4PB5A

D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with l-erythro-3-hydroxyaspartate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNAACATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate.
pubmed doi rcsb
source organism Delftia sp.
molecule tags Lyase
molecule keywords D-threo-3-hydroxyaspartate dehydratase
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4pb5A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4pb5A02
3KW3A 2J66A 4XG1A 2DY3A 2TODA 2QGHA 3GWQA 1KNWA 1RCQA 1KO0A 1L6FA 2VD8A 3R79A 2VD9A 5FAJA 1FTXA 1VFTA 2O0TA 3NZPA 2PLKA 1L6GA 4XBJA 4Y2WA 3S46A 4LUTA 4LUTB 3B8TA 3WQCA 5GJPA 5BWAA 2YXXA 2P3EA 3E5PA 4A3QA 5GJMA 1SFTA 3LLXA 3N29A 1F3TA 1B54A 1HKWA 3NZQA 3E6EA 1HKVA 3AWOA 7ODCA 4FS9A 3HA1A 4DYJA 1EPVA 1W8GA 2RJHA 1SZRA 2OO0A 3B8VA 5FAGA 1XQKA 1VFSA 3WQEA 2ON3A 4BEQA 1XFCA 2SFPA 4ILSA 3UW6A 4ECLA 3MT1A 2NVAA 4DZAA 3BTNA 3B8WA 2ODOA 3WQGA 3ANVA 1NJJA 1XQLA 3SY1A 4PB3A 4QHRA 4WR3A 2PLJA 4LUYA 4AIBA 5IRPA 4V15A 4LUSA 4LUSB 3ANUA 1BD0A 3HURA 5GJNA 1TWIA 4BF5A 3CO8A 3WQFA 3CPGA 3N2BA 5FACA 3AWNA 4BHYA 1TUFA 2NV9A 3OO2A 4KBXA 1NIUA 4PB4A 2RJGA 1CT5A 4PB5A 4BEUA 3VABA 3N2OA 1VFHA 3B8UA 1D7KA 4ZGYA 3WQDA 3C5QA 1QU4A
chains in the Genus database with same CATH superfamily
1A5NC 4UTHA 3VIJA 1C3FA 3AFBA 3KOFA 3TAKA 1W2VA 3O05A 4IM4A 1H7OA 4L4MA 4OE7A 4IJRA 1X97A 3S0CA 3EWDA 2QGYA 2E6DA 3U2ZA 1U33A 4PTDA 3M0KA 4NU7A 3CZLA 3UZXA 5A8NA 2RHGA 3LQGA 1SFTA 5KZEA 3EX1A 2C14A 2WYSA 5LYRA 4MIMA 1JYVA 3ITXA 3WF3A 2PDPA 2AQOA 1B90A 1MEIA 2X30A 1IXPA 4HOWA 3N2MA 2HK0A 4ZXLA 1VBHA 1PHWA 3GXTA 1R9XA 4NRRA 1VR6A 1XH0A 4ILSA 2V5JA 3E0VA 3Q37A 1ISXA 3MV11 3TA9A 3NPWA 2YL5A 5A6JA 3AOFA 4M7TA 4HB7A 5FD0A 2EAWA 2DP3A 3IV3A 2CITA 1J6OA 5F4SA 1FCQA 4B4HA 3F4WA 1F8IA 4JTCA 4NHVA 5IDZA 3H2NA 3GAYA 5EBAA 5G2HA 4L6DA 5AVNA 3UCDA 3QSRA 5A2CA 1YTEA 2Q6ZA 4Y9AA 3CC1A 2YDSA 3VILA 3HFTA 1KM4A 3WFZA 1K9EA 1TPEA 1W5NA 1M41A 5DMYA 1UA3A 1QI5A 4LVGA 3N04A 3G1FA 1QPKA 3PZTA 2PDMA 4FNTA 5E93A 1TV4A 4PMVA 1P0BA 4QQ3A 4FX6M 4C6FA 2NQHA 1JDFA 1LT8A 1UWSA 3WNOA 5KETA 3VO0A 3LTPA 2XH7A 4P8VA 3WEMA 3IJ8A 3VNJA 1D9EA 2OQLA 1VFOA 3LU2A 1RVKA 1XPGA 3DBPA 3M5XA 1JFHA 4JTIA 4ZENA 1YNQA 2FGBA 3IUHA 1T41A 2RFGA 5CC6A 1EL3A 2BVYA 4JL1A 5EYWA 3MT1A 3H70A 3HJEA 2G3FA 4KFPA 3WD0A 1KQZA 3RN6A 1X1ZA 5CSUA 3KRZA 4A8IA 2WZTA 1R46A 1JIBA 1NM9A 4HN8A 4O1EA 4O57A 3PPHA 4B2DA 2Z1KA 4CVUA 3PHAA 3M0MA 3A3XA 5LA2A 2VZSA 4C6EA 3RR4A 5EMLA 2WJZA 3QZEA 2XINA 1HO1A 5D32A 4LVBA 2FPYA 4QP0A 1OYAA 4J3UA 2WC7A 3N15A 2PDBA 4ACZA 4J3VA 3C5QA 2VCCA 3T55A 4DZIA 4JYEA 3PFRA 4XZWA 3ZIZA 1KBLA 2VKZG 2FMNA 3FGCB 4MM1A 3JZEA 3H2FA 4AQLA 4LEQA 1XM3A 3W00A 2FTPA 2J88A 3DFYA 3W73A 1PZ3A 1O5KA 2FPVA 1TG7A 1QK0A 1LL4A 2DZAA 5IM51 4ZL1A 4XBSA 5CPTA 3NCOA 1ENUA 2YW4A 4GISA 2CLMA 5LIXX 4KIEA 1BTCA 4Q8QA 2P8CA 1CGXA 4YMZA 2OSYA 2ZCGA 1J11A 2QQ6A 4O1DA 3UG8A 3VNIA 2EPOA 3BJTA 4NSBA 3SECA 4W8BA 1CB7B 3SW6A 3TXZA 4XZBA 2XVNA 1JG9A 3WLJA 1OQFA 3MWCA 1MNSA 4R9XA 1S1PA 4XD5A 5K9XA 5AECA 2D24A 3S5ZA 3NAVA 4TQTA 1DJZA 1M68A 2DT1A 2J25A 3U3HA 2V69A 2QUUA 6XIAA 4M6QA 3SUVA 2PRHA 1IR1A 1LRQA 1ZALA 2GVJA 4M6UA 2F38A 1HL2A 4U5IA 4V15A 2BMBA 3RFAA 4GY1A 2NZLA 1KA9F 1CENA 1TWIA 3BWWA 3EDKA 3IJLA 1SVDA 2FHCA 3ID7A 4MWAD 1U2YA 4DY1A 4IGHA 1ONEA 3AHTA 2PDHA 3O6DA 3T07A 1JDCA 1YE6A 3EB4A 3KWSA 3C3NA 1B3XA 2PP0A 1QTWA 3CHEA 4W84A 4AAJA 2X1UA 3KVKA 3VOGA 3SCOA 3APGA 4AZ6A 1O7AA 1CXKA 2LLEA 3K4AA 2HTMA 2NX3A 3VX0A 5C0QA 1MXDA 4DXXA 2ZX9A 1QI2A 4HCLA 5A6SA 5EBUA 4JDBA 3BJSA 3GH7A 1BXNA 3VM5A 1M7JA 3MUAA 4NASA 3QHMA 1CGYA 3BUVA 1MEHA 4QLJA 2WVTA 1RZMA 1A5CA 2ZDSA 4ZSTA 2C15A 4UFHA 2DPEA 3S1XA 1ECQA 4N42A 3PN8A 3CUZA 2FDSA 4PUEA 4S3DA 4J28A 1ISVA 5A3HA 1AFSA 3VIIA 1LP6A 2EKCA 2XPKA 5C54A 4IMAA 3CQJA 5FJUA 3GVVA 4PMZA 2YXOA 5H1WA 1H49A 1VJSA 1L6SA 3SDOA 4AU0A 1OGSA 1MZRA 2J9ZA 3BJFA 4A2SA 2AL1A 4RE0A 1XQLA 1WUEA 5CZTA 4DIAA 3NQ7A 2DZVA 2VZOA 2BXYA 4WKHA 2PD5A 2HEJA 2VTFA 4EXAA 3C0LA 3GG8A 5A2BA 4ZZ9A 3WX7A 4LYRA 1UWUA 5D2TA 3W88A 4O13A 1NIUA 1EYEA 1QXLA 4UCFA 3SCNA 3G1SA 2R1LA 3VCNA 3CV6A 3TQVA 4RNHA 5DEZA 3LXAA 3MC5A 1GTEA 3PBVA 3GNXA 1XDMA 5K3VA 5SWUA 3SGGA 4XV0A 3AXHA 5F2IA 1YRRA 3ZM8A 1DKWA 2VFHA 4R85A 2O0TA 1I2PA 2PLKA 3FJNA 2NW0A 4D6DA 2FZDA 2BY2A 3LNMA 1WXZA 5E1QA 3WQCA 1DTUA 1VJIA 4IUOA 5GJMA 1E6ZA 3VE9A 1E51A 2Z28A 5IDIA 1RCOB 1B54A 1MO0A 5JBDA 4LX4A 3ARTA 4HYVA 1E1EA 1SZFA 1Z44A 4C6KA 1XYBA 1XYLA 4TX8A 2QCGA 1GHSA 1S38A 3AJ7A 3B04A 1PB0A 3D3AA 3NO3A 3B8IA 4FI4A 2DIKA 1CNVA 1RP9A 1B1YA 4Z0SA 3BGGA 4I90A 2B7QA 2WSYA 3MHUA 3TTSA 2J8TA 4XUYA 1FHLA 3C0SA 4U3AA 3S2NA 5IXEA 3A3WA 3IACA 3MUY1 3WH9A 1GOXA 2X1RA 2YGYA 1QNVA 3AHXA 1HT6A 4E2DA 4V28A 1S2AA 2BGSA 3W86A 2VELA 1HJXA 3G0SA 1D7KA 4IP5A 2O7QA 3OBKA 1OX4A 4FOJA 2OLSA 4C90A 4H6EA 1UR3M 2J7CA 3NFUA 3A23A 3C2FA 4B15A 4QQUA 5HANA 3P0XA 3AJXA 3SRFA 3RO8A 3RPMA 3QMRA 3IGSA 3GHUA 3CL7A 3FIGA 1DIOA 1VH7A 2GJPA 5EMKA 1VQTA 1N8WA 3M0LA 3CQHA 2XIJA 2B7PA 1PO9A 4DUOA 3WJZA 1RY0A 2P50A 4IP4A 1W1TA 2ZA1A 4XSLA 3UCCA 3FY1A 3DHPA 4KGJA 2GYIA 4J3XA 1F76A 1YW1A 2Q09A 2Z4GA 4TXEA 1V3JA 4GC3A 3K8KA 1H1NA 1OJXA 3W71A 1SR0A 2XFYA 4ICMA 5XINA 1R2TA 2FTWA 3UPBA 1RSCA 3S9ZA 4PYSA 1A4LA 2GDVA 2VZTA 1LLWA 2PDUA 4U2YA 2R1NA 4WKAA 6ALDA 4UFKA 3VGDA 1GCYA 4C6DA 3MCOA 4AD1A 4PRWA 1H1ZA 2QEZA 2RJGA 5D37A 2J75A 1VHNA 3TLQA 3THDA 4HD5A 1FQ0A 1XG4A 3NXLA 3O0KA 1F7BA 3PZGA 1LROA 5D9MA 1JZ6A 1BXBA 2YZRA 3I3EA 4C7FA 4IPPA 3T44A 1PX4A 4ML9A 3HPZA 1Y5WA 4GVFA 4S23A 2QUVA 1A3XA 1J0IA 4MLJA 2GUUA 1XWYA 2J27A 3GX9A 3TW7A 3PBGA 4HYRA 3RRAA 1XLBA 2OTDA 4PMDA 4QS5A 2OYLA 3I65A 3NYDA 1REQA 2GVEA 1HKVA 4M51A 7ODCA 2DW6A 3QR0A 4BQ5A 3BQ6A 2BXZA 2WNZA 2PDJA 4DVOA 4CN4A 4UTLA 1TTQA 5E0CA 4IFKA 2O55A 4JKLA 1A5SA 2CZFA 1LYXA 4KEUA 3K8LA 1NOWA 3QTGA 2DH3A 3UP8A 2BWGA 4MTVA 5E70A 4K8HA 1P0DA 2J24A 3AXMA 5LNWA 4B3LA 4X9SA 1CBGA 2VXNA 2BY3A 2WNWA 2J6XA 4W89A 1EUAA 2B31A 3DECA 4G2DA 3I7SA 4MDOA 1VLWA 4XWUA 3DYMA 3IIPA 4O10A 1MQQA 2UY3A 4AZIA 4ZFCA 1RAKA 1TPDA 3MP5A 5T9BG 4H1ZA 2PRMA 3B0VC 4YYCA 3P67A 5CG0A 5FACA 4LT9A 2OVLA 3M0XA 3GHRA 2PEVA 3DCPA 4L4PA 3OEXA 4LSBA 3AS1A 3UVAA 1QR7A 2XSXA 4UFJA 3O6CA 1W31A 3NYZA 1JFXA 4WJ8A 3BV7A 4CUCA 3T1GA 4WUIA 2Y24A 2W66A 2DY3A 4MSSA 2WSRA 4B92A 3BCJA 1Q6GA 3VXGA 5JVLA 3JZUA 1VAHA 3CLMA 1OSEA 4AVFA 2PP1A 2WSQA 1NP0A 2NV1A 1QI0A 1I60A 4IX2A 1JYNA 5GJPA 5D9OA 1RPXA 4E8CA 3AS3A 4AZ7A 1LCOA 4QCEA 2ALDA 1TZ9A 4A4AA 1WXYA 1EGVA 2V9DA 3SN0A 1E15A 1QCWA 3O1NA 3W7HA 2FPTA 3SR7A 1BPLB 2JF7A 2FGZA 3D3FA 2SFPA 3MI3A 2V0TA 3ZSTA 2GL5A 3LPOA 3OGSA 1RALA 2RGMA 5D9NA 2VX5A 2PFHA 1EDQA 2OZTA 4Q7IA 5HNNA 3A22A 3H4GA 3IJIA 4ZXOA 3AYTA 1GYNA 3E49A 1ITXA 4XB3A 2PTWA 4ZE5A 4HZ7A 4C7DA 4I7VA 2OSWA 2WZMA 3BOLA 4OOZA 1T8XA 2X2GA 3I3DA 3CZGA 3B97A 1IV8A 3OGRA 1HJSA 3UPWA 2BB0A 4GX9A 4TIMA 1SO6A 3G8RA 2OEKA 4EACA 4UBPC 2BV9A 2VVNA 2A85A 3VZYA 3VZZA 1ZTVA 5L6UA 3WL1A 2CU0A 4BF7A 2WANA 4MYXA 3LCXA 3AIRA 2G96A 1OK4A 2I5QA 4C7GA 4LF2A 3WF1A 4O11A 1VPQA 3N6HA 4FAMA 1NEYA 3E2QA 1KGUA 2HQAA 2O9TA 3UR2A 4KKXA 3GIQA 4J2PA 2ISVA 3W2NA 3P7YA 1BRLA 1YDNA 4K38A 3RPTA 3V5CA 4GVGA 4QE4A 1VENA 1W2PA 2H8XA 4FMVA 2YL8A 4KF1A 5A6BD 4HHPA 1CZ1A 3KAOA 1B3WA 5A69A 4A6GA 3ABSA 3GD6A 4J2MA 4PTVA 1CLKA 4ZQPA 3KHJA 3UNTA 1B3VA 1F6KA 2QZRA 1MW0A 3AMLA 4PB3A 4NIRA 4Y9MA 1QW8A 1Q6DA 4UOJA 1E40A 1H11A 1B3ZA 3R0UA 1QRQA 1GEHA 3HGJA 4BF5A 3WQFA 4O54A 4ZB0A 4NJIA 1AQMA 1W6TA 3WQ5A 2QDGA 4QDMA 4LTSA 2DSWA 3NSNA 1VBRA 2QKFA 4LB3A 2B7NA 3W26A 4UIOA 3GY1A 3MI6A 3MS8A 4PMOA 2YLAA 3PB0A 2OKTA 3VUSA 2HVNA 1E4NA 1GT8A 3SUWA 1Q66A 4WDXA 4DYEA 4XAFA 1PIFA 3P8IA 3S46A 1UZDA 2IKGA 4IMCA 4N02A 1W9PA 1Z3NA 5EMYA 3B4YA 4F0KA 1JPKA 3SADA 1UIOA 3BSMA 2VR5A 1OK6A 3FLUA 3SGZA 4M6VA 4AD3A 5AHEA 4ZQMA 3BK0A 1CXIA 2Y5JA 1UQYA 3L5AA 1BG4A 5BOOA 1XR2A 2NX1A 3TXVA 3H55A 3QRHA 3LK6A 4YYFA 5F1UA 4H19A 3NJ3A 5REQA 4NXKA 3WQGA 2DUAA 3DFPA 4D9PA 3UYIA 4QROA 1J0ZA 3W7CA 3PJUA 1X39A 2WOQA 4AEFA 2XUCA 2A7PA 3EZ4A 1V0NA 3A5VA 2INEA 2ZRUA 4OVXA 1DYSA 3AIQA 4Z2IA 1I2NA 2X40A 3ZJKA 3U7BA 1MYRA 1V8EA 3ENLA 4JTKA 3V18A 1BWKA 4HK7A 3W1PA 1W3TA 4ACZB 1JCNA 1V3IA 2INZA 3UA3A 4W5UA 2V38A 1K02A 4MUPA 4MYAA 2CNCA 3FGCA 3TROA 1XG3A 2ZRXA 4MJ2A 1P48A 4O4VA 4KCWA 4NG3A 4HMNA 3VKDA 3H2AA 2DSUA 4DN1A 4KETA 3E5PA 4EK7A 2JEPA 2EKGA 4NVTA 3IANA 3ICJA 3KL3A 1AH0A 3TN5A 1C7SA 3UY7A 3DDMA 5A6TC 5HQLA 3GTFA 3TJXA 4I5XA 4DF2A 1TCMA 1XLAA 4BF9A 1K8CA 1AJ2A 3F7JA 4FALA 3QY8A 1EBHA 1VHCA 1G67A 2DSKA 3EX6A 3LV6A 1MEWA 2WAGA 3BMXA 3BTNA 3N34A 3W1TA 4LB4A 1OFDA 3WH8A 4BA0A 3OQEA 3DEQA 3GNNA 5IRPA 4HHMA 3R8HA 3GVGA 1I2RA 2W3ZA 3L4ZA 5I5RA 3S1VA 1FWEC 4D6JA 1OBAA 3VD9A 3M6YA 3AC0A 3Q58A 2ZFAA 4ZOEA 2ZWYA 1WP6A 4Z2JA 1QK2A 2A3EA 4ORMA 3SQMA 1GOWA 2C8NA 3TN6A 2W27A 5CJNA 3ZVIA 1KTCA 3ABXA 3RXZA 1WZMA 3A21A 4U5KA 2OOGA 4QEHA 1AQ0A 3AO0A 3RM9A 3TW9A 1G4PA 3UJ2A 4PUJA 1BQGA 3GTXA 3SN1A 4NYUA 1LWHA 4XZIA 2QIWA 4H04A 4S3KA 3UJEA 4HKPA 4Z1DA 4KEZA 3VNZA 4E4PA 1XYMA 3G1YA 4RDZA 4B5VA 3CUFA 2Z27A 3C4UA 1JAKA 3RLHA 1TV3A 2XIQA 1XYCA 3IK4A 4X0NA 3TN3A 5DCBA 3GVWA 1XSIA 2D1ZA 4H8NA 4JIRA 1K7FA 1XIGA 3AIUA 4AIEA 5IHRA 1OCNA 2A7NA 3HBLA 3S47A 4MG4A 1SM9A 3VDGA 1T40A 4X3ZA 3QH2A 3U2OA 4ADUA 1UMYA 3DOPA 3W6MA 1FRBA 4J40A 1UMLA 3VIPA 5XIMA 2R1KA 3F5KA 2FZ8A 3HPFA 5C71A 3WMCA 5AHNA 1NH6A 3LPFA 2AAAA 1GYMA 4AZBA 5LNVA 3OW1A 2RAGA 5I79A 1PTDA 3BOXA 4QG6A 4J27A 4P8XA 3NL2A 2QVHA 3QR3A 4HU4A 1ZL1A 3ZR4A 2QAFA 3DFTA 3DX5A 2VC6A 2F9RA 3BAXA 4OGZA 3I7RA 1BKHA 3WMSA 4L1GA 3PZMA 4IL2A 3GTNA 2ZUMA 3LHVA 3R1ZA 1XBZA 4IJCA 3CGTA 4WY0B 4AC1X 2J66A 3VVGA 2OG9A 1T8QA 4BJHA 3A9IA 4WOZA 3WUFA 4GC4A 2O4QA 1HGYA 1JF5A 1WOBA 2QDHA 2YXXA 3HPXA 3KM8A 1R3YA 2EJAA 4MDPA 1ADOA 5CEWA 4IQDA 1DWIM 3WYZA 2WHMA 4LC8A 1GVEA 1Q7QA 1XISA 3DYPA 1T5AA 3R11A 5CBIA 1THFD 4X0VA 2ZXBA 4I7UA 1GYLA 1E6NA 3I6EA 3NEHA 1M01A 5TNVA 4M5PA 4TV6A 5FJPA 4Q4OA 3B9NA 3WD3A 1W5QA 3TZFA 2I17A 1ZBVA 3B9AA 1V0KA 3TKFA 1MUWA 1UH2A 4ORIA 1J6PA 4GOAA 1EF3A 3P6LA 5I0DA 2R94A 3O0FA 3TC6A 1J10A 1EP2A 1H09A 3EDEA 1TELA 3RF9A 1LDCA 5DCEA 4XK2A 4HNTA 5F2LA 3OVRA 3C6CA 3LRMA 1CXLA 2GOUA 4GACA 1I0DA 1YBQA 3CL6A 3DFNA 1CGTA 4LPCA 1X6UA 3PJXA 4HGXA 3QZ6A 4DJDD 1SZEA 3L5MA 1NP2A 1UASA 2ZXAA 1WZLA 1S1RA 4DWSD 5M3WA 3L4VA 2ADAA 4DPQA 1OX4B 1RH9A 1E6PA 4L5ZA 4KQNA 2NT0A 4X61A 1L6FA 4EAMA 3LLFA 1TPH1 5FOOA 3PNUA 2C19A 2QNEA 4IF2A 3KBWA 4GGHA 1FH9A 1EJXC 4A3QA 1EPXA 1NDWA 1VRDA 3EXRA 1DPMA 5G4WA 4NNCA 1U5HA 1ZJBA 4HBKA 3AHZA 1G0CA 2DZBA 4G1KA 4W93A 3RCMA 4KRUA 1TMQA 3KS6A 4PSPA 1HJVA 1BSLA 3KBNA 3M0HA 3TWBA 1VFSA 2GGHA 4GUIA 3M43A 4CU6A 3E1F1 4NZ3A 4DM1A 2H8ZA 3Q4DA 3NPVA 4RL3A 4DO6A 1IT0A 3KZSA 2OR2A 3QQWA 5I78A 2OT1A 1AL7A 4WJXA 4B5TA 3FDGA 5A6MA 1TV2A 4BCEA 2MNRA 4WR3A 2ZICA 4U31A 3BLEA 2C0AA 1G6CA 4W8LA 2X8RA 3N17A 1YHTA 1UR9A 5RUBA 4IJBA 1UYQA 4CU8A 4C1KA 1E71M 1QATA 2NXIA 4GD0A 3U7VA 4AXNA 4JYDA 2XVPA 3B03A 3MVIA 1U5VA 4KIRA 2IKHA 3T8LA 2ACSA 4M6PA 3SUTA 1J96A 4DBWA 1EXPA 3QHOA 4GUGA 1YMYA 1W3HA 2QF8A 2XYLA 2YLLA 3BE7A 2FJUB 3WBAA 4QNEA 4FX8A 2GUBA 4LVFA 7TIMA 1UD6A 3MO4A 4JN6A 2P53A 4TTUA 3VNKA 5AZ1A 1ME8A 1ZPTA 4H2HA 4A8LA 3SRDA 1R3VA 3TSDA 1D8CA 5CZ0A 2XGBA 1GONA 2A79A 1IGWA 4GZ7A 1HKKA 2X1IA 4DJDA 2A21A 4PC8A 1RUSA 3PB2A 3LMZA 3L4YA 5DLCA 1ME9A 1Q85A 3SI9A 3W37A 4IFKB 1OABA 2VMFA 3W0KA 1X6LA 3EEZA 5A6BA 3TCSA 3V5OA 4QX4A 1X8CA 4LAOA 1XIIA 4WKFA 1E0WA 1V79A 3VMPA 3LOTA 5DMNA 3PTMA 3PAJA 3LM7A 4MUZA 2F61A 3CWOX 4LS2A 3N6QA 1M3UA 4I8DA 4NJJA 4BI5A 4P7QA 2IW0A 1RQBA 3E2RA 2JGYA 2FZBA 3I3BA 7PTDA 5KITA 3WJSA 4Q4PA 3H2EA 3SCRA 1AVAA 1B30A 2GGGA 2E6FA 5CC5A 3LLDA 1A80A 2OX4A 2XFRA 3PWAA 4IMEA 3L4XA 5A6KA 3LTSA 3NPXA 1WAUA 4B2DD 1J0HA 2XN0A 3TR9A 3S2JA 2R24A 1OFAA 4XVEA 1JVNA 3ZJ8A 3APTA 1Y0EA 1MRAA 3C8NA 1HP4A 4QJ3B 2RDTA 3GVRA 4KT2A 3XIMA 4LFYA 3F5JA 1Q6CA 2YSWA 2ZTJA 1OT1A 1JL8A 2PDYA 3FJLA 2OMAA 3GTIA 2XGIA 3ELFA 1X96A 2X1SA 3DI1A 1XLJA 4L61A 4W9TA 4JNZA 1UP3A 1KM6A 1GZGA 4ZQNA 2ZZ3A 3T9PA 1PEZA 4E4FA 2D2GA 4FPSA 4CD4A 3K1DA 4LGXA 3CUGA 1JCYA 4G56A 1RY8A 4U33A 3BG5A 2W91A 3BC9A 2HXUA 3I4KA 1R85A 3GXIA 1XD0A 3KBJA 3WQPA 3I7QA 1XBYA 4LF1A 4ZFMA 5ABHA 3QZAA 3BW4A 5EFFA 4LOCA 2WC3A 2O92A 1SJCA 3RLUA 1ZJIA 1OG6A 2CZVA 1V93A 2DJLA 2QMKA 1IWPA 1S3TC 1BAGA 2FZ9A 3QPYA 4LUIA 2YJQA 1EWEA 1YEYA 1CGUA 1VFTA 5HR7A 4UTWA 1W1A1 3T0DA 4UCGA 4EPKA 3ARPA 4WX2A 4BKNA 1YXCA 2Y8VA 5HJXA 5DX7A 3OP2A 8A3HA 3T08A 2CZ5A 4HPXA 4LANA 3CT2A 1TIWA 1BRLB 4MKNA 5E09A 1PCWA 1WOAA 4MY8A 1Q8JA 1GUVA 1V6WA 3TWAA 3OYZA 3H24A 1D3GA 3VDHA 2RDWA 1EUNA 3URAA 4V27A 2B81A 4JOMA 2J62A 5G1MA 3THQA 3VFCA 4LUYA 1F5ZA 1FOBA 1UP0A 3S9YA 1XJBA 1OX6A 2GWNA 5FF7A 3NQFA 3OG3A 4UUIA 3W84A 4MNKA 5GJNA 4MHBA 2IS7A 3LN3A 4GY7A 3SFKA 4C6IA 3LCFA 1TWDA 5DMLA 3SO7A 3UZZA 4ZB5A 5CPNA 1BWLA 4JAWA 1SQ7A 1TJPA 1MI3A 2E5CA 3WF0A 4JXCA 3EDJA 3KE0A 2BS9A 2TODA 3PZVA 1I2QA 4R5EA 3DFSA 4GI6A 2JKAA 5CQ1A 1BGAA 3SB0A 3MMDA 1V7AA 5A8GA 5BZAA 2GQAA 3D6NA 4AUBA 1H7PA 3OVPA 4HA0A 3W83A 4TR9A 3LBCA 3VD4A 3EMQA 5BRBA 5DBTA 2E8ZA 1TZZA 2Y62A 4GUFA 4JIPA 4PCTA 3KRSA 3FX4A 3MI2A 2CWXA 3VAVA 5I24A 4ZO9A 2VQUA 2VEKA 3OBAA 1SZNA 2XU2A 1BYCA 3KVJA 5B7ZA 4NI3A 3D47A 1R0MA 2PZNA 4ICNA 5REQB 5I3IA 3KS5A 4PMYA 2QPSA 1FWSA 1M6JA 4H6QA 2J7HA 4NY2A 2OZ0A 3VZXA 3RILA 3OA3A 4H2CA 1KR1A 3LZ3A 4W7VA 3UR5A 1BF2A 1BYBA 2E4TA 3ZR6A 4ZSUA 3H2CA 1TRIA 2QJHA 4IIEA 2HBXA 4E8DA 3VDBA 4CD5A 2Y88A 3DFQA 2VWTA 3BMVA 4F0LA 2UBPC 4JIEA 1HG3A 1F73A 2X05A 3JW7A 1J93A 4DAIA 2F6UA 1EJSC 3BW2A 3GDLA 4QGCA 2QR6A 3DKJA 1QPOA 4B5XA 3GK0A 4W4QA 4I9AA 4U28A 2YCLA 1EF2A 2HE5A 1GPWA 5DBUA 3MKKA 1UJPA 1GVSA 5I00A 5LIYX 2VFEA 3P8JA 3H7UA 5D04C 4H7ZA 1U22A 1ZCOA 3CB3A 4LQ1A 1TJ1A 1H7NA 3QPEA 2CERA 2PBGA 2HMCA 1DJIA 3SY8A 3M47A 3HIJA 3LXCA 1V6TA 2OO0A 5CPLA 1S5WA 3K1GA 1VC4A 2ZUTA 2VZUA 3OJGA 2ON3A 4UTJA 3PG9A 5PTDA 3GH5A 4OTKA 2AOSA 2GSHA 3ZVHA 4XSMA 4HT3A 4HHHA 1AG1O 3P14A 1FCUA 1YLVA 4JTFA 4MWAE 1D7FA 1UZHA 2WCSA 1FCBA 4JEJA 5TQLA 4AYGA 3CQ0A 2Z1SA 3ZLFA 4YTQA 1CT5A 1WCGA 3M44A 3ZXWA 1GQLA 4QFUA 3W1LA 1DIEA 4WDTA 5EB8A 2JIWA 3SQLA 2X0HA 3UJSA 1FP8A 1O5RA 3F5LA 1PIIA 2HNHA 1D3HA 4I9MA 1W1ZA 4O1CA 4UMAA 1KD0A 3B0UX 4JTGA 5HMFA 1W5PA 3F4CA 1P0EA 2FYMA 3SUSA 4MGGA 4C6LA 2V5CA 1R9ZA 3QYQA 3B05A 2V63A 1J2WA 4CKQA 2WPGA 4RJEA 1TR1A 3M46A 2CHOA 3QOMA 5JQ9A 4US5A 2PDNA 2WHLA 5CH9A 2BOGX 5HPOA 1O12A 2Y2WA 4K7VA 1EXBA 4DNHA 3MUIA 4ZO6A 4RR4A 1MW2A 3BV4A 4AZHA 3TSMA 1XCFA 4XD3A 2BVTA 3PSWA 1WE5A 2HISA 3FYYA 2EG7A 1TTPA 1W91A 1V3LA 4KMQA 3U5YA 4AXKA 4Q33A 1C9DA 1BF6A 2BY1A 3DUGA 4B3ZA 2DVTA 3BZJA 3S1GA 4AWTA 4A29A 3RCNA 3WDQA 3W7KA 1QHPA 2J8GA 1Q3NA 2XDFA 5HINA 1HXJA 3MVTA 4IUGA 1EHAA 5H8UA 3CV2A 3GSMA 3K4DA 3VNLA 3PVFA 3WK3A 4HHLA 1E72M 1F3XA 5M2FX 3CUIA 4H8UA 5L9FA 5BXSA 3T4CA 4WY0A 2XG9A 3P3BA 3OHIA 3V0TA 4Z0JA 5LIKX 4D6FA 2ZZ4A 4IIHA 2E5BA 5E6YA 1TSIA 4IIGA 3GDMA 2H3DA 2VVSA 3NUKA 1GVYA 3MANA 3CEPA 3W02A 1W5OA 4H3DA 5F2GA 1TMHA 3PBYA 1DWJM 3SIZA 3PF3A 4EPBC 5I77A 3H54A 1UW9A 1WXJA 3HV9A 4L6HA 1OD8A 3TQKA 1DJYA 4S3FA 1HJUA 4GXPA 3OZPA 4F0MA 4E5TA 3V36A 3OODA 5BNKA 1EJWC 1JAEA 2PDKA 3U4FA 3EPNA 3NSMA 3OLGA 4MWAC 1JI2A 1FWJC 3TQ0A 2Z2AA 4UTMA 3RLVA 5CZJA 2I57A 1DXIA 3IAQA 1DOSA 5KZDA 2GUYA 1YBQB 2NV9A 2FVLA 4A22A 4O50A 1TX0A 5D2WA 2VHLA 4DF0A 1S5NA 2WMHA 3CHFA 4Q6JA 4H6KA 2GK1A 3V7PA 3W53A 3SEPA 1GOQA 3TA6A 3DC8A 1YE4A 3UBPC 2A7RA 4AWUA 3VPLA 5G1YA 3CZJA 4KWWA 3ZWSA 1PV8A 2Y7EA 4V1XA 3UWZA 1DWGM 1DBTA 4MAVA 1IZJA 1XRTA 1XYFA 1ONXA 1MUMA 3DHFA 2VURA 3MB9A 5CZSA 4XAGA 2C1IA 4JTLA 4Y7EA 1SR9A 1BHGA 3GC2A 4XZMX 1SGJA 3GNOA 1UWIA 2PWEA 4ROQA 2IKIA 2Y5SA 2G3MA 1SFSA 4QE1A 3ES7A 3DBNA 1EJRC 2CEQA 3EWCA 4AHQA 1S2CA 3VCRA 5FJJA 4JX5A 3R8RA 3WUBA 3T2PA 2PU1A 1XIBA 1Z69A 1XFBA 3GBEA 1LT7A 4CCZA 2HK1A 3CUHA 1KBIA 1H5VA 4LCQA 1K4HA 5HNRA 1OIFA 3SIMA 1B57A 4AVOA 3N9KA 1TJRA 1VCGA 1CGWA 1J79A 3ORWA 4J35A 1XX1A 2OEMA 3M9YA 3P93A 1VCFA 3DIPA 3L4UA 1E6QM 3W1AA 3Q67A 3T05A 1OHLA 1G9HA 1POJA 3HQPA 5D4YA 4ZOCA 4FLSA 2Z1WA 1PZ2A 1LWIA 2GGIA 2Q02A 4MKSA 2E40A 2B7OA 3G8EA 4YXGA 1YQ2A 3EXTA 4CNOA 3ZLGA 4D71A 3JS3A 4HNVA 4H9TA 5C8BB 3VGFA 3NPUA 4B5SA 5D02A 2WLZA 4JIIX 2ASHA 2F2KA 1I2OA 1F3WA 3WBXA 4IMGA 3INPA 1EQCA 1R38A 2CETA 3NM1A 4QJ5B 4E0CA 1P0KA 1RK6A 4I5RA 4GIRA 2WZHA 1PZ0A 2BTMA 1QVBA 1RP8A 3FJ6A 2NVDA 2DJXA 2ZX5A 4ASTA 4PCPA 3W82A 1XRVA 3WLSA 3VKJA 2AL2B 1Q63A 1YXDA 1OCBA 2WHKA 4KFOA 3TE9A 2D0HA 4AYSA 3NG3A 4QG9A 3THCA 1J8VA 1VPXA 3G24A 3DXIA 1OFQA 1DV7A 4U3CA 2GVLA 4IPIA 1FH8A 1ZJAA 3EGJA 3W25A 4ATWA 2G5WA 5DXXA 4G5DA 1F61A 1IEQA 3IWPA 2TAAA 4N0RA 3LGEA 1MNZA 2EPNA 1KKOA 2E3ZA 3ARQA 3S1UA 3H26A 4HNOA 3S83A 1PS9A 3RM4A 3ME3A 3O7UA 4XAZA 3T40A 1WAWA 1W1YA 2I16A 3KTSA 2Y8UA 1KNWA 2RKXA 1B5TA 5LIUX 4UOQA 4Q8UA 1AW5A 4JCLA 2JIEA 4BK9A 5KMYA 4DZHA 4IHCA 1H62A 5FJTA 2IKJA 1J9YA 1JUBA 6TAAA 3P2VA 1YDYA 4RZ6A 3VYLA 4O15A 3SSJA 4Y9OA 4W5ZA 3GFYA 2QCFA 1TE1A 3DFOA 2W63A 4RK8A 2WLYA 1W1B1 3ABRA 4LCRA 1U1JA 3W1UA 1N55A 4UQEA 1IIGA 1YTKA 3NO1A 5LIWX 5K7JA 3CMFA 3UWVA 3RITA 1E0VA 1MZHA 4DJDC 3HJZA 1PDYA 3DGRA 3AHVA 2TSYA 2FIQA 3KCLA 1XLDA 3AUJA 3W1MA 3WK0A 4DBUA 4UTKA 2RUSA 3AU2A 4PUMA 1I9CB 1WKDA 2P76A 4AY1A 3GG1A 1G4TA 1UWAA 1XL9A 2R8WA 2KAUC 2EJ1A 4OT7A 2VFDA 2WJEA 2XWDA 1AODA 4ERGA 3O16A 3UA4A 3CMGA 2FHFA 3WQ4A 3QYSA 3SQSA 3M7WA 4PTXA 2VEIA 1PKYA 4FLQA 4YU1A 2ZC1A 3NL5A 4PRTA 4QG8A 1SFJA 4G1NA 1L6GA 2ATMA 4L56A 4HTYA 3RCYA 3BLOA 3LPPA 4YLWA 3N9SA 2CLFA 2Z29A 3EDDA 2ZYFA 3GW0A 4IIDA 3P80A 3O07A 3NQAA 5HJLA 3TUUA 5LHEA 4R53A 3WNPA 3G22A 4GI9A 5D2XA 3LERA 3PTDA 1P6WA 3M64A 4U10A 3O6YX 1GVOA 1UOKA 3TTYA 3KTXA 5I09A 3CTTA 4CQ8A 1NQKA 3WLTA 4K7YA 4WXZA 2PDWA 2DT2A 4YTUA 3KP1A 3ABQA 1OB0A 1B0IA 4K36A 4XKYA 1YDOA 1FWAC 4LY8A 4QM1A 1V08A 4E3VA 1RLDA 1V7YA 4GQ0A 1KV5A 5H8PA 5DMMA 1V03A 3NXFA 1JXKA 4S3EA 3GHTA 1QAPA 3LQLA 3MJYA 3NQBA 1GJWA 1G5AA 2CZDA 3CU2A 3GYEA 3HQOA 4ENLA 5AHIA 3FN9A 3O8AA 4IXHA 2OWWA 3NQ6A 3IIZA 3UFYA 4RPQA 3C3UA 3TYBA 1C7TA 1LWJA 5FAJA 1K77A 2CWNA 1KR0A 3NZPA 1TE6A 3FYPA 1WNOA 4PBEA 2QHAA 3W6LA 5EPDA 3E0LA 4JN8A 5F7UA 4GZIA 1U30A 3V0UA 3BAIA 4JX6A 1M7XA 4JICA 4D6IA 1Q45A 3AHYA 2O9RA 1GJPA 1JZ2A 4NP7A 4FSAA 3QN3A 2POTA 4ONVA 3SBFA 5IBXC 1IF2A 1YXYA 1JDEA 2PGWA 1TRDA 4LRSA 3CPRA 1S2WA 1P1XA 5BW6A 2XM1A 1GVRA 4AZGA 4TOQA 3MTWA 1WQ5A 2J7BA 4O18A 4YWIA 1ZAJA 2R1PA 3MU7A 1Z6KA 3F4NA 3ITTA 3MUXA 4K6AA 1IXOA 3O6AA 1LL6A 5IHSA 3F1QA 1XGEA 4JYFA 1UIPA 5FJRA 1TWSA 2BY0A 2VL4A 3N2BA 4TMCA 5BXRA 4LAZA 3C0QA 4OUEA 3HZ3A 3QV6A 2XZ7A 1KCKA 3UZ5A 4HNUA 4PB5A 2E1WA 2YCEA 5J5DA 2ZC8A 3VA8A 4HCHA 3W7DA 1O66A 3BXWA 4JX4A 2PMQA 3EPOA 4AD2A 3WKZA 3NL3A 1QNOA 3IAPA 2VGFA 3UD6A 2A0NA 2ACRA 4Q8VA 2WMFA 3VMOA 1J2BA 4YJ5A 4GMEA 5C55A 2XISA 2VD9A 3BQ5A 2ZRVA 1TPC1 1VCVA 3WSUA 4RNFA 4V33A 4KESA 5AYYA 2YCLB 1ZGDA 4PL2A 4IGNA 5BOEA 3E3HA 2HRWA 4HOZA 4EE9A 4P8WA 1QNRA 1DJNA 1ZFJA 1FX6A 2HCVA 1QHOA 2P0OA 1KBJA 3ARUA 1EO7A 3PK7A 1RBLA 2IQDA 4WOQA 5C9RA 4B5WA 1Q4WA 1CGVA 2NSXA 1JCLA 2WB5A 5I3GA 3CIWA 5EU9A 5ABFA 2QAPA 3ZVHB 4EPEC 1UWRA 2YX0A 5T8GA 3NVDA 4GXMA 3OA5A 1QMLA 3NURA 2VENA 3W38A 5HULA 3FCPA 3UWEA 2QJJA 1FHUA 3VKKA 1XYZA 3GXMA 4KFNA 5E0KA 3CHCA 4HMEA 1HL9A 1XDJA 1NFGA 2WM1A 3TMLA 4F3HA 4KS0A 3KUMA 3EX3A 2RH9A 2Y8KA 3VNDA 1EKOA 2WMGA 2VX6A 1YIXA 3ZS4A 1C93A 4UR7A 5CSYA 1HIZA 3IVSA 3LCIA 3RX2A 5HWNA 3CWNA 4W86A 3HN3A 4Q7BA 3RO6A 2ZX6A 5FEPA 2Z1XA 4DUVA 4MFEA 1SO4A 3U0HA 1M03A 5AYIA 1RA0A 4ZR8A 2J4GA 1MSSA 3SRHA 3AXKA 3RLGA 4HMDA 2BHYA 3GZAA 3W28A 3GH4A 4KRTA 2PDFA 1UWTA 4TVCA 2YDAA 1XIFA 4M1RA 3GAKA 1UQZA 3OOQA 3LI1A 1NSJA 3M7SA 3LCLA 4D2JA 4ML4A 4E8GA 1U1UA 1RK5A 1E1CB 3W9ZA 3NDZA 3PR2A 1CIUA 1V6VA 1DQXA 3IGUA 3BLLA 1JZ8A 3HG3A 3KHDA 8XIMA 1RD5A 1UKSA 4NZJA 1PSCA 1E73M 1GVQA 3G1XA 1S39A 2XGZA 5HR6A 3G5EA 3IUDA 4JTAA 1K8XA 2PDCA 3LHTA 2Z2BA 1VBUA 4Y6GA 3S4TA 4C6CA 1SW3A 3LS9A 4JFWA 5M5DA 1OY0A 3SCQA 4O14A 2GGEA 1HGWA 2C71A 2P0IA 4B3KA 4JTDA 2BG5A 2E28A 3II1A 3DYOA 4MZ1A 1MUCA 1YPIA 3BMWA 7TAAA 3MHFA 1NOUA 1VYSX 1PL9A 2OLHA 1M1BA 4PH6A 3MP4A 2ZUWA 3NDYA 3MYPA 5CCZA 1L8NA 4EVZA 1AUSL 1JUEA 4LS0A 1BVWA 4GJJA 1JQXA 3WLPA 4HK6A 3OVGA 4G7EA 4BWLA 5ECUA 2CBVA 4I3GA 1A4MA 1B4EA 1CX9A 3GBDA 4J4KA 3RJYA 3G1HA 4OBTA 5MF5A 1UD5A 4LV9A 3WY1A 2E9MA 4QBXA 1EGZA 4B9ZA 3COTA 4MWAB 5K9DA 4UR9A 3MP3A 2WM0A 3REQB 4LRTA 4UNKA 1D3CA 5AHLA 3KBMA 3IRSA 2V5BA 5HAOA 4AH7A 2XVGA 2YA0A 2ONEA 3B8VA 4JR5A 5M1TA 3U9IA 3OTRA 4Q22A 3TYCA 3DG7A 3LEPA 2P1FA 3NQ2A 1E6XM 1ZCCA 3UCQA 2AMGA 3W27A 5F1VA 5LXXA 2HXTA 1CTNA 2HE8A 4JTRA 3RJXA 3URBA 3H4XA 1RV8A 3NNTA 4NF7A 4PODA 4GY0A 4H00A 1XD1A 3BL3A 3TCEA 3MWAA 1WV2A 1UC5A 2IUZA 3MHGA 2PS2A 4B4FA 3U8GA 1H41A 3C2VA 4MB5A 2EG6A 1XIEA 1BG9A 2EGZA 3MDUA 3WD2A 4HPHA 4PB4A 2EHHA 5G2IA 2Q71A 1FBAA 4NXSA 1EEPA 3U4AA 1ONRA 1AJZA 1WZKA 4PUNA 1TPB1 1XDLA 1LOSA 3K8MA 2GK1B 1SSGA 3Q45A 1KGXA 1KO0A 1XIHA 4H8HA 4LW7A 4Q8OA 4A05A 5EY5A 3IVTA 2ESCA 3I4EA 1ZHAA 3USBA 4OHQA 1JGMA 4FNRA 3PUOA 1Q6FA 2P3EA 4DELA 1FUYA 1VBJA 1AMKA 4MJ4A 1NU5A 3MSYA 4XO6A 3WLQA 3QY6A 5EMJA 2NQJA 3DG6A 4ZVJA 4DYJA 4JNYA 4AB4A 3QFEA 4Z1YA 4US6A 2CXGA 1E5NA 2VQTA 1EJVC 4EANA 4NILA 1XGZA 5IBXA 1VB9A 3IJDA 2CLHA 4W87A 4P61A 3CLWA 4R27A 4J9JA 2XIOA 3BLPX 4GRSA 2A5HA 1IGSA 4J3TA 3IARA 1NARA 4PEEA 4HA1A 2VEMA 2NUXA 4AHPA 4BI7A 3VD5A 4CNTA 3QGKC 5J04A 4JKMA 2FLIA 4GUHA 4UZSA 2D2JA 4JCMA 4NQ1A 2W62A 2QV4A 1JRBA 2WZEA 4IPNB 5LGXA 3AICA 1A0EA 1DE6A 3FXGA 4KBXA 3WN6A 2P88A 3QXBA 4TX9A 2ABAA 3L7RA 3GYCA 4IFRA 3M5YA 1MRQA 3KCJA 1KLZA 3D46A 3UZJA 4PCFA 2ZVRA 3VGHA 3UF9A 4Z1CA 2VCBA 1HW6A 1F6PA 1SMAA 2G4JA 1FWFC 2XIBA 1TV8A 2Y5EA 1I0BA 3L66A 3HG5A 3FXYA 2HROA 3BAWA 1OFRA 1UUMA 1QBBA 4M81A 4HU8A 4XAYA 2VM8A 3NZRA 2CBIA 3CUXA 4IFOA 3SFWA 3E2VA 4LVDA 5KEZA 3RGTA 4U4MA 3EKZA 5C70A 3FYOA 3MZ2A 3B8DA 3QKEA 1ZUAX 3GRIA 4O17A 3KP0A 1XFCA 5CGQA 2QJIA 3V1PA 5LNSA 3DKLA 2WV8A 2PURA 8TIMA 2PDLA 2AL2A 3QGVA 2W92A 5CLWA 3R6IA 3U6WA 1A5MC 2VEFA 3OLIA 3S8HA 4AF0B 2B4GA 2DZTA 3FW6A 2WKLA 5E6ZA 1T99A 4ADTA 1BD0A 2A6NA 4K68A 3HB9A 1N7KA 3XISA 3N19B 4AG0A 2OCZA 3N2XA 1FFQA 3STGA 3R13A 3KFTA 4ZCWA 3VINA 3BAJA 2NLIA 2QCHA 5AOUA 1GWJA 2ZX7A 3LHZA 4B5NA 3M0VA 1H0IA 3FS2A 3R2GA 2GDUA 1W17A 4YS1A 4GYFA 2QDDA 1OVDA 2I56A 3T0AA 4PTWA 1J5SA 1F4HA 3R25A 3QM3A 1KB3A 3G0XA 3PPCA 4WY0F 3URQA 3DAQA 4JFSA 3N29A 4HNLA 1PBGA 1PWMA 4F48A 4C91A 4QLKA 1KM0A 1LBLA 2P10A 1HKWA 1ZP3A 3WJWA 1EWDA 2CLKA 1YTDA 4GI8A 1QT1A 5A8PA 1GZJA 6PTDA 4Q6XA 3PUDA 2E7FA 3T42A 1WDDA 1E56A 3VCCA 1O5XA 1QUMA 1GW1A 3AIBA 1EH9A 4O52A 1B3OA 3CH9A 4UTIA 3R89A 1J18A 2BFGA 3HOJA 3T2QA 4O28A 1VKFA 2RDXA 2H6RA 4XZ9A 2XM2A 1FXQA 4JTHA 4M80A 3VGBA 4KERA 5DN1A 3VGEA 2VR2A 1VFFA 4DLFA 3K2GA 1HUVA 2G4FA 1ODUA 1D8WA 3LDVA 1UROA 2VNCA 3EWUA 4A3UA 1E0XA 2BHUA 4XD6A 3S3GA 3IJQA 1YKWA 1H60A 3L21A 5C2CA 1UC4A 2QS8A 2BGNE 4GLEA 4C6BA 3L4WA 1E1FA 1ISYA 5IFTA 3OG2A 3ARWA 1GK8A 4BQ3A 1O5QA 3GQYA 1ZSXA 3TC7A 3TC3A 4FNQA 4CVWA 1XICA 3ITLA 4PUKA 4E6MA 3H23A 4GPNA 3DENA 1ZBKA 2V5DA 1PX8A 4XIAA 3L2MA 4CQCA 3KOWA 1XIMA 3S1WA 1R3SA 3C2RA 1GW9A 3G2GA 1UH4A 3QPZA 2E67A 3FA3A 3CWHA 1BQCA 3GW3A 3HA1A 3A5FA 3LUTA 4N9CA 1J0KA 1XINA 5CLTA 1FDJA 1DIDA 2CLIA 4HPNA 3RDKA 3E02A 4D8LA 4GNJA 4S2CA 1TIMA 1GJUA 1ZZMA 3WJYA 3WDRA 2ACQA 1PPIA 2VJXA 3T0TA 1K6AA 1KWKA 1KFCA 3EDFA 4XKYB 4OKDA 2WO5A 4IT1A 4AIBA 3WQOA 4LEFA 3W74A 3B0PA 5AZ0A 3AAMA 1FWIC 2OOFA 1LOLA 1HTIA 1C29A 4BY3A 2VI0A 2VRJA 1EEXA 1ZBCA 1DL3A 1QNPA 2ALRA 4S3CA 2XN1A 1ME7A 2CCRA 3UXDA 4IQJA 3BARA 1GOKA 2Y7DA 1XSKA 4JTQA 1NWSA 3H8AA 1FWRA 1JZ4A 4CEXC 4AMAA 5CAHA 4GBDA 4WXYA 1RVGA 4HK5A 2OSXA 1GOOA 3VOCA 5EFDA 2X0SA 4GGBA 2G41A 2A6LA 1FWNA 3C0JA 1HKJA 3B9EA 4M82A 4Y2WA 2VGBA 4RXFA 2Q3OA 1JPHA 3BO9A 1W9VA 3M5VA 3G77A 4LYPA 4GYJA 4A8NA 4PMQA 1SO3A 4JTUA 2BODX 1IWAA 3FA5A 2DZUA 3ISIX 4JS3A 3AISA 3BANA 2BVDA 6A3HA 1SW0A 4INFA 4XTIA 4QJ1A 3VGGA 3SJ3A 2E6AA 2TYSA 1TVNA 3EPMA 4HA4A 4KEVA 4FIRA 1V3MA 4DHGA 1E4MM 3R5EA 4BQ2A 3WELA 4DZAA 3MUCA 2GQ9A 4IZGA 3P60A 3GR4A 1WKFA 1EHNA 2VX4A 2YIHA 1T96A 3C61A 1US2A 4CQ9A 4OECA 3IJ7A 4JTTA 4LNCA 4P2VA 4LUSB 4RDYA 5A2AA 4WRHA 1BEUA 1E55A 3WBYA 3W1XA 3RG6A 1TUFA 4FP1A 1NY1A 4LS1A 4YHGA 3CYVA 4F2BA 2EO7A 4RDWA 4GZJA 4L1XA 1JCTA 1PUDA 1GPFA 1KKRA 1MXGA 3NZ1A 1A0DA 4HZ6A 1B9ZA 1K9TA 1VIWA 3QKZA 2NT1A 3AMCA 1BFNA 1IE7C 3B9OA 4AISA 3VOJA 2OELA 4UQAA 3VUPA 1XLGA 3WFLA 4UXDA 5DXYA 3SURA 1OCJA 1UH3A 2WC4A 2O9OA 3W7MA 3BLFA 1OF8A 4NZCA 3TIMA 3GDKA 3PPGA 3BCFA 4N9EA 4KWOA 4H9YA 4RZ4A 1SUXA 3NIYA 4OJYA 3MSDA 2Z7GA 1ELSA 1KFKA 4LV4A 5I7GA 1E4IA 1PDZA 1TVPA 1ZJHA 3U48A 1IZCA 2FHBA 3WQEA 3TTQA 1CDGA 1KFEA 1AL8A 3E2SA 1JDAA 4LCSA 5ABFB 1EDTA 1A50A 3N12A 3QV7A 3HO8A 3SGUA 5C9UA 3TYDA 3B8WA 1P4CA 5HMEA 2WK2A 4GUJA 4DBDA 2W0UA 3DHDA 2FFIA 2QF7A 1QOXA 1JGIA 5FCZA 1Z9AA 2DT0A 5LNRA 3C56A 5CG7A 4BFAA 1NF7A 3PZQA 4DRSA 2QUMA 3R58A 4DJFD 3WLOA 2XFFA 3OO2A 1I45A 3ZR5A 5BU9A 5AB3A 3R0KA 3HPAA 3A6OA 3WEZA 4DI8A 1KXQA 2F6KA 1E9ZB 1HFBA 5LZLA 2VUYA 2HVOA 2QT3A 2CHNA 4AVNA 8XIAA 3GUGA 3EEGA 4FOUA 1A5UA 4N9DA 2E25A 1W9DM 4L64A 1KRAC 3WBWA 4O4WA 3CB8A 3BG9A 1QWKA 4U2ZA 3IVUA 2VGGA 4ADSA 3W3OA 2V8ZA 4IP7A 1TPWA 1NELA 1DJWA 2Y61A 5DT5A 4PTNA 2X16A 3SZ8A 3ITYA 4ZA0A 3LCGA 5H2ZA 2XSAA 4EAYA 5CPOA 3NZQA 1E1CA 1PVNA 4GZEA 3HQ1A 4IMDA 2JGQA 3W23A 3J7HA 4OZOA 2FMOA 5G4EA 3T4WA 1Q2RA 1TO3A 4QAIA 4K3ZA 3VE7A 5T26A 3EA1A 2VZVA 1G7VA 4Q4KA 3EA2A 3VOIA 2P3ZA 1RQHA 1DJHA 3I6TA 4NYYA 3QV9A 1Q6LA 1S5TA 4G8TA 1TJ2A 4LU0A 2J7DA 1U1HA 4XZHA 2DU2A 2NVAA 2ZZ5A 2E8YA 4KWUA 3W7PA 4X63A 1NJJA 3WK2A 3VD3A 2J47A 4Q8MA 3VFLA 3W70A 1PX3A 3WJXA 1X1OA 3LHWA 3MJMA 2QCMA 1FWTA 3N2TA 3SCVA 4LXFA 4OV9A 4GIYA 2QYGA 3H12A 1WDSA 3GVQA 1EFZA 2DORA 2W79A 1W9BM 3DC0A 1VEMA 3V35A 3VTRA 1W0MA 2YOCA 2D69A 2Y85A 3WLRA 2Y63A 4G7EB 4UMCA 1AQHA 3GKFA 4RE3A 1B4KA 3JRKA 1XLMA 2NX9A 1XLKA 2V67A 1VPYA 5AYXA 2F84A 4XAPA 1TVLA 1UHVA 5D33A 1KGWA 2HS6A 3VM7A 2OT0A 2ZA3A 4MWAA 2DQXA 1CECA 3REQA 3JVAA 3UYCA 3R94A 2PODA 2REQB 3OGVA 2OO6A 4WSHA 2D0FA 5H91A 1QPQA 3STPA 1OYBA 3GM8A 4UOZA 7XIMA 1L0PA 1TMLA 3EB3A 1A3WA 5TF0A 3S2LA 1US0A 1VLIA 2WHJA 1LRTA 3FHQA 4IWWA 1H51A 3IRDA 2F8QA 1LTDA 3LGDA 1GTHA 2E68A 3PZUA 1YADA 4D72A 1UD3A 1U83A 3LSCA 4FF5A 5EMUA 4RV8A 1OGBA 1YPFA 2Q8ZA 4W85A 3CIVA 3W1QA 5FF2A 5D05A 5DF0A 4LWWA 2Z1BA 3ZJ6A 3AMKA 2G37A 1RR2A 4LAMA 4FOKA 3AWNA 5HUPA 3L68A 4NJKA 2PGRA 4B16A 3CXOA 3S42A 3GUWA 1BGGA 1HZYA 1JR1A 1XW8A 3BLDA 1RHCA 5DQPA 5CSSA 3WQ6A 3L0GA 4V2XA 3HGOA 3VDCA 2HV5A 3BZGA 1PYFA 2V82A 1F2JA 4IGMA 3OIHA 3OHMB 2FGLA 1ZP4A 3WLNA 2KZHA 3W2JA 4GG9A 1UKPA 2XJ7A 4KGLA 4DAFA 2C1GA 5AVHA 5BWAA 1KLYA 3MCNA 5BRQA 4HTBA 5AYZA 4UWMA 1EC9A 1B3YA 2JEQA 4FNPA 1UBPC 3OIXA 1MFVA 5E5CA 1W37A 1X38A 1MW1A 2FJKA 3ITCA 4F40A 4FS9A 4Y8EA 3P62A 2WWCA 3NL6A 4UQ9A 3H2OA 2E9BA 1CPUA 4CCEA 3EXSA 3WDIA 3POCA 2R6OA 4NI8A 3ABOA 4AWEA 3ZT7A 1RBOB 3N11A 3AXXA 1HX0A 1G1YA 1GKQA 3WUGA 4GWEA 3M0YA 3GHSA 3NQ8A 3WH6A 3BSHA 4KWSA 1RBAA 3CQIA 3G1DA 1HNYA 1VJZA 1S2TA 2JALA 3N6JA 1SO5A 4AFYA 2PBOA 3QQ0A 2AGKA 2W61A 3ANUA 4OV4A 4DBSA 3QLDA 3CV1A 2GLKA 4MB3A 2J7FA 2G0WA 3CO8A 4I9TA 5MKGB 1TYGA 1EDGA 2WVSA 4O1FA 1IXQA 4LY4A 3CQKA 2EBNA 2V2DA 4LH8A 4JBRA 4L65A 4WDUA 4JFUA 4GHRA 1WDQA 1UZ4A 1EO5A 1PJ9A 4XG1A 4GBUA 4GIAA 4DO5A 1D2KA 1W3IA 1WO2A 4NZ1A 5BMWA 3BDKA 4H9MA 1G4SA 3ARXA 2C13A 4JD4A 1Q5MA 1UR2A 4XX6A 4J3ZA 9RUBA 4LBSA 4V1YA 1SPQA 4GQQA 4S3AA 3MSGA 1DE5A 1KRBC 1E43A 1XUUA 3T0CA 3TK7A 3LSBA 2EPLX 1WKEA 2PC4A 1MDLA 3T09A 1HVXA 3E0IA 3B06A 5LA1A 4E2BA 1FWDC 1JYWA 1JJKA 1EIXA 2BP1A 2CLLA 4OBRA 3SY5A 4X22A 3RYSA 1IYXA 5JH1A 2NV2A 4WK9A 3CYJA 1KRCC 3VOFA 1O60A 4XTDA 2XZ9A 3E38A 3ATZA 2ZTKA 2AQWA 2Z7KA 4QNWA 3PS7A 2F6XA 2GQ8A 4AF0A 4X60A 3MKCA 1O6IA 5JIWA 3MDWA 3B8SA 4OWGA 2BNJA 4DJEA 4ZEPA 2EPMX 1Q7ZA 5I3HA 2CLEA 3ONCA 4D1IA 1KBKA 2YB1A 1H7WA 1KTNA 2X1TA 3EX4A 5LGZA 2Z25A 4M0XA 1NOFA 4W8AA 3PZNA 1CI1A 4EKJA 1H7RA 3LM3A 5JBEA 2Q01A 4ERIA 4WD0A 1V0LA 1A0CA 4AIOA 1VGAA 1RQEA 1I1WA 2OODA 1ISWA 2D20A 4RW5A 1FDZA 1AH4A 4D6CA 1XKYA 4N4PA 4NUWA 5HK4A 3RMEA 1FHVA 1KCZA 2RDUA 3OZMA 1LRNA 2O4MA 1QI4A 2AQVA 1AW2A 4HOXA 3LLXA 3TJ4A 3LI0A 5D8ZA 4ZQOA 4MLRA 1ZAIA 3STFA 4M56A 1PE1A 2ACUA 2V2CA 4LYKA 4L4OA 3R7MA 5GNYA 3NR0A 1UR4A 1ISZA 2YFOA 4B5UA 4GX8A 2ATSA 2BASA 2CPUA 3RPDA 3N13A 1ADDA 1XHGA 1SJBA 4N9BA 1QHZA 2NVCA 1ITUA 3RM8A 5A94A 4MY9A 4NRSA 2QULA 1UR8A 3O15A 4F9DA 3UWUA 1JI1A 1VD6A 4M24A 4IICA 1FA2A 1TPFA 2OWXA 1ECEA 3MBFA 3PY2A 1Y8BA 4XISA 1VFHA 2C1HA 1XC4A 4MB4A 1V02E 1DWFM 3KZPA 3N2CA 2Q8XA 4BQ4A 3PUGA 1QWGA 1SJAA 3GE7A 1F9CA 3CUJA 3TOYA 2UV8G 2AMXA 1CYGA 5IFPA 3NQDA 3N9RA 3P5ZA 1S5VA 2HJPA 3GC4A 2C18A 2POZA 2HWGA 4AZ5A 3URNA 3UGVA 5XIAA 4R7JA 3GTHA 3YPIA 4DO7A 1RA5A 4N4QA 2GQ3A 2PAJA 2AKZA 1XH2A 4JHMA 1J0YA 4M29A 3WQWA 3NWRA 4C5YA 3WL0A 2DH2A 4O1BA 1EZWA 1X6NA 1W8GA 4PEKA 4KRZA 1WX0A 2YKKA 3CS2A 3N3TA 2VUNA 3WD1A 2BDQA 4NT0A 3UESA 1K7EA 4WEVX 4DLMA 3GNDA 5KZ6A 3QW4B 2BOFX 2DSZA 4YIWA 5C9ZA 2PGEA 3PTKA 2J9XA 1F05A 1EIBA 1NTHA 4FNSA 4Q4RA 1JRCA 3QOKA 2BVWA 1P5BA 5BOFA 1XPYA 2VC5A 3TOPA 3ZFHA 3GR8A 1PZ1A 1QASA 4EF9A 1UD4A 3TMQA 1EOMA 1V6XA 1F4AA 4PMNA 2VC7A 4J3SA 1G69A 4HP5A 2E0PA 3A64A 4Z17A 4DJFA 4PUWA 3EWZA 1JCMP 3BH4A 4L9ZA 1EC7A 3DESA 3QEZA 2GFTA 4GNVA 4E4UA 4DX3A 5K4XA 2R82A 2W4XA 4HQVA 3W7QA 1QO2A 3M6DA 1ZQ5A 1ODZA 3QF0A 1JNDA 2JFEX 3NQEA 2J13A 3TR2A 3QMSA 3VIFA 1TV5A 1IEXA 2AAMA 2HPIA 2L5HA 4GCAA 1P7TB 3UXKA 4DUXA 4ERAA 3BURA 1KBBA 4WQ6A 1E4LA 4CU7A 1P6BA 2PB1A 4NKCA 1A3HA 1Q13A 3PBWA 1B31A 4LAUA 1BTMA 1EJ7L 1L9WA 3RNDA 5FF0A 3FNDA 3DN5A 1FKXA 1WBJA 4H9ZA 2OQHA 4O8AA 2ICSA 4F0SA 5DRCA 1XQKA 3K5XA 4AWSA 2WMIA 3CASA 3TNBA 4XUGA 1I4NA 3CL8A 2PCQA 1UKQA 1EOKA 2ZADA 2Z00A 4QE5A 5HATA 3W07A 1Z32X 4AX7A 2NQ9A 1EBGA 2VOMA 3HV8A 3A47A 4LBRA 1H4PA 1FY6A 3D0CA 7CGTA 3EWWA 2JBMA 4LUSA 4S1FA 5BXTA 1H1YA 1HP5A 2X41A 1NDYA 5FKYA 5EGRA 1IEIA 6XIMA 3CPGA 4EIVA 4HPJA 1N82A 2HDJA 2ZRYA 1L2UA 4MMWA 2YW3A 3VIGA 2ZZ2A 2NXGA 1UB3A 3SRKA 2VO5A 4Y96A 3DU0A 1A5BA 3P74A 3ARVA 2X2YA 4YTRA 3VI2A 3G1VA 5DCDA 1QU4A 3PULA 1KXHA 2C7FA 5I3FA 2O7SA 1AMYA 3FEQA 2WCGA 4F2TA 3SN4A 2ANUA 3CZEA 4PA8A 2PUZA 3LMYA 3T81A 6REQB 5B7YA 3BLKA 3R43A 1CWYA 3L0KA 4C60A 4XD4A 4R9OA 2CKRA 5HMSA 3V1HA 3WQ8A 3MSRA 3WENA 2OGYA 2H9AB 1KFLA 2Y70A 2YPIA 3ANYA 1IEWA 2YA2A 2NUYA 3VIKA 4C6PA 2H90A 1V4YA 3ECQA 2VRQA 4MJMA 4GYPA 2VFIA 4H7CA 4Z1BA 1W1IE 3TLLA 3XINA 1RJPA 4E3TA 4AD0A 4UQBA 4L9XA 5HA7A 2J6VA 1GG0A 4LNYA 4MPQA 4QJ4B 1C8YA 4UTTC 3VKBA 2WXDM 5FA5A 1PXGA 3ZT5A 1CXFA 5CC3A 3LRLA 2YFNA 4QISA 3BLIA 3ITVA 3N73A 4CD8A 1GQKA 5TBOA 1Z42A 3E96A 3IS4A 5HWJA 4ZODA 5F4XA 3U2EA 3UT0A 2IPJA 5AYBA 1NWRA 2NQLA 4JTSA 1FFRA 1R47A 2O56A 3F4DA 3W1NA 1QOPA 4UZUA 3LENA 3FKRA 2ISSA 3UXIA 3PJWA 5FJOA 3DH7A 2OLAA 3VX1A 1KC7A 4GYPC 4GVIA 1GVIA 4A3YA 3O2LA 1FDYA 1DQUA 1H61A 1S46A 1R3WA 3O06A 4KW2A 1LBMA 5FL1A 1RCQA 4QS6A 3AXIA 3N18A 3KBVA 1YNYA 1DP0A 3VIHA 3ZJ7A 1DVJA 5H6HA 1ZRQA 4PUUA 4JNMA 3W01A 1V6YA 2R9RA 4HJFA 4W7UA 3HQNA 3OB8A 2IQ0A 3HMJG 3B0YA 3E74A 4NZ5A 1S2UA 1EQPA 2QUNA 4RXGA 3HGSA 3S6TA 5HQMA 2WBKA 4ZE4A 4CNPA 5FEZA 1XIJA 1EZ2A 3OZYA 3VC6A 1FH7A 1XS2A 2HS8A 4PFMA 2D2HA 2FQIA 4FXSA 4GNKB 3RU8X 2VWSA 2OYMA 2XFWA 4F4RA 3FV9A 5AHMA 4LALA 1NDZA 3ERPA 4TO8A 3UPMA 4D6HA 2G97A 3PUEA 3WBEA 4G6CA 2X7WA 1IEVA 1KM1A 1NVMA 4HNNA 2D22A 3STCA 1QI3A 2EPHA 3MMUA 3TYAA 4F66A 1R8LA 3HG4A 1G94A 2KX9A 3UJRA 3TQPA 1QPNA 4IH3A 2OPJA 3K46A 2WQPA 2QJMA 1BWVA 2E5DA 4QIUA 1S2VA 2ZOXA 2YXGA 4JN7A 4Q3MA 3THUA 2FFCA 3LXBA 1H0GA 2V5KA 1HN1A 4O19A 2REQA 2QIIA 3NM3A 1TFVA 4FXRA 4UTFA 4UTTA 3OVQA 1FXPA 3L23A 3AWOA 3JUGA 2EEXA 1VYPX 4J1OA 2OGJA 2W6RA 2Y0FA 1TB3A 2DQWA 3GDRA 3WUEA 1HL8A 4O16A 2DEPA 3MPGA 1Q8AA 1M53A 3UG3A 5BXPA 3M16A 3A4AA 3R8GA 1F6YA 1AZ2A 1ICSA 3IIOA 1BVZA 3CZ8A 1MFUA 1VF8A 1XLCA 1J01A 3MCMA 2CXEA 3QW3A 2DVUA 2V3FA 5HWMA 1V77A 2GJNA 3K13A 1LG2A 4H83A 4H01A 3HMCA 4US5D 3S9IA 3BOFA 2FB3A 5C6MA 9XIAA 4Q8TA 1GQJA 3T78A 1P43A 5CPSA 4PCNA 4Q8NA 4CCCA 3GU2A 1VP5A 3AROA 4L6OA 5AN7A 4JZ5A 5CGMA 2OZ8A 2YBUA 3HGRA 4FA3A 4O0KA 2VD8A 3R79A 1P6CA 4I9JA 1BKSA 5D03A 1Q6EA 1E3XA 5TAOA 4EWND 4HN4A 4XBJA 3WH5A 1M04A 3G18A 8CGTA 2I7GA 3RHGA 1DQWA 2YCKX 4DYKA 4YNGA 3L67A 2PLCA 3O9NA 3UG4A 2YCIX 4WF7A 4FX7A 4YCPA 3A4JA 1OC5A 3WLMA 3S6DA 1IT8A 1KM5A 1JDDA 4OFCA 3F4VA 4TUFA 3VKAA 2PE4A 2DFAA 1TWWA 2JQXA 4G7FA 5FF3A 1MQPA 5ECVA 2XH0A 2Z6JA 5B80A 3LZ5A 2VX7A 2I9EA 4A3HA 4AX6A 1J0JA 4WCJA 4M7SA 3MMTA 4AC7C 3K30A 1R2SA 2P8BA 4GH1A 5EA9A 4W7WA 2CBUA 3OLEA 1R86A 2RGLA 1PWLA 4NZFA 4GO8A 3SY1A 4CEUC 4P7RA 2R91A 1ONWA 4NJGA 1I6NA 2DUXA 4S3BA 3GXDA 2VP8A 4HSOA 4GABA 4D8AA 3P82A 3NO5A 1C9WA 5MKGA 3CH0A 3E0FA 3N1AA 3G3DA 1DJQA 1WYIA 1OX5A 3E5BA 3CAKA 4O1AA 1NFBA 1HKIA 4D6GA 2XHYA 1OIMA 3THAA 3OLDA 3G3MA 4AW7A 1E3ZA 1KW1A 1QNQA 3TYUA 4JQ2A 3T0BA 3GFXA 1Y7VA 4JKKA 3W7IA 4L4LA 4Z2KA 1DJXA 1WKYA 1DTNA 1A53A 4ZTXA 2DZSA 1LQAA 4Z2HA 4C1LA 3WNKA 2FDMA 2WNNA 1E0UA 3FKKA 1L2QA 3G1AA 4C6OA 4HU0A 2WJFA 1K8YA 1KWGA 3W2KA 5BRPA 4LBUA 1A49A 3WLKX 3RK8A 1TZ7A 4M1BA 3AZSA 1XGDA 1FWCC 1G01A 3D5HA 3W4RA 1UCWA 4I5UA 5CJ5A 3W85A 1F8MA 1UWQA 1JF6A 4ATDA 5D38A 1S5MA 2PRLA 2PGFA 4PULA 4HPGA 3G6LA 4X9YA 4CN1A 2YL9A 2ZE0A 1OC7A 1K3UA 3AI0A 3KOYA 4ZBCA 3L5LA 1WPCA 1EX5A 3FVDA 2PP3A 3CJPA 2ZX8A 3BAKA 1N8FA 4D1JA 3WMBA 4BHYA 1Q4NX 1EJTC 2QCDB 4J7RA 4W88A 1JD7A 3PTQA 2CIPA 3TNOA 4E2OA 4A35A 2PWGA 4L9YA 3R4IA 3UGRA 4WZHA 2VC9A 4ZGYA 1SFLA 2ZUUA 4JQAA 3ARSA 2DIEA 1W1VA 4ZTYA 3GNPA 1W3KA 5CAKA 3RRXA 4RZ5A 1H3GA 1T0OA 3G0UA 3JU2A 1C8XA 3ALFA 3GS6A 1M65A 4UC5A 1UG6A 4F2UA 1MDRA 4H9VA 4HYWA 1LQ2A 3TAOA 2X0YA 1IT7A 2H3BA 2J7EA 5AC5A 3T6CA 4JQ3A 2DIJA 4K1WA 4JY9A 1R30A 3BW3A 1KFJA 3QGAC 1C92A 4GH3A 1DWHM 4AIUA 4ICCX 1F3EA 4GKTA 4OUIA 4QCFA 4DXKA 3GIYA 1AD1A 4PBFA 3V16A 1LZOA 2PDQA 3ATYA 1XCWA 2CKSA 3CO4A 2PF0A 1C91A 1ZU8A 2J8FA 4BI6A 4P7LA 1UZ1A 1RD6A 5CKSA 1E9YB 1V3KA 4H6RA 4DBEA 4RW3A 1LORA 1LQ0A 4IGSA 3HFYA 4O8RA 3GG7A 1UBSA 5E9AA 1CLXA 4QDPA 4EF8A 3TYEA 2V3EA 1DXEA 4GFSA 1M9HA 3FVMA 4UR8A 1TQXA 3WK1A 3EOUA 2QCEA 3MO7A 1LOQA 4ZOAA 1XCXA 5G5IA 4HVXA 4JFVA 4ES4A 5DO8A 4H41A 2V68A 1QO5A 3TH6A 4DO4A 1N2VA 5ENLA 4O0ZA 2A3BA 4JPGA 4QRNA 2GGJA 5HXMA 3UVIA 1Q6OA 1JPMA 5CPQA 3W2MA 3APYA 1OYCA 4WHBA 3DG3A 1FTXA 2WZIA 2ZZ1A 3F2CA 1ZS2A 3KOXA 5GQBA 2E9LA 2C0HA 4RV3A 3PZ9A 1I8JA 4RCXA 2CYGA 3CAQA 2YBVA 4NAFB 3P5YA 2PWVA 2UY5A 3WLLA 1KV8A 1B9BA 3NQMA 3GNRA 3QHNA 2RJHA 5F2MA 1PCKA 3A9BA 3W81A 5FAGA 4HZMA 1V02A 4B90A 3FAXA 5A1AA 3RUBL 3UW6A 1KCLA 5BROA 5C7HA 4FR1A 4OIFA 2BSLA 4ZO7A 5KINA 5M03A 2XIIA 1P0NA 3WO8A 1FWWA 2VDIA 1C90A 4XIMA 1ZB5A 2OU4A 4GK8A 2WMJA 4GXWA 4I7WA 3UR7A 1CLVA 3IJ6A 3PWGA 4KPLA 7REQB 4IG2B 2VFGA 2XVKA 4YPJA 3SSZA 2PTDA 1TREA 2PLMA 4AD4A 4G9PA 3PM6A 3RX4A 2XIMA 5C5YA 6TIMA 3CV7A 5FIPA 4L1WA 3Q94A 4KCTA 3W75A 3TTEA 3IGXA 4LAKA 3VMNA 1P7TA 3FOKA 3W1RA 5K4ZA 2A3AA 3AS2A 2PF8A 2QCLA 4URIA 3LGGA 3FJ4A 4JGDA 4IIFA 3C2YA 3LBMA 2UZ9A 3EBVA 1JZ7A 4JL2A 4RLIA 1IQ8A 2JKEA 1GKPA 2Z1VA 1OFEA 4FLRA 2GSEA 3AZTA 3EWBX 3WNMA 4Z1AA 4F79A 2WMIB 3TFCA 1I1XA 3UWQA 4QEEA 1C8VA 3NOEA 1TV7A 2J78A 2ZUNA 4IL0A 1EB3A 3WDJA 3S5YA 3QMTA 2V30A 2OYKA 2DGAA 2G8ZA 4CD7A 7ENLA 4HNCA 4CQDA 5I07A 1Q7MA 3ITOA 3L2LA 3KRBA 1Y65A 2F2HA 3FK4A 2QJGA 1DIKA 3FHAA 3H53A 3GU9A 1W9XA 4MZ8A 2C16A 2BOEX 2BBFA 4DPPA 1E5JA 1KTBA 3HM7A 1XV8A 4L80A 1BVNP 6CGTA 2PCEA 1W3NA 3GWQA 2J9YA 3ABZA 1VIZA 3DERA 2G3IA 1R7OA 1R87A 3FSUA 2PDXA 1J5TA 1VEPA 3IUIA 1DHKA 6REQA 4MAZA 5TD4A 2GSJA 3LG3A 2BGQA 1XLIA 2H9AA 4LVAA 4DQWA 4MNJA 4AEOA 3V0SA 3UEQA 4UTUA 3QSTA 4ZOBA 4IQEA 1V5XA 1A5LC 4TTGA 5I2UA 5CXPA 1TJ0A 2GJXB 4I6KA 1UJQA 1WDPA 4XQ6A 3M41A 3GIPA 5M17A 3OU8A 2E1DA 3PSVA 1SSDA 1XSJA 2ZKMX 4Q8PA 4E2VA 3P81A 4R88A 3HTWA 4JTJA 4FK9A 2CZEA 1AA1B 3LD5A 3L65A 3MV01 3EB2A 4BWLC 1J12A 4HU3A 1AD4A 2Z26A 3BVJA 3ALGA 3CK5A 1PAMA 3PNZA 3EYPA 2PLJA 4Q32A 2OZ3A 5FF4A 4CGTA 4IQLA 3WDHA 2IMRA 4PMRA 1JPIA 2HBVA 1KM3A 1XKJA 2VDHA 3TP4A 4JHOA 2YB4A 4GCXA 5D2YA 3V3WA 3AIVA 4GO9A 3DGBA 3M1ZA 5I3JA 4OOUA 4GINA 4FXFA 3EX2A 1TCDA 3AYVA 4JIHA 3ONBA 2Y7GA 2ZQ0A 1QOQA 4RNIA 5A8QA 3ZO9A 5FESA 5BYWA 1GG1A 1EJUC 1F07A 4GIEA 1PTAA 4QDWA 3AS0A 1K03A 3A24A 3IGHX 2IPGA 1R3TA 3N14A 4DF1A 2HPMA 4M8UA 4GA8A 4IISA 5D2VA 1JNEA 4GYKA 3KCOA 3FFSA 3TV8A 5LXEA 1IIHA 2QLYA 2VGIA 1EPVA 2EQDA 4LUJA 1B2YA 2MUCA 4CQAA 4KWVA 4CCDA 3WDPP 1UKTA 4ALDA 1VFLA 5JH2A 1KRMA 4RDVA 1PKMA 5I3KA 5GPRA 1M7OA 4JFTA 2CBJA 3QR1A 4QR6A 3AMGA 2IPFA 1KCXA 2VFFA 3ANVA 5FL0A 2ISWA 1XF0A 2A2IA 1BSIA 4ZQRA 2VT0A 3CEUA 4Z42C 3QQ1A 3C2OA 1O1HA 1TPVA 5JBFA 2ZZ6A 3K4WA 1OFPA 3OYXA 2A4AA 4A21A 3BCDA 3T7VA 5HOSA 2YA1A 4PCSA 2GJRA 3BG3A 3SCUA 3LBOA 4N2YA 3PWIA 2Z24A 1XP3A 3CT7A 1JXJA 3RR1A 2PD9A 5LHFA 1GQIA 4X2PA 3W2UA 3NEVA 1RCXB 4GQGA 3ZYZA 5BU6A 4BR1A 3KW3A 3S2CA 2Z2UA 1VEOA 3W2LA 3PZIA 2ZRWA 1K8ZA 3IIXA 3GU1A 2AGTA 4HSHA 2OB3A 1YPXA 1GZ1A 1IZKA 1X7FA 1R5YA 5J5RA 1PKLA 4YVPA 3SCWA 2GVYA 4PZVA 3SCSA 3KXQA 3E6EA 5A6LA 2FVKA 5FSDC 1H7XA 1CXEA 5DANA 2A3HA 1XBVA 4CN6A 3WF2A 1K4GA 1QW9A 2WWDA 4BS0A 3NZGA 4K1GA 5KTLA 2ZXDA 1JUKA 4RUBA 3WFAA 2G50A 5IOBA 3STEA 3PP7A 4PE8A 2TRSA 3PZOA 3W7EA 1XI3A 2QW5A 3IV8A 1X98A 4JIQA 2A3LA 3ARRA 3KLKA 5A8OA 1NAL1 3MA8A 5FJIA 3R0DA 1GKRA 3GLCA 3PANA 4UNIA 2Y7FA 2WCAA 4YVXA 2VEPA 1I75A 2ABBA 4R7OA 3RMJA 2GJLA 5HJYA 2E09A 1BYAA 1NDVA 4DUWA 2X09A 3H7RA 1GQNA 2A1YA 4K8GA 4IPLA 3VNYA 1OF6A 1OEPA 1K6WA 1EYWA 4JHZA 3N4AA 4FIQA 3ZOAA 1QPRA 3KBSA 4A3RA 2XSBA 2DVXA 2GZXA 1Z41A 1UPMB 4X2RA 4ZO8A 4PTMA 4OU1A 1S3HA 4WLCA 3EA3A 3KTCA 3UG5A 2ISFA 3NGFA 1DWAM 3UZYA 3A12A 5LA0A 2CW6A 4O0QA 2OJPA 1XXXA 1SZRA 1ESWA 1TWZA 4C65A 3LA4A 1SYTA 2UY4A 4K39A 2WNQA 4NL1A 4DWSB 3DHUA 2QUTA 2D3NA 2J74A 5LSMA 4E38A 4PMJA 1G7UA 4TX6A 1K9FA 2WVVA 3QBUA 2PDIA 3SCPA 4PRRA 4HIBA 1LUCA 1A5KC 2HSAA 1XRSA 2FVMA 2XN2A 4B9YA 4WJEA 4R33A 3W24A 3GDBA 1ZAHA 5EMMA 3GXNA 3BGJA 4HMCA 2IPWA 3W72A 2DZWA 2V5LA 5DRIA 5FSEC 3Q65A 4O53A 2VEGA 4Y9NA 4S39A 3LCHA 5ABGA 3C8FA 1BXCA 3AUOA 3S5NA 2YBTA 1UPPA 2CHRA 1OGGA 1R3QA 2D73A 2P5NA 4NAEA 3ZMRA 4Y9PA 4AHOA 2G3JA 3CHVA 2OEJA 1OM0A 2ZUSA 4REQA 4EPDC 2DUZA 3TSBA 1RXOB 5C2GA 3UWWA 1A5OC 3I10A 4CNSA 2BHZA 2D2OA 3WD4A 1GVFA 3MW7A 1JYXA 2PU0A 2EF9A 3EAUA 3VNMA 5LKYA 4D6EA 1ICPA 2IQTA 5AY7A 4WGHA 1TA3B 4OQVA 4FLOA 3ARYA 4FNUA 5AC7A 5GVJA 1EP1A 2O9PA 3EKLA 1DEDA 4DJED 1PKNA 1MXSA 3QV8A 4Q4SA 1FWBC 3V5FA 1WDRA 4WGXA 1VFMA 5D09A 4GQBA 2WBGA 2PZ0A 2QXWA 5C9WA 1KFBA 1JULA 4RKAA 1QNSA 1IWBA 3NSXA 2MANA 4NX0A 4UFIA 1QW7A 3QFWA 1L8PA 3EOLA 1UKOA 4P7OA 4IOTA 4K37A 3AIWA 1L6WA 1EGMA 2XTKA 4DM2A 4N7QA 4XO7A 5AKQA 4Q4MA 3OZOA 5CPMA 2X42A 3VU2A 3UETA 4GJIA 4C1NA 4ZB2A 2QCDA 1V51A 3VIOA 2PI6A 3W6YA 5T9CE 1K70A 2A3CA 1HJWA 1TX2A 2DSVA 1V6UA 3B4UA 1CEOA 3B8UA 3H6OA 3B3DA 3ZT6A 3C52A 1M7PA 1LM1A 1IHIA 3EOOA 3UNDA 2YR1A 1VRXA 2NQ5A 3OQ8A 3EOEA 5K2ZA 3KVMA 3NDOA 4FZIA 3O63A 2EPKX 5JXQA 2INFA 4LUTB 3TTOA 1QBAA 1JQVA 3QC0A 2FTYA 4DNMA 2WMKA 1T6MA 2I14A 2Y89A 1AK5A 3ITGA 4MZYA 3AZRA 3CMJA 4JQ1A 1AZ1A 2YCJA 3H4WA 2Y4SA 1X1NA 2E6YA 2HNEA 4LYQA 2VOTA 1OADA 1Z48A 4MOZA 4UQDA 4AEEA 1AQFA 3EMZA 1TTIA 1MWOA 9XIMA 1CXHA 3F03K 3SJNA 2FZMA 3MYOA 4Q4QA 3TZNA 1SJDA 2YYTA 3UXLA 1SMDA 4S38A 4YTSA 1ICQA 1PIGA 3TW6A 3NTYA 2EXOA 1CW2A 4QSHA 5HNUA 4Y8FA 2ZVIA 5E0FA 1ML1A 5G1TA 3HURA 2ZE3A 3VKCA 4XBKA 3R12A 1WBHA 1LJYA 4NNBA 4GFIA 3RU6A 1US3A 3T8QA 4AZCB 1PTGA 1Q65A 1G4EA 2OWCA 1GGOA 3U5UA 3IJ9A 3GFZA 1KQYA 3O3RA 4XVDA 3JR2A 3KLLA 4PUDA 3S5SA 1XYAA 2EG8A 4JDYA 5GNXA 1EP3A 3VK5A 3ZZ1A 1W8SA 4HCDA 3H7VA 1LL7A 2ZWZA 4HJWA 4N6EA 1AH3A 1FCVA 4NAFA 3FSTA 3HF3A 4H9UA 5I23A 1Q6RA 4YCOA 3L0NA 2AKMA 4K8EA 1YX1A 2V81A 5HPCA 3CAWA 3W7LA 3F2BA 5U7SA 2QVNA 4DI9A 4Y90A 4UFLA 3HG2A 4C5ZA 4C6JA 4NZ4A 4XZNX 1NWTA 1FP9A 1HQTA 1R2RA 1GHRA 1OFOA 1YDVA 3AYSA 3FAWA 1UD8A 3G1RA 4WDWA 2FB2A 3AIEA 4JQ4A 3CM4A 4NX5A 4RE4A 4DXVA 4P7NA 3L2IA 3MQTA 1LG1A 1XH1A 1TQJA 1LBFA 1X7IA 3NQCA 4ROPA 1DORA 3H2MA 4AY7A 3KDOA 2W67A 5DY2A 2PWUA 7REQA 1LF1A 4QLLA 1JCJA 4IG2A 3WLHA 2PWDA 5A6AA 2YDQA 2DZPA 3PAOA 5HQEA 3V4BA 4KCUA 3LTYA 3WMLA 2DW7A 1RJRA 3M5ZA 5FI8A 1VFUA 3UERA 1KFWA 4MNMA 4CNNA 3DI0A 3WIJA 1W32A 4YVVA 4R34A 1Y5XA 1SU5A 2PC8A 3EKGA 4YTTA 1U5JA 2QV5A 1O68A 3CIXA 1OFBA 2C6QA 1Y5VA 3WNLA 1UR1A 3QY7A 3FA4A 4GKLA 3RX3A 1W5MA 5BCAA 2WJDA 3E9AA 3N3MA 4KH2A 3BAYA 1W3LA 4FHAA 5HDRA 4BZYA 3M0ZA 1IXNA 3EMCA 3GC5A 1GOMA 1UOZA 4S2BA 3PBMA 1E6SM 3EWYA 3PBUA 1OINA 2WKJA 4WVXA 1E6RA 1WZAA 4LC6A 5EL1A 1TTJA 5H8MA 3E12A 5A5WA 5D9PA 1IR2A 2XH2A 1LLZA 3S5OA 3CBWA 5AC8A 3BICA 2DDXA 3A13A 1XBXA 4GVHA 1O4UA 1ADSA 2NLYA 4UQCA 2J7GA 2WPBA 3L9CA 1W1PA 1E70M 3U57A 2CESA 2VCAA 3ZWTA 2CLOA 5G2WA 1SW7A 1HJQA 4UMBA 3A4WA 1TPUA 1BYDA 1R9YA 3SM0A 3VIMA 4KEMA 4WSKA 5BWFA 3Q2DA 2GPTA 2PWFA 4F0HA 1VYRA 5D30A 1EA9C 3WH7A 4GJ1A 4AY8A 2ZA2A 3SCTA 1K1DA 1X8FA 2QJNA 5ABEA 3MKVA 3VOHA 2PWHA 3MMWA 3RIKA 5AC4A 3S6OA 3LHYA 4I6VA 4ZMGA 2J79A 3TN4A 1QFEA 2WKGA 1GEQA 2QCCA 3UXAA 3KRUA 4Z2GA 3G6MA 4YWSA 4QTGA 4QSFA 5JUVA 3U2CA 2B0MA 3CPUA