4PB5A

D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with l-erythro-3-hydroxyaspartate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
b'QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNAACATGAQFPAYQALAADGSVQTWERLHGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate.
pubmed doi rcsb
source organism Delftia sp.
molecule tags Lyase
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4pb5A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4pb5A02
2ODOA 2VD9A 2NV9A 5GJPA 2PLKA 1VFHA 4QHRA 3B8TA 4ECLA 4BEUA 3ANUA 3HURA 1NIUA 4PB3A 3CPGA 1FTXA 4AIBA 1EPVA 1XFCA 1BD0A 3N2OA 2NVAA 1L6GA 3NZQA 1SFTA 5GJNA 4BF5A 7ODCA 3N2BA 4XG1A 3UW6A 2QGHA 2J66A 2VD8A 3LLXA 1B54A 4WR3A 3WQDA 2O0TA 5FAGA 4LUTA 3AWOA 4LUSA 4ZGYA 3VABA 1W8GA 2RJHA 4LUYA 5FACA 1NJJA 4XBJA 1TUFA 2DY3A 4V15A 1VFSA 3MT1A 4BHYA 5IRPA 4LUSB 3ANVA 3S46A 4DYJA 3E6EA 3E5PA 4ILSA 5GJMA 2P3EA 3WQCA 1F3TA 3B8VA 3B8WA 1CT5A 3SY1A 4Y2WA 1HKVA 1SZRA 2PLJA 1QU4A 3WQEA 5BWAA 3B8UA 3NZPA 4PB5A 4PB4A 1RCQA 5FAJA 2OO0A 1L6FA 4LUTB 4DZAA 2ON3A 2YXXA 3GWQA 1XQKA 4A3QA 1HKWA 1TWIA 1D7KA 3BTNA 2TODA 3R79A 3WQFA 3WQGA 3KW3A 1VFTA 2RJGA 3OO2A 1XQLA 3C5QA 4KBXA 3CO8A 4FS9A 3HA1A 4BEQA 1KNWA 1KO0A 2SFPA 3N29A 3AWNA
chains in the Genus database with same CATH superfamily
4N0RA 5DELA 3SUTA 1TKKA 4MADA 4N4PA 4E3TA 3WENA 2F7FA 2DIEA 1BVWA 4JX6A 2YCLA 3BH4A 3OG2A 3T7VA 3WJWA 2ZRUA 4DY1A 3B9DA 4D6CA 1LBMA 1YE6A 3G77A 1F74A 4Q4SA 3NQAA 4PCPA 1CX9A 1LT7A 3INPA 1MDRA 2VZUA 1TREA 3IJIA 1SJBA 1JPMA 2VUNA 3E96A 3ZO9A 1JDDA 5CPSA 3GR8A 1Z69A 1TCMA 3I3DA 4HOWA 1IZJA 2ISFA 1BXBA 2BXVA 4KQNA 4M6UA 1XYMA 1GNXA 5JBEA 2IPWA 2VR4A 3UERA 1HQTA 5HINA 4EP8C 4WZHA 3F03K 5E09A 4ZVJA 2JE8A 3RHGA 2FH6A 2HS8A 1T99A 5LNUA 2C6QA 4L9YA 4F2TA 2E7FA 4QBXA 3SDOA 4HCDA 4EF8A 1TWIA 3BMXA 2J47A 1RR2A 3LHUA 2PTYA 3SW6A 2QJHA 1IEIA 3M6YA 4NQ1A 5G2HA 1TTJA 2PDIA 3ITLA 2AQOA 3FYYA 3DYMA 4IG2B 1EDQA 1UWQA 2O56A 4GIEA 3VCNA 2JKPA 2EXOA 3O0FA 4O50A 2GOUA 1HJXA 4Y9NA 4QHRA 3G24A 5LKYA 1Q13A 1GVRA 3E49A 5A69A 4IP7A 4M19A 1GZJA 1NDWA 4KWOA 1F5ZA 1QR7A 3EMCA 2V5LA 6TIMA 3EWCA 1CI1A 4B5NA 3WQWA 1TPH1 5RUBA 4QS5A 3BG9A 5DXYA 1XSKA 3F5KA 1A5SA 4FNTA 4ACZA 5JBDA 1WCGA 2AKZA 3L5MA 4BWLC 2J66A 1RHCA 3TJIA 3OGSA 5D38A 3EX3A 1W3HA 4CN4A 3GNDA 4WSJA 4HMNA 3RUBL 2Z00A 5BCAA 3OODA 1Z3NA 1KLYA 1YPXA 7XIMA 3NG3A 3SAZA 4UTTA 4WIWA 1PIFA 5E1QA 5FF7A 4ZQNA 3L4YA 1ZUAX 4TMCA 4O8AA 2CW6A 1CENA 3GG0A 3W74A 3G1FA 1J5TA 1WXZA 3DFTA 2PDCA 4LCSA 3RU8X 4H41A 1CEOA 4PRWA 4BA0A 3OVRA 3UGVA 3G8RA 9XIMA 1XC6A 3M5VA 3FJLA 3N9RA 2G8ZA 2AQVA 3HU7A 3RPTA 1QMLA 2XH7A 4XZBA 3H2EA 4F40A 3TA6A 2B4GA 3LBOA 3UJ2A 4HSOA 3C86A 1UUMA 3ATZA 2X09A 1S2VA 1HGYA 2ZX5A 1HP5A 2HISA 1LT8A 1JG9A 2BS9A 5FEZA 5A8OA 4MJMA 1YPFA 3DG3A 3MJMA 1HXJA 1DWJM 1PHWA 3N15A 1GYNA 1FTXA 4A35A 4ZZ9A 2LLEA 3W1AA 5ABGA 2YZRA 2NVAA 1UH2A 1PJ9A 2X05A 3GG1A 3HQPA 1OCBA 1BRLA 3WH8A 1I6NA 3RITA 1R30A 4HK6A 1ZP3A 5H8MA 3ZSTA 1EP3A 2BMBA 1POKA 4WSHA 3TWBA 2OWXA 2VZSA 2YCJA 3LA4A 1WYIA 2WLYA 4QE5A 2Z25A 3BSHA 3GVGA 4CCEA 1O5XA 1JFXA 2HQAA 4BFAA 1TMLA 3B8SA 4P5UA 1RZMA 2XISA 3IV3A 3S0CA 1Q8JA 4IPLA 1D3HA 3W84A 3V16A 1F3EA 1PCKA 2FVMA 4GYPC 4A3RA 5KZMA 1SYTA 3STEA 3N3TA 3M7WA 4I5RA 3FEMA 2A79A 3W7NA 1VFMA 3HF3A 4UNKA 1G4PA 1B3XA 3IJ8A 3WZ0E 1ENUA 4MLRA 1S5VA 4MMWA 1T8XA 2DZPA 4G5DA 3IGXA 3QPYA 1F7BA 1ZBVA 2ZADA 3QHOA 4JEQA 4GYKA 3W23A 1RAKA 4DI9A 4E0CA 1NF7A 5GJPA 1KCKA 3CV7A 5A6TC 3RMJA 3NM3A 1CPUA 2VQTA 5M5DA 4UFJA 4LQ1A 3N6QA 3LZ3A 1DOSA 4N42A 1SSDA 4G56A 4U33A 2YBVA 3S4TA 2EO7A 2W9MA 1OFOA 1DHPA 3FA3A 4PTXA 3S6TA 3WDPP 4JTHA 2GJRA 5DY2A 4OT7A 2X41A 1FWFC 4XBJA 1TJ0A 4HK5A 1H63A 1IEVA 3UR8A 3LSCA 1I2PA 1XYFA 1H60A 4H00A 3WEZA 3E6EA 4O0QA 2VX4A 3PWGA 2OZ3A 4JPGA 2YGYA 3W83A 4GY1A 3VMPA 2RKXA 1EX5A 2QZRA 3UP8A 2ZC1A 3PUOA 1H1NA 1F9CA 4PN2A 3AMGA 1NDZA 1UMLA 4QLKA 1CGUA 1JD9A 2ON3A 1E0WA 3K1GA 3PPCA 3QN3A 1KM3A 5FJRA 1FY6A 2PSNA 5CBJA 5EMMA 3L9CA 2QUMA 4F0LA 3SCOA 1B4EA 2OX4A 3P14A 3W00A 4R9OA 2W79A 2XU2A 2YZ5A 4H04A 2C7FA 4GZIA 1AW2A 2DJLA 2FJKA 4ZTXA 4AZIA 1OY0A 1PKLA 5A8GA 3AYTA 1RY0A 4TTUA 1KFJA 1XFCA 4RE0A 4LX4A 4LB4A 2F6XA 2YFNA 2A0NA 3W1QA 1XCXA 1OZQA 2RHGA 3KOZA 3WYZA 2QVHA 2QGHA 4CD7A 3T0TA 5LXXA 4LUTA 2DUAA 1Q6OA 1BKHA 1UP0A 4BS0A 2RH9A 2XZ9A 2Z1SA 1AJZA 2PGWA 2RDTA 5CG7A 3AAMA 5KTLA 2GQ3A 4YMZA 2Y8VA 1XLBA 4G2DA 5F4XA 3S1UA 1A5OC 2VC6A 3MSYA 4RNFA 3WKZA 2XSBA 1CGYA 4TQTA 1SFLA 3G1AA 3N73A 4L61A 4Y2WA 4HT3A 4POCA 1AJ2A 4W8AA 3W6LA 4RXFA 2C79A 3L5AA 1F76A 4MHBA 4NILA 3CHCA 3BAJA 4V33A 4Z2LA 2QAFA 4JD4A 4US5A 1S39A 4BY3A 3ABOA 1IWBA 3VUPA 3T2QA 3W7IA 1XCFA 4N6EA 1V77A 1CGTA 4CD6A 4INFA 4RNJA 3PZ9A 4RZBA 3TNBA 2G96A 3JR2A 4ZSTA 3RJYA 3D3AA 3H7VA 1OADA 4F8XA 1TJ1A 3OVQA 5C2CA 4KIEA 1ZAIA 1VHNA 3KRBA 2G41A 2VFIA 1TPVA 4L6HA 4O18A 4DNMA 1QT1A 3NM1A 2V2DA 3LU2A 3PJUA 3ZMRA 5EGRA 4AWSA 4F4RA 3DHFA 3O9NA 1JRCA 1DIDA 3GK0A 2CZEA 4Z1YA 3PSWA 2QCGA 5TD4A 3VOIA 1NJJA 4A3YA 2PDYA 1XCWA 1H4PA 4IZGA 5CZKA 2DY3A 1RBOB 4H4IA 1QI2A 3PHAA 2Y88A 4GQ0A 3EDFA 2PC8A 3I6RA 1AW5A 4FA3A 4UFIA 4O1CA 5AYIA 4E6MA 4S38A 2C19A 3UJRA 2ZUMA 3RGTA 1J96A 3CLWA 5KEZA 1AA1B 2H90A 4R9XA 1CIUA 4DBWA 1MXGA 2YW4A 1TJPA 1EIBA 3BCDA 3PUGA 1GOXA 1UH3A 2Y0FA 1MEHA 1KM5A 1T0OA 2OB3A 4KBXA 4O52A 3K8LA 1XKJA 3TYCA 4HA0A 1U1JA 3E5BA 2GSEA 1B9BA 5HUPA 2DZAA 3LUTA 5U7SA 2GQ8A 4UQAA 3SCQA 1PUDA 2QNEA 2JGQA 3BO9A 3YPIA 1KCXA 4C6JA 3NPVA 1EPVA 1YDVA 2CC0A 3PM6A 4NL1A 4KF1A 3EEGA 5BOFA 1UG6A 3D3FA 3KZPA 6TAAA 4GI8A 5CBBA 1B3OA 4YWSA 3QPZA 4GMEA 3RCYA 3N25A 4ZQOA 3QC0A 3ARUA 5C54A 2G3FA 2NQLA 2G3NA 3AXHA 1E9LA 1R3VA 1PE1A 1LBFA 2QUUA 4M5PA 5CZSA 2VDIA 2INZA 3DC0A 4OECA 5F4WA 1JDEA 1XRTA 4Q7NA 2UY5A 4ALDA 1FH8A 1J10A 4JY8A 1W2VA 1JR1A 4QG6A 1WUFA 2BY0A 1KFWA 1FXQA 1XLMA 2GQAA 4KRZA 1HO4A 1PTAA 1F4HA 2QAPA 4NF7A 2NQZA 2XWDA 3GZAA 4V28A 3BG3A 4NZCA 2D23A 1F6PA 2CBVA 3S2NA 3WBXA 1GK8A 2WVUA 2WZMA 3GXMA 1XQLA 3WK1A 3C5QA 1BQCA 3TXVA 5LSMA 4BQ4A 2BVDA 5FEXA 5FI8A 4FS9A 2SFPA 3OTRA 2PLKA 2AL1A 4IQEA 5BOOA 1CXHA 1EX1A 2ZX6A 3TTYA 4KCWA 4RK8A 3G6LA 3M5ZA 2W0UA 2A6NA 3BURA 1XHGA 3DGBA 4HTBA 1XBYA 5REQA 2C0AA 2WZEA 3QXBA 1UKPA 2ZQ0A 4GGHA 3QMSA 1MNZA 4LVFA 4JTKA 3S6DA 4XAZA 4LYQA 1DORA 2Y63A 5DANA 4C65A 2V69A 2O9OA 4NG3A 2E77A 3SN1A 3TAKA 1EFZA 3LOTA 5BWFA 3BOLA 1J0YA 5G4WA 3B9OA 3KTSA 2YA2A 4HNTA 1TX0A 3W2LA 3UJSA 2X2GA 4JTCA 3C3NA 2INEA 4AZBA 5TQLA 2FJUB 1J0IA 4AAJA 5EB8A 3OJGA 3GM8A 5AFDA 3TVAA 4TX9A 4GZJA 4W86A 3CJPA 1YNPA 3AYVA 1Z42A 2C8NA 1ME7A 2B31A 2BOFX 4G8TA 5K4ZA 1QHPA 5HULA 3DUGA 2ZRVA 4JFVA 4IISA 1XIMA 2WO5A 4DJEA 5HNTA 4W7VA 4LW7A 3WDHA 1V3MA 4XTIA 3TZFA 3USZA 4YTTA 3ZLGA 3RX2A 1VYPX 2DZBA 3VIJA 2XPKA 3EDEA 5D8ZA 1XFBA 3CTTA 3NQ7A 2R14A 2A7NA 1RK5A 4IL2A 1EEXA 2VD9A 2W27A 4DF2A 1E0UA 5BXPA 1LG1A 1EC7A 5C7HA 1W8SA 2O7SA 2ISDA 1J8VA 2FH8A 3M0ZA 5A8QA 4P8WA 3NAVA 3LB0A 4GI6A 3E2VA 4HZMA 1P7TB 3DBNA 4UTUA 1TQJA 3VIKA 1XINA 4UNIA 3LEPA 1LWIA 5JH1A 4P7QA 4C6LA 2QV5A 4DXXA 5BRBA 4PUUA 3GAYA 3BLOA 2QPSA 1FP8A 1W3JA 4BQ5A 4Z1BA 3TYEA 1WZAA 2EPKX 3EWZA 1A4LA 2CHRA 4J3WA 3G18A 1S38A 4BQ2A 3GDLA 5BROA 1GQJA 2PRHA 2BY3A 3HZ3A 3W7HA 3CQJA 3N14A 4LOCA 2BWGA 3DAQA 2QCNA 4B2DA 2V6AA 2PF0A 4YN5A 2XVLA 3EPMA 3M5XA 4ATDA 5D03A 1ZZMA 4EWJA 1E6PA 1QBAA 3O63A 3E0WA 2C0HA 3W7KA 4IIBA 1QI5A 3R8RA 4FLRA 4YVXA 1RXOB 3VGDA 3KHJA 4GJIA 3WF4A 1BVZA 4PMNA 3BOFA 4I8YA 5U4NA 3W75A 3M07A 1U22A 1H0GA 1RD6A 3H8AA 1TYGA 3CWHA 1UA7A 1X6NA 2POTA 4XSMA 5HUOA 1ZFJA 2XVKA 3PPFA 1NOFA 2W67A 4E3VA 4IIFA 3HJZA 4MKSA 3TV8A 4AHOA 3W25A 2EPMX 2AQWA 2E5DA 3PFMA 1CLVA 3MO4A 3ZVHB 3CGTA 1BG9A 1QWGA 1V6WA 3DH7A 4PL1A 1UWSA 3ARZA 3UY8A 1US0A 4M6PA 4PMRA 2JBMA 4GY7A 2EPOA 2Z1BA 4LWWA 3V36A 3GTXA 3H7RA 3ANVA 3GXTA 4GI9A 4JOMA 3VO0A 1V6VA 4LYKA 2BLEA 4WDXA 2A3BA 5T26A 3ONCA 3G0SA 4PRRA 2W66A 1IR1A 1UPMB 2BZNA 4W8LA 1NM9A 4MAVA 1YNQA 4K3ZA 2GVLA 3U2EA 1N8IA 3JW7A 3GDMA 2GJNA 3S47A 2DVXA 5BRQA 1LQ0A 4WGXA 3WJYA 1H62A 2E5CA 1ISYA 3CH0A 3KZSA 4AH7A 3TFCA 1ISZA 4B5UA 4WLCA 4XWUA 1BWVA 4JDBA 4EXQA 1K70A 2CLHA 3VX0A 2NXGA 1TV3A 1KNWA 4N7QA 2TYSA 2ALDA 4AQLA 1GQNA 3NQEA 2WPBA 5GVJA 4HMCA 1P7TA 5D2VA 4GISA 4Y9PA 2VGGA 3UZZA 1EJ7L 2PCQA 3R13A 1A4MA 1I4NA 3VC5A 3FCPA 3O7UA 3QOKA 4UQEA 3MZ2A 1YBQB 4C6EA 2PI6A 3AISA 3AZRA 3UWQA 1JYNA 4GLEA 1R2SA 3APGA 4AC1X 2J9XA 4W9TA 4YTSA 1L8PA 2J7BA 3OLDA 4MAZA 2PGEA 1I75A 1IIHA 3ZXWA 1QBBA 2H9AB 4V15A 3LHYA 4H8NA 2F61A 4AFYA 3SCSA 3FK4A 3GTHA 2HK1A 2ZYFA 4ES4A 1TX2A 2FB3A 1OX5A 1LZOA 3W7RA 1KM4A 4UMCA 4N4QA 4B3KA 4G1NA 4HU0A 3WO8A 3CH9A 2TSYA 2GPTA 3RPMA 1PTGA 3WLLA 2PDQA 3RFAA 1W5MA 2C1IA 2Z26A 2J27A 3IANA 1HKWA 3NCOA 1YYAA 2AAAA 2WV8A 1WZLA 2VENA 1OWQA 3I68A 2BNJA 3TC6A 1E4MM 4LC6A 4PE8A 4V1XA 2J7CA 4X9YA 2WSQA 3F4WA 4S39A 2DSVA 2WM1A 5EU9A 1HL8A 1V0KA 2WCSA 1DE6A 4R33A 3MP4A 5E0FA 1G9HA 3GUWA 5HWMA 1EQCA 3NO5A 4BCEA 4KERA 4I90A 1SGJA 4J40A 5HPCA 2I9UA 4QAWA 4HA3A 3W7JA 3ZVHA 4UC5A 1AODA 3MU7A 3SJNA 3E9AA 2E1WA 5CZJA 5JXQA 1Q6GA 3WX7A 3ZS4A 2ONEA 2QF8A 4DAIA 5AC5A 3URQA 4Z2GA 2I57A 4ZGYA 5DCBA 1Y8BA 4PTWA 5SWUA 3U8GA 2GFTA 1KXHA 3RMEA 3NURA 1SMDA 4QJ4B 1F07A 4PC8A 2R8WA 1U1HA 4JCMA 4RW5A 3H4WA 1LWHA 2F6UA 3U6WA 4GFIA 4WX2A 3M6DA 1OYAA 4GIYA 2NV1A 4PH6A 3HIJA 1E6ZA 4J35A 5F1VA 1JIBA 3W72A 4O1DA 4GVFA 4TOQA 3F4DA 1JCTA 1HNYA 4W84A 4AUBA 5I79A 1PYFA 3B0XA 3VDCA 4CCDA 5PTDA 1WDRA 2WOQA 4H8UA 1H7NA 1G0CA 1W6TA 4JDYA 3MUCA 1PIIA 3TN3A 3EX4A 1VFOA 4HZ8A 1XD1A 1A53A 3M0VA 2J88A 2WJDA 4BJHA 3OHIA 2P1FA 2XYLA 4IJRA 1GHRA 2C71A 2DQWA 3MA8A 3DHUA 3EDDA 1XIBA 1K8XA 4S3JA 1A5KC 4MYXA 3H7UA 1C8YA 2Y8UA 4HCLA 5A2CA 3LPOA 3TX9A 1D8WA 1NIUA 4PB3A 2PDWA 2VO5A 4XQ6A 4IT1A 3UXKA 3VGFA 1J6OA 3O6YX 5FJTA 2NX3A 1S2TA 1YBQA 4JTAA 4URIA 2OT1A 3BW3A 3HGSA 5KSWA 1KR0A 4K8GA 3S1GA 1AG1O 4NSBA 2OYLA 3UZXA 4YLWA 4WKAA 2WHMA 3WLMA 3UNDA 3WQ4A 2DZVA 2ZWZA 2NX9A 1TWSA 1RJRA 2QMJA 2GGJA 1MW3A 5I3FA 1EJTC 1GW9A 3B9EA 4ZB2A 3NXLA 1JZ4A 5H91A 3L2MA 1S3TC 4FXJA 2CETA 1DP0A 3BLDA 3UVAA 1KFCA 1O5RA 3OZMA 2Y1HA 1OB0A 1LL4A 3ARYA 4OTKA 4PMVA 1R9XA 3UR7A 1BHGA 4L65A 4NP7A 2ZCGA 3CHVA 4JL2A 1EBGA 2GK1B 4MB5A 2ZZ4A 4JTGA 4PFMA 1WZKA 4P2VA 3BV4A 3VIHA 2VVSA 3MI6A 2NUYA 4JIPA 1RBAA 3BLIA 4IJBA 4QJ3B 1VQTA 3R25A 2GGIA 3T0DA 1GKRA 1Q6CA 4BQ3A 1B30A 2E68A 1L6YA 1ZGDA 4WDWA 5LIUX 1W54A 3NVTA 2DZXA 3M44A 4OBSA 1MFUA 4MTVA 3S5OA 1QPQA 4LUJA 1FHDA 1SVDA 5D2YA 1H7WA 3CMGA 4A2RA 1R3RA 2GVYA 5TIMA 3CHEA 1VJIA 4HMEA 1YRRA 4GACA 4JN8A 3MSGA 1OFRA 1IWAA 3GFZA 2QCCA 2UZ9A 4X22A 5EMLA 1MO0A 4JXCA 1UB3A 3LTYA 4JQ2A 3VFLA 5HPOA 1MQQA 1V3HA 3CAKA 1RPKA 1JPKA 2NT0A 1CGWA 1XKYA 3AXIA 4EPKA 3PULA 3HM7A 2DT1A 3PSVA 1V6TA 1NQ6A 4CQ8A 1WBJA 1UD6A 1IV8A 3P60A 3KXQA 3CQ0A 1O94A 3TIMA 3MY9A 2GJXB 1GW1A 1K4GA 3TAOA 3LM3A 1J0HA 3EDKA 4JHOA 3VTRA 2BDQA 4FOKA 1PAMA 4FX7A 2OLSA 3IK4A 1GOMA 4N02A 3PY2A 2WBGA 2I56A 2DSKA 2PDJA 4A3QA 4ATWA 3LCFA 1J5SA 1NU5A 1UJPA 2Y7FA 3ITXA 4OOZA 3ZYZA 3NZRA 1LJYA 1EJVC 1F4AA 4NVTA 4C6PA 1UBSA 3FHQA 1R5YA 1KRMA 3OVGA 3WQOA 4B4HA 3SSZA 3JVAA 3WBYA 3APTA 4NUWA 1E15A 1BD0A 5BMWA 3W27A 1NWTA 1KCLA 2Y5JA 3ZOAA 2OMAA 3UETA 3AIEA 4NT0A 2CKRA 3H2OA 4HHHA 2ZUSA 4KMQA 2C91A 3H2AA 1HKKA 3OBAA 1KXVA 2UWFA 3A4WA 3TMLA 2OTDA 3LMYA 1W1B1 4GGBA 2WC3A 3BAYA 2GZXA 3URNA 1BFNA 4FOUA 2DSUA 2A3HA 2J9YA 3HMCA 1C9DA 1NP0A 1UA3A 3VA8A 2WSYA 4AIOA 2E6AA 1TMQA 4ILSA 4UR8A 3NPXA 1V3JA 5E0CA 3FJ6A 3UF9A 2GK1A 1R3QA 3BUVA 4UTLA 1FH7A 2XIOA 3STGA 4HJFA 4PCNA 4AW7A 1TR1A 2GDUA 1S2CA 4XB3A 4NX0A 1ZQ5A 3DI1A 1WDWA 2ZFAA 3HG5A 4F48A 2ISSA 4AD2A 3DDMA 2QEZA 4ZOCA 4I9AA 4EF9A 4RPQA 4X3ZA 4KGLA 3WK0A 3ZJ8A 1ODUA 1YQ2A 4LALA 4ACYA 3AOFA 4TTGA 1EQPA 4AZHA 2X7WA 1QAPA 5FF3A 1OFDA 3K4DA 2FHFA 3TYBA 4PTVA 4ZQPA 3ABZA 2IXUA 4RUBA 4C6BA 3U4AA 8TIMA 1K9DA 2ANUA 2GVEA 3MZNA 3CUZA 5E5CA 5LYRA 3KWXA 2D0GA 5FJPA 4NXKA 3AO0A 3N2OA 1L6GA 3EX1A 4ZENA 3MPGA 2CIPA 4FNRA 4AB4A 1ZCOA 5C9RA 3WMSA 4DIAA 1OD8A 2GJLA 5LXEA 5LIWX 2OEMA 2C13A 1EA0A 1UZDA 1M53A 2BXYA 4ADTA 2FHCA 1Z9AA 1LQAA 2G97A 3C0LA 3UG8A 3BAXA 3T0AA 1PSCA 3BZGA 2H8XA 3RM9A 1SMAA 2C18A 1P6WA 1PKYA 3UD6A 3W22A 2BSLA 3EYPA 4ZXLA 2YJQA 2ZVRA 3ABQA 2ISVA 1S2AA 3B8VA 3L65A 4RZ6A 1I1WA 5I06A 1K7XA 1XSJA 4ZB0A 4GWEA 1QPNA 4AD5A 3PTDA 2ZWYA 1L6WA 5E93A 3P67A 3BLKA 1FQ0A 4IL0A 3W6YA 3WFLA 4UBPC 4ZTYA 1FUYA 1V7AA 1XGEA 1OIFA 4DO6A 1Q7MA 3AUJA 4LF1A 4UMAA 2NQ9A 1M01A 3AHTA 5CBIA 1W3IA 3J7HA 1ADOA 2WMIB 2DT0A 3KBSA 1WQ5A 4CD8A 3CL6A 4ORMA 4H6EA 4S23A 4UMBA 3O3RA 3UZ5A 3CPGA 3T44A 1EB3A 3U4FA 5BYWA 3W4RA 1KWGA 4AHQA 4ZQCA 1OQFA 4KRTA 5IBXC 4IGSA 1S1PA 1ZP4A 4XVDA 1X7FA 2XGBA 1VBRA 3EX2A 4GUFA 3TN5A 3GBDA 4NX5A 2VDHA 3GH5A 3O6AA 3VM7A 1TPC1 1AZ2A 2Z7KA 3F2BA 2VJXA 3QZ6A 3QHMA 3KM8A 3GC4A 3EA3A 1EYWA 3KVLA 3W7MA 2XFWA 3T40A 1LUCA 3EWWA 1C91A 4BI7A 4JS3A 3L12A 3C0SA 3IAQA 3CQHA 1EBHA 1D9EA 3W28A 1MUMA 4YU1A 1Z8AA 1QXLA 3CZ8A 3POCA 3BWWA 3W88A 3MHFA 3UQNA 3GIPA 4G1KA 6PTDA 4FB7A 4ZA0A 1TV7A 1SM9A 3EXTA 4M6VA 4DVOA 5B7YA 4Z1DA 2FGLA 4K37A 1HVQA 3PANA 1HX0A 4GUGA 2PTDA 1JZ5A 1VYRA 2X2YA 2BVYA 1PTDA 1XYAA 3QLLA 1MW2A 1O66A 2VWSA 4H9ZA 3UA3A 1RQEA 1THFD 2CKSA 2CLIA 3OP2A 2DFAA 2B7NA 2PP3A 4G6CA 1E9IA 3LERA 5FEWA 1R3WA 1XGZA 5F4SA 1B54A 3M0HA 1WE5A 4S3CA 6CGTA 4IFKB 4HSHA 4P7OA 2QXWA 1EYEA 3LBMA 3DKLA 1UWRA 2E25A 3W82A 1RP8A 2HE5A 1P0BA 2XN1A 3Q94A 3F2DA 1J2WA 1HKMA 2BBFA 3GXPA 4LV9A 4FLOA 4PCFA 4GXPA 3LI0A 3LTSA 1T7LA 3M4HA 4IQJA 3CUXA 3SM0A 1FCVA 5FAJA 4QDWA 4HNCA 2Z0IA 4WOZA 3EOUA 1W37A 1O68A 2DW6A 4V27A 4M7TA 1VGAA 4Z42C 3LK6A 1SO3A 4U2YA 4AZ6A 4UIOA 3W7OA 5EMYA 1FCBA 1GKPA 4XIMA 1KFLA 1F73A 3RLUA 1M5WA 3MUIA 4ZEPA 1EL3A 1GVIA 3GR4A 2GUYA 3VKDA 2WMIA 3DHDA 3T6CA 1X6LA 3MKCA 1Q65A 5D32A 2X1RA 4QRNA 4ADUA 5XINA 1FDZA 3WUFA 3E0FA 3MP5A 4FAMA 1I60A 2BHZA 3ANUA 5FA5A 2PDMA 3BCJA 1X38A 3NQ8A 4XUGA 4J3UA 3TN6A 4J28A 1R85A 2EF9A 1JUBA 1U5JA 4MJ2A 3ARQA 2YLAA 4PCTA 4A8NA 3Q37A 5ABTA 1VH7A 2DZWA 2DZSA 5DBUA 2FHBA 4GCXA 2YR1A 3VNYA 4K1WA 2OZ0A 5AC7A 4JTFA 1QW9A 4IJCA 1VR6A 3R10A 5TNVA 3HO8A 1EUNA 3B4UA 2PD9A 5DCEA 3MMWA 3KCOA 5EY5A 1VF8A 3C2YA 4DJFC 3ME3A 2FMOA 4D6GA 3AYSA 4PMXA 5MKGA 2J77A 3DGRA 3MDUA 2JIWA 1Q4NX 1NEYA 1PO9A 3LHWA 3QW4B 3SUWA 1FH9A 3EXSA 1F6KA 4JQAA 4M56A 4Q32A 1XJBA 3C8NA 3NSMA 2XWEA 4F0RA 3VNMA 1AQHA 2IKIA 5KETA 3S3GA 1UUOA 5HMDA 4M6QA 5I07A 2Y7GA 3TOYA 2J7GA 4GX9A 2ZRXA 4RE3A 1ZJIA 5DT7A 1UD3A 3S1WA 2PLMA 1N8FA 3JZUA 2DGAA 2WCAA 4EOUA 1VFLA 4AIBA 2OPJA 2ZXQA 3NR0A 2J8FA 2A3EA 4B9YA 1JD7A 1PVNA 3PPHA 4GQGA 1DE5A 1EC8A 4O13A 1QPRA 5I03A 2BVWA 2D1ZA 1UR8A 4Z2JA 4IFKA 3UPWA 4Y9OA 1WP6A 3EA2A 1LBLA 3O6DA 3CT2A 5EFDA 4M0XA 4ZBCA 2JK2A 4CN1A 4HK7A 2XUCA 5LIYX 1SJCA 3LCLA 4M7SA 4Q8QA 1I2RA 2J62A 1L0PA 1XW8A 2HK0A 3NDOA 3BAKA 3CC1A 1L2QA 4UFLA 2BGNE 2W5FA 3L4UA 1U5VA 1QI0A 4FOJA 4TX8A 3GW3A 1YTDA 2BG5A 1BWLA 4NYYA 2I9EA 1AD4A 1KA9F 4WGHA 2P0OA 4GXWA 4QDPA 3DFSA 4E8DA 1OFQA 4CNNA 3TYAA 3V75A 2XVNA 5I3GA 5J5DA 5LHEA 2ZOXA 3KVKA 4LPCA 4Q8MA 5IHRA 2VRKA 5TBOA 3W07A 1JCXA 1ZJAA 3PPGA 4J2MA 5F2MA 4YWIA 4IMFA 5I6SA 2A3CA 1RVKA 4UTTC 1QNVA 3HG3A 1PX3A 2JGYA 1H61A 3HMJG 1MRQA 3DU0A 2WZIA 4DBSA 3CHFA 1KQZA 2V2CA 1XISA 4XKYB 3UPMA 1M41A 3AS0A 1Z32X 3NQFA 3L0NA 2NSXA 4YXGA 2ZXBA 2CZVA 4L6OA 3FA5A 3FVMA 4IP5A 4GYJA 1SU5A 1J11A 2PZ0A 4DBEA 1JCYA 5AYZA 2Q09A 1O5QA 3C6CA 1TRIA 4H19A 3E38A 4K8HA 1HJQA 1ZENA 3LPPA 4JAWA 1N55A 4K6AA 1WDPA 1TFVA 1TV2A 4MJZA 1MQRA 4ZR8A 3STPA 1VBUA 3CASA 3P5YA 3TYZA 3MDWA 3MBFA 1A5BA 2XIIA 1XLCA 2PC4A 3A3XA 1Q5MA 1PYMA 1GOWA 5D9NA 1DBTA 2XSXA 4KWSA 5EBUA 3B4YA 3FIGA 2Z2AA 4AYGA 4UCGA 4MNJA 3V5FA 3MQTA 4H83A 1R3YA 1HG3A 1ZL1A 4D8AA 1C3FA 1UWTA 1G69A 3ALGA 3A4XA 2X40A 3TJ4A 4B5SA 4CQCA 3BCFA 4GA8A 2H8ZA 1MMFA 2VR5A 2A1YA 2V3DA 3RR4A 4H6RA 1OT1A 1S1RA 1VEOA 3MWCA 1M3UA 1ZHAA 1Z48A 4JTSA 4N6FA 5EMJA 4HZ7A 2PF8A 1X1NA 3AFBA 1RH9A 5HMFA 3U0HA 1TJ2A 1BF6A 3T81A 3KDNA 1JULA 3GY1A 3U7BA 3M64A 1US2A 3PZIA 4AMAA 1CGXA 1H7OA 4S2CA 4H2HA 3CUIA 2IUZA 3PP7A 2VEKA 4I5UA 2WMHA 3A21A 1K6AA 1M7JA 1KKRA 4JYDA 3OW1A 3VUSA 3GHUA 3UCDA 3VI2A 1ZBWA 1AH3A 1TCDA 3FXYA 4KPLA 4KWWA 2A6LA 1POJA 2DVUA 3B0PA 3P0XA 2J78A 4UFMA 5CJ5A 2ZUVA 1E56A 2VRQA 5AY7A 1TE1A 1W9VA 4OOUA 2KAUC 1H5VA 1KV5A 3LGEA 1ECQA 3L23A 3WF2A 3F5JA 4JFWA 3S8HA 3S1VA 2FZ8A 3LV6A 4L1XA 4HMDA 1E6XM 2QJIA 3CT7A 1RJPA 1EOMA 5EA9A 3W6MA 2P50A 4PEEA 5DLCA 2FMNA 4FIQA 4IMGA 2A4AA 4CQ9A 2BGSA 1Q6DA 2XFFA 3L0KA 4KESA 2Y7DA 2WNQA 2F2HA 5F2LA 3UG3A 3GHSA 4C1NB 3AUOA 1TZ9A 5KINA 3BW2A 4I9MA 4IPIA 4W7WA 1OF6A 4XKYA 4P8XA 5AC8A 3VNIA 1QCWA 1IE7C 1OC5A 2XIJA 4Y6GA 1OYBA 4O1FA 5C9XA 3L67A 4LBSA 1IEWA 1MW1A 1DHKA 5M1TA 1EO7A 1N82A 1A5CA 4BF7A 5FJOA 1NDVA 1JCLA 3SN0A 3LXCA 4O1AA 3S83A 3ARVA 1MW0A 2XN0A 1PKMA 5ABHA 1QNQA 2POZA 3GR7A 5CC3A 3KBNA 1LP6A 2D73A 2QPXA 4ZCWA 5M03A 4N9DA 5I78A 1DQWA 1LLZA 2WNNA 4KETA 2VNCA 3CV1A 4LRTA 2CLLA 2VZOA 2DSZA 1UWAA 4EK7A 5I0DA 1EH9A 4LU0A 5M17A 2OEJA 3CM4A 3H6OA 4MB1A 1UUQA 2ZZ3A 4IGHA 5J5RA 1HKIA 4KRUA 1NF0A 3WQGA 4Z1CA 4FX6M 3WNLA 3SCWA 3VGHA 2P3ZA 3ZM8A 2P53A 3GH7A 3ZT6A 4CQAA 2WVTA 5LIXX 4Q4QA 3CPUA 3V5OA 7ENLA 1XICA 4MGGA 2DORA 3BW4A 1KM0A 3NO3A 5CSUA 4OV4A 3QY7A 3ZWTA 1E6QM 1LL6A 2GVGA 3POHA 3T09A 1YPIA 1E3ZA 1OX4B 3N4EA 1FWGC 4JIRA 2IXVA 4AXNA 2Y62A 3MWAA 5CKSA 1JNDA 1JRBA 5GJNA 3LHTA 3M43A 3QFEA 2X16A 2DT2A 3KBVA 2HV5A 5C7VA 3UW6A 1YIXA 3QZAA 2R1KA 4UWMA 3WQDA 2E40A 4NIRA 4WKHA 1GQIA 1UC4A 1RA5A 4WDTA 1Q63A 2GWNA 2GUBA 1ITXA 2OT0A 5IRPA 3UR5A 2QULA 1FFQA 2YYUA 5HQEA 3TLLA 4L1GA 2QKFA 2QPUA 4C6DA 1ADDA 1BGAA 3RM4A 1DYSA 3UYCA 1WB0A 4IUGA 4PCSA 4B16A 5A95A 5FESA 1FOBA 2WVVA 4A21A 4IWWA 2GGGA 4Y9MA 2FFCA 5BRPA 2GJPA 2X0SA 2YFOA 1WOBA 1E5JA 4CQBA 4DJDA 3QR0A 5HOSA 3FSUA 3W2MA 3H2CA 3NQVA 4C1NA 3WQ8A 2PD5A 3CUGA 3KBWA 2E8YA 1H49A 3W7GA 4JY9A 3S5YA 4P8UA 1YXDA 4MWAB 2BOGX 5JUVA 4O14A 3IRSA 3G1YA 4IMDA 4KH2A 2PDGA 4ZO7A 3BJFA 3E0VA 1EZ2A 3NVDA 2QJJA 3QBUA 2UY4A 3DX5A 7ODCA 1SZFA 3G8EA 4M3PA 1K8ZA 1HGWA 5ECVA 4REQB 1R86A 2GDVA 1UIPA 4G7EB 4PBGA 1KBJA 5C2GA 3SECA 1BTCA 4C90A 2ZTJA 4XZIA 4CCZA 1UPPA 3IRDA 3AZSA 3C2RA 2B0MA 4L1WA 4HOXA 2YL8A 1UR0A 3A64A 4LVAA 1XC4A 3H2FA 4DPPA 1K02A 4LT9A 4RDWA 1DXFA 2VCCA 1DWIM 4IICA 3S9YA 2ZDRA 4US5D 5DRCA 4PMZA 1A5MC 4CD4A 1Q7QA 3T78A 4DXKA 4LJ3A 1VLWA 1C8XA 4XISA 1TB3A 5AHLA 1XDJA 1JYXA 4YYCA 1ZU8A 1I0BA 3GNPA 3ZLFA 3GVQA 1OABA 1P1MA 5B80A 4R7JA 4GBDA 1NP2A 1U1UA 3UVIA 1OX4A 4UTKA 2ODOA 5CLTA 2E9LA 4W85A 5IDIA 3LSBA 3GX9A 1Q6EA 1FWRA 1AH0A 3NDYA 2NUXA 4MUZA 5FKYA 2CLEA 3AHXA 2YA0A 2V38A 2NX1A 2QCHA 3F4NA 3M0YA 4WCJA 3GNXA 2WAGA 1NOWA 4QISA 5I3HA 5K7JA 4DWSB 2D2GA 5DEZA 3I7RA 3RN6A 1A3XA 1XPGA 3BAWA 3PNUA 4MFEA 1K8CA 1W32A 1K1DA 3WQ6A 2J7FA 1LDCA 1K9TA 4HNUA 3MVIA 4FALA 3EKLA 3HGRA 1C7SA 3NSNA 4S1FA 3MCNA 1VCVA 1W31A 3IARA 2J75A 1N8WA 2H6RA 2QCDB 3GXFA 4UNLA 3BZJA 4XD3A 3DECA 3M46A 2WW5A 3EOOA 2HVMA 2WSPA 4Z2HA 1CXEA 3VAVA 1OZMA 2GYIA 3GQYA 4GO8A 4WSKA 4J1OA 2FLIA 2Z1XA 4HGXA 2OWCA 2MUCA 1YNYA 4MWAA 1RALA 3VNZA 4W89A 3F5LA 3C0JA 5T8GA 4KS0A 4AF0A 2V5CA 4D6EA 1RVGA 3L0GA 4CKQA 4CGTA 5I3DA 1C8VA 1JAEA 4RE2A 4JKLA 2QCMA 1YDYA 4OBRA 1V3KA 1E4LA 1EWDA 1W9BM 4U3CA 1NFGA 3NFUA 4G7EA 4ZB5A 3U3HA 1NELA 4E2OA 4HSNA 5T9CE 3HPSA 2OGYA 2Z27A 1XDLA 4GH3A 1EJRC 1VJSA 4JEJA 3RAOA 1J79A 1AL8A 1OK6A 4DJEC 1KBIA 5KZ6A 5CXPA 2G3IA 1KTNA 4BR1A 3SY5A 1SUXA 5EBAA 4F3HA 4CLMA 3QMTA 5FJJA 1WO2A 3NYDA 3WUGA 3N04A 3HQ1A 1F61A 9XIAA 2Y6ZA 3SY8A 3APYA 2X7VA 5I24A 5E6YA 4PB5A 3GU9A 3DBPA 1KRCC 2VL4A 1X7IA 4CNTA 4QTGA 3GXIA 2V68A 2VXNA 4X0NA 3TSMA 1XYLA 1YEYA 1W56A 3WDIA 4JFTA 3QR1A 2XDFA 3M0JA 5K9CA 1SZEA 2ACQA 2WPGA 1HN1A 4D6FA 2CWXA 4YPJA 4PMUA 5CSSA 5T91A 1BF2A 3IVSA 4AVNA 2CXGA 1OHLA 2QW5A 2TAAA 2ZICA 2OELA 4TX6A 1HTIA 4UB9A 5C6MA 5EFFA 3TJXA 3FXGA 3VD9A 3OOQA 3F4VA 4N9BA 1I9CB 4GUJA 4RPPA 2NLIA 4UUIA 2WMKA 4QSFA 2YL6A 3FYPA 4TU1A 3S42A 4HB7A 8XIMA 3QHNA 5D9OA 4DWSA 4I8DA 3N12A 3DG6A 4LAZA 4J9JA 1F3XA 2JQXA 3H53A 1S3HA 3TCEA 5AKQA 1VEPA 1JZ6A 4ZO9A 3VIPA 3R11A 1XXXA 3BDKA 4MKVA 3A5VA 1IXQA 3KDOA 1PDZA 5GQBA 3L4TA 3RK8A 3RRXA 2PUZA 1XLGA 1KM1A 4OGZA 1Y5WA 1ZPTA 2QCDA 3G0UA 4JICA 5HQMA 5JIPA 4DJED 4DM2A 2QIWA 5HK4A 1J0ZA 3SEPA 2CITA 1LM1A 3MI2A 1KRBC 1PV8A 5G4EA 2D2JA 2PZNA 3QVQA 2A5HA 3VC6A 4XZNX 3SCNA 3ABXA 1VIWA 5FF0A 1PXGA 3LRLA 4MNKA 3ZVIA 5HANA 2FTYA 3L4WA 3IVUA 2PURA 1WZMA 4MDPA 6XIMA 2HJPA 1UWIA 3RXZA 2ESCA 3HG2A 2R82A 3M0MA 3AC0A 4MYAA 2O9TA 3B05A 3FS2A 3MMTA 4F9JA 4KEMA 2YCEA 2ZA3A 1ISWA 2IKJA 1JDFA 1V08A 5AHEA 1OYCA 3A24A 1LCOA 3QEZA 5AYXA 2OXNA 1W1A1 4NAFA 3LLXA 4UOQA 3FKRA 1GT8A 3GDKA 3P61A 1UKSA 3PZQA 3NWRA 4X63A 1DWAM 4DWDA 2UV8G 5C2XA 4O15A 3MJYA 1B5TA 3VCCA 5D37A 4LUSB 4DYJA 2VCBA 3T8QA 5CPTA 4TVUA 2PTZA 4B2DD 2HXTA 2BHUA 4KCTA 4A29A 1E9YB 2CZFA 2Z1KA 3TQ0A 1G67A 1DJWA 3LLFA 2W92A 1ISXA 1SO4A 3VPLA 5FOOA 3GTIA 2FGBA 4PUEA 3N6JA 2FTWA 2ZKMX 2KZHA 3OGRA 4PB4A 1UZHA 1XI3A 4YHGA 3A5FA 3LM7A 4P8VA 3CK5A 3CIXA 3PR2A 1JDAA 3WNPA 4WJ8A 3W01A 3AZTA 3WBAA 3GD6A 3P3BA 3PZGA 3IACA 2VFEA 3GH4A 2RDXA 4GNJA 4YCPA 1AQ0A 1TR9A 3TN4A 4MLJA 4JBRA 3W29A 3E0LA 3B40A 3QYQA 3B9NA 1C92A 3MW7A 2OOGA 1KWKA 3N29A 2VRJA 1T6MA 2CLMA 1A5LC 6XIAA 3BLFA 5D4YA 3BLPX 4AYSA 1A0EA 3FDKA 4E4UA 1X1ZA 4L4LA 1ODZA 1DQXA 2G5WA 2HSAA 1WDSA 2CZDA 4HN4A 1E0VA 4AG0A 3W2JA 2R1MA 3W38A 3P82A 4RR4A 3Q58A 1V6YA 3R8GA 1OFBA 3W7EA 2XG9A 1DWGM 5AB3A 1A80A 3AJ7A 3R94A 3MSRA 2VX7A 1CLKA 4OWGA 1KRAC 3WLIA 3P93A 4LCQA 1ITUA 3WQ5A 1ZALA 1CGVA 5LA2A 1R87A 3VFCA 5IFTA 3N11A 1UW9A 3EMQA 1TUFA 1K9FA 3OZYA 5HR7A 1FDJA 3RX3A 4IG2A 4DPQA 5F2GA 5AECA 2VM8A 3LGGA 4QCFA 2ZZ2A 4LY8A 3O16A 5BZAA 1W1IE 2PAJA 1KC7A 3WQPA 4FIRA 2PTXA 3OU8A 3TEVA 3CQIA 2XVPA 1VPXA 5XIMA 3ZT5A 1LYXA 4NJHA 5HWNA 1F8MA 1EPXA 1G5AA 1DJZA 3NQCA 3WEOA 1G4SA 5CPLA 4B5XA 1TRDA 5M3WA 5XIAA 3MV01 1U30A 1R7AA 3E0IA 1FWSA 3ARSA 2WNWA 5AHIA 4Z0JA 3LG3A 1BYCA 3KBMA 3ANYA 1B4KA 2FFIA 3ARXA 1YE4A 4L9XA 1UIOA 1AD1A 3V7PA 3N2MA 4ZODA 2YX0A 3JZEA 1UKQA 2OGJA 3C2EA 4UQDA 4W88A 1WKEA 3CAQA 4RZ4A 1VS1A 1EJXC 2AMGA 3VNDA 2DPEA 3S6OA 4C6OA 4GQRA 4LUSA 2VZTA 2VOTA 3EEZA 3MBDA 3V3WA 3N13A 1ICPA 1GVOA 1D3GA 1EP2A 3GW0A 2WSKA 2W3ZA 3SZ8A 4Y8FA 5JBFA 4RW3A 3QLDA 3D5HA 5ABEA 4OHQA 2WXDM 5A6BA 2FQIA 3I4EA 3PZNA 4JIHA 4DZIA 1VLIA 1TO3A 5CPOA 2AL2B 1LROA 3TQKA 1IXNA 4JTDA 1UC5A 3W1MA 2DZUA 4GRSA 3SB0A 1SFJA 2J7HA 4E4FA 3EGJA 1KV8A 3VDGA 1LTDA 3B0VC 2FPVA 1UASA 5CEWA 3VM5A 2RJGA 3CU2A 1BYBA 4YS1A 2BVTA 2F2KA 3OBEA 1L9WA 3NZGA 4H7ZA 3U7VA 1B3YA 1FDYA 2A3LA 4GH1A 3GKAA 2BGQA 2D24A 1TPWA 1TV5A 3A3HA 4H8VA 1HUVA 3W71A 1DJGA 4A8RA 1G7UA 4O4WA 1TA3B 4YL2A 3GDTA 2ABBA 3FN9A 3P62A 4XZLX 3D47A 4Q4OA 1IEXA 1KM2A 2Z6JA 3B06A 4Y96A 3VZXA 3T2OA 4C5YA 4Q4MA 4B3LA 2XVGA 4GYFA 1BLIA 4A3UA 4H01A 4O0ZA 2MANA 4WR3A 1M7OA 3PBGA 1TZ7A 1O5KA 4GC4A 1CB2A 4H9MA 2Y85A 4IX2A 5GPRA 1H1ZA 4NHVA 1MRAA 3BGJA 2Y5EA 4LXFA 5CPMA 3CUJA 3F2CA 2QQ6A 3S46A 3NQMA 1B31A 1BAGA 1UR3M 1W9DM 5HR6A 3TJLA 4LNCA 3MS8A 1SZRA 4MG4A 3VK5A 5I2UA 3VDBA 3KEHA 2WBKA 1R8LA 3B8UA 2QLYA 2B7QA 2DH2A 4KWVA 2EJ1A 4JKKA 1YW1A 5FD0A 1VPYA 4IUOA 3LCGA 4IMEA 4YTQA 3COTA 7TIMA 4S3DA 4L80A 5LGZA 5LZLA 2VFGA 2G3MA 4JFSA 1DJQA 1KM6A 1CECA 1EHNA 1JGIA 3N2CA 2PWFA 4O1EA 2VWTA 1AMKA 4WJEA 4XSLA 4AIEA 3LS9A 2QHAA 3TNOA 2QJNA 2UY3A 1NDYA 3V5CA 3KP0A 3TC3A 1PHQA 4WOQA 5CC7A 3UJEA 4QAIA 3A47A 3G1SA 2YKKA 5JIWA 3V0TA 1HP4A 1FRBA 1W3KA 3LCXA 4NZJA 4XO7A 1B2YA 3LNMA 1MQPA 4XUYA 2X30A 4XBSA 3VZZA 1EIXA 3AQUA 2F38A 3MVTA 4ZO6A 1GG1A 5CJNA 1RP9A 1YMYA 3Q4DA 4O8RA 3H26A 3W2UA 3PBYA 3PN8A 4DYKA 4JTLA 3IGSA 3PTQA 3UWYA 4LYRA 1C8QA 1W9UA 4K7VA 3WJXA 3P5ZA 1WV2A 2OO6A 3WK3A 3DESA 3XIMA 4J3XA 3R0DA 4EPEC 1HKVA 1V6UA 2UY2A 1J4EA 1A5UA 4GQQA 5G1MA 3BSGA 4TUFA 3AIVA 2IMRA 4BZYA 3VNKA 4WY0F 4V1YA 3MO7A 2ATSA 5A2AA 1AQFA 1VFTA 2I17A 1Y7VA 1GEQA 4NI8A 5TF0A 3W24A 3ARRA 3TU9A 2O92A 4ZOBA 1UMYA 1RLCL 4F2UA 2GQ9A 1XG3A 1TA3A 1W5QA 3WLKX 4RE4A 3WH7A 4JNMA 4I6VA 1UBPC 4O57A 1ZJBA 2PBOA 3NEVA 4U28A 3DEQA 1MZHA 4LS2A 1V5XA 1TVNA 1D2KA 4PUJA 3SURA 3QV8A 2ZXDA 1TIMA 1EJWC 4UOJA 2QV4A 5K4XA 3ITTA 3MI3A 1O7AA 1BG4A 3REQB 1D8CA 5A6KA 3RLGA 5HAOA 4X60A 2WLZA 3UESA 3G5EA 3L21A 4QEEA 1MVYA 4RNHA 4WF7A 5BMXA 4XD4A 3O0KA 1HKJA 3IWPA 4J5NA 4L64A 3TONA 3P81A 4QQUA 4YTUA 1A3HA 3MMDA 4Q6JA 1HZYA 1FWDC 4GIRA 4FNUA 5EYWA 3ZJ7A 3R2GA 4GO9A 2XH0A 4OIFA 3ITYA 3U2CA 2OKTA 5A6AA 1VAHA 5I3IA 1TMHA 3OLIA 4DUWA 2X8RA 3HV9A 4HNNA 1S2UA 5FJIA 1TTPA 2YXOA 1K03A 3NOEA 1AJ0A 4CCCA 3VGGA 3A22A 5KITA 3DFHA 1R3SA 3VIFA 3A3WA 4O17A 4YVPA 5HNUA 2WK2A 1CDGA 3FFSA 4O54A 1ESWA 3AHVA 2OFJA 3NA8A 3AIQA 4I7VA 2OG9A 4AD3A 4M1RA 1EA9C 3KVJA 2EGZA 2PWVA 1PL9A 3C3UA 3VDAA 1GHSA 3OBKA 1FHUA 1Y5VA 5I7GA 3VZYA 2BXZA 1IWPA 3CQKA 1UOKA 1UP2A 1W9XA 2XIBA 3FLUA 5CGTA 4GNVA 2O4MA 2P88A 4Y90A 3LGDA 3CYJA 3RF9A 3RLVA 3W76A 1PX8A 2J8GA 4KCUA 4CNUA 3BMWA 5DMNA 3HN3A 4ZXOA 5A3HA 1L6SA 1XRSA 1GQLA 3GG7A 4CQDA 4EKJA 3TDFA 4LS0A 1WAUA 3BGGA 4MB4A 2D3NA 1A0CA 2Y7EA 2Z29A 1XH1A 4FF5A 2NV2A 1BXCA 4TV6A 4K68A 4J3TA 4Q4PA 3PB2A 1LL7A 4E8CA 2OZTA 4LAKA 3MB9A 4JTTA 1FWWA 2YB1A 1AUSL 1OCJA 2Y8KA 3M1ZA 3WJSA 1QOPA 4LS1A 3FOKA 2FB2A 1I45A 2CBUA 3KW3A 3OO2A 4IMCA 2OYKA 1ZBCA 1AQMA 3OYXA 4KW2A 5CLWA 2G95A 3THAA 1W2PA 1S46A 4WK9A 2BODX 2FZBA 1MNSA 4U2ZA 1TTQA 1JPHA 1EJUC 2ZUUA 1V02A 3OB8A 1ZJHA 4D72A 1QW7A 2REQB 4PTNA 2OZ8A 1FWIC 3C4UA 4KGJA 5D2TA 4NZ3A 3REQA 1E4IA 3WLRA 3I7SA 5C9WA 3MC5A 4DO5A 3W02A 1JYVA 8XIAA 1R6WA 2G3JA 3O07A 5EPDA 1BYDA 3NPWA 4LB3A 4D6DA 3OLEA 3W1PA 3GRIA 5E0KA 3OZPA 4AMCA 1HF6A 4PFHA 1E4NA 1UJQA 2E6YA 3GDBA 2WHJA 2ZVIA 5HQLA 3VKKA 3FX4A 3N17A 1AH4A 2Q3RA 4B4FA 1QPOA 1EGZA 2XGIA 4AZ7A 3SRFA 3KTCA 4NKCA 2OYMA 3TSDA 5HDRA 4ORIA 3KS5A 4R34A 2EG7A 1Y65A 4R27A 2VZVA 3VMOA 1DJHA 1Q45A 3TA9A 4KEUA 2OSXA 1DWFM 4C7DA 1D7KA 1T5AA 2IQ0A 3M0LA 3R89A 3WQFA 3NZ1A 4JQ1A 4PRTA 2J24A 3UWVA 1W1ZA 3HA1A 4NRRA 4PMYA 5A94A 1JPDX 2DV0A 4FXSA 3TP4A 3IPWA 4RKAA 3DYOA 2ZUTA 3PUEA 2HRWA 3CEPA 3QW3A 1OGBA 3GTNA 4JQ3A 1ZCCA 4JTRA 5FF4A 4YJ5A 4HHMA 3WLSA 4S3EA 3WF1A 3GVRA 1IT0A 1Q3NA 3B8DA 1C29A 2B7OA 1P0EA 1GVQA 3W9ZA 4Q8UA 3SGGA 1V0MA 2PEVA 4A6GA 2DIJA 1XLFA 1GPWA 3O1NA 1XP3A 1V0LA 1VFSA 1VJZA 3NGJA 2B7PA 4XBKA 4MZ1A 3M41A 3PAOA 1ZAHA 5BXSA 3EDJA 2FZ9A 3RO6A 2NUWA 4PUKA 2VCAA 3H70A 4E5TA 1YADA 4L56A 3C61A 2P8BA 1PX4A 3QYSA 3ELFA 4ACZB 1HJUA 2PCEA 2NSOA 2QGYA 1XIJA 4XAFA 2HPMA 1Q2RA 1J0JA 4HP5A 2ZZ7A 1EKOA 5E6ZA 1VBHA 4JTIA 3L4VA 1X1OA 3RILA 4GVHA 1VCGA 4E2DA 4LEQA 1E6SM 3TXZA 3WD2A 3NL2A 3RX4A 1KW1A 4TV5A 2AGTA 3CO8A 1SO5A 3IK2A 2BB0A 1IF2A 4UTIA 4PEKA 3FNDA 1F3WA 1M7XA 1LG2A 2PTWA 3VIMA 2F8QA 2REQA 3HPFA 1F2JA 4F2BA 5KZDA 5CJMA 5LNWA 3PJTA 1TG7A 3CIWA 4IMAA 2WM0A 1JQXA 1E0XA 4IIDA 4MB3A 4D2JA 1U2YA 2ZX7A 1GG0A 1UZ4A 4DJFA 3SADA 1XD0A 5CC5A 2Q71A 3GYCA 4JX5A 3H55A 2WKGA 3W81A 2XSAA 1B0IA 3K5XA 3KS6A 1K6WA 1PDYA 3PK7A 1XIDA 4XAGA 8A3HA 3VOHA 2VEMA 4YVVA 4BI5A 3ARPA 2WHKA 1XSIA 3T55A 4ZO8A 4DBDA 1W5PA 3ARTA 4I6KA 3SCUA 5AHFA 3A4AA 3NQ6A 1WKYA 1VENA 2VR2A 2VVNA 1BRLB 3HBLA 1XIGA 3B04A 3MYOA 2Y2WA 1B3WA 1MYRA 2TODA 4Q7BA 4JCLA 3FKKA 1HIZA 4JR5A 3V35A 1JUEA 2JALA 3W1UA 1KGWA 3TTOA 2AAMA 1FVPA 2OLHA 3NQ2A 3LN3A 4E38A 4FR1A 3GVVA 1YTEA 3OA3A 3PUDA 2YW3A 3S5SA 4DF1A 5G1TA 3EPNA 3JUGA 3B0YA 1UOZA 3XISA 4DX3A 2WZTA 2XFRA 1MUWA 1OF8A 4GG9A 4R3UA 4IPNB 2JF7A 3NL6A 4W7UA 3UPBA 3TR9A 4MIMA 3AIUA 5FCZA 2GGHA 3HPAA 1GVEA 3M0IA 1N7KA 1CTNA 3GTFA 3M5YA 8CGTA 1WAWA 1VCFA 3WCZA 3QM3A 3W37A 2W91A 4A8IA 1QFEA 1ZBKA 3LENA 3RLHA 2ALRA 3F1QA 3IUIA 3W2KA 3EB2A 3PBUA 4IGNA 4EX4A 4UCFA 2VT0A 3IIXA 4FXFA 3BXWA 3R5EA 2PP0A 9CGTA 2C16A 2WKJA 2BOEX 1JI2A 4U10A 2ZRWA 1C7TA 4ZFCA 4LFYA 5I09A 1XM3A 1EF3A 4XAYA 1ONEA 1XUZA 1G4TA 3ZIZA 1E1EA 3UCCA 2R94A 4R88A 1OVDA 1IT8A 2RDUA 5C55A 3TTQA 3GNRA 5AC4A 5D09A 1VD6A 1E1CB 1RUSA 4HKPA 3MANA 3AS3A 3OLGA 2VGBA 3TSBA 4NNAA 1TIWA 4MPKA 3IUDA 2QT3A 2VC7A 3RO8A 4JIEA 1B9ZA 1DIKA 4S3KA 3TH6A 1OFAA 3GZ3A 5A2BA 2PDNA 3SBFA 3AXMA 4FLQA 4HIBA 1LWJA 1MFVA 5I00A 3KRUA 1UQZA 3C2FA 3ATYA 2H9AA 3WF0A 3HFYA 2IKGA 4GUHA 2VX6A 4AY7A 4JIIX 1IYXA 4AWUA 3CZEA 2VGIA 3UZYA 1RV8A 1E55A 5HMSA 1OX6A 2EKGA 4FPSA 1H11A 1CXIA 3W1LA 4JTEA 2G37A 3TTSA 3OVPA 1VIZA 4H9UA 2IKHA 2DUZA 3MCOA 1CCWB 4ZOAA 1DVJA 1W5NA 2PWHA 3GE7A 1JZ8A 4U4MA 2RJHA 3H54A 4QCEA 3IUHA 4UR7A 3ID7A 1FKXA 5K2ZA 1ZS2A 3NQBA 3KLKA 2WMGA 3E2QA 2XH2A 4C5ZA 4GUIA 6ALDA 1V03A 1K8YA 5G2WA 4H1ZA 3CWNA 2Q8ZA 4AXKA 2Y5SA 4M24A 4XZMX 2Y61A 4LUTB 3V1HA 3V0SA 3TCSA 4PR4A 4ZQMA 3DFPA 2V9DA 4KFNA 2Y89A 4QJ1A 1NWSA 2CCRA 1H1YA 4RZ5A 3FV9A 3K8KA 2PWUA 8RUCA 4YNGA 1A5NC 4D1JA 2CU0A 4WKFA 4D8ZA 5D2XA 3CL7A 1XF0A 2OU4A 2HTMA 3VNLA 4IFRA 5C5YA 1Z41A 5GNXA 2GSJA 3BL3A 4CUCA 3HJEA 4WHBA 4HCHA 5F7UA 4BF5A 4IQDA 2PDFA 1G1YA 2RGLA 2KX9A 1O1ZA 4CU8A 4D6HA 1LOLA 4PUDA 3AIWA 3KOYA 3L68A 3VXGA 4NNBA 3RNDA 2O9PA 3SGZA 2NLYA 5G1YA 2XGZA 4MZYA 3N9SA 2P10A 3OGVA 3AHZA 3DN5A 2CPUA 1BTMA 1OBAA 1X97A 3WNMA 1REQB 4UTMA 1XG4A 4FEZA 2DU2A 3LNPA 4LAMA 3ZR5A 2V3EA 2CFFA 1SW3A 4NYUA 3VD3A 5H2ZA 4D1IA 1XWYA 3K30A 4RL3A 4M29A 3WD4A 3ZR6A 3UZJA 1E1CA 5G4HC 2OQYA 3W1TA 1IGWA 1XLLA 2QUTA 4DHGA 3W26A 1T41A 4WXZA 3EOEA 1VEMA 3N6HA 1QHZA 1TPUA 3SSJA 3AHYA 4ZOEA 1FBAA 3SUSA 1LRQA 1AK5A 1QNOA 2CZ5A 3QPEA 3LQLA 3WELA 3PZTA 3WK2A 3R12A 2VMFA 2FDMA 1TV8A 2J74A 1JFHA 4OFCA 3KAOA 1QTWA 1Z7AA 1TVLA 4C6QA 1ITQA 2BFGA 1FX6A 1ZNNA 4IPPA 4UR9A 1FCQA 4XD5A 1JNEA 3HB9A 3AJXA 5D04C 3PJXA 4JHMA 2WB5A 4XAPA 1WUEA 2ZRZA 1LOQA 5HJLA 3ITCA 4Y8EA 3UT0A 2GVJA 1Y5XA 4JYEA 1IT7A 2VGFA 4L5ZA 2J8TA 4I9JA 1BVNP 1F05A 2QJGA 2GWGA 4H2CA 2VELA 4LBRA 4H9YA 5IOBA 4F0MA 2VDGA 3THDA 1F3TA 2I5GA 1TV4A 3L7RA 3LX9A 4W5UA 1CNVA 2DW7A 4AD4A 3O8AA 2X1IA 2ZE3A 3KBJA 2YDRA 5DMMA 3W1XA 3OIHA 3NQDA 1RLDA 1YDNA 3T1GA 1XQKA 4JNYA 1W3NA 2OODA 4D8LA 3H4XA 3EWXA 3WLPA 2D2HA 3GU1A 4DLMA 3ZQ9A 3S2MA 2HCVA 3SRHA 2XM2A 5D05A 3WQVA 4RV3A 4QR6A 3RPDA 3NOYA 3QFWA 4BEQA 1P1XA 3GXNA 4HHPA 5T9BG 1TJRA 1CXKA 3AI0A 1UROA 3U48A 3URBA 5DFAA 3THQA 4UZUA 2XIMA 4W4QA 2INFA 2OQHA 1NQKA 1XRFA 2Z24A 1GVFA 2YL5A 3H22A 1J18A 1I2QA 4C6MA 4Q8NA 1JQVA 5HXMA 5AVNA 4X2RA 2GJXA 3NZQA 4DRSA 2ZUNA 1MXDA 3N9KA 5ECUA 1PWLA 4U5IA 3QV6A 4X61A 3P0WA 4DUXA 3K13A 1TELA 4EXBA 4NZ1A 1UD5A 3GAKA 3SI9A 4DEFA 4IXXA 3AWOA 1FP9A 1XLJA 3PZVA 3VABA 4PSRA 1TWDA 2XZ7A 4DJDC 2BV9A 3RRAA 4Q6XA 3BQ6A 1SJDA 1REQA 2OX1A 3VD5A 4I3GA 4HYRA 4GC3A 5DO8A 5REQB 4K1GA 2AMXA 4ONVA 3URAA 2WSRA 4AX6A 4R53A 3T4CA 3V18A 1XLAA 4WVXA 4PODA 5A6JA 3FA4A 3HOJA 4GZ7A 3WBWA 1M65A 1GOIA 4QDMA 1QNRA 2ZA1A 5G2IA 3BTNA 2I1OA 3K1DA 4ATLA 1QK2A 3F4CA 3WLNA 3AS1A 1XLKA 3T42A 2X0YA 3W7QA 5K9DA 4EAMA 2DVTA 4FNSA 3W85A 5F2IA 4HNOA 4EANA 3UBPC 3GSMA 1OGGA 4QLLA 4GVGA 2ABAA 3KCLA 1ITCA 2V2HA 5IHSA 3KUMA 1GQKA 2QJMA 2HMCA 2PU0A 2WWCA 1I2NA 3IJLA 1CWYA 2BTMA 4MF4A 3TOPA 1TSIA 3EWUA 2XTKA 1VFFA 4Z2IA 1W1YA 3FAWA 1DIEA 3BVJA 1M6JA 1PKNA 4IQLA 3SCTA 3M16A 4MZ8A 4K8EA 1ME9A 1EHAA 1E6RA 1TTIA 2VFFA 2PMQA 1JDCA 3CLMA 4QEHA 3N18A 1GOQA 2GSHA 3FGCB 3LD5A 1OJXA 3BPWA 1RCXB 3LXBA 1A47A 3ES7A 1SR0A 3UWUA 4QIUA 1SFSA 3V4BA 2BY1A 3WJZA 5DMYA 3IS4A 4DJDD 1OINA 1OG6A 2VEIA 2WYSA 4PUWA 3TKFA 2QCFA 2DT3A 3S1XA 2J25A 4GJ1A 4C6NA 3FJ4A 3CAWA 1OFPA 3QF0A 2QUNA 5CSRA 2IPFA 2NV9A 2ASHA 1V93A 2DJXA 1O60A 3IIPA 4PUNA 3B0UX 2P0IA 2DDXA 5A6LA 1W3TA 4W5ZA 3LHVA 4CNSA 1S5NA 4ZE5A 3O2LA 3ZJ6A 4DXVA 1OIMA 4UXDA 1S2WA 1EEPA 1PS9A 3WMLA 1LRTA 4GD0A 4LCRA 1ICQA 3S2JA 2EPHA 5A8NA 3N19B 1EF2A 4CVUA 3QSTA 1DXIA 4UTWA 2O9RA 1GZGA 4WEVX 2NWSA 3CO4A 1UR9A 2ATMA 2Y70A 3WLTA 4EE9A 3IIVA 4MWAC 3S9ZA 1H50A 3MP3A 3QKZA 1V0NA 1KQYA 3CIVA 5DY3A 3SQLA 2WHLA 3TW6A 4LUIA 3R4IA 4WD0A 2PLJA 1FKWA 4MKNA 4NJKA 1XX1A 2G4FA 5DCDA 4DO4A 3U5UA 3NDZA 5D33A 1X96A 4ERGA 1Q85A 1TZZA 2AKMA 3B3DA 1M68A 1NVMA 3U57A 2JKEA 3VD7A 3CYVA 4QFUA 4AHPA 4JTUA 4R5EA 4MWAE 2DH3A 3S5NA 5TAOA 3OIXA 4RDVA 4J27A 1Q66A 2DQXA 4J3VA 3SCPA 1BEUA 2QIIA 4PTDA 1TWWA 4HTYA 1IZKA 3RG6A 3EXRA 4US6A 1TPDA 4WQ6A 1XBVA 1NWRA 1FHVA 2J79A 3MYPA 5C70A 1O1HA 3QQWA 2HPIA 4NZFA 5CH9A 4PGLA 4YCOA 4GKLA 3G3DA 4C60A 1VB9A 2R1NA 3ECQA 1QATA 3IJQA 1SPQA 3O6CA 5C9UA 3MUY1 3FGCA 4DF0A 3AS2A 5DN1A 4MSSA 2V63A 5CSYA 4D9PA 4GKTA 7PTDA 3T0BA 1VRXA 1XIFA 1XDMA 4TO8A 3TLQA 4NXSA 2W62A 3G1DA 3VE7A 5JVLA 2I5QA 2OQLA 3GKFA 1MXSA 3II1A 2YCIX 4ML9A 2OOFA 3M47A 1E5NA 3QGAC 1UKOA 1A3WA 2E8ZA 1OSEA 2X1TA 3P80A 3RR1A 1PEZA 4LVDA 4B90A 4ENLA 4KT2A 4L7ZA 1OC7A 3EAUA 4MWAD 4DBUA 4DUOA 3W7CA 2J9ZA 3OEXA 2ISWA 5I02A 5IXEA 1J01A 3CXOA 2D22A 2WJEA 4DWSC 5CAHA 2YYTA 4UZSA 4XTDA 3MHUA 4GNKB 3LZ5A 3PWAA 2I16A 3NGFA 3UR2A 1UKTA 3JRKA 2PDUA 4PBEA 1AMYA 3O05A 1NFPA 3CTLA 3DCPA 3EMZA 3UY7A 3WD1A 5HBFA 5ENLA 4YHEA 1J12A 1DIOA 3BK0A 3PG9A 4AD0A 1TE6A 4MM1A 4IPJA 4GABA 1WPCA 4HPJA 3TMQA 1K7EA 1ZRQA 3KCJA 4M8UA 4AISA 3N2TA 3EOLA 4OJYA 2ZC8A 5C71A 3HGJA 1MEWA 3PTMA 2V5BA 3MSDA 4Y7EA 4C1LA 4HYWA 5JQ9A 4R7OA 2OSYA 1YKWA 3ITVA 5KZEA 1EOKA 4K39A 2OJPA 3NL5A 4FK9A 3M0KA 3N34A 1AZ1A 3UA4A 5MHBA 3G1VA 4BWLA 5DF0A 4FXRA 4EPBC 3TZNA 4W93A 4MNMA 3BLEA 3SCVA 3A4JA 4Q4RA 4GVIA 4ML4A 4LV4A 1UP3A 4JFUA 5DRIA 1W1VA 1XYZA 3QGKC 3FDGA 2JFEX 1H41A 2RFGA 4FMVA 2R9RA 2JF6A 7CGTA 3VVGA 1UR2A 1QOQA 4C7FA 4J7RA 2VQUA 4O12A 2VC9A 5H8PA 3EX6A 4IX0A 1B1YA 3NXFA 1S5WA 2R6OA 3GHTA 2E1DA 3GG8A 2ACRA 1HW6A 1GPFA 1B90A 4Q8TA 5DT5A 1KGXA 4FHAA 1MWOA 4DWSD 3DIPA 2XJ7A 2FVKA 1R7OA 1XL9A 2ADAA 2PFHA 3P2VA 1UCWA 2G0WA 4DQWA 4DB7A 3WNOA 1ECEA 3OZOA 5BXTA 1FHLA 3ORWA 4C6IA 3KTXA 1JGMA 4IHCA 2W4XA 4DZ5A 1HL2A 4P7RA 2HZGA 2R1LA 1E51A 5GNZA 4F0HA 1ISVA 2PB1A 1QOXA 3STCA 1EUAA 1QDSA 3C52A 2P3EA 4Q33A 2YDSA 3HGOA 3EWDA 1FXPA 1E73M 1O95A 1QU4A 3G22A 1JEZA 3KL0A 2YXGA 1M1BA 2D0FA 3L4ZA 2PWGA 3KRZA 1J0KA 1Q2SA 5AC6A 1ADSA 1JL8A 4Q7IA 4KEVA 4W8BA 5GNYA 2NW0A 5H6HA 1JZ3A 2R91A 1JZ2A 1DWHM 4G7FA 1OGSA 3QC3A 3W7DA 4PMQA 2DIKA 3T0CA 1XGDA 5H8UA 3PZUA 1QO2A 2A21A 3BC9A 4GYPA 2OR2A 2VEGA 5A5WA 2CHNA 3DENA 4QNWA 4NZ4A 3VOFA 1R0MA 4QJ5B 3UNTA 3H21A 4H9VA 5BW6A 4CU6A 3Q67A 1LLWA 2FZDA 4A4AA 1FWCC 4UOZA 3H2NA 1JYWA 2Y24A 4LRSA 2E9MA 2WC4A 5C9ZA 3NIYA 3MUXA 3S9IA 3AMDA 4XZWA 1G4EA 2J6VA 4ICNA 1JPIA 3RJXA 3QGVA 1KBBA 3UFYA 4RLIA 1J2BA 1ZLPA 1P6CA 3D46A 1HFBA 2IQDA 1EGMA 1M7PA 3WLJA 3L66A 2ZXAA 4QITA 1P4CA 1KCZA 1E3XA 3LYEA 1ZAJA 2E28A 2Z7GA 4DM1A 4IF2A 3KE0A 1V51A 1S5MA 1BPLB 4FR6A 1UR1A 1PZ1A 2O55A 1QRQA 3RDKA 1VRDA 1E0TA 1W91A 3TE9A 4P7LA 2V5JA 3A6OA 1BGGA 1X8CA 3TW7A 2WQPA 3QV9A 1XLHA 4IM4A 4GPNA 4FO4A 1Y0EA 2HXUA 4JHZA 2H3DA 1PCWA 4DO7A 2WANA 5CGMA 1JXKA 1YXYA 3C2VA 2CLPA 3NSXA 3R1ZA 3UXDA 3W7PA 1KLZA 5CAKA 4JQ4A 4DUVA 4AD1A 3VINA 3WSUA 4PA8A 4Z0SA 4KEZA 1K4HA 5DX7A 1KBKA 3FSTA 5D8WA 2WCGA 1OM0A 3DFOA 2VTFA 2X1SA 3VGBA 1Q6QA 1P48A 1QWKA 1P0DA 2R24A 5FAGA 2X42A 1P0KA 3OQEA 5I77A 3UCQA 1US3A 5FACA 4NY2A 4H9XA 3ISIX 3CB8A 1VHCA 4CVWA 3HPXA 2YSWA 2EKCA 2XFYA 1QUMA 4JX4A 2CERA 1SQ7A 1A50A 4MPQA 4I9TA 2NVCA 4Q3MA 4Q8PA 1RSCA 2O7QA 1X6UA 2OO0A 4JL1A 3IJ6A 3QTPA 3ZR4A 3EKGA 2EAWA 1KTBA 3W3OA 1TWZA 4IIHA 3SRDA 1W1PA 3FAXA 4WJXA 1NFBA 1C90A 1WOAA 1J93A 1XIIA 2FVLA 1XYCA 5ABFB 4NAEB 3PC0A 2CWNA 5FSDC 4Y9AA 4XVEA 2VEPA 5I3JA 3GUGA 1EXBA 2WKLA 3R43A 5LGXA 3ZWSA 3I7QA 4AX7A 3T8LA 1Z44A 3E2SA 3SR7A 2BP1A 1BSIA 2GGEA 5AHNA 5JU6A 1VP5A 4S3BA 4HBKA 1W1TA 2HVOA 3NL3A 1NY1A 1Z89A 2FTPA 3S2LA 4N9CA 3BV7A 3KOWA 1OCQA 3WF3A 4DLFA 7REQB 3BGAA 1R2TA 2DUXA 5EMKA 4F79A 5LNSA 1HL9A 3WBEA 1QVBA 1TPB1 3E2RA 3E3HA 3I65A 1PBGA 1GJPA 1JCJA 2QMKA 3FW6A 5A6BD 4BKNA 4GFSA 4E8GA 2PS2A 2FKPA 2VHLA 3IJ9A 3UWZA 4O1BA 3R7MA 3OHMB 3AMLA 2PGRA 1C9WA 4J3ZA 4UFKA 3PBMA 2V5KA 1JF5A 1Q6RA 3HQNA 3SGUA 3TQPA 4RXGA 2PODA 3R58A 4M1BA 2V30A 3CZKA 1U83A 2YBUA 4FF7A 2XHYA 2RGMA 4KWUA 3GWQA 1XIHA 5HWJA 2ICSA 1SSGA 2P8CA 3CMJA 2CEQA 2XM1A 1XV8A 3T08A 3CHDA 4EPDC 2NXHA 1UYQA 1YHTA 3ZLHA 5G5IA 3ENLA 3C0QA 5DBTA 2EQDA 3Q45A 1GYMA 1GWJA 1BYAA 4MDOA 2E3ZA 3USBA 3HQOA 4UFHA 4I5XA 3LTPA 4LNYA 2ZA2A 5FSEC 3MCMA 1KFEA 4JGDA 4U31A 3OYZA 2TRSA 2J13A 2QUVA 1SFTA 5BU9A 3VX1A 2Z28A 1M04A 4JTQA 3WY1A 2X0HA 1OT2A 1ME8A 1Q7ZA 3I10A 1CZ1A 3GBEA 3HTWA 5LHFA 3NUKA 1SJAA 2PRMA 5AYYA 2E0PA 1X39A 5AZ0A 5LNVA 1GJWA 3EZ4A 1UH4A 3P74A 2TMDA 3QTGA 1L2UA 4MJ4A 3CWOX 4FLSA 3E5PA 4N2YA 1RK6A 4A22A 1JF6A 3BJSA 4IFOA 2I7GA 1T40A 2DZTA 5BWAA 4QM1A 1XUUA 2V82A 4H8HA 3QH2A 5FEPA 4DZAA 4OBTA 4LSBA 2YXXA 1GORA 3ZSSA 3VKBA 4HVXA 5ABFA 4NAEA 1CB7B 1EDTA 5JMUA 3W1RA 3T07A 4GJJA 1K7FA 7A3HA 1LUCB 4PTMA 1F8IA 6A3HA 3QMRA 4HPGA 1XBXA 3WN6A 3PS7A 3AIBA 2IPJA 1RBLA 4HU8A 3NQGA 3ITOA 2FDSA 2PDKA 4GIAA 1ALDA 3SJ3A 4PUMA 3VOCA 4FSAA 3E12A 2CXEA 3GS6A 3NYZA 5DMLA 3GNOA 7REQA 1TVPA 1EC9A 2WQDA 3K4WA 4HA4A 2WMJA 3H12A 1PZ2A 3RCMA 1IXPA 4HYVA 3LCWA 1CXFA 1ONRA 1WBHA 4NNCA 4X0VA 2YPIA 1E72M 3M9YA 2DSWA 3PWIA 3W1NA 3G0XA 3DG7A 3UG4A 4UQBA 5HJYA 4NZ5A 1WDDA 3DERA 4J3SA 1DL3A 1K77A 4E2BA 1R9ZA 4K2SA 3H24A 2NWRA 3ARWA 2CESA 2XN2A 4AVOA 3PJWA 4DN1A 4HPHA 4GY0A 4LBUA 1ONWA 5D30A 3B97A 4EIVA 3UXAA 1EDGA 3SIZA 3VMNA 4AZ5A 1HJVA 3LLDA 3DI0A 4X9SA 1E40A 3P8JA 4HU3A 4Q8VA 3DXIA 2QF7A 4L6DA 4FI4A 2C1HA 1TUXA 2YA1A 3KOXA 4RDYA 4K36A 2WZHA 3BQ5A 4MY8A 1E6NA 1W5OA 4FNPA 5CPQA 1KBLA 3NJ3A 4REQA 5E70A 4RDZA 1QNPA 3P84A 4BK9A 3HG4A 4M81A 3V1PA 1R9YA 3GLCA 4M80A 1A49A 3QOMA 5EL1A 2XH4A 2ZUWA 4GK8A 3TYUA 2E67A 1ZY9A 4QE1A 1OC6A 4B5VA 3TUUA 4MNLA 4DAFA 1XH2A 1OCNA 2V3GA 1AW1A 5A8PA 4EACA 2YLLA 5LIKX 3H23A 3VYLA 2J7DA 3C56A 3GC2A 3E02A 1GZ1A 3WIJA 2EG6A 1DJYA 3VDHA 3EKZA 4H9TA 1KB3A 1QI4A 3TROA 1XLIA 2YDAA 4M51A 1UZ1A 4HD5A 4ZSUA 3M0XA 1I1XA 1R38A 2QCEA 2HVNA 5AHMA 5A1AA 2ZZ5A 3IIZA 1DQUA 1DKWA 1SO6A 1GVSA 2EG8A 2VX5A 2GLKA 1KFBA 4TMBA 1K3UA 2E5BA 3IGUA 3PZOA 1CBGA 4MUPA 3EWYA 1XLEA 4GXMA 3BMVA 2DP3A 2JEPA 3VGEA 5AYBA 1P5BA 3VKCA 3WH6A 1JCMP 2MNRA 1GOKA 5LNRA 4EXAA 4AU0A 3AIRA 4HHLA 5CGQA 5MKGB 2BASA 4BEUA 1WKFA 3SO7A 4LEFA 3DC8A 1N2VA 1PIGA 4OZOA 2GUUA 4QG8A 1NOUA 3WNKA 1AFSA 5I3KA 3WUBA 1V02E 1IZCA 2VKZG 2OWWA 4U5KA 1DTUA 1GYLA 2G4JA 3TYDA 5EKYA 4QLJA 1XH0A 1DTNA 3E1F1 4JNZA 5C8BB 4P7NA 3G1HA 3BG5A 1JXJA 4LC8A 4A3HA 4M82A 4AZGA 4ZL1A 1X8FA 3VD4A 4HNLA 1E9ZB 2YBTA 5CQ1A 2GOKA 2PDBA 4OU1A 2VYOA 1MI3A 1UD2A 4PYSA 2OKOA 4WY0B 3THUA 1SR9A 2NQJA 4B3ZA 3CZJA 3EPOA 1RCQA 3MV11 5B7ZA 3SUVA 1KD0A 5C0QA 5HA7A 2PA6A 1RY8A 1UR4A 3R79A 4B15A 4A8LA 1TPFA 2NXIA 2PRLA 1VPQA 4O10A 4GI4A 2PWEA 3G3MA 4H6QA 3BAIA 3TR2A 4FNQA 4IP4A 3RM8A 4OUIA 3QY8A 1F6YA 1KO0A 3S5ZA 2EJAA 1G6CA 1GVYA 3LPFA 3HURA 4CEXC 4AZCB 3PAJA 4K7YA 4JN7A 4H6KA 1XLDA 2PU1A 3BLLA 7TAAA 2IS7A 4HU4A 5IM51 4I7WA 4LVBA 3BOXA 1WDQA 5DQPA 4PMDA 1DV7A 3P7YA 4CU7A 1KGUA 3BANA 2Q01A 4QS6A 3UWWA 4LAUA 3AMKA 2Z2BA 4QE4A 3CBWA 5KMYA 5D2WA 3GDRA 3L5LA 3TFXA 2WMFA 3G2GA 1W8GA 4ZE4A 4O53A 3M7SA 5AZ1A 4XZ9A 1FWBC 3VKAA 1XPYA 2VEFA 1H7XA 1ZTVA 1U5HA 4AWTA 3U9IA 4Z17A 5HNRA 1O6IA 3KVMA 2D0HA 3B8WA 2BX7A 4GZEA 4OUEA 5CCZA 3U2ZA 1W9PA 4Z1AA 4J4KA 3SY1A 2ZZ6A 4ADSA 4QX4A 3PG8A 4QNEA 4DELA 3EOSA 4LYPA 1L6FA 3CMFA 1R46A 2Z1VA 1KKOA 4A2SA 2WJZA 1GGOA 3NPUA 1EZWA 4HJWA 3LHZA 1QI3A 3C2OA 4CD5A 3FY1A 1H2JA 3KFTA 3ITGA 1B57A 2FGZA 1KFKA 4FX8A 4ICCX 3BARA 4XK2A 1P43A 4HNVA 3AU2A 3MKKA 4JYFA 2PBGA 1UD4A 3GU2A 3CAVA 3WL0A 1SW0A 4I7UA 3I3EA 4K38A 2EHHA 1VFHA 3PB0A 4ECLA 2OLAA 3BSMA 3Q2DA 1JAKA 1JJKA 2CLKA 1MEIA 2P5NA 1KXQA 2V81A 2Z4GA 3BJTA 3CZLA 3KOFA 1D7FA 2QCLA 1T96A 1SW7A 3IIOA 2ZX8A 4EAYA 4AEOA 4XG1A 2V8ZA 3EB4A 1V8EA 2ACSA 4U3AA 1JVNA 4ZMGA 1PZ0A 4GCAA 3ICJA 5L9FA 2V5DA 3AROA 4GE8A 1R3TA 1AVAA 2ZX9A 4IXHA 2WNZA 1OEPA 4LANA 1OFEA 1FA2A 1FCUA 4WY0A 3H2MA 2QDDA 3WD0A 1O4UA 2A7RA 4NU7A 4J2PA 3GYEA 1E43A 3XINA 4B5WA 3LMZA 4V2XA 3GB6A 1BXNA 1DPMA 3K8MA 3AYRA 5BOEA 2E4TA 2UBPC 3LBCA 4R7WA 3GXDA 1XS2A 9RUBA 4F0KA 2ZE0A 4GINA 1LQ2A 6REQB 2NQHA 2WVSA 3ERPA 3A9IA 4RV8A 4D6JA 1A0DA 2OEKA 3LI1A 4PMOA 3OQ8A 4GHRA 1GTHA 5EMUA 3QR3A 2E09A 4QQ3A 4O16A 1EGVA 3GO2A 3UG5A 3GIYA 3L2IA 4XX6A 5J04A 2HEJA 5L6UA 4B92A 5IFPA 4AZCA 1K9EA 1C93A 1TPEA 2A85A 1VBJA 5A6SA 3TQVA 2ZZ1A 4JTJA 2QR6A 3HFTA 4XKMA 5D02A 4UTJA 4IIEA 5I5RA 3GFYA 4DJFD 5CC6A 1IHIA 1KR1A 3WH9A 3WLQA 1GKQA 2PDHA 3W7LA 4LAOA 2Q8LA 3WUEA 4O11A 3B03A 3I4KA 4JIQA 3I3BA 4X2PA 3KP1A 2FIQA 2IW0A 4KKXA 3T05A 4TIMA 4L4MA 1M9HA 4HN8A 3PBVA 4CNOA 1VZWA 2CLFA 2AOSA 3QJAA 2ZIDA 3MUZ1 4Z2KA 3Q65A 4XD6A 1RCOB 3RU6A 4WXYA 1QO5A 5M2FX 1H51A 4TR9A 3VIOA 4RX0A 4Q4KA 3WQCA 3K4AA 3VOJA 4OVXA 1IR2A 2OVLA 1QNSA 1FWTA 4MY9A 3PTKA 1I2OA 1HJWA 4UQCA 1H3GA 3WDJA 3W0KA 3N3MA 3QRHA 3A12A 2FPTA 3BICA 4QXIA 1ICSA 3WMBA 3SFKA 4C1KA 1GJUA 2DEPA 3ALFA 1NH6A 4Q8OA 5F1UA 3WEMA 2IPGA 4ROQA 4KCVA 3LQGA 2PDPA 3OG3A 2V0TA 3WDQA 3IJDA 1FWEC 4TVCA 2RUSA 4O19A 2VI0A 2CBIA 1VKFA 3QY6A 3AWNA 3MTWA 1JCNA 1VC4A 3ZFHA 4HOZA 2C14A 3LRKA 3STFA 2Q6ZA 4C7GA 5BNKA 1YTKA 3SN4A 5HMEA 3W73A 3TW9A 4S3FA 1KXTA 3A23A 3W86A 1FWAC 4F66A 4S3GA 2FZMA 3MHGA 1WKDA 1MUCA 2O0TA 1B3ZA 4CN6A 3GVWA 3FEQA 4QGCA 3I6TA 1DXEA 3VNJA 2XINA 4E2VA 4GBUA 4FP1A 4OV9A 3LY0A 3KHDA 5FIPA 5K3VA 1VBGA 4L4PA 2VUYA 1WX0A 2Y4SA 4AVFA 3GHRA 1W3LA 2VOMA 3PFRA 4WUIA 3T4WA 3AALA 5D9MA 3IGHX 1EXPA 6REQA 3THCA 3ZZ1A 1M03A 3LV5A 3A13A 4C6KA 3R6IA