4PBQA

Crystal structure of a trap periplasmic solute binding protein from haemophilus influenzae rdaw (hicg_00826, target efi-510123) with bound l-gulonate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
b'KTIIKLGHYNSDIHPSHIALQEYFKKTIENETNHKYEIRLYPNNQLGGEDQIVNGLRNGTIEAGITGLLLQNVDPIFGVWEWPYLFKDNQEAKKVLESPIANKIGQKMEKYGIKLLAYGMNGFRVISSNKKLEKFDDFKGLRLRVPLNSLFVDWAKAMNINPQSMPLSEVFTALEQKVIDGQENPYMLIKDSGLYEVQKYIIQSNHIFSPGLLQISLKTWNKIPKEDQIIFEKAAKLYQEKEWELAIKTELEVKDYLAKHGNEIIVPSEAFKNDMVNASKVLYDSFYKKYDWAKDVVQKINEAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TRAP PERIPLASMIC SOLUTE BINDING PROTEIN
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Solute-binding protein
total genus 103
structure length 304
sequence length 304
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pbqA00
5CM6A 2ZZWA 4YZZA 3U65A 4MHFA 4O8MA 3GYYA 4PDHA 5IGAA 4OVQA 4MX6A 2XXKA 4DI3D 2WYPA 4P9KA 4X04A 4PF8A 4O7MA 4NF0A 2XWKA 4MEVA 4PFRA 4N15A 2CEXA 4NQ8A 4PBHA 3B50A 4XEQA 4PETA 3FXBA 4PF6A 4NGUA 2VPNA 4PGNA 4P56A 4PAIA 4NG7A 4P3LA 4P8BA 4OVPA 4OANA 2HZKA 4NN3A 4N8YA 2ZZXA 4PC9A 4MMPA 5LTCA 5IZZA 4P47A 4OVTA 4NHBA 4N91A 2ZZVA 4PCDA 2XWVA 4MAGA 5I5PA 4PAKA 4XFEA 2HZLA 4MIJA 4P1EA 4YICA 2XA5A 2XWIA 4MCOA 4MNPA 4MNCA 4MNIA 4PGPA 4PFBA 4PBQA 2PFYA 4UABA 2V4CA 2WX9A 4OA4A 4PDDA 4PFIA 2WYKA 2XWOA 4N6DA 4P1LA 4N8GA 4PE3A 4N4UA 2HPGA 4OVSA 4OVRA 4PAFA 4NAPA 4NX1A 2PFZA 4LN5A 4DI4B 4XF5A 4O94A 4X8RA 2CEYA 5IM2A 5I7IA 4N6KA 4N17A 2VPOA
chains in the Genus database with same CATH superfamily
3SZPA 1N84A 2L5VA 3O9PA 4PFTA 2WYPA 4NF8B 5ICQA 4O7MA 1A8EA 4UA8A 4GQOA 3FXRA 5IZ3B 1KWHA 4IGTA 5KCJA 2ZYNA 4JVDA 1WDNA 5CI5A 4ZZAA 3BKIB 3PD8A 4R74A 2F7BA 3VVDA 2KR0A 3S9MC 1M5EA 1LAGE 4RJZA 1B2HA 2Q74A 3QAXA 1LBYA 3FVNA 1CB6A 4OXVA 1YYZA 2V3TA 2KLFA 3KG2A 1YPNA 2O7UA 3KBRA 1R6ZA 1ATGA 2R6GE 2RINA 3VDFA 5H8NB 3ISPA 3VLVA 1NV1A 2QSXA 3IB0A 1UTBA 3BFTA 4XKNA 5AE4A 3VE1B 1N04A 4R73A 2OK2A 2Y7RA 3EPEA 2PFYA 4F3PA 1NV4A 5J1DA 5CBRA 3OSRA 4KCCA 2HPGA 1AIVA 3CSBA 2DQVA 2P0SA 3B7DA 2ZYOA 2Y7WA 2F7CA 3CFZA 5LDZA 2XXRA 1POTA 2OLBA 3CHGA 1D4NA 3U65A 1DOTA 4MHFA 2FHYA 4G61A 4R2BA 3VV5A 2BJIA 2ESNA 1T0KA 4IO6A 4N13A 1PBPA 3LSLA 3E3KA 1JNFA 1MQJA 1NI9A 3PUWE 4ESXA 3ODBA 4DCYA 3SEWA 3CG3A 3CSGA 4OERA 2AIXA 4G2ZA 2R8TA 4MLVA 4YB7A 2CZIA 4OEUA 4WXJA 4EQ9A 4ELRA 2DE4A 1EZOA 4G68C 2ZZXA 1US5A 5KDTA 4GLIA 1FTJA 1MH3A 1SQYA 1NUYA 2MKZA 3OO8A 1SI0A 3UK4A 3MJNA 1G0IA 4NHBA 4YKPA 4ECFA 3L6GA 2UYEA 3SETA 3TTNA 4AS4A 1M5BA 1VSOA 1Y9UA 4HE1A 1B5IA 2QRYA 4OENA 1NV0A 3SESA 4GX6A 4I40A 2DXRA 1FBFA 2YPNA 5FHNA 4JXIA 1LSTA 1JW5A 1XOCA 4GXSB 1NV7A 2PT1A 3LSFB 1I6AA 1B40A 2OX3A 3V5AA 2WX9A 1FQCA 1LAXA 1MPBA 4QF9A 4PFYA 4P1LA 4NF6B 1LLSA 3KBZA 3KEIA 3M3FA 4FE8A 3RLFE 2V3QA 3HN0A 1FQBA 1IXHA 3R7XA 3OD7A 5H8FA 3KOSA 1EYIA 3IAZA 4O94A 3OOAA 4RNSA 4F1YA 5EHMA 1FPBA 1ZLQA 1B5JA 2D21A 1A54A 1FBHA 3KJ7A 3LSXA 4H8IA 3D4CA 5I2KB 2O84X 1NUWA 3FXQA 1FPEA 1URDA 4YB6A 3TZAA 1MXZA 3SKPA 1B51A 1Z7ME 3PMVA 2RC7A 5F24A 2I0CA 3USDA 1GGGA 3Q28A 2O7IA 3O66A 1IUDA 3SEYA 4PBHA 3B50A 1Y3QA 5AA1A 2ZNUA 4XIGQ 4F39A 3SEVA 4F1VA 4GX3A 5ET7A 4RK2A 3SDFA 2B4MA 3B6WA 1P1WA 2GHBA 4H0WA 5DTBA 4HCYA 1AH5A 3K6XA 2JJKA 4QRZA 3MPLA 2XHDA 1A8FA 1HSJA 4HTGA 4U23A 3KN7A 2W7YA 1LFGA 1FCKA 4PCDA 2XXXA 2PMSA 1D3KA 4G77A 5EQ8A 1NV2A 1FTMA 3CRBA 3B6TA 1N7WA 4IY5A 4XKRA 4DZ1A 1NH7A 3MZ9A 1QULA 3N94A 2QMXA 3OENA 4PDDA 1N3XA 3CVGA 4G8HA 4N6DA 4HXVA 1MH4A 1PBQA 3SERA 1XI6A 3RUMA 1IMDA 2D5WA 2VP1A 4GVOA 4QFLA 1S7YA 5FTIA 4LZ5A 5CM6A 3MVZA 1ZMGA 2P3VA 4DXCA 4JSOA 2ZNTA 4I9DA 4JSDA 1MQHA 1XT8A 3LV0A 4DI3D 4HCWA 1UTHB 3W15C 5L9SA 4GL8A 4X48A 5KZTA 2REJA 2XWKA 4PFRA 4N15A 5H8QA 3K1MA 3I5OA 2FBPA 1I6BA 5HBCA 3VXCA 1EYJA 1BLFA 5A5XA 5FHOA 4NF5B 4P3LA 4ND9A 1IXGA 1LFIA 5I59B 2XX8A 3K0VA 1D9QA 2PT2A 2DWHA 1JVXA 3A3CA 5EYGA 1MXUA 4N91A 3VLUA 3RT8A 4POWA 2I4CA 3T93B 4EQBA 2CZLA 3IO6A 1XVXA 3K1NA 2XA5A 2X7PA 1NL5A 4JWOA 3RPLA 5DW8A 3MC2A 3IOVA 2Q9TA 1P99A 5EYFA 1FPGA 1QUIA 5I56B 4Q30B 3F11A 2WYKA 3FATA 3QSLA 1M5FA 3RGYA 4OVRA 4PAFA 3FIRA 3TKDA 2DDKA 1XC1A 1LAHE 3PPPA 3HPIA 1H3DA 4FEDA 2PBWA 1MRPA 1SW5A 2XXWA 1B9JA 1MQDA 3IL1B 2WKYA 1BKAA 4O3BA 1ZKBA 3RQTA 2FIEA 4O8MA 4KYEA 2OWTA 4GRKA 5CBSA 3CIJA 4KYSA 2XXIA 1NV5A 4ZECA 1FPLA 1MY2A 2DP8A 3CG1A 5I2NB 3KN8A 3LC8A 4QHQA 3FXBA 2HHMA 1JVYA 4OFLA 5ESYA 4IGRA 4P0IA 1USYE 4YMAA 1FRPA 1O63A 2WBBA 4X9TA 4IR8A 4BDMA 3I6VA 3TDJA 3MZBA 4PC9A 4IB2A 3TMGA 3PV0E 2ZYMA 1DBZA 2A5TB 4R75A 4RPOA 4C1TA 2Z23A 1IXIA 4HS7A 2XXVA 3MWBA 3C34A 3EN3A 1IMAA 3RYDA 1DTGA 3MP8A 4X1BA 2HCAA 4GBVA 3OMBA 3FJ7A 2UXAA 3TAJA 5ET6A 2XWIA 3O29A 1AMFA 2D3IA 4E0XA 3ILUB 2O1MA 3KZGA 2ONKE 4AB6A 2V3UA 4LQ5A 3TTKA 3K00A 4N8GA 1B5HA 4QSCA 5TPAA 3Q29A 1B3EA 2RF1A 3C35A 2YLNA 5H8HA 3S9EA 3UP9A 3QXMA 5IM2A 3T0JA 4Q8RA 5CMKA 1IMEA 3HV1A 4KPTA 5IZ3A 3C32A 1NMUA 3TUSA 4G68B 1H45A 4U21A 2VGQA 3N26A 2V25A 2F97A 2RCAA 1OVTA 4H46A 5EHSA 1HSLA 2WBDA 4UACA 4TLLB 5I58B 4XKQA 4ESWA 2OCUA 4NQ8A 1FTOA 1F9BA 1ELJA 3FVKA 1SBPA 2F7AA 3LUZA 4IO7A 3TQWA 2QL3A 1MPDA 3G3JA 1IZ1A 1SVXB 3HHGA 1NNKA 2Z8DA 4P0GA 1FQEA 4ONYA 1SYIA 3FXUA 4EXLA 4H6DA 2B4LA 1B0HA 3WAFA 4Q5TA 4RXLA 3EHUA 3GBAA 1YXIA 1MXYA 1QUJA 4OVTA 2FA7A 3RT6B 5CC2A 5FBPA 1FTLA 3KOTA 2G29A 4FAJA 1PB8A 5FTHA 2Y5LA 1GR2A 2B65A 3FASA 2X7QA 3ZS6A 1R9LA 4QSDA 4AB5A 1JP4A 4MJOA 3E13X 2V4CA 2DSFA 1FSAA 3O2AA 1MPCA 2XWOA 3M3LA 1WVJA 1NH8A 4DIGA 2XXPA 1B32A 2DE2A 1FBGA 1LEVA 1ZIUA 2PFZA 3PUZE 2LAOA 4DI4B 1DSNA 3PUXE 3H6TA 4YKKA 3P7IA 3TFLA 2PYYA 4JDFA 3HCQA 1VDWA 2QFLA 4MFIA 4OVQA 4MX6A 3C9HA 3S9NC 1MQIA 5KCJB 2QS1A 2I0BA 2QVUA 1OMPA 4QSEA 2GRVA 2VPNA 2H5YA 4PGNA 2R71A 1B3FA 1R9QA 2QVRA 4P8BA 4LP2B 3PUVE 1P1QA 3E9XA 1FBCA 1ZBMA 4ZEBA 2VT5A 1OLAA 4F2QA 2NVUB 4P47A 1BK4A 5L9MA 3IO4A 4EXKA 2GH9A 3O6GA 4THIA 2QVVA 3ILTB 2Y7IA 3N6UA 5TP9B 1B58A 3LSWA 3PPNA 4QFNA 4O7IA 3O97A 4PGPA 2XXQA 1FBDA 3FD3A 2THIA 4ZE8A 1NV3A 1FPDA 4QFKA 3IB1A 3KGCA 3SEXA 4KR5A 3CFLA 1B7ZA 4OFOA 5CMMA 4OMBA 4LN5A 3WAEA 3D1RA 1OVBA 4PFWA 1NV6A 3CFXA 3OSQA 1LBVA 1Y1MA 3VLWA 3RTFB 4FATA 2QPQA 3HSTA 1LFHA 4OESA 1SYHA 4KHZE 4GWUA 1GV8A 2I6EA 1B6HA 4NF0A 3U94A 3T9VA 4OFJA 3H6VA 4DE8A 4G8MA 3EKIA 1B7UA 4OTEA 1L5TA 1S50A 1UQWA 1B52A 4NGUA 3L6HA 3W9WA 2H9BA 4DCXA 1NUZA 4I62A 1SDXA 3MSTA 5KDTB 5L8DA 3B8BA 1QVSA 1USYH 3JZJA 1BP5A 2HXWA 5B70A 4KQPA 3UN6A 2OWZA 4OZ9A 1LBWA 2V84A 1ZU0A 4FECA 4QXDA 3FV1A 1QKBA 4DXBA 3FJMA 4AQ4A 2H99A 4YICA 1TFDA 4R2FA 3VFJA 1IMBA 4LVQA 3U1OA 4DLDA 4RY1A 1UIVA 1QUKA 2VD2A 5AA4A 1R1NA 3QUFA 1LAFE 1N76A 1IQ7A 2REGA 4XXUA 3FBPA 2CEYA 3TQLA 4N6KA 4N17A 4IY6A 2E1SA 4BDNA 3TCFA 3U8QA 3PU5A 4F22A 4ZEIA 1SW4A 4YU0A 1EU8A 1ZJLA 1RYOA 1UIUA 1TT1A 2I3VA 2HXRA 3IFCA 2UVIA 3HO7A 2AL5A 3TTMA 1VFEA 3DP8A 5M2VA 4IO3A 1XVYA 1IIWA 3S2VA 1FPIA 1LCFA 4OVPA 4PTKA 3N6TA 3ONMA 1N0TA 2DVZA 4FORA 3D4GA 1MXWA 3MUQA 3U93A 3K6VA 1WODA 3CR9A 1H44A 3HHFA 5I56A 2XX9A 4FEBA 4H45A 4F18A 1DPPA 3LBSA 3H03A 1ANFA 4PP0A 1MDQA 4MLQA 3QMFA 4PFBA 3AXFA 2A5SA 3KSJA 4IO2A 4ELOA 2H98A 2X26A 1XS5A 3MP6A 1FBPA 1NKXA 2RC9A 3FZVA 5JTYB 1RDYA 1SD3A 3Q27A 3PPOA 3U92A 4H5GA 1NUXA 1B7HA 3PPQA 1RDZA 3UIFA 2O1LA 1IMCA 2Q89A 2B3BA 2NUVA 5I7IA 1IITA 2QS2A 2ZYKA 5AA2B 1OLCA 4YZZA 5DEXB 3A29A 5EQ9A 3GYYA 5BWJA 3G7WA 4JBZA 4NWCA 5EQ7A 3FV2A 3K01A 3EHTA 4PFUA 4N6PA 2UVGA 3OO7A 3MVYA 4GWOA 3T66A 3QUJA 3UGWA 4NF4A 1IEJA 1FQDA 5A5XB 3E4RA 1H43A 3IJXB 4WEPA 5ITPA 3Q25A 1II5A 3EQ1A 3I3VA 2CZKA 2I58A 4NWDA 4H67A 3IB2A 3IOTA 4NN3A 4BDLA 5I84A 1MM6A 1FW0A 4OHNA 5IZZA 4ZDMA 5ISUA 1SW2A 3TYHA 1B05A 4R9GA 1B4ZA 3DM0A 2XXTA 4POXA 5DVJA 4OYVA 3C31A 4XFEA 1K9ZA 3FVOA 3RPLB 3RPWA 4NEDA 5I57A 3LUYA 5IAIA 1MXXA 3PPRA 1LBBA 1Z7NE 2PVUA 1LBXA 4UABA 1B3GA 2OZZA 3O6IA 4OWDA 4TLMB 2I49A 4YMBA 2FIXA 4GWXA 2UVHA 1MY1A 3DLNA 3V8XB 4GWSA 3MVXA 3PMXA 4X8RA 2Q8MA 3JYRA 4LUBA 3PMWA 4YKIA 1A7LA 2P1SA 2DOJA 4GL0A 2HEUA 4L17A 3THIA 2ANJA 5EYHA 1BIYA 4LA9A 1IMFA 2ONSA 5HM4B 3KSXA 4OETA 1MG1A 4OEVA 2DS9A 3Q26A 2F6GA 4ELQA 1B4HA 3MP1A 3G3FA 2PCRA 4NF8A 3W9VA 1A55A 4MEVA 4R9FA 3FGSA 2CEXA 1AL3A 2Y5KA 4DXUA 2OBGA 2Q2AA 4PF6A 5DYHA 2F78A 2XD2A 3OO9A 1Q1KA 2H25A 1O64A 2V93A 1FTKA 5L9OA 3OO6A 2XX7A 1NFTA 4C1UA 1XHYA 4MF3A 3S9LC 3H4ZA 1O7TA 1CNQA 1Y20A 3QK6A 2P2AA 5I5PA 3V83A 4YAHX 4G8NA 3GXAA 5H8NA 1PC3A 3MVWA 1H76A 4MIJA 3RNNA 3G3HA 1FBEA 3PGFA 1DPEA 4E0WA 2F35A 1QJMA 3IX1A 4MCOA 4KYDA 1BTJA 4MNCA 2Q8JA 2F3BA 2RKMA 5TPAB 4PE3A 3VVFA 3IR1A 1RYXA 4YB5A 3MQ9A 5H8HB 2CZHA 3KC1A 4HE0A 2I3WA 2DYXA 3E79A 1US4A 4MBPA 4U2RA 3IJOB 1DK4A 4IO4A 1B3HA 4PQJA 1P1UA 3K02A 2O69A 1FJ9A 2E0SA 1MM7A 2GFEA 3T9XB 5JK4A 1Y3NA 3A09A 3QYTA 1JQFA 1OQGA 3IK6B 2F8DA 1LBCA 4BDOA 5DVIA 3V89B 4FBPA 4F29A 4EF2A 5LOMA 2KQZA 2XXYA 2XXHA 2OJTA 3TCHA 1KA1A 4XKPA 5TP9A 4QFOA 2HAUA 4P11A 4FJPA 4NTLA 4ZEKA 1MDP1 3MYUA 3SEUA 4I1DA 2ZZVA 4ELPA 1B1XA 3NOHA 4MAGA 1Y4CA 1SPIA 2DWAA 1URSA 1G0HA 4NE4A 4U1OA 4U4XA 4F3BA 4JVIA 1M5CA 1VR5A 4EF1A 4MNIA 1MXVA 3DP6A 1LB9A 3C36A 4QFPA 2G93A 3T22A 3H06B 1YZ0A 4GXAA 4H8JA 3H6UA 2P3NA 3IFAA 3DP4A 4R6KA 4U4SA 5CMCA 3KC0A 5F1QA 1UTBB 4NX1A 4NF6A 5ITOA 2O6AA 1A99A 1NNFA 1I6QA 5DVFA 4KCDA 2ZXTA 3IOUA 4BLAA 4ZE9A 1VFDA 3K2DA 4TOZA 2VPOA 4WKMA 3ZSFA 4QBAA 5EQAA 2ZZWA 1RKMA 2R9JA 5CMBA 1TXFA 1INPA 4H65A 4JWYA 5FHMA 1QKAA 2I4BA 1JEUA 4I8CA 2F6PA 4PF8A 2O51A 5I2KA 1SW1A 1Y3PA 2F5XA 5I3SA 2ONRA 5B7DA 4LZ7A 3FJGA 2FVZA 2YJPA 5TU0A 3VVEA 5ET8A 4LATA 2DE3A 4XEQA 3KFMA 1JETA 2Z8EA 1PEBA 1A40A 3M3KA 3G3IA 2DXYA 4GOTA 2O68A 3MZ1A 4N81A 2HZKA 3MPKA 3RN8A 1FJ6A 3BIGA 1N3WA 2BJJX 5LTCA 2FNCA 1HSEA 2B3FA 2DWJA 3T1BA 2Q88A 4BDRA 2NXOA 2XWVA 4X1DA 1M5DA 4P1EA 1LCTA 3GZGA 5ET5A 2ABHA 4F2OA 3TEPA 1MY4A 1OQHA 1LB8A 3G3KA 4MNPA 2OWSA 1PB7A 5IZ1A 1I69A 4LQ2A 5F7VA 1JW1A 3E78A 2ALUA 3O28A 2QS3A 5BUUA 4IO5A 4F19A 2NOOA 4FIMA 2FYIA 4NMYA 1P1NA 4ZEFA 1ZTYA 3TODA 1NNTA 3A3UA 5IKBA 3T9HB 3IORA 4GWZA 2VD3A 3JV9A 4RYAA 3PD9A 5H8FB 2HQ0A 5JEIA 3TCGA 2RCBA 1UTHA 4GWYA 2GHAA 3U72A 3BBRA 1KZ8A 1YCJA 1EZ9A 3K1PA 2XXUA 4O3CA 4PAIA 5T3JA 4NG7A 1MS7A 1IXCA 4GWWA 4I3YA 4NF5A 4N8YA 4KD5A 1FPKA 2VHAA 2Q2CA 3HFUA 5K2YA 4GFRA 3R26A 5I59A 2GQ1A 1DMBA 1PB9A 3M8UA 1D9YA 3C4MA 1SI1A 1LBZA 1B1HA 3BFUA 3TPAA 2Y7KA 4F31B 2HZLA 5JTYA 4KI0E 4K3FA 3K6WA 3K6UA 1DTZA 5AA4B 4PBQA 3FVGA 5HPQA 1FPFA 4PFIA 5AA2A 1OIBA 1NNPA 5DEXA 4I3EA 4GIZA 3TTRA 2QS4A 2H4IA 1QGXA 2QJEA 4EQ7A 2AL4A 1FQAA 3TELA 1VE4A 1URGA 5ELVA 3H6WA 3KJTA 3H3GA 1P1OA 2XD3A 1Q35A 3OEKA 3ROJA 5IGAA 2I48A 3DELB 4OVJA 4P9KA 3G3GA 4GD5A 2F3DA 4U1ZA 1Y4TA 4PE5B 5AA3A 4G4PA 2QMWA 1JW4A 4PETA 1N7XA 3RTWB 5I2NA 1YAEA 2F36A 1B0LA 4P56A 1FTAA 3FUZA 4ZZEA 3KN3A 4GX4A 4MH5A 2IEEA 5H8QB 4Z7EA 3N5LA 2VOZA 3H7MA 1KA0A 2NWJA 3PTYA 2Y84A 4RK9A 1Y1ZA 2A5TA 2Y7PA 3GLBA 3EF7A 2ZNSA 4U22A 4EDPA 1B3LA 1GTKA 4Z0IA 4O3AA 2IA4A 5DT6A 1Q9DA 4F1UA 4M1VA 2DWIA 3MAMA 3T9UA 3CI8A 3TTLA 4YKJA 1EH3A 3MW0A 4F3GA 1K9YA 3O6HA 4NAPA 4R6YA 1TFAA 1MY3A 1AWBA 3T96B 1J1NA 1EYKA 1PDAA 3OEMA 5H8SA 2CMOA 4R6HA 4PDHA 1FQFA 2Z8FA 4WEDA 1DCUA 2XXKA 4G68A 2AYSA 5K2XA 3GBBA 4LONB 4X04A 1YTVA 3UORA 1FPJA 4NF4B 5CRYA 5ICTA 1JEVA 4HE2A 4JB7A 1CE2A 1AOVA 4HW8A 1S9TA 3ECRA 1QW0A 2F34A 4AS5A 4EUOA 5I58A 2ZMBA 3LR1A 4N07A 1MY0A 2HFBA 4C0RA 3VXBA 3ZKKA 2WEFA 1MQGA 4OANA 2PX1A 2Z22A 4BDQA 2M8CA 4XTCQ 4RA1A 3C33A 5J16A 4MMPA 2UVJA 4DDDA 4ISUA 3BIHA 1RDXA 3OXNA 3PUYE 4JWXA 4KXPA 3QIMA 4H1XA 4Q0CA 3B6QA 3K4UA 2UYFA 3R6UA 3RY3A 5I57B 1EZPA 4PAKA 1POY1 1LGBC 2HAVA 5AA2D 4ZEDA 3ZKLA 4R72A 3OELA 3S4UA 4TQUQ 1B46A 4M4GA 3MBPA 4OA4A 4KFQA 1D9VA 4N4UA 4OVSA 2RC8A 3UA8A 4GBWA 5A5LA 4H5FA 4F3SA 4XF5A 2DVCA 3EHSA 4JVCA 4ZS9A 1TWYA 3IOWA 1GVCA 4GF8A 4OQOA 4RPNA 4LZ8A
chains in the Genus database with same CATH topology
4QBAA 5EQAA 3SZPA 2ZZWA 2L5VA 2FIEA 4O8MA 1INPA 2WYPA 4PF8A 4O7MA 2F5XA 5I3SA 5IZ3B 2HXRA 3IFCA 1NV5A 1FPLA 2FVZA 5ET8A 4JVDA 2DE3A 4XEQA 3FXBA 2HHMA 1FPIA 2KR0A 5ESYA 4N81A 4OVPA 4PTKA 2HZKA 1FRPA 1FJ6A 2WBBA 2DVZA 4X9TA 4IR8A 2Q74A 3BIGA 1LBYA 4PC9A 5LTCA 1YYZA 1DBZA 3T1BA 4H45A 3ISPA 2XWVA 1NV1A 1IMAA 3RYDA 4F18A 4GBVA 4P1EA 5ET5A 5ET6A 2XWIA 3QMFA 4MNPA 5IZ1A 4PFBA 2PFYA 1NV4A 5J1DA 1FBPA 4N8GA 3E78A 2HPGA 1RDYA 1NUXA 4F19A 1RDZA 1IMCA 5LDZA 5I7IA 5IM2A 3T0JA 3CHGA 1IMEA 5IZ3A 4YZZA 3U65A 4MHFA 3A29A 5EQ9A 2FHYA 3GYYA 4G61A 5EQ7A 4GWZA 2BJIA 4H46A 4GWYA 2WBDA 1NI9A 1KZ8A 4NQ8A 3LUZA 4PAIA 2CZKA 2R8TA 5T3JA 4NG7A 4GWWA 2CZIA 4I3YA 2DE4A 4NN3A 4N8YA 2ZZXA 2B4LA 1FPKA 3HFUA 5IZZA 2GQ1A 1NUYA 2MKZA 1YXIA 4OVTA 1G0IA 4NHBA 4AS4A 5FBPA 4HE1A 1LBZA 4XFEA 1K9ZA 3RPLB 1NV0A 4GX6A 4I40A 2HZLA 2Y5LA 1FBFA 1NV7A 1JP4A 4PBQA 4MJOA 2OX3A 1LBXA 4UABA 2V4CA 2WX9A 1FSAA 1FPFA 4PFIA 2XWOA 4P1LA 2FIXA 4GWXA 2DE2A 1FBGA 4I3EA 3KBZA 1LEVA 2PFZA 2V3QA 4GWSA 1QGXA 4DI4B 1EYIA 4O94A 4X8RA 2Q8MA 1FPBA 5EYHA 1VDWA 2QFLA 1FBHA 3ROJA 5IGAA 4OVQA 1IMFA 4MX6A 1NUWA 1FPEA 4P9KA 2F3DA 2PCRA 3W9VA 5F24A 4MEVA 2CEXA 2QVUA 4PBHA 3B50A 2Y5KA 4PETA 4PF6A 2VPNA 4PGNA 4P56A 1FTAA 4F1VA 4GX3A 5ET7A 2B4MA 2QVRA 4P8BA 4GX4A 4HCYA 2JJKA 1FBCA 2VT5A 4P47A 1KA0A 3PTYA 1BK4A 4PCDA 1CNQA 5I5PA 2QVVA 4MIJA 1FBEA 5EQ8A 1NV2A 4MCOA 4O7IA 4MNCA 4PGPA 1FBDA 2F3BA 1NV3A 1Q9DA 4F1UA 4M1VA 1FPDA 4PDDA 4N6DA 4HXVA 4PE3A 1K9YA 1XI6A 2CZHA 3KC1A 4HE0A 4NAPA 1IMDA 3E79A 4LN5A 3D1RA 1AWBA 1EYKA 1NV6A 5CM6A 1DK4A 1LBVA 2P3VA 4PDHA 1FJ9A 1DCUA 2XXKA 2QPQA 3LV0A 4DI3D 4HCWA 5JK4A 4GWUA 4X04A 1FPJA 4NF0A 4HE2A 2XWKA 4PFRA 4N15A 3EKIA 2FBPA 4AS5A 4FBPA 1EYJA 4NGUA 2KQZA 3W9WA 1NUZA 2WEFA 4P3LA 4OANA 3MSTA 3B8BA 1KA1A 1D9QA 5J16A 4MMPA 3BIHA 1RDXA 4KXPA 2OWZA 3MYUA 5EYGA 4N91A 1LBWA 2ZZVA 3NOHA 4QXDA 4MAGA 4PAKA 1SPIA 4YICA 1G0HA 2XA5A 3RPLA 5DW8A 4JVIA 1IMBA 2Q9TA 4MNIA 1FPGA 4OA4A 1YZ0A 2WYKA 2P3NA 4N4UA 3IFAA 4OVSA 4OVRA 3KC0A 4PAFA 2DDKA 4NX1A 4GBWA 5A5LA 4XF5A 3FBPA 4JVCA 2CEYA 4N6KA 4N17A 2VPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CM6 A;  2ZZW A;  4YZZ A;  3U65 A;  4MHF A;  4O8M A;  3GYY A;  4PDH A;  5IGA A;  4OVQ A;  4MX6 A;  2XXK A;  4DI3 D;  2WYP A;  4P9K A;  4X04 A;  4PF8 A;  4O7M A;  4NF0 A;  2XWK A;  4MEV A;  4PFR A;  4N15 A;  2CEX A;  4NQ8 A;  4PBH A;  3B50 A;  4XEQ A;  4PET A;  3FXB A;  4PF6 A;  4NGU A;  2VPN A;  4PGN A;  4P56 A;  4PAI A;  4NG7 A;  4P3L A;  4P8B A;  4OVP A;  4OAN A;  2HZK A;  4NN3 A;  4N8Y A;  2ZZX A;  4PC9 A;  4MMP A;  5LTC A;  5IZZ A;  4P47 A;  4OVT A;  4NHB A;  4N91 A;  2ZZV A;  4PCD A;  2XWV A;  4MAG A;  5I5P A;  4PAK A;  4XFE A;  2HZL A;  4MIJ A;  4P1E A;  4YIC A;  2XA5 A;  2XWI A;  4MCO A;  4MNP A;  4MNC A;  4MNI A;  4PGP A;  4PFB A;  4PBQ A;  2PFY A;  4UAB A;  2V4C A;  2WX9 A;  4OA4 A;  4PDD A;  4PFI A;  2WYK A;  2XWO A;  4N6D A;  4P1L A;  4N8G A;  4PE3 A;  4N4U A;  2HPG A;  4OVS A;  4OVR A;  4PAF A;  4NAP A;  4NX1 A;  2PFZ A;  4LN5 A;  4DI4 B;  4XF5 A;  4O94 A;  4X8R A;  2CEY A;  5IM2 A;  5I7I A;  4N6K A;  4N17 A;  2VPO A; 
#chains in the Genus database with same CATH topology
 3SZP A;  1N84 A;  2L5V A;  3O9P A;  4PFT A;  2WYP A;  4NF8 B;  5ICQ A;  4O7M A;  1A8E A;  4UA8 A;  4GQO A;  3FXR A;  5IZ3 B;  1KWH A;  4IGT A;  5KCJ A;  2ZYN A;  4JVD A;  1WDN A;  5CI5 A;  4ZZA A;  3BKI B;  3PD8 A;  4R74 A;  2F7B A;  3VVD A;  2KR0 A;  3S9M C;  1M5E A;  1LAG E;  4RJZ A;  1B2H A;  2Q74 A;  3QAX A;  1LBY A;  3FVN A;  1CB6 A;  4OXV A;  1YYZ A;  2V3T A;  2KLF A;  3KG2 A;  1YPN A;  2O7U A;  3KBR A;  1R6Z A;  1ATG A;  2R6G E;  2RIN A;  3VDF A;  5H8N B;  3ISP A;  3VLV A;  1NV1 A;  2QSX A;  3IB0 A;  1UTB A;  3BFT A;  4XKN A;  5AE4 A;  3VE1 B;  1N04 A;  4R73 A;  2OK2 A;  2Y7R A;  3EPE A;  2PFY A;  4F3P A;  1NV4 A;  5J1D A;  5CBR A;  3OSR A;  4KCC A;  2HPG A;  1AIV A;  3CSB A;  2DQV A;  2P0S A;  3B7D A;  2ZYO A;  2Y7W A;  2F7C A;  3CFZ A;  5LDZ A;  2XXR A;  1POT A;  2OLB A;  3CHG A;  1D4N A;  3U65 A;  1DOT A;  4MHF A;  2FHY A;  4G61 A;  4R2B A;  3VV5 A;  2BJI A;  2ESN A;  1T0K A;  4IO6 A;  4N13 A;  1PBP A;  3LSL A;  3E3K A;  1JNF A;  1MQJ A;  1NI9 A;  3PUW E;  4ESX A;  3ODB A;  4DCY A;  3SEW A;  3CG3 A;  3CSG A;  4OER A;  2AIX A;  4G2Z A;  2R8T A;  4MLV A;  4YB7 A;  2CZI A;  4OEU A;  4WXJ A;  4EQ9 A;  4ELR A;  2DE4 A;  1EZO A;  4G68 C;  2ZZX A;  1US5 A;  5KDT A;  4GLI A;  1FTJ A;  1MH3 A;  1SQY A;  1NUY A;  2MKZ A;  3OO8 A;  1SI0 A;  3UK4 A;  3MJN A;  1G0I A;  4NHB A;  4YKP A;  4ECF A;  3L6G A;  2UYE A;  3SET A;  3TTN A;  4AS4 A;  1M5B A;  1VSO A;  1Y9U A;  4HE1 A;  1B5I A;  2QRY A;  4OEN A;  1NV0 A;  3SES A;  4GX6 A;  4I40 A;  2DXR A;  1FBF A;  2YPN A;  5FHN A;  4JXI A;  1LST A;  1JW5 A;  1XOC A;  4GXS B;  1NV7 A;  2PT1 A;  3LSF B;  1I6A A;  1B40 A;  2OX3 A;  3V5A A;  2WX9 A;  1FQC A;  1LAX A;  1MPB A;  4QF9 A;  4PFY A;  4P1L A;  4NF6 B;  1LLS A;  3KBZ A;  3KEI A;  3M3F A;  4FE8 A;  3RLF E;  2V3Q A;  3HN0 A;  1FQB A;  1IXH A;  3R7X A;  3OD7 A;  5H8F A;  3KOS A;  1EYI A;  3IAZ A;  4O94 A;  3OOA A;  4RNS A;  4F1Y A;  5EHM A;  1FPB A;  1ZLQ A;  1B5J A;  2D21 A;  1A54 A;  1FBH A;  3KJ7 A;  3LSX A;  4H8I A;  3D4C A;  5I2K B;  2O84 X;  1NUW A;  3FXQ A;  1FPE A;  1URD A;  4YB6 A;  3TZA A;  1MXZ A;  3SKP A;  1B51 A;  1Z7M E;  3PMV A;  2RC7 A;  5F24 A;  2I0C A;  3USD A;  1GGG A;  3Q28 A;  2O7I A;  3O66 A;  1IUD A;  3SEY A;  4PBH A;  3B50 A;  1Y3Q A;  5AA1 A;  2ZNU A;  4XIG Q;  4F39 A;  3SEV A;  4F1V A;  4GX3 A;  5ET7 A;  4RK2 A;  3SDF A;  2B4M A;  3B6W A;  1P1W A;  2GHB A;  4H0W A;  5DTB A;  4HCY A;  1AH5 A;  3K6X A;  2JJK A;  4QRZ A;  3MPL A;  2XHD A;  1A8F A;  1HSJ A;  4HTG A;  4U23 A;  3KN7 A;  2W7Y A;  1LFG A;  1FCK A;  4PCD A;  2XXX A;  2PMS A;  1D3K A;  4G77 A;  5EQ8 A;  1NV2 A;  1FTM A;  3CRB A;  3B6T A;  1N7W A;  4IY5 A;  4XKR A;  4DZ1 A;  1NH7 A;  3MZ9 A;  1QUL A;  3N94 A;  2QMX A;  3OEN A;  4PDD A;  1N3X A;  3CVG A;  4G8H A;  4N6D A;  4HXV A;  1MH4 A;  1PBQ A;  3SER A;  1XI6 A;  3RUM A;  1IMD A;  2D5W A;  2VP1 A;  4GVO A;  4QFL A;  1S7Y A;  5FTI A;  4LZ5 A;  5CM6 A;  3MVZ A;  1ZMG A;  2P3V A;  4DXC A;  4JSO A;  2ZNT A;  4I9D A;  4JSD A;  1MQH A;  1XT8 A;  3LV0 A;  4DI3 D;  4HCW A;  1UTH B;  3W15 C;  5L9S A;  4GL8 A;  4X48 A;  5KZT A;  2REJ A;  2XWK A;  4PFR A;  4N15 A;  5H8Q A;  3K1M A;  3I5O A;  2FBP A;  1I6B A;  5HBC A;  3VXC A;  1EYJ A;  1BLF A;  5A5X A;  5FHO A;  4NF5 B;  4P3L A;  4ND9 A;  1IXG A;  1LFI A;  5I59 B;  2XX8 A;  3K0V A;  1D9Q A;  2PT2 A;  2DWH A;  1JVX A;  3A3C A;  5EYG A;  1MXU A;  4N91 A;  3VLU A;  3RT8 A;  4POW A;  2I4C A;  3T93 B;  4EQB A;  2CZL A;  3IO6 A;  1XVX A;  3K1N A;  2XA5 A;  2X7P A;  1NL5 A;  4JWO A;  3RPL A;  5DW8 A;  3MC2 A;  3IOV A;  2Q9T A;  1P99 A;  5EYF A;  1FPG A;  1QUI A;  5I56 B;  4Q30 B;  3F11 A;  2WYK A;  3FAT A;  3QSL A;  1M5F A;  3RGY A;  4OVR A;  4PAF A;  3FIR A;  3TKD A;  2DDK A;  1XC1 A;  1LAH E;  3PPP A;  3HPI A;  1H3D A;  4FED A;  2PBW A;  1MRP A;  1SW5 A;  2XXW A;  1B9J A;  1MQD A;  3IL1 B;  2WKY A;  1BKA A;  4O3B A;  1ZKB A;  3RQT A;  2FIE A;  4O8M A;  4KYE A;  2OWT A;  4GRK A;  5CBS A;  3CIJ A;  4KYS A;  2XXI A;  1NV5 A;  4ZEC A;  1FPL A;  1MY2 A;  2DP8 A;  3CG1 A;  5I2N B;  3KN8 A;  3LC8 A;  4QHQ A;  3FXB A;  2HHM A;  1JVY A;  4OFL A;  5ESY A;  4IGR A;  4P0I A;  1USY E;  4YMA A;  1FRP A;  1O63 A;  2WBB A;  4X9T A;  4IR8 A;  4BDM A;  3I6V A;  3TDJ A;  3MZB A;  4PC9 A;  4IB2 A;  3TMG A;  3PV0 E;  2ZYM A;  1DBZ A;  2A5T B;  4R75 A;  4RPO A;  4C1T A;  2Z23 A;  1IXI A;  4HS7 A;  2XXV A;  3MWB A;  3C34 A;  3EN3 A;  1IMA A;  3RYD A;  1DTG A;  3MP8 A;  4X1B A;  2HCA A;  4GBV A;  3OMB A;  3FJ7 A;  2UXA A;  3TAJ A;  5ET6 A;  2XWI A;  3O29 A;  1AMF A;  2D3I A;  4E0X A;  3ILU B;  2O1M A;  3KZG A;  2ONK E;  4AB6 A;  2V3U A;  4LQ5 A;  3TTK A;  3K00 A;  4N8G A;  1B5H A;  4QSC A;  5TPA A;  3Q29 A;  1B3E A;  2RF1 A;  3C35 A;  2YLN A;  5H8H A;  3S9E A;  3UP9 A;  3QXM A;  5IM2 A;  3T0J A;  4Q8R A;  5CMK A;  1IME A;  3HV1 A;  4KPT A;  5IZ3 A;  3C32 A;  1NMU A;  3TUS A;  4G68 B;  1H45 A;  4U21 A;  2VGQ A;  3N26 A;  2V25 A;  2F97 A;  2RCA A;  1OVT A;  4H46 A;  5EHS A;  1HSL A;  2WBD A;  4UAC A;  4TLL B;  5I58 B;  4XKQ A;  4ESW A;  2OCU A;  4NQ8 A;  1FTO A;  1F9B A;  1ELJ A;  3FVK A;  1SBP A;  2F7A A;  3LUZ A;  4IO7 A;  3TQW A;  2QL3 A;  1MPD A;  3G3J A;  1IZ1 A;  1SVX B;  3HHG A;  1NNK A;  2Z8D A;  4P0G A;  1FQE A;  4ONY A;  1SYI A;  3FXU A;  4EXL A;  4H6D A;  2B4L A;  1B0H A;  3WAF A;  4Q5T A;  4RXL A;  3EHU A;  3GBA A;  1YXI A;  1MXY A;  1QUJ A;  4OVT A;  2FA7 A;  3RT6 B;  5CC2 A;  5FBP A;  1FTL A;  3KOT A;  2G29 A;  4FAJ A;  1PB8 A;  5FTH A;  2Y5L A;  1GR2 A;  2B65 A;  3FAS A;  2X7Q A;  3ZS6 A;  1R9L A;  4QSD A;  4AB5 A;  1JP4 A;  4MJO A;  3E13 X;  2V4C A;  2DSF A;  1FSA A;  3O2A A;  1MPC A;  2XWO A;  3M3L A;  1WVJ A;  1NH8 A;  4DIG A;  2XXP A;  1B32 A;  2DE2 A;  1FBG A;  1LEV A;  1ZIU A;  2PFZ A;  3PUZ E;  2LAO A;  4DI4 B;  1DSN A;  3PUX E;  3H6T A;  4YKK A;  3P7I A;  3TFL A;  2PYY A;  4JDF A;  3HCQ A;  1VDW A;  2QFL A;  4MFI A;  4OVQ A;  4MX6 A;  3C9H A;  3S9N C;  1MQI A;  5KCJ B;  2QS1 A;  2I0B A;  2QVU A;  1OMP A;  4QSE A;  2GRV A;  2VPN A;  2H5Y A;  4PGN A;  2R71 A;  1B3F A;  1R9Q A;  2QVR A;  4P8B A;  4LP2 B;  3PUV E;  1P1Q A;  3E9X A;  1FBC A;  1ZBM A;  4ZEB A;  2VT5 A;  1OLA A;  4F2Q A;  2NVU B;  4P47 A;  1BK4 A;  5L9M A;  3IO4 A;  4EXK A;  2GH9 A;  3O6G A;  4THI A;  2QVV A;  3ILT B;  2Y7I A;  3N6U A;  5TP9 B;  1B58 A;  3LSW A;  3PPN A;  4QFN A;  4O7I A;  3O97 A;  4PGP A;  2XXQ A;  1FBD A;  3FD3 A;  2THI A;  4ZE8 A;  1NV3 A;  1FPD A;  4QFK A;  3IB1 A;  3KGC A;  3SEX A;  4KR5 A;  3CFL A;  1B7Z A;  4OFO A;  5CMM A;  4OMB A;  4LN5 A;  3WAE A;  3D1R A;  1OVB A;  4PFW A;  1NV6 A;  3CFX A;  3OSQ A;  1LBV A;  1Y1M A;  3VLW A;  3RTF B;  4FAT A;  2QPQ A;  3HST A;  1LFH A;  4OES A;  1SYH A;  4KHZ E;  4GWU A;  1GV8 A;  2I6E A;  1B6H A;  4NF0 A;  3U94 A;  3T9V A;  4OFJ A;  3H6V A;  4DE8 A;  4G8M A;  3EKI A;  1B7U A;  4OTE A;  1L5T A;  1S50 A;  1UQW A;  1B52 A;  4NGU A;  3L6H A;  3W9W A;  2H9B A;  4DCX A;  1NUZ A;  4I62 A;  1SDX A;  3MST A;  5KDT B;  5L8D A;  3B8B A;  1QVS A;  1USY H;  3JZJ A;  1BP5 A;  2HXW A;  5B70 A;  4KQP A;  3UN6 A;  2OWZ A;  4OZ9 A;  1LBW A;  2V84 A;  1ZU0 A;  4FEC A;  4QXD A;  3FV1 A;  1QKB A;  4DXB A;  3FJM A;  4AQ4 A;  2H99 A;  4YIC A;  1TFD A;  4R2F A;  3VFJ A;  1IMB A;  4LVQ A;  3U1O A;  4DLD A;  4RY1 A;  1UIV A;  1QUK A;  2VD2 A;  5AA4 A;  1R1N A;  3QUF A;  1LAF E;  1N76 A;  1IQ7 A;  2REG A;  4XXU A;  3FBP A;  2CEY A;  3TQL A;  4N6K A;  4N17 A;  4IY6 A;  2E1S A;  4BDN A;  3TCF A;  3U8Q A;  3PU5 A;  4F22 A;  4ZEI A;  1SW4 A;  4YU0 A;  1EU8 A;  1ZJL A;  1RYO A;  1UIU A;  1TT1 A;  2I3V A;  2HXR A;  3IFC A;  2UVI A;  3HO7 A;  2AL5 A;  3TTM A;  1VFE A;  3DP8 A;  5M2V A;  4IO3 A;  1XVY A;  1IIW A;  3S2V A;  1FPI A;  1LCF A;  4OVP A;  4PTK A;  3N6T A;  3ONM A;  1N0T A;  2DVZ A;  4FOR A;  3D4G A;  1MXW A;  3MUQ A;  3U93 A;  3K6V A;  1WOD A;  3CR9 A;  1H44 A;  3HHF A;  5I56 A;  2XX9 A;  4FEB A;  4H45 A;  4F18 A;  1DPP A;  3LBS A;  3H03 A;  1ANF A;  4PP0 A;  1MDQ A;  4MLQ A;  3QMF A;  4PFB A;  3AXF A;  2A5S A;  3KSJ A;  4IO2 A;  4ELO A;  2H98 A;  2X26 A;  1XS5 A;  3MP6 A;  1FBP A;  1NKX A;  2RC9 A;  3FZV A;  5JTY B;  1RDY A;  1SD3 A;  3Q27 A;  3PPO A;  3U92 A;  4H5G A;  1NUX A;  1B7H A;  3PPQ A;  1RDZ A;  3UIF A;  2O1L A;  1IMC A;  2Q89 A;  2B3B A;  2NUV A;  5I7I A;  1IIT A;  2QS2 A;  2ZYK A;  5AA2 B;  1OLC A;  4YZZ A;  5DEX B;  3A29 A;  5EQ9 A;  3GYY A;  5BWJ A;  3G7W A;  4JBZ A;  4NWC A;  5EQ7 A;  3FV2 A;  3K01 A;  3EHT A;  4PFU A;  4N6P A;  2UVG A;  3OO7 A;  3MVY A;  4GWO A;  3T66 A;  3QUJ A;  3UGW A;  4NF4 A;  1IEJ A;  1FQD A;  5A5X B;  3E4R A;  1H43 A;  3IJX B;  4WEP A;  5ITP A;  3Q25 A;  1II5 A;  3EQ1 A;  3I3V A;  2CZK A;  2I58 A;  4NWD A;  4H67 A;  3IB2 A;  3IOT A;  4NN3 A;  4BDL A;  5I84 A;  1MM6 A;  1FW0 A;  4OHN A;  5IZZ A;  4ZDM A;  5ISU A;  1SW2 A;  3TYH A;  1B05 A;  4R9G A;  1B4Z A;  3DM0 A;  2XXT A;  4POX A;  5DVJ A;  4OYV A;  3C31 A;  4XFE A;  1K9Z A;  3FVO A;  3RPL B;  3RPW A;  4NED A;  5I57 A;  3LUY A;  5IAI A;  1MXX A;  3PPR A;  1LBB A;  1Z7N E;  2PVU A;  1LBX A;  4UAB A;  1B3G A;  2OZZ A;  3O6I A;  4OWD A;  4TLM B;  2I49 A;  4YMB A;  2FIX A;  4GWX A;  2UVH A;  1MY1 A;  3DLN A;  3V8X B;  4GWS A;  3MVX A;  3PMX A;  4X8R A;  2Q8M A;  3JYR A;  4LUB A;  3PMW A;  4YKI A;  1A7L A;  2P1S A;  2DOJ A;  4GL0 A;  2HEU A;  4L17 A;  3THI A;  2ANJ A;  5EYH A;  1BIY A;  4LA9 A;  1IMF A;  2ONS A;  5HM4 B;  3KSX A;  4OET A;  1MG1 A;  4OEV A;  2DS9 A;  3Q26 A;  2F6G A;  4ELQ A;  1B4H A;  3MP1 A;  3G3F A;  2PCR A;  4NF8 A;  3W9V A;  1A55 A;  4MEV A;  4R9F A;  3FGS A;  2CEX A;  1AL3 A;  2Y5K A;  4DXU A;  2OBG A;  2Q2A A;  4PF6 A;  5DYH A;  2F78 A;  2XD2 A;  3OO9 A;  1Q1K A;  2H25 A;  1O64 A;  2V93 A;  1FTK A;  5L9O A;  3OO6 A;  2XX7 A;  1NFT A;  4C1U A;  1XHY A;  4MF3 A;  3S9L C;  3H4Z A;  1O7T A;  1CNQ A;  1Y20 A;  3QK6 A;  2P2A A;  5I5P A;  3V83 A;  4YAH X;  4G8N A;  3GXA A;  5H8N A;  1PC3 A;  3MVW A;  1H76 A;  4MIJ A;  3RNN A;  3G3H A;  1FBE A;  3PGF A;  1DPE A;  4E0W A;  2F35 A;  1QJM A;  3IX1 A;  4MCO A;  4KYD A;  1BTJ A;  4MNC A;  2Q8J A;  2F3B A;  2RKM A;  5TPA B;  4PE3 A;  3VVF A;  3IR1 A;  1RYX A;  4YB5 A;  3MQ9 A;  5H8H B;  2CZH A;  3KC1 A;  4HE0 A;  2I3W A;  2DYX A;  3E79 A;  1US4 A;  4MBP A;  4U2R A;  3IJO B;  1DK4 A;  4IO4 A;  1B3H A;  4PQJ A;  1P1U A;  3K02 A;  2O69 A;  1FJ9 A;  2E0S A;  1MM7 A;  2GFE A;  3T9X B;  5JK4 A;  1Y3N A;  3A09 A;  3QYT A;  1JQF A;  1OQG A;  3IK6 B;  2F8D A;  1LBC A;  4BDO A;  5DVI A;  3V89 B;  4FBP A;  4F29 A;  4EF2 A;  5LOM A;  2KQZ A;  2XXY A;  2XXH A;  2OJT A;  3TCH A;  1KA1 A;  4XKP A;  5TP9 A;  4QFO A;  2HAU A;  4P11 A;  4FJP A;  4NTL A;  4ZEK A;  1MDP 1;  3MYU A;  3SEU A;  4I1D A;  2ZZV A;  4ELP A;  1B1X A;  3NOH A;  4MAG A;  1Y4C A;  1SPI A;  2DWA A;  1URS A;  1G0H A;  4NE4 A;  4U1O A;  4U4X A;  4F3B A;  4JVI A;  1M5C A;  1VR5 A;  4EF1 A;  4MNI A;  1MXV A;  3DP6 A;  1LB9 A;  3C36 A;  4QFP A;  2G93 A;  3T22 A;  3H06 B;  1YZ0 A;  4GXA A;  4H8J A;  3H6U A;  2P3N A;  3IFA A;  3DP4 A;  4R6K A;  4U4S A;  5CMC A;  3KC0 A;  5F1Q A;  1UTB B;  4NX1 A;  4NF6 A;  5ITO A;  2O6A A;  1A99 A;  1NNF A;  1I6Q A;  5DVF A;  4KCD A;  2ZXT A;  3IOU A;  4BLA A;  4ZE9 A;  1VFD A;  3K2D A;  4TOZ A;  2VPO A;  4WKM A;  3ZSF A;  4QBA A;  5EQA A;  2ZZW A;  1RKM A;  2R9J A;  5CMB A;  1TXF A;  1INP A;  4H65 A;  4JWY A;  5FHM A;  1QKA A;  2I4B A;  1JEU A;  4I8C A;  2F6P A;  4PF8 A;  2O51 A;  5I2K A;  1SW1 A;  1Y3P A;  2F5X A;  5I3S A;  2ONR A;  5B7D A;  4LZ7 A;  3FJG A;  2FVZ A;  2YJP A;  5TU0 A;  3VVE A;  5ET8 A;  4LAT A;  2DE3 A;  4XEQ A;  3KFM A;  1JET A;  2Z8E A;  1PEB A;  1A40 A;  3M3K A;  3G3I A;  2DXY A;  4GOT A;  2O68 A;  3MZ1 A;  4N81 A;  2HZK A;  3MPK A;  3RN8 A;  1FJ6 A;  3BIG A;  1N3W A;  2BJJ X;  5LTC A;  2FNC A;  1HSE A;  2B3F A;  2DWJ A;  3T1B A;  2Q88 A;  4BDR A;  2NXO A;  2XWV A;  4X1D A;  1M5D A;  4P1E A;  1LCT A;  3GZG A;  5ET5 A;  2ABH A;  4F2O A;  3TEP A;  1MY4 A;  1OQH A;  1LB8 A;  3G3K A;  4MNP A;  2OWS A;  1PB7 A;  5IZ1 A;  1I69 A;  4LQ2 A;  5F7V A;  1JW1 A;  3E78 A;  2ALU A;  3O28 A;  2QS3 A;  5BUU A;  4IO5 A;  4F19 A;  2NOO A;  4FIM A;  2FYI A;  4NMY A;  1P1N A;  4ZEF A;  1ZTY A;  3TOD A;  1NNT A;  3A3U A;  5IKB A;  3T9H B;  3IOR A;  4GWZ A;  2VD3 A;  3JV9 A;  4RYA A;  3PD9 A;  5H8F B;  2HQ0 A;  5JEI A;  3TCG A;  2RCB A;  1UTH A;  4GWY A;  2GHA A;  3U72 A;  3BBR A;  1KZ8 A;  1YCJ A;  1EZ9 A;  3K1P A;  2XXU A;  4O3C A;  4PAI A;  5T3J A;  4NG7 A;  1MS7 A;  1IXC A;  4GWW A;  4I3Y A;  4NF5 A;  4N8Y A;  4KD5 A;  1FPK A;  2VHA A;  2Q2C A;  3HFU A;  5K2Y A;  4GFR A;  3R26 A;  5I59 A;  2GQ1 A;  1DMB A;  1PB9 A;  3M8U A;  1D9Y A;  3C4M A;  1SI1 A;  1LBZ A;  1B1H A;  3BFU A;  3TPA A;  2Y7K A;  4F31 B;  2HZL A;  5JTY A;  4KI0 E;  4K3F A;  3K6W A;  3K6U A;  1DTZ A;  5AA4 B;  4PBQ A;  3FVG A;  5HPQ A;  1FPF A;  4PFI A;  5AA2 A;  1OIB A;  1NNP A;  5DEX A;  4I3E A;  4GIZ A;  3TTR A;  2QS4 A;  2H4I A;  1QGX A;  2QJE A;  4EQ7 A;  2AL4 A;  1FQA A;  3TEL A;  1VE4 A;  1URG A;  5ELV A;  3H6W A;  3KJT A;  3H3G A;  1P1O A;  2XD3 A;  1Q35 A;  3OEK A;  3ROJ A;  5IGA A;  2I48 A;  3DEL B;  4OVJ A;  4P9K A;  3G3G A;  4GD5 A;  2F3D A;  4U1Z A;  1Y4T A;  4PE5 B;  5AA3 A;  4G4P A;  2QMW A;  1JW4 A;  4PET A;  1N7X A;  3RTW B;  5I2N A;  1YAE A;  2F36 A;  1B0L A;  4P56 A;  1FTA A;  3FUZ A;  4ZZE A;  3KN3 A;  4GX4 A;  4MH5 A;  2IEE A;  5H8Q B;  4Z7E A;  3N5L A;  2VOZ A;  3H7M A;  1KA0 A;  2NWJ A;  3PTY A;  2Y84 A;  4RK9 A;  1Y1Z A;  2A5T A;  2Y7P A;  3GLB A;  3EF7 A;  2ZNS A;  4U22 A;  4EDP A;  1B3L A;  1GTK A;  4Z0I A;  4O3A A;  2IA4 A;  5DT6 A;  1Q9D A;  4F1U A;  4M1V A;  2DWI A;  3MAM A;  3T9U A;  3CI8 A;  3TTL A;  4YKJ A;  1EH3 A;  3MW0 A;  4F3G A;  1K9Y A;  3O6H A;  4NAP A;  4R6Y A;  1TFA A;  1MY3 A;  1AWB A;  3T96 B;  1J1N A;  1EYK A;  1PDA A;  3OEM A;  5H8S A;  2CMO A;  4R6H A;  4PDH A;  1FQF A;  2Z8F A;  4WED A;  1DCU A;  2XXK A;  4G68 A;  2AYS A;  5K2X A;  3GBB A;  4LON B;  4X04 A;  1YTV A;  3UOR A;  1FPJ A;  4NF4 B;  5CRY A;  5ICT A;  1JEV A;  4HE2 A;  4JB7 A;  1CE2 A;  1AOV A;  4HW8 A;  1S9T A;  3ECR A;  1QW0 A;  2F34 A;  4AS5 A;  4EUO A;  5I58 A;  2ZMB A;  3LR1 A;  4N07 A;  1MY0 A;  2HFB A;  4C0R A;  3VXB A;  3ZKK A;  2WEF A;  1MQG A;  4OAN A;  2PX1 A;  2Z22 A;  4BDQ A;  2M8C A;  4XTC Q;  4RA1 A;  3C33 A;  5J16 A;  4MMP A;  2UVJ A;  4DDD A;  4ISU A;  3BIH A;  1RDX A;  3OXN A;  3PUY E;  4JWX A;  4KXP A;  3QIM A;  4H1X A;  4Q0C A;  3B6Q A;  3K4U A;  2UYF A;  3R6U A;  3RY3 A;  5I57 B;  1EZP A;  4PAK A;  1POY 1;  1LGB C;  2HAV A;  5AA2 D;  4ZED A;  3ZKL A;  4R72 A;  3OEL A;  3S4U A;  4TQU Q;  1B46 A;  4M4G A;  3MBP A;  4OA4 A;  4KFQ A;  1D9V A;  4N4U A;  4OVS A;  2RC8 A;  3UA8 A;  4GBW A;  5A5L A;  4H5F A;  4F3S A;  4XF5 A;  2DVC A;  3EHS A;  4JVC A;  4ZS9 A;  1TWY A;  3IOW A;  1GVC A;  4GF8 A;  4OQO A;  4RPN A;  4LZ8 A; 
#chains in the Genus database with same CATH homology
 4QBA A;  5EQA A;  3SZP A;  2ZZW A;  2L5V A;  2FIE A;  4O8M A;  1INP A;  2WYP A;  4PF8 A;  4O7M A;  2F5X A;  5I3S A;  5IZ3 B;  2HXR A;  3IFC A;  1NV5 A;  1FPL A;  2FVZ A;  5ET8 A;  4JVD A;  2DE3 A;  4XEQ A;  3FXB A;  2HHM A;  1FPI A;  2KR0 A;  5ESY A;  4N81 A;  4OVP A;  4PTK A;  2HZK A;  1FRP A;  1FJ6 A;  2WBB A;  2DVZ A;  4X9T A;  4IR8 A;  2Q74 A;  3BIG A;  1LBY A;  4PC9 A;  5LTC A;  1YYZ A;  1DBZ A;  3T1B A;  4H45 A;  3ISP A;  2XWV A;  1NV1 A;  1IMA A;  3RYD A;  4F18 A;  4GBV A;  4P1E A;  5ET5 A;  5ET6 A;  2XWI A;  3QMF A;  4MNP A;  5IZ1 A;  4PFB A;  2PFY A;  1NV4 A;  5J1D A;  1FBP A;  4N8G A;  3E78 A;  2HPG A;  1RDY A;  1NUX A;  4F19 A;  1RDZ A;  1IMC A;  5LDZ A;  5I7I A;  5IM2 A;  3T0J A;  3CHG A;  1IME A;  5IZ3 A;  4YZZ A;  3U65 A;  4MHF A;  3A29 A;  5EQ9 A;  2FHY A;  3GYY A;  4G61 A;  5EQ7 A;  4GWZ A;  2BJI A;  4H46 A;  4GWY A;  2WBD A;  1NI9 A;  1KZ8 A;  4NQ8 A;  3LUZ A;  4PAI A;  2CZK A;  2R8T A;  5T3J A;  4NG7 A;  4GWW A;  2CZI A;  4I3Y A;  2DE4 A;  4NN3 A;  4N8Y A;  2ZZX A;  2B4L A;  1FPK A;  3HFU A;  5IZZ A;  2GQ1 A;  1NUY A;  2MKZ A;  1YXI A;  4OVT A;  1G0I A;  4NHB A;  4AS4 A;  5FBP A;  4HE1 A;  1LBZ A;  4XFE A;  1K9Z A;  3RPL B;  1NV0 A;  4GX6 A;  4I40 A;  2HZL A;  2Y5L A;  1FBF A;  1NV7 A;  1JP4 A;  4PBQ A;  4MJO A;  2OX3 A;  1LBX A;  4UAB A;  2V4C A;  2WX9 A;  1FSA A;  1FPF A;  4PFI A;  2XWO A;  4P1L A;  2FIX A;  4GWX A;  2DE2 A;  1FBG A;  4I3E A;  3KBZ A;  1LEV A;  2PFZ A;  2V3Q A;  4GWS A;  1QGX A;  4DI4 B;  1EYI A;  4O94 A;  4X8R A;  2Q8M A;  1FPB A;  5EYH A;  1VDW A;  2QFL A;  1FBH A;  3ROJ A;  5IGA A;  4OVQ A;  1IMF A;  4MX6 A;  1NUW A;  1FPE A;  4P9K A;  2F3D A;  2PCR A;  3W9V A;  5F24 A;  4MEV A;  2CEX A;  2QVU A;  4PBH A;  3B50 A;  2Y5K A;  4PET A;  4PF6 A;  2VPN A;  4PGN A;  4P56 A;  1FTA A;  4F1V A;  4GX3 A;  5ET7 A;  2B4M A;  2QVR A;  4P8B A;  4GX4 A;  4HCY A;  2JJK A;  1FBC A;  2VT5 A;  4P47 A;  1KA0 A;  3PTY A;  1BK4 A;  4PCD A;  1CNQ A;  5I5P A;  2QVV A;  4MIJ A;  1FBE A;  5EQ8 A;  1NV2 A;  4MCO A;  4O7I A;  4MNC A;  4PGP A;  1FBD A;  2F3B A;  1NV3 A;  1Q9D A;  4F1U A;  4M1V A;  1FPD A;  4PDD A;  4N6D A;  4HXV A;  4PE3 A;  1K9Y A;  1XI6 A;  2CZH A;  3KC1 A;  4HE0 A;  4NAP A;  1IMD A;  3E79 A;  4LN5 A;  3D1R A;  1AWB A;  1EYK A;  1NV6 A;  5CM6 A;  1DK4 A;  1LBV A;  2P3V A;  4PDH A;  1FJ9 A;  1DCU A;  2XXK A;  2QPQ A;  3LV0 A;  4DI3 D;  4HCW A;  5JK4 A;  4GWU A;  4X04 A;  1FPJ A;  4NF0 A;  4HE2 A;  2XWK A;  4PFR A;  4N15 A;  3EKI A;  2FBP A;  4AS5 A;  4FBP A;  1EYJ A;  4NGU A;  2KQZ A;  3W9W A;  1NUZ A;  2WEF A;  4P3L A;  4OAN A;  3MST A;  3B8B A;  1KA1 A;  1D9Q A;  5J16 A;  4MMP A;  3BIH A;  1RDX A;  4KXP A;  2OWZ A;  3MYU A;  5EYG A;  4N91 A;  1LBW A;  2ZZV A;  3NOH A;  4QXD A;  4MAG A;  4PAK A;  1SPI A;  4YIC A;  1G0H A;  2XA5 A;  3RPL A;  5DW8 A;  4JVI A;  1IMB A;  2Q9T A;  4MNI A;  1FPG A;  4OA4 A;  1YZ0 A;  2WYK A;  2P3N A;  4N4U A;  3IFA A;  4OVS A;  4OVR A;  3KC0 A;  4PAF A;  2DDK A;  4NX1 A;  4GBW A;  5A5L A;  4XF5 A;  3FBP A;  4JVC A;  2CEY A;  4N6K A;  4N17 A;  2VPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...