 9RUBA 1UUOA 4HA0A 5IHSA 1XIEA 2JEPA 3DUGA 2VEIA 3C2EA 3GXMA 3W02A 1R7OA 1JCMP 1TIWA 1RK5A 3QV7A 2HDJA 4AXNA 4GZEA 3OBEA 1SFLA 2H3DA 2WHMA 4O19A 3PFMA 1TPH1 2CZFA 3WQCA 3C61A 4KF1A 3ALGA 3BSMA 3TC3A 3RO6A 1GOQA 1CCWB 4PMYA 3VI2A 2QJGA 2PDYA 1QK2A 1W1PA 1X6UA 5KZ6A 1XYBA 1QU4A 2QMKA 3TX9A 1H61A 1MI3A 1I2QA 4P61A 1YKWA 4A35A 1TB3A 1MUCA 3EDKA 1XDMA 3VOHA 5JBDA 4PRTA 1S5NA 3EWCA 4MY1A 4ERAA 4PL2A 3AISA 4Q22A 4MAZA 4MLJA 1JCJA 1PIFA 2UV8G 5A6JA 1PVNA 3OYXA 2ZOXA 2CPUA 3TZNA 4IQEA 4A29A 5CPTA 4PULA 4LJ3A 3CWHA 5FJOA 5BW6A 4LVGA 3GDTA 1YBQB 1U30A 3IVUA 2V81A 2JIWA 3Q58A 4XV0A 4PMZA 2W63A 2P3EA 4LC6A 4JCLA 4A3QA 5AFDA 3CC1A 4FP1A 2VHLA 2YDRA 4IIFA 3EB2A 4I5RA 3UWQA 1SW7A 1B3ZA 4YIWA 3ZWSA 2OXNA 1R9ZA 3CAVA 3VXGA 2PWGA 3CEPA 1FRBA 5CBJA 2OZTA 2IMRA 5T9BG 3NPWA 1OJXA 3QM3A 5ABFB 3PANA 3UWUA 4TTUA 1V08A 3VNKA 3LDVA 3QFWA 3UPMA 2EGZA 3WSUA 2G95A 3LTPA 3F4DA 3W82A 5JH1A 5GJMA 1E9IA 3A6OA 1ONRA 4JTJA 1ODUA 1Q7QA 2RHGA 4Y9MA 5FJRA 4HA4A 4Q8PA 3TTOA 3ZLGA 3SRKA 1J79A 3O6AA 1VPYA 4S3EA 3PSWA 2F2KA 5DY2A 4LBSA 3E2RA 3UNTA 3DHDA 4MY9A 2QCNA 3SFKA 2Y5SA 2OR2A 5DXYA 1RCQA 2Q71A 4PMDA 3CH0A 3CXOA 4PUNA 1MXDA 5E6ZA 3BG5A 1H7NA 2YCIX 1UH2A 2YCKX 1W3LA 2I14A 3BMVA 1TREA 1T40A 4QQUA 3D5HA 3BAIA 3WEOA 1I2RA 2VOTA 4DJED 3U3HA 1V3MA 1F7BA 3EDFA 9CGTA 1RUSA 3AIRA 1TE1A 3H4XA 2VNCA 4JX5A 2VRQA 4UFIA 3V5FA 1R8LA 1F6YA 2NSOA 4UFLA 5EMLA 2ON3A 3WQPA 4G7FA 3BL3A 1E0UA 2G41A 3OGRA 4I8DA 5CQ1A 2F8QA 1HF6A 2F6XA 4NX5A 3AIEA 1MQRA 1YTDA 2ZQ0A 1EEPA 3B9EA 1CXEA 4ZE5A 4L9XA 4WR3A 1JRBA 2QPXA 1BGAA 4H9ZA 1CI1A 2VFEA 1KBIA 3B97A 3S9ZA 1EC8A 3PBVA 4U33A 4MNKA 1UWTA 1GG1A 1TV8A 3FKRA 4PE8A 5U7SA 1Z6KA 3R2GA 1GONA 4FXSA 1OG0A 3SGZA 2PF8A 4WCJA 5J5DA 1V02A 1XL9A 3CQKA 2DW7A 4JIQA 3MU7A 5AZ1A 4GE8A 4ZZ9A 1MQPA 3SN0A 2GSEA 4HU3A 4F8XA 1IT7A 1R3QA 1CGVA 4LPCA 5FEWA 4GWEA 4FLRA 1BYDA 4AX7A 4TV6A 1CW2A 2E9BA 1YNQA 1OZMA 3GFYA 4XWUA 3UA3A 4QE1A 3RR1A 2YA2A 3TN5A 3ECQA 4QIUA 1GVSA 4XD5A 1V93A 3S83A 3UGRA 3FA3A 4FNPA 1ME9A 4UQDA 4CN6A 5CZ0A 4YMZA 4ZCWA 4IIHA 1KWGA 3TQ0A 3OA3A 1ONWA 2DIEA 4D6FA 4OBSA 3OBAA 2AQVA 2E09A 2XINA 3LTSA 3WH9A 3EOOA 4TXEA 1OCNA 4TO8A 4OQVA 3OZYA 2PE4A 1DWHM 2ZRYA 3UPBA 4AWSA 5I00A 5A95A 3JU2A 1LP6A 4PCTA 3A24A 2J7DA 4GH3A 4IJCA 2DSVA 1JZ7A 2DQXA 4IJRA 2NQZA 2ISDA 3NEVA 3ONCA 3S46A 1JZ5A 2CZEA 5A3HA 2PDFA 2EJ1A 4MGGA 2ZX7A 4DHGA 1UROA 4AXKA 3GVWA 2CLPA 1WAUA 1CX9A 4DYKA 1DHPA 4YL2A 4H41A 3TN4A 2J74A 4M56A 5D33A 3W7NA