4PBQA

Crystal structure of a trap periplasmic solute binding protein from haemophilus influenzae rdaw (hicg_00826, target efi-510123) with bound l-gulonate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
KTIIKLGHYNSDIHPSHIALQEYFKKTIENETNHKYEIRLYPNNQLGGEDQIVNGLRNGTIEAGITGLLLQNVDPIFGVWEWPYLFKDNQEAKKVLESPIANKIGQKMEKYGIKLLAYGMNGFRVISSNKKLEKFDDFKGLRLRVPLNSLFVDWAKAMNINPQSMPLSEVFTALEQKVIDGQENPYMLIKDSGLYEVQKYIIQSNHIFSPGLLQISLKTWNKIPKEDQIIFEKAAKLYQEKEWELAIKTELEVKDYLAKHGNEIIVPSEAFKNDMVNASKVLYDSFYKKYDWAKDVVQKINEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TRAP PERIPLASMIC SOLUTE BINDING PROTEIN
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Solute-binding protein
total genus 103
structure length 304
sequence length 304
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pbqA00
4PDHA 2V4CA 4PE3A 4PBQA 2PFYA 4PBHA 4N17A 4P8BA 4PC9A 5CM6A 4O7MA 4NF0A 4N6KA 2ZZWA 4MX6A 4O8MA 4LN5A 4O94A 3B50A 4MAGA 4XF5A 4P1EA 4PAIA 4PF6A 4N4UA 5IZZA 4NQ8A 4DI3D 2XWIA 5IGAA 2XWKA 2HPGA 2ZZXA 4DI4B 4OVQA 4OVPA 2WYPA 2XWOA 2CEXA 5I7IA 4P56A 4X04A 4P3LA 4X8RA 2HZLA 4PGNA 2VPNA 4PF8A 4PDDA 4XEQA 4PFIA 4N8GA 4NX1A 4PFRA 4MNIA 4PETA 4P47A 4MNPA 2XXKA 4MCOA 4P1LA 4MHFA 4NHBA 4OVTA 4PCDA 2HZKA 4MEVA 2PFZA 2CEYA 3U65A 4OA4A 3FXBA 4PGPA 4NAPA 4N91A 4MIJA 2XA5A 4N8YA 4PAKA 4NN3A 4NG7A 4NGUA 4XFEA 4PAFA 5LTCA 5IM2A 2ZZVA 4YZZA 4PFBA 4YICA 2WYKA 4N15A 4OANA 4UABA 4MMPA 5I5PA 2XWVA 4MNCA 2WX9A 4OVRA 4P9KA 2VPOA 4OVSA 3GYYA 4N6DA
chains in the Genus database with same CATH superfamily
3ZSFA 2CZKA 2DVZA 4P11A 3A3CA 1TXFA 3O2AA 1P1QA 4XKRA 5HPQA 2DWAA 1XVYA 4RNSA 4OFJA 3ILUB 1EZ9A 1H43A 1FQFA 3B50A 1FBGA 1CE2A 4H8IA 4FIMA 4RK9A 4E0XA 2VOZA 5IZZA 1T0KA 2D5WA 5M2VA 2XWIA 5I57A 4PQJA 4O3CA 1MPBA 3CSBA 1BLFA 5I7IA 2REGA 5CMBA 2HAUA 3OEMA 2O51A 2OK2A 3ZKLA 5J16A 3G3JA 4G8MA 2OWTA 3O9PA 1UTBB 4ESXA 4GFRA 3VV5A 2Y7WA 2QPQA 1OMPA 1AMFA 3BFUA 2B3FA 3CG3A 5B7DA 4MLVA 1NUYA 1QVSA 1B46A 2BJJX 1M5CA 1WODA 4IO4A 5L9MA 5TPAA 2A5TB 3K01A 1LBZA 2QVVA 1IXGA 4DLDA 1OQGA 2DSFA 1HSJA 3EQ1A 3TCHA 4NF8A 3S9MC 1JW5A 1MXYA 1F9BA 3K1NA 1IXCA 4HCWA 1FTAA 3EHSA 3HN0A 4OVSA 1B05A 4EXLA 3G7WA 4PDHA 5EYFA 3SEVA 1B9JA 4GWWA 2F35A 4KXPA 4GQOA 4ZEKA 2VD2A 1ZLQA 1FQCA 2PT2A 1MG1A 4OTEA 1DPEA 2M8CA 4QFLA 4G68C 3MVYA 4XXUA 1SI1A 2Q9TA 4GD5A 3EF7A 4KI0E 1US5A 2PBWA 4GIZA 2XWKA 2QJEA 1ZMGA 2W7YA 4U1ZA 5AA3A 3MJNA 3W9WA 4P3LA 1SPIA 4X8RA 4MJOA 4X48A 4ESWA 1RDZA 1N7WA 2DXYA 3FUZA 2VD3A 1GV8A 4OWDA 3EKIA 1O63A 4GWOA 4KQPA 3HPIA 4QBAA 1FTLA 5KDTA 1LFHA 2G29A 4NF4B 3DLNA 1R9LA 4TQUQ 4G68B 3C4MA 1QUJA 4MIJA 4HS7A 1IMEA 4F18A 3RLFE 2R9JA 5DT6A 2GRVA 5FBPA 5ICTA 4DXCA 2ONKE 1B0HA 2A5TA 2QS1A 2CZLA 5IZ1A 3TCGA 1MQHA 1HSEA 2VPOA 1SYHA 3M3LA 3IFAA 3K6XA 3F11A 2ZMBA 3OSRA 3H4ZA 4KCCA 5J1DA 2OJTA 2XXXA 2OWZA 3O97A 4ZDMA 3K0VA 1MH3A 3T9VA 3MC2A 3ECRA 4XF5A 2F7CA 3KOSA 1IMBA 4PF6A 3AXFA 2O84X 2X7QA 5DYHA 3V89B 4C0RA 1MY2A 5KZTA 4G2ZA 5I2KA 3IB0A 3LUZA 4H65A 1A7LA 3T93B 3K6WA 2D21A 1FPEA 2X7PA 3FXUA 2AYSA 1PB8A 4BDNA 4TOZA 3E78A 2H9BA 1YPNA 1SYIA 4RPNA 4UACA 1FBFA 1SBPA 1B3HA 5H8FB 4NX1A 1QUIA 3A3UA 2ONRA 2O69A 3O66A 3JZJA 3ONMA 4LATA 2V3UA 1MM6A 1EZPA 3K6VA 1FTJA 1VR5A 2V3QA 2XXPA 2O6AA 1S7YA 4NAPA 3B6QA 3TPAA 4NWCA 4U4XA 1MQJA 3DP6A 2XXWA 3E9XA 3UN6A 5FTIA 3PD8A 4UABA 4RYAA 2KR0A 4AS4A 1FPDA 1NH8A 4JSDA 2WBDA 3VVDA 5KCJB 2L5VA 4IO2A 2YPNA 1UTHA 3IL1B 2UXAA 5I84A 4R73A 3ILTB 4NTLA 3FBPA 2VT5A 3UGWA 2GFEA 3OD7A 2F6PA 4XIGQ 5H8HA 3H03A 3Q28A 2H4IA 3G3FA 3FZVA 1VE4A 5EQ7A 1II5A 3BFTA 1MY3A 4AS5A 2P2AA 4GRKA 2BJIA 2HPGA 2QVUA 1FW0A 4FEDA 2HCAA 3TELA 2ZNTA 2CEXA 3V8XB 4LONB 2B4LA 5JK4A 2THIA 2PT1A 3G3HA 2FBPA 2VPNA 5ITPA 1Y4TA 1DPPA 1POTA 3RTFB 4PFRA 4ELPA 4R6YA 4DCYA 5ET7A 1SW4A 1OLCA 1D9QA 4OVTA 4PCDA 4TLMB 3H7MA 1MXWA 4U22A 2ZYKA 2AL4A 1MPCA 5ET8A 5H8FA 5I3SA 3TTKA 1AH5A 3VVEA 3CIJA 4PAFA 1LB8A 2HAVA 1YZ0A 4PFBA 3CVGA 4E0WA 4NF5B 2I4BA 3USDA 3PGFA 3PUXE 4ND9A 4MMPA 3LR1A 1PEBA 4WKMA 2ZNUA 3FIRA 3EN3A 3PPQA 3SDFA 1H3DA 4LQ2A 1LBXA 5AA2A 1D9YA 1FTKA 5I59A 4MFIA 2Z22A 3FV1A 4ISUA 3IB1A 4DIGA 2VHAA 1B58A 2XX8A 3RUMA 2Z8EA 2FIEA 4Z7EA 1JETA 2ZZWA 5JTYA 4BDQA 2DWIA 4L17A 2UVJA 2F97A 4F19A 1A8EA 3PV0E 3TEPA 2FYIA 3K2DA 1B5JA 3FGSA 3QK6A 3KG2A 4IGTA 5IGAA 3BIGA 2OWSA 2DQVA 4QSDA 1GR2A 3K1PA 2QS4A 4FBPA 4EDPA 3M3FA 4EXKA 5I57B 1FTOA 1DOTA 2DE2A 3C32A 4THIA 4Z0IA 1SD3A 5LOMA 4QFPA 1S50A 2OCUA 3O6IA 5AA2D 4PDDA 2F7BA 5EHSA 2UYFA 3S9NC 3SETA 4XKPA 3R6UA 4LZ5A 5DVIA 4YKJA 4JVIA 2XXKA 1RYXA 4ONYA 2XXYA 1Y3QA 2Z23A 4GF8A 4P1LA 3KN3A 1M5FA 4N6PA 2I4CA 1YCJA 3VFJA 5TPAB 4NG7A 5LTCA 3CFXA 3PMXA 3FD3A 4ELQA 4F1UA 1B3EA 1LB9A 3QMFA 4PFTA 5I5PA 2XWVA 1NNTA 1B5HA 4NF8B 1D4NA 3IFCA 1MQIA 4N6DA 1D9VA 3RGYA 3TQLA 1Y3NA 4YKKA 3S2VA 2HXWA 4R6KA 3IB2A 3JV9A 3DP4A 4I3EA 3TODA 3Q25A 2IEEA 2ZNSA 3OELA 4EUOA 4O94A 4H0WA 1ZBMA 3IX1A 3MBPA 4OESA 1IXIA 1YAEA 4IGRA 4GWUA 5EYHA 4R9FA 1URDA 2XD2A 1FBHA 1NV0A 4GX4A 1N76A 3E13X 1HSLA 4POWA 1INPA 4BDLA 3QYTA 4PGNA 1FSAA 3KN7A 1IUDA 5DVJA 3VLUA 3VXCA 4MNIA 4U1OA 3KFMA 1QUKA 3R26A 3OO9A 3I3VA 4NHBA 4EF1A 5H8NA 2QL3A 4GBVA 3S4UA 1KA0A 4R74A 4M4GA 1NUZA 3Q27A 2WEFA 3QAXA 4I1DA 1S9TA 4O3BA 4N91A 4PFWA 3QSLA 5KDTB 4H1XA 3C9HA 3EPEA 4YB6A 5ITOA 4PE5B 3MWBA 3PUVE 4F22A 2QSXA 1Q35A 5F24A 4X1BA 5F7VA 4OANA 4R75A 2KLFA 2CMOA 3GBAA 2JJKA 2R71A 3TZAA 3FVKA 4MX6A 1AOVA 1EYKA 3H6TA 3IOVA 3N5LA 3KZGA 4LZ8A 2Y84A 4PBHA 4ZEDA 3DP8A 2B4MA 1OIBA 2NVUB 2Q8JA 2ALUA 2HFBA 5EQ8A 1LBYA 4KHZE 4MBPA 4O7MA 4IR8A 3FATA 2OX3A 3MYUA 4GX6A 5CMKA 3OXNA 4G8HA 1J1NA 2QMXA 3KC1A 4XKQA 3KGCA 2ZZXA 4OVQA 4U4SA 2WYPA 3Q26A 2Y5LA 3IOTA 2Q74A 3EHTA 4YB5A 5CI5A 4RY1A 3N6TA 5I2KB 1FPFA 1B3GA 4R2FA 3M8UA 1P1UA 4ZEFA 1NNKA 3TQWA 5DEXA 1SW1A 3SZPA 4JWXA 1CNQA 3OO6A 5IZ3B 2ESNA 1O7TA 3G3KA 2IA4A 4F3SA 2RC9A 4KFQA 1XHYA 2PFZA 5I2NA 4O3AA 4KPTA 1NNFA 2XA5A 1M5BA 4PAKA 3VDFA 4XFEA 1LCFA 1ZJLA 3IJXB 4DCXA 1B40A 4QHQA 4G8NA 1FPBA 2RC7A 2DDKA 4H6DA 5EQAA 3KBZA 4PP0A 3SESA 4RPOA 3V5AA 5DW8A 3C36A 3PUZE 4YKPA 3RTWB 3M3KA 5EYGA 3WAEA 1XS5A 1IIWA 2RC8A 1LFIA 1CB6A 3CRBA 4IY5A 1MQGA 4OERA 1UTHB 1OQHA 4YMAA 4ZE9A 3D1RA 1TT1A 4JVCA 3TMGA 5H8HB 3TAJA 3B7DA 2QS2A 3PMVA 3PU5A 1N3XA 3PD9A 2KQZA 2Q89A 1FQBA 3IR1A 1USYH 3O29A 1G0HA 3OMBA 3T9XB 4F3GA 3MP8A 4NWDA 5AA4A 2Y7RA 3T66A 2DP8A 2XXVA 4AB6A 3S9EA 3PPRA 4MCOA 4OETA 2LAOA 5LDZA 1VFEA 2NOOA 4MEVA 4GWYA 2XXUA 3TUSA 5FHMA 5IZ3A 4IO7A 4RXLA 4OFOA 1FPKA 2ZZVA 3O6GA 5HBCA 1Z7NE 1TWYA 1B51A 1B1XA 2OLBA 4MNCA 2WX9A 2VP1A 1MY4A 1I6AA 3TTMA 3A29A 4LP2B 4OEUA 1MM7A 4P0GA 3HV1A 2V4CA 1NUXA 1B4ZA 3ISPA 1Y20A 3MZ9A 5AA2B 5I59B 3VE1B 4N17A 3TTRA 1JW4A 4JVDA 4PC9A 2H99A 4QFNA 3W15C 4MAGA 4I40A 4POXA 1LBCA 4BDRA 1B7HA 4H5GA 3OO7A 3MP6A 5JTYB 4WXJA 2DE4A 3WAFA 4XKNA 4OQOA 1EYIA 4OVPA 2I0BA 3T9UA 1FRPA 3KEIA 4X04A 4F31B 1FQAA 3QUFA 1SVXB 3LSXA 3I5OA 3GXAA 1NMUA 2O1LA 4I3YA 5FTHA 2DS9A 3H6WA 4HE1A 4ZZEA 1UIUA 3FXQA 3SEXA 1B7UA 4PFIA 4F3PA 2XXRA 4P47A 5A5XA 5F1QA 3SERA 1A40A 4EF2A 3CHGA 1LEVA 1N3WA 1NUWA 3U65A 3FVOA 3IORA 3ODBA 4P0IA 4PGPA 2FHYA 1IQ7A 2V84A 1GTKA 4OENA 4YZZA 5EHMA 2Z8DA 1FJ9A 1R9QA 3UP9A 3C33A 1AIVA 1BP5A 1IITA 2GHBA 1Q1KA 5DTBA 3OENA 3RNNA 3VLVA 2MKZA 3CG1A 2PX1A 1AWBA 4N13A 2GHAA 2F6GA 1XI6A 1SW2A 4X1DA 4IO5A 4GX3A 2ZXTA 2PVUA 4F1VA 2F7AA 1YTVA 5I56A 1A54A 1USYE 3RT8A 3IK6B 4JDFA 4KYDA 2OZZA 5FHNA 3RPLA 1JNFA 2XWOA 4N07A 3PTYA 2F8DA 2I3VA 1B5IA 3MPKA 3MQ9A 4ZEBA 3VVFA 4I9DA 5L8DA 4PFUA 3K02A 4NF6A 1Z7ME 3T1BA 2B65A 2GQ1A 1I6QA 2CZIA 2I58A 3PUWE 1NV5A 4PETA 2HEUA 3MP1A 2FA7A 1PBQA 4F39A 1L5TA 1NKXA 4K3FA 2WBBA 1FQDA 3MVXA 4ZE8A 1LBBA 4JXIA 5I58A 4OA4A 5AE4A 2D3IA 3TDJA 5H8NB 1EZOA 1IMDA 1QKBA 3D4CA 1MXUA 3C35A 5L9OA 2Q88A 4MLQA 3VLWA 2RF1A 3BBRA 4MH5A 4DXUA 3DELB 3TTLA 2ZYNA 1N84A 4JB7A 4GWXA 4ECFA 3FVGA 2XHDA 3B8BA 2DWHA 2Q8MA 5ET5A 3H6VA 1RYOA 1H44A 1NV1A 5IAIA 2PFYA 1MY0A 1MRPA 5BWJA 2PYYA 3KN8A 1D3KA 3MSTA 3FJGA 3D4GA 1IMAA 4N4UA 4H8JA 4NQ8A 4H45A 4JSOA 1KWHA 4G4PA 1N04A 4FJPA 3LC8A 4YB7A 5CC2A 1NV2A 2Y7KA 4P56A 5CBSA 4GOTA 3LSLA 4R9GA 4O7IA 5JEIA 4KYSA 3K6UA 4KD5A 5TP9A 5TU0A 4HE2A 1M5EA 4ZZAA 3OOAA 3C34A 3KSXA 4G61A 1N7XA 5DEXB 3THIA 3MUQA 5ICQA 1DTGA 3JYRA 4MHFA 2P3NA 1OLAA 1LAXA 1Y4CA 3ZS6A 4BDMA 1YYZA 1I69A 3T22A 1ATGA 2F34A 3KBRA 4N8YA 3KJ7A 1H45A 3HFUA 2YJPA 5I2NB 3MAMA 4RJZA 1JVYA 1POY1 4U23A 4DXBA 3MW0A 1ZIUA 2XXTA 4HE0A 3KOTA 4WEPA 5H8SA 4F2QA 3GYYA 2G93A 1FBPA 1DTZA 5CRYA 5ISUA 1B4HA 2ONSA 3UA8A 4ELOA 4KCDA 2Y7PA 4PE3A 4YU0A 3N94A 1DSNA 1LAFE 1JW1A 1OVBA 1DCUA 5B70A 4BLAA 1B7ZA 2XX9A 3S9LC 1MXZA 4DI4B 3SEWA 4QF9A 3FVNA 1YXIA 2OBGA 3HCQA 1JEVA 3IJOB 1EU8A 4I8CA 1B32A 1KZ8A 4OHNA 4QFKA 4KYEA 4F1YA 4H46A 4DE8A 3PUYE 1B3FA 3IO4A 3FV2A 1NFTA 3LBSA 4XEQA 2V93A 4NMYA 1P1WA 4GBWA 4LZ7A 5AA4B 1VDWA 3KSJA 1QJMA 2H98A 2P1SA 2HZKA 1K9ZA 4G77A 4U21A 1B0LA 1SI0A 3MVZA 3QXMA 1FTMA 3T96B 5CMMA 4LQ5A 1PB7A 3G3IA 3E79A 2R6GE 1LBVA 4LUBA 2ANJA 3RY3A 1AL3A 2WYKA 3CR9A 4PTKA 2AL5A 4FE8A 4ELRA 4OFLA 2UVHA 3IO6A 4IO3A 3DM0A 4P9KA 1JQFA 1SW5A 1FPLA 1TFAA 1P99A 2Y5KA 1LAHE 4YKIA 1EYJA 2QVRA 2DE3A 3I6VA 5ET6A 1BK4A 2DOJA 2PMSA 1B3LA 4PBQA 1FPIA 2YLNA 1IEJA 3IOWA 1Q9DA 1R6ZA 4EQ7A 2R8TA 2RKMA 2UVIA 1O64A 5CM6A 1LAGE 3SEUA 1BIYA 1MS7A 4JWYA 4GL8A 4P1EA 4PAIA 2VGQA 3Q29A 2PCRA 1RDXA 4DI3D 1FQEA 4GXAA 1B6HA 1MPDA 3BIHA 1FPGA 3KC0A 3H6UA 4EQBA 4FAJA 1M5DA 1NV4A 3PMWA 4H5FA 1UTBA 3FASA 2HZLA 3IOUA 2O68A 3T9HB 3N26A 3PPNA 4GL0A 2HHMA 4IB2A 1EH3A 2I0CA 4C1UA 3EHUA 1XVXA 1NH7A 1OVTA 2XD3A 4QRZA 1PB9A 2Q2AA 1R1NA 4OVJA 1ANFA 2CEYA 3SEYA 5A5XB 1ELJA 5K2YA 3U94A 1WDNA 1JEUA 2QFLA 3TYHA 2RINA 5A5LA 4TLLB 2REJA 3IAZA 4YICA 1UIVA 3SKPA 1Y3PA 2Y7IA 2XXIA 1H76A 4UA8A 1XT8A 2V25A 3L6HA 4DDDA 1P1NA 3K1MA 4FATA 1FPJA 1DMBA 2E1SA 3HHGA 3HHFA 4RA1A 4Q0CA 3ROJA 3MPLA 2DYXA 2I48A 4OXVA 3E3KA 4MF3A 1LBWA 1G0IA 3K00A 4N6KA 3B6WA 2RCAA 3U93A 4LN5A 5BUUA 4F3BA 3FJMA 2QS3A 1NV3A 1TFDA 4FECA 1JP4A 3FJ7A 2ABHA 2AIXA 4M1VA 1MXXA 2O1MA 1QULA 5I56B 1PBPA 1GVCA 5H8QB 1IXHA 3RPWA 3RPLB 4F2OA 2P0SA 3NOHA 4PF8A 2QRYA 4DZ1A 3L6GA 4LA9A 4NF6B 1QGXA 1PDAA 3T0JA 2HXRA 4JWOA 2QMWA 4MNPA 1VFDA 3MZ1A 4NF4A 5T3JA 2F3DA 4G68A 2NUVA 3O6HA 4HCYA 3RT6B 3OEKA 4R72A 2Q2CA 4QFOA 4NEDA 3P7IA 1LFGA 3LSFB 4GWZA 4NN3A 1SQYA 2DXRA 5I58B 1IZ1A 2UYEA 1KA1A 4OZ9A 4HW8A 1IMFA 4Q8RA 1URGA 4OEVA 3CFZA 1A99A 1I6BA 4N15A 2F3BA 3B6TA 1QW0A 2HQ0A 4C1TA 1FJ6A 1NL5A 2I6EA 4GWSA 4YMBA 1FBEA 3RN8A 1Y9UA 1N0TA 1RKMA 4R6HA 1LCTA 2DWJA 2WKYA 4P8BA 4R2BA 4ZS9A 4NF0A 1B52A 3E4RA 4O8MA 1NV6A 3LUYA 4F29A 2X26A 2O7UA 2A5SA 1GGGA 1IMCA 1LLSA 4I62A 3TFLA 2DVCA 3GBBA 4AB5A 4GVOA 4HTGA 3N6UA 3ZKKA 2CZHA 5CBRA 1NV7A 3G3GA 2E0SA 3K4UA 1BKAA 3KJTA 2P3VA 3CSGA 3HSTA 4EQ9A 1URSA 4N8GA 2F5XA 4BDOA 5H8QA 4RK2A 2H5YA 5TP9B 4YAHX 1NI9A 5DVFA 3GLBA 3U92A 5EQ9A 1P1OA 3VXBA 2Z8FA 3H06B 4FORA 2NXOA 4ZEIA 4IY6A 2UVGA 3UORA 1FBDA 3FXBA 2O7IA 4IO6A 4Q30B 1DBZA 1LSTA 3A09A 2ZYMA 4Q5TA 2F36A 3MVWA 5IKBA 5KCJA 5AA1A 1MDP1 1MY1A 4WEDA 4N81A 1A55A 2GH9A 3CFLA 1DK4A 1FCKA 4GLIA 2FNCA 3RYDA 3W9VA 1WVJA 1XOCA 4AQ4A 1ZTYA 4X9TA 2B3BA 2XX7A 2I49A 3HO7A 2XXHA 5K2XA 4PFYA 1A8FA 3OSQA 3BKIB 3LV0A 1LGBC 3CI8A 3GZGA 5ESYA 1B1HA 3V83A 4JBZA 5ELVA 3O28A 4ZECA 1Y1MA 1ZU0A 3QUJA 1US4A 4HXVA 3LSWA 4QSEA 1MXVA 3C31A 4GXSB 1B2HA 2V3TA 1QKAA 1NNPA 1VSOA 1ZKBA 2H25A 1JVXA 5FHOA 5HM4B 3PPOA 4OMBA 4OYVA 2XXQA 3TTNA 1SDXA 1UQWA 4U2RA 3QIMA 4QSCA 1K9YA 2RCBA 4KR5A 4FEBA 1PC3A 3RQTA 3U8QA 4XTCQ 1XC1A 3FXRA 3UIFA 3TCFA 1MQDA 5L9SA 4NGUA 3MZBA 4NF5A 2NWJA 3U1OA 5IM2A 3TKDA 3U72A 1MDQA 3R7XA 1MH4A 4QXDA 4H67A 3OO8A 1RDYA 4NE4A 2ZYOA 4LVQA 1FBCA 2FVZA 2I3WA 3PPPA 1Y1ZA 2F78A 4OVRA 3H3GA 3UK4A 2FIXA 5CMCA 1BTJA
chains in the Genus database with same CATH topology
2Y5KA 1FPLA 3A29A 2CZKA 1EYJA 2QVRA 2DE3A 5ET6A 1BK4A 2DVZA 2V4CA 1NUXA 3ISPA 4PBQA 1FPIA 4N17A 1Q9DA 4JVDA 4PC9A 2R8TA 2FIEA 5CM6A 2ZZWA 3B50A 4MAGA 1FBGA 4F19A 4P1EA 4PAIA 4I40A 2DE4A 5IZZA 2PCRA 1RDXA 4DI3D 2XWIA 5IGAA 3BIGA 1EYIA 4OVPA 3BIHA 1FPGA 4FBPA 5I7IA 3KC0A 2DE2A 1FRPA 4X04A 1NV4A 5J16A 2HZLA 4I3YA 4HE1A 4PDDA 2QPQA 4PFIA 2HHMA 4P47A 4JVIA 1NUYA 2XXKA 4P1LA 3CHGA 2CEYA 1LEVA 1LBZA 2QVVA 1NUWA 3U65A 2QFLA 4PGPA 5A5LA 2FHYA 4NG7A 5LTCA 4YZZA 4YICA 4F1UA 1FJ9A 3QMFA 5I5PA 2XWVA 4HCWA 1FTAA 3IFCA 4OVSA 1FPJA 4N6DA 4PDHA 3ROJA 4GWWA 4KXPA 2MKZA 1AWBA 4I3EA 1LBWA 1G0IA 1XI6A 4N6KA 4GX3A 4LN5A 4O94A 2Q9TA 4F1VA 1NV3A 4GWUA 5EYHA 1JP4A 2XWKA 4M1VA 1FBHA 1NV0A 3RPLA 4GX4A 2XWOA 3PTYA 3W9WA 4P3LA 1SPIA 1INPA 4MJOA 4X8RA 3RPLB 3NOHA 4PGNA 4PF8A 3T1BA 1RDZA 2GQ1A 1FSAA 2CZIA 1QGXA 1NV5A 3T0JA 2HXRA 3EKIA 4MNIA 4PETA 4MNPA 5T3JA 2F3DA 4NHBA 4QBAA 2WBBA 4HCYA 4GBVA 1KA0A 1NUZA 4OA4A 2WEFA 4N91A 4MIJA 1IMEA 1IMDA 4GWZA 4NN3A 4F18A 1KA1A 1IMFA 5FBPA 5F24A 4N15A 2F3BA 5IZ1A 4OANA 1FJ6A 2JJKA 4GWXA 2VPOA 4GWSA 3B8BA 2Q8MA 3IFAA 5ET5A 1FBEA 4MX6A 1EYKA 1NV1A 5J1DA 2PFYA 4PBHA 2OWZA 2B4MA 4P8BA 5EQ8A 1LBYA 4O7MA 4NF0A 4IR8A 2OX3A 3MYUA 4O8MA 1NV6A 4GX6A 4XF5A 3MSTA 1IMBA 1IMAA 4PF6A 1IMCA 4N4UA 4NQ8A 4H45A 3KC1A 2ZZXA 4OVQA 2WYPA 3LUZA 2Y5LA 2Q74A 1NV2A 4P56A 1FPEA 2CZHA 1NV7A 1FPFA 3E78A 4O7IA 2P3VA 3SZPA 4HE2A 1FBFA 1CNQA 4N8GA 2F5XA 4NX1A 5IZ3B 1NI9A 4G61A 5EQ9A 4MHFA 2P3NA 2PFZA 1YYZA 2V3QA 1FBDA 3FXBA 4NAPA 2XA5A 4N8YA 1DBZA 4PAKA 4XFEA 3HFUA 1FPBA 2DDKA 5EQAA 3KBZA 4UABA 2KR0A 4HE0A 1FPDA 4AS4A 4N81A 3GYYA 5DW8A 1FBPA 2WBDA 2L5VA 1DK4A 3RYDA 3W9VA 5EYGA 4X9TA 4PE3A 3FBPA 2VT5A 3LV0A 3D1RA 5ESYA 1DCUA 4JVCA 5EQ7A 4AS5A 2BJIA 2HPGA 2QVUA 4DI4B 1YXIA 4HXVA 2CEXA 2KQZA 2B4LA 5JK4A 2FBPA 1KZ8A 1G0HA 2VPNA 4H46A 4XEQA 4PFRA 4GBWA 1VDWA 4MCOA 5ET7A 5LDZA 1K9YA 1D9QA 4OVTA 4PCDA 2HZKA 4MEVA 4GWYA 1K9ZA 5ET8A 5I3SA 5IZ3A 4NGUA 4PAFA 5IM2A 3E79A 1FPKA 2ZZVA 1LBVA 1YZ0A 4PFBA 2WYKA 4PTKA 4QXDA 1RDYA 1FBCA 2FVZA 4MMPA 4MNCA 2WX9A 4OVRA 4P9KA 2FIXA 1LBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDH A;  2V4C A;  4PE3 A;  4PBQ A;  2PFY A;  4PBH A;  4N17 A;  4P8B A;  4PC9 A;  5CM6 A;  4O7M A;  4NF0 A;  4N6K A;  2ZZW A;  4MX6 A;  4O8M A;  4LN5 A;  4O94 A;  3B50 A;  4MAG A;  4XF5 A;  4P1E A;  4PAI A;  4PF6 A;  4N4U A;  5IZZ A;  4NQ8 A;  4DI3 D;  2XWI A;  5IGA A;  2XWK A;  2HPG A;  2ZZX A;  4DI4 B;  4OVQ A;  4OVP A;  2WYP A;  2XWO A;  2CEX A;  5I7I A;  4P56 A;  4X04 A;  4P3L A;  4X8R A;  2HZL A;  4PGN A;  2VPN A;  4PF8 A;  4PDD A;  4XEQ A;  4PFI A;  4N8G A;  4NX1 A;  4PFR A;  4MNI A;  4PET A;  4P47 A;  4MNP A;  2XXK A;  4MCO A;  4P1L A;  4MHF A;  4NHB A;  4OVT A;  4PCD A;  2HZK A;  4MEV A;  2PFZ A;  2CEY A;  3U65 A;  4OA4 A;  3FXB A;  4PGP A;  4NAP A;  4N91 A;  4MIJ A;  2XA5 A;  4N8Y A;  4PAK A;  4NN3 A;  4NG7 A;  4NGU A;  4XFE A;  4PAF A;  5LTC A;  5IM2 A;  2ZZV A;  4YZZ A;  4PFB A;  4YIC A;  2WYK A;  4N15 A;  4OAN A;  4UAB A;  4MMP A;  5I5P A;  2XWV A;  4MNC A;  2WX9 A;  4OVR A;  4P9K A;  2VPO A;  4OVS A;  3GYY A;  4N6D A; 
#chains in the Genus database with same CATH topology
 3ZSF A;  2CZK A;  2DVZ A;  4P11 A;  3A3C A;  1TXF A;  3O2A A;  1P1Q A;  4XKR A;  5HPQ A;  2DWA A;  1XVY A;  4RNS A;  4OFJ A;  3ILU B;  1EZ9 A;  1H43 A;  1FQF A;  3B50 A;  1FBG A;  1CE2 A;  4H8I A;  4FIM A;  4RK9 A;  4E0X A;  2VOZ A;  5IZZ A;  1T0K A;  2D5W A;  5M2V A;  2XWI A;  5I57 A;  4PQJ A;  4O3C A;  1MPB A;  3CSB A;  1BLF A;  5I7I A;  2REG A;  5CMB A;  2HAU A;  3OEM A;  2O51 A;  2OK2 A;  3ZKL A;  5J16 A;  3G3J A;  4G8M A;  2OWT A;  3O9P A;  1UTB B;  4ESX A;  4GFR A;  3VV5 A;  2Y7W A;  2QPQ A;  1OMP A;  1AMF A;  3BFU A;  2B3F A;  3CG3 A;  5B7D A;  4MLV A;  1NUY A;  1QVS A;  1B46 A;  2BJJ X;  1M5C A;  1WOD A;  4IO4 A;  5L9M A;  5TPA A;  2A5T B;  3K01 A;  1LBZ A;  2QVV A;  1IXG A;  4DLD A;  1OQG A;  2DSF A;  1HSJ A;  3EQ1 A;  3TCH A;  4NF8 A;  3S9M C;  1JW5 A;  1MXY A;  1F9B A;  3K1N A;  1IXC A;  4HCW A;  1FTA A;  3EHS A;  3HN0 A;  4OVS A;  1B05 A;  4EXL A;  3G7W A;  4PDH A;  5EYF A;  3SEV A;  1B9J A;  4GWW A;  2F35 A;  4KXP A;  4GQO A;  4ZEK A;  2VD2 A;  1ZLQ A;  1FQC A;  2PT2 A;  1MG1 A;  4OTE A;  1DPE A;  2M8C A;  4QFL A;  4G68 C;  3MVY A;  4XXU A;  1SI1 A;  2Q9T A;  4GD5 A;  3EF7 A;  4KI0 E;  1US5 A;  2PBW A;  4GIZ A;  2XWK A;  2QJE A;  1ZMG A;  2W7Y A;  4U1Z A;  5AA3 A;  3MJN A;  3W9W A;  4P3L A;  1SPI A;  4X8R A;  4MJO A;  4X48 A;  4ESW A;  1RDZ A;  1N7W A;  2DXY A;  3FUZ A;  2VD3 A;  1GV8 A;  4OWD A;  3EKI A;  1O63 A;  4GWO A;  4KQP A;  3HPI A;  4QBA A;  1FTL A;  5KDT A;  1LFH A;  2G29 A;  4NF4 B;  3DLN A;  1R9L A;  4TQU Q;  4G68 B;  3C4M A;  1QUJ A;  4MIJ A;  4HS7 A;  1IME A;  4F18 A;  3RLF E;  2R9J A;  5DT6 A;  2GRV A;  5FBP A;  5ICT A;  4DXC A;  2ONK E;  1B0H A;  2A5T A;  2QS1 A;  2CZL A;  5IZ1 A;  3TCG A;  1MQH A;  1HSE A;  2VPO A;  1SYH A;  3M3L A;  3IFA A;  3K6X A;  3F11 A;  2ZMB A;  3OSR A;  3H4Z A;  4KCC A;  5J1D A;  2OJT A;  2XXX A;  2OWZ A;  3O97 A;  4ZDM A;  3K0V A;  1MH3 A;  3T9V A;  3MC2 A;  3ECR A;  4XF5 A;  2F7C A;  3KOS A;  1IMB A;  4PF6 A;  3AXF A;  2O84 X;  2X7Q A;  5DYH A;  3V89 B;  4C0R A;  1MY2 A;  5KZT A;  4G2Z A;  5I2K A;  3IB0 A;  3LUZ A;  4H65 A;  1A7L A;  3T93 B;  3K6W A;  2D21 A;  1FPE A;  2X7P A;  3FXU A;  2AYS A;  1PB8 A;  4BDN A;  4TOZ A;  3E78 A;  2H9B A;  1YPN A;  1SYI A;  4RPN A;  4UAC A;  1FBF A;  1SBP A;  1B3H A;  5H8F B;  4NX1 A;  1QUI A;  3A3U A;  2ONR A;  2O69 A;  3O66 A;  3JZJ A;  3ONM A;  4LAT A;  2V3U A;  1MM6 A;  1EZP A;  3K6V A;  1FTJ A;  1VR5 A;  2V3Q A;  2XXP A;  2O6A A;  1S7Y A;  4NAP A;  3B6Q A;  3TPA A;  4NWC A;  4U4X A;  1MQJ A;  3DP6 A;  2XXW A;  3E9X A;  3UN6 A;  5FTI A;  3PD8 A;  4UAB A;  4RYA A;  2KR0 A;  4AS4 A;  1FPD A;  1NH8 A;  4JSD A;  2WBD A;  3VVD A;  5KCJ B;  2L5V A;  4IO2 A;  2YPN A;  1UTH A;  3IL1 B;  2UXA A;  5I84 A;  4R73 A;  3ILT B;  4NTL A;  3FBP A;  2VT5 A;  3UGW A;  2GFE A;  3OD7 A;  2F6P A;  4XIG Q;  5H8H A;  3H03 A;  3Q28 A;  2H4I A;  3G3F A;  3FZV A;  1VE4 A;  5EQ7 A;  1II5 A;  3BFT A;  1MY3 A;  4AS5 A;  2P2A A;  4GRK A;  2BJI A;  2HPG A;  2QVU A;  1FW0 A;  4FED A;  2HCA A;  3TEL A;  2ZNT A;  2CEX A;  3V8X B;  4LON B;  2B4L A;  5JK4 A;  2THI A;  2PT1 A;  3G3H A;  2FBP A;  2VPN A;  5ITP A;  1Y4T A;  1DPP A;  1POT A;  3RTF B;  4PFR A;  4ELP A;  4R6Y A;  4DCY A;  5ET7 A;  1SW4 A;  1OLC A;  1D9Q A;  4OVT A;  4PCD A;  4TLM B;  3H7M A;  1MXW A;  4U22 A;  2ZYK A;  2AL4 A;  1MPC A;  5ET8 A;  5H8F A;  5I3S A;  3TTK A;  1AH5 A;  3VVE A;  3CIJ A;  4PAF A;  1LB8 A;  2HAV A;  1YZ0 A;  4PFB A;  3CVG A;  4E0W A;  4NF5 B;  2I4B A;  3USD A;  3PGF A;  3PUX E;  4ND9 A;  4MMP A;  3LR1 A;  1PEB A;  4WKM A;  2ZNU A;  3FIR A;  3EN3 A;  3PPQ A;  3SDF A;  1H3D A;  4LQ2 A;  1LBX A;  5AA2 A;  1D9Y A;  1FTK A;  5I59 A;  4MFI A;  2Z22 A;  3FV1 A;  4ISU A;  3IB1 A;  4DIG A;  2VHA A;  1B58 A;  2XX8 A;  3RUM A;  2Z8E A;  2FIE A;  4Z7E A;  1JET A;  2ZZW A;  5JTY A;  4BDQ A;  2DWI A;  4L17 A;  2UVJ A;  2F97 A;  4F19 A;  1A8E A;  3PV0 E;  3TEP A;  2FYI A;  3K2D A;  1B5J A;  3FGS A;  3QK6 A;  3KG2 A;  4IGT A;  5IGA A;  3BIG A;  2OWS A;  2DQV A;  4QSD A;  1GR2 A;  3K1P A;  2QS4 A;  4FBP A;  4EDP A;  3M3F A;  4EXK A;  5I57 B;  1FTO A;  1DOT A;  2DE2 A;  3C32 A;  4THI A;  4Z0I A;  1SD3 A;  5LOM A;  4QFP A;  1S50 A;  2OCU A;  3O6I A;  5AA2 D;  4PDD A;  2F7B A;  5EHS A;  2UYF A;  3S9N C;  3SET A;  4XKP A;  3R6U A;  4LZ5 A;  5DVI A;  4YKJ A;  4JVI A;  2XXK A;  1RYX A;  4ONY A;  2XXY A;  1Y3Q A;  2Z23 A;  4GF8 A;  4P1L A;  3KN3 A;  1M5F A;  4N6P A;  2I4C A;  1YCJ A;  3VFJ A;  5TPA B;  4NG7 A;  5LTC A;  3CFX A;  3PMX A;  3FD3 A;  4ELQ A;  4F1U A;  1B3E A;  1LB9 A;  3QMF A;  4PFT A;  5I5P A;  2XWV A;  1NNT A;  1B5H A;  4NF8 B;  1D4N A;  3IFC A;  1MQI A;  4N6D A;  1D9V A;  3RGY A;  3TQL A;  1Y3N A;  4YKK A;  3S2V A;  2HXW A;  4R6K A;  3IB2 A;  3JV9 A;  3DP4 A;  4I3E A;  3TOD A;  3Q25 A;  2IEE A;  2ZNS A;  3OEL A;  4EUO A;  4O94 A;  4H0W A;  1ZBM A;  3IX1 A;  3MBP A;  4OES A;  1IXI A;  1YAE A;  4IGR A;  4GWU A;  5EYH A;  4R9F A;  1URD A;  2XD2 A;  1FBH A;  1NV0 A;  4GX4 A;  1N76 A;  3E13 X;  1HSL A;  4POW A;  1INP A;  4BDL A;  3QYT A;  4PGN A;  1FSA A;  3KN7 A;  1IUD A;  5DVJ A;  3VLU A;  3VXC A;  4MNI A;  4U1O A;  3KFM A;  1QUK A;  3R26 A;  3OO9 A;  3I3V A;  4NHB A;  4EF1 A;  5H8N A;  2QL3 A;  4GBV A;  3S4U A;  1KA0 A;  4R74 A;  4M4G A;  1NUZ A;  3Q27 A;  2WEF A;  3QAX A;  4I1D A;  1S9T A;  4O3B A;  4N91 A;  4PFW A;  3QSL A;  5KDT B;  4H1X A;  3C9H A;  3EPE A;  4YB6 A;  5ITO A;  4PE5 B;  3MWB A;  3PUV E;  4F22 A;  2QSX A;  1Q35 A;  5F24 A;  4X1B A;  5F7V A;  4OAN A;  4R75 A;  2KLF A;  2CMO A;  3GBA A;  2JJK A;  2R71 A;  3TZA A;  3FVK A;  4MX6 A;  1AOV A;  1EYK A;  3H6T A;  3IOV A;  3N5L A;  3KZG A;  4LZ8 A;  2Y84 A;  4PBH A;  4ZED A;  3DP8 A;  2B4M A;  1OIB A;  2NVU B;  2Q8J A;  2ALU A;  2HFB A;  5EQ8 A;  1LBY A;  4KHZ E;  4MBP A;  4O7M A;  4IR8 A;  3FAT A;  2OX3 A;  3MYU A;  4GX6 A;  5CMK A;  3OXN A;  4G8H A;  1J1N A;  2QMX A;  3KC1 A;  4XKQ A;  3KGC A;  2ZZX A;  4OVQ A;  4U4S A;  2WYP A;  3Q26 A;  2Y5L A;  3IOT A;  2Q74 A;  3EHT A;  4YB5 A;  5CI5 A;  4RY1 A;  3N6T A;  5I2K B;  1FPF A;  1B3G A;  4R2F A;  3M8U A;  1P1U A;  4ZEF A;  1NNK A;  3TQW A;  5DEX A;  1SW1 A;  3SZP A;  4JWX A;  1CNQ A;  3OO6 A;  5IZ3 B;  2ESN A;  1O7T A;  3G3K A;  2IA4 A;  4F3S A;  2RC9 A;  4KFQ A;  1XHY A;  2PFZ A;  5I2N A;  4O3A A;  4KPT A;  1NNF A;  2XA5 A;  1M5B A;  4PAK A;  3VDF A;  4XFE A;  1LCF A;  1ZJL A;  3IJX B;  4DCX A;  1B40 A;  4QHQ A;  4G8N A;  1FPB A;  2RC7 A;  2DDK A;  4H6D A;  5EQA A;  3KBZ A;  4PP0 A;  3SES A;  4RPO A;  3V5A A;  5DW8 A;  3C36 A;  3PUZ E;  4YKP A;  3RTW B;  3M3K A;  5EYG A;  3WAE A;  1XS5 A;  1IIW A;  2RC8 A;  1LFI A;  1CB6 A;  3CRB A;  4IY5 A;  1MQG A;  4OER A;  1UTH B;  1OQH A;  4YMA A;  4ZE9 A;  3D1R A;  1TT1 A;  4JVC A;  3TMG A;  5H8H B;  3TAJ A;  3B7D A;  2QS2 A;  3PMV A;  3PU5 A;  1N3X A;  3PD9 A;  2KQZ A;  2Q89 A;  1FQB A;  3IR1 A;  1USY H;  3O29 A;  1G0H A;  3OMB A;  3T9X B;  4F3G A;  3MP8 A;  4NWD A;  5AA4 A;  2Y7R A;  3T66 A;  2DP8 A;  2XXV A;  4AB6 A;  3S9E A;  3PPR A;  4MCO A;  4OET A;  2LAO A;  5LDZ A;  1VFE A;  2NOO A;  4MEV A;  4GWY A;  2XXU A;  3TUS A;  5FHM A;  5IZ3 A;  4IO7 A;  4RXL A;  4OFO A;  1FPK A;  2ZZV A;  3O6G A;  5HBC A;  1Z7N E;  1TWY A;  1B51 A;  1B1X A;  2OLB A;  4MNC A;  2WX9 A;  2VP1 A;  1MY4 A;  1I6A A;  3TTM A;  3A29 A;  4LP2 B;  4OEU A;  1MM7 A;  4P0G A;  3HV1 A;  2V4C A;  1NUX A;  1B4Z A;  3ISP A;  1Y20 A;  3MZ9 A;  5AA2 B;  5I59 B;  3VE1 B;  4N17 A;  3TTR A;  1JW4 A;  4JVD A;  4PC9 A;  2H99 A;  4QFN A;  3W15 C;  4MAG A;  4I40 A;  4POX A;  1LBC A;  4BDR A;  1B7H A;  4H5G A;  3OO7 A;  3MP6 A;  5JTY B;  4WXJ A;  2DE4 A;  3WAF A;  4XKN A;  4OQO A;  1EYI A;  4OVP A;  2I0B A;  3T9U A;  1FRP A;  3KEI A;  4X04 A;  4F31 B;  1FQA A;  3QUF A;  1SVX B;  3LSX A;  3I5O A;  3GXA A;  1NMU A;  2O1L A;  4I3Y A;  5FTH A;  2DS9 A;  3H6W A;  4HE1 A;  4ZZE A;  1UIU A;  3FXQ A;  3SEX A;  1B7U A;  4PFI A;  4F3P A;  2XXR A;  4P47 A;  5A5X A;  5F1Q A;  3SER A;  1A40 A;  4EF2 A;  3CHG A;  1LEV A;  1N3W A;  1NUW A;  3U65 A;  3FVO A;  3IOR A;  3ODB A;  4P0I A;  4PGP A;  2FHY A;  1IQ7 A;  2V84 A;  1GTK A;  4OEN A;  4YZZ A;  5EHM A;  2Z8D A;  1FJ9 A;  1R9Q A;  3UP9 A;  3C33 A;  1AIV A;  1BP5 A;  1IIT A;  2GHB A;  1Q1K A;  5DTB A;  3OEN A;  3RNN A;  3VLV A;  2MKZ A;  3CG1 A;  2PX1 A;  1AWB A;  4N13 A;  2GHA A;  2F6G A;  1XI6 A;  1SW2 A;  4X1D A;  4IO5 A;  4GX3 A;  2ZXT A;  2PVU A;  4F1V A;  2F7A A;  1YTV A;  5I56 A;  1A54 A;  1USY E;  3RT8 A;  3IK6 B;  4JDF A;  4KYD A;  2OZZ A;  5FHN A;  3RPL A;  1JNF A;  2XWO A;  4N07 A;  3PTY A;  2F8D A;  2I3V A;  1B5I A;  3MPK A;  3MQ9 A;  4ZEB A;  3VVF A;  4I9D A;  5L8D A;  4PFU A;  3K02 A;  4NF6 A;  1Z7M E;  3T1B A;  2B65 A;  2GQ1 A;  1I6Q A;  2CZI A;  2I58 A;  3PUW E;  1NV5 A;  4PET A;  2HEU A;  3MP1 A;  2FA7 A;  1PBQ A;  4F39 A;  1L5T A;  1NKX A;  4K3F A;  2WBB A;  1FQD A;  3MVX A;  4ZE8 A;  1LBB A;  4JXI A;  5I58 A;  4OA4 A;  5AE4 A;  2D3I A;  3TDJ A;  5H8N B;  1EZO A;  1IMD A;  1QKB A;  3D4C A;  1MXU A;  3C35 A;  5L9O A;  2Q88 A;  4MLQ A;  3VLW A;  2RF1 A;  3BBR A;  4MH5 A;  4DXU A;  3DEL B;  3TTL A;  2ZYN A;  1N84 A;  4JB7 A;  4GWX A;  4ECF A;  3FVG A;  2XHD A;  3B8B A;  2DWH A;  2Q8M A;  5ET5 A;  3H6V A;  1RYO A;  1H44 A;  1NV1 A;  5IAI A;  2PFY A;  1MY0 A;  1MRP A;  5BWJ A;  2PYY A;  3KN8 A;  1D3K A;  3MST A;  3FJG A;  3D4G A;  1IMA A;  4N4U A;  4H8J A;  4NQ8 A;  4H45 A;  4JSO A;  1KWH A;  4G4P A;  1N04 A;  4FJP A;  3LC8 A;  4YB7 A;  5CC2 A;  1NV2 A;  2Y7K A;  4P56 A;  5CBS A;  4GOT A;  3LSL A;  4R9G A;  4O7I A;  5JEI A;  4KYS A;  3K6U A;  4KD5 A;  5TP9 A;  5TU0 A;  4HE2 A;  1M5E A;  4ZZA A;  3OOA A;  3C34 A;  3KSX A;  4G61 A;  1N7X A;  5DEX B;  3THI A;  3MUQ A;  5ICQ A;  1DTG A;  3JYR A;  4MHF A;  2P3N A;  1OLA A;  1LAX A;  1Y4C A;  3ZS6 A;  4BDM A;  1YYZ A;  1I69 A;  3T22 A;  1ATG A;  2F34 A;  3KBR A;  4N8Y A;  3KJ7 A;  1H45 A;  3HFU A;  2YJP A;  5I2N B;  3MAM A;  4RJZ A;  1JVY A;  1POY 1;  4U23 A;  4DXB A;  3MW0 A;  1ZIU A;  2XXT A;  4HE0 A;  3KOT A;  4WEP A;  5H8S A;  4F2Q A;  3GYY A;  2G93 A;  1FBP A;  1DTZ A;  5CRY A;  5ISU A;  1B4H A;  2ONS A;  3UA8 A;  4ELO A;  4KCD A;  2Y7P A;  4PE3 A;  4YU0 A;  3N94 A;  1DSN A;  1LAF E;  1JW1 A;  1OVB A;  1DCU A;  5B70 A;  4BLA A;  1B7Z A;  2XX9 A;  3S9L C;  1MXZ A;  4DI4 B;  3SEW A;  4QF9 A;  3FVN A;  1YXI A;  2OBG A;  3HCQ A;  1JEV A;  3IJO B;  1EU8 A;  4I8C A;  1B32 A;  1KZ8 A;  4OHN A;  4QFK A;  4KYE A;  4F1Y A;  4H46 A;  4DE8 A;  3PUY E;  1B3F A;  3IO4 A;  3FV2 A;  1NFT A;  3LBS A;  4XEQ A;  2V93 A;  4NMY A;  1P1W A;  4GBW A;  4LZ7 A;  5AA4 B;  1VDW A;  3KSJ A;  1QJM A;  2H98 A;  2P1S A;  2HZK A;  1K9Z A;  4G77 A;  4U21 A;  1B0L A;  1SI0 A;  3MVZ A;  3QXM A;  1FTM A;  3T96 B;  5CMM A;  4LQ5 A;  1PB7 A;  3G3I A;  3E79 A;  2R6G E;  1LBV A;  4LUB A;  2ANJ A;  3RY3 A;  1AL3 A;  2WYK A;  3CR9 A;  4PTK A;  2AL5 A;  4FE8 A;  4ELR A;  4OFL A;  2UVH A;  3IO6 A;  4IO3 A;  3DM0 A;  4P9K A;  1JQF A;  1SW5 A;  1FPL A;  1TFA A;  1P99 A;  2Y5K A;  1LAH E;  4YKI A;  1EYJ A;  2QVR A;  2DE3 A;  3I6V A;  5ET6 A;  1BK4 A;  2DOJ A;  2PMS A;  1B3L A;  4PBQ A;  1FPI A;  2YLN A;  1IEJ A;  3IOW A;  1Q9D A;  1R6Z A;  4EQ7 A;  2R8T A;  2RKM A;  2UVI A;  1O64 A;  5CM6 A;  1LAG E;  3SEU A;  1BIY A;  1MS7 A;  4JWY A;  4GL8 A;  4P1E A;  4PAI A;  2VGQ A;  3Q29 A;  2PCR A;  1RDX A;  4DI3 D;  1FQE A;  4GXA A;  1B6H A;  1MPD A;  3BIH A;  1FPG A;  3KC0 A;  3H6U A;  4EQB A;  4FAJ A;  1M5D A;  1NV4 A;  3PMW A;  4H5F A;  1UTB A;  3FAS A;  2HZL A;  3IOU A;  2O68 A;  3T9H B;  3N26 A;  3PPN A;  4GL0 A;  2HHM A;  4IB2 A;  1EH3 A;  2I0C A;  4C1U A;  3EHU A;  1XVX A;  1NH7 A;  1OVT A;  2XD3 A;  4QRZ A;  1PB9 A;  2Q2A A;  1R1N A;  4OVJ A;  1ANF A;  2CEY A;  3SEY A;  5A5X B;  1ELJ A;  5K2Y A;  3U94 A;  1WDN A;  1JEU A;  2QFL A;  3TYH A;  2RIN A;  5A5L A;  4TLL B;  2REJ A;  3IAZ A;  4YIC A;  1UIV A;  3SKP A;  1Y3P A;  2Y7I A;  2XXI A;  1H76 A;  4UA8 A;  1XT8 A;  2V25 A;  3L6H A;  4DDD A;  1P1N A;  3K1M A;  4FAT A;  1FPJ A;  1DMB A;  2E1S A;  3HHG A;  3HHF A;  4RA1 A;  4Q0C A;  3ROJ A;  3MPL A;  2DYX A;  2I48 A;  4OXV A;  3E3K A;  4MF3 A;  1LBW A;  1G0I A;  3K00 A;  4N6K A;  3B6W A;  2RCA A;  3U93 A;  4LN5 A;  5BUU A;  4F3B A;  3FJM A;  2QS3 A;  1NV3 A;  1TFD A;  4FEC A;  1JP4 A;  3FJ7 A;  2ABH A;  2AIX A;  4M1V A;  1MXX A;  2O1M A;  1QUL A;  5I56 B;  1PBP A;  1GVC A;  5H8Q B;  1IXH A;  3RPW A;  3RPL B;  4F2O A;  2P0S A;  3NOH A;  4PF8 A;  2QRY A;  4DZ1 A;  3L6G A;  4LA9 A;  4NF6 B;  1QGX A;  1PDA A;  3T0J A;  2HXR A;  4JWO A;  2QMW A;  4MNP A;  1VFD A;  3MZ1 A;  4NF4 A;  5T3J A;  2F3D A;  4G68 A;  2NUV A;  3O6H A;  4HCY A;  3RT6 B;  3OEK A;  4R72 A;  2Q2C A;  4QFO A;  4NED A;  3P7I A;  1LFG A;  3LSF B;  4GWZ A;  4NN3 A;  1SQY A;  2DXR A;  5I58 B;  1IZ1 A;  2UYE A;  1KA1 A;  4OZ9 A;  4HW8 A;  1IMF A;  4Q8R A;  1URG A;  4OEV A;  3CFZ A;  1A99 A;  1I6B A;  4N15 A;  2F3B A;  3B6T A;  1QW0 A;  2HQ0 A;  4C1T A;  1FJ6 A;  1NL5 A;  2I6E A;  4GWS A;  4YMB A;  1FBE A;  3RN8 A;  1Y9U A;  1N0T A;  1RKM A;  4R6H A;  1LCT A;  2DWJ A;  2WKY A;  4P8B A;  4R2B A;  4ZS9 A;  4NF0 A;  1B52 A;  3E4R A;  4O8M A;  1NV6 A;  3LUY A;  4F29 A;  2X26 A;  2O7U A;  2A5S A;  1GGG A;  1IMC A;  1LLS A;  4I62 A;  3TFL A;  2DVC A;  3GBB A;  4AB5 A;  4GVO A;  4HTG A;  3N6U A;  3ZKK A;  2CZH A;  5CBR A;  1NV7 A;  3G3G A;  2E0S A;  3K4U A;  1BKA A;  3KJT A;  2P3V A;  3CSG A;  3HST A;  4EQ9 A;  1URS A;  4N8G A;  2F5X A;  4BDO A;  5H8Q A;  4RK2 A;  2H5Y A;  5TP9 B;  4YAH X;  1NI9 A;  5DVF A;  3GLB A;  3U92 A;  5EQ9 A;  1P1O A;  3VXB A;  2Z8F A;  3H06 B;  4FOR A;  2NXO A;  4ZEI A;  4IY6 A;  2UVG A;  3UOR A;  1FBD A;  3FXB A;  2O7I A;  4IO6 A;  4Q30 B;  1DBZ A;  1LST A;  3A09 A;  2ZYM A;  4Q5T A;  2F36 A;  3MVW A;  5IKB A;  5KCJ A;  5AA1 A;  1MDP 1;  1MY1 A;  4WED A;  4N81 A;  1A55 A;  2GH9 A;  3CFL A;  1DK4 A;  1FCK A;  4GLI A;  2FNC A;  3RYD A;  3W9V A;  1WVJ A;  1XOC A;  4AQ4 A;  1ZTY A;  4X9T A;  2B3B A;  2XX7 A;  2I49 A;  3HO7 A;  2XXH A;  5K2X A;  4PFY A;  1A8F A;  3OSQ A;  3BKI B;  3LV0 A;  1LGB C;  3CI8 A;  3GZG A;  5ESY A;  1B1H A;  3V83 A;  4JBZ A;  5ELV A;  3O28 A;  4ZEC A;  1Y1M A;  1ZU0 A;  3QUJ A;  1US4 A;  4HXV A;  3LSW A;  4QSE A;  1MXV A;  3C31 A;  4GXS B;  1B2H A;  2V3T A;  1QKA A;  1NNP A;  1VSO A;  1ZKB A;  2H25 A;  1JVX A;  5FHO A;  5HM4 B;  3PPO A;  4OMB A;  4OYV A;  2XXQ A;  3TTN A;  1SDX A;  1UQW A;  4U2R A;  3QIM A;  4QSC A;  1K9Y A;  2RCB A;  4KR5 A;  4FEB A;  1PC3 A;  3RQT A;  3U8Q A;  4XTC Q;  1XC1 A;  3FXR A;  3UIF A;  3TCF A;  1MQD A;  5L9S A;  4NGU A;  3MZB A;  4NF5 A;  2NWJ A;  3U1O A;  5IM2 A;  3TKD A;  3U72 A;  1MDQ A;  3R7X A;  1MH4 A;  4QXD A;  4H67 A;  3OO8 A;  1RDY A;  4NE4 A;  2ZYO A;  4LVQ A;  1FBC A;  2FVZ A;  2I3W A;  3PPP A;  1Y1Z A;  2F78 A;  4OVR A;  3H3G A;  3UK4 A;  2FIX A;  5CMC A;  1BTJ A; 
#chains in the Genus database with same CATH homology
 2Y5K A;  1FPL A;  3A29 A;  2CZK A;  1EYJ A;  2QVR A;  2DE3 A;  5ET6 A;  1BK4 A;  2DVZ A;  2V4C A;  1NUX A;  3ISP A;  4PBQ A;  1FPI A;  4N17 A;  1Q9D A;  4JVD A;  4PC9 A;  2R8T A;  2FIE A;  5CM6 A;  2ZZW A;  3B50 A;  4MAG A;  1FBG A;  4F19 A;  4P1E A;  4PAI A;  4I40 A;  2DE4 A;  5IZZ A;  2PCR A;  1RDX A;  4DI3 D;  2XWI A;  5IGA A;  3BIG A;  1EYI A;  4OVP A;  3BIH A;  1FPG A;  4FBP A;  5I7I A;  3KC0 A;  2DE2 A;  1FRP A;  4X04 A;  1NV4 A;  5J16 A;  2HZL A;  4I3Y A;  4HE1 A;  4PDD A;  2QPQ A;  4PFI A;  2HHM A;  4P47 A;  4JVI A;  1NUY A;  2XXK A;  4P1L A;  3CHG A;  2CEY A;  1LEV A;  1LBZ A;  2QVV A;  1NUW A;  3U65 A;  2QFL A;  4PGP A;  5A5L A;  2FHY A;  4NG7 A;  5LTC A;  4YZZ A;  4YIC A;  4F1U A;  1FJ9 A;  3QMF A;  5I5P A;  2XWV A;  4HCW A;  1FTA A;  3IFC A;  4OVS A;  1FPJ A;  4N6D A;  4PDH A;  3ROJ A;  4GWW A;  4KXP A;  2MKZ A;  1AWB A;  4I3E A;  1LBW A;  1G0I A;  1XI6 A;  4N6K A;  4GX3 A;  4LN5 A;  4O94 A;  2Q9T A;  4F1V A;  1NV3 A;  4GWU A;  5EYH A;  1JP4 A;  2XWK A;  4M1V A;  1FBH A;  1NV0 A;  3RPL A;  4GX4 A;  2XWO A;  3PTY A;  3W9W A;  4P3L A;  1SPI A;  1INP A;  4MJO A;  4X8R A;  3RPL B;  3NOH A;  4PGN A;  4PF8 A;  3T1B A;  1RDZ A;  2GQ1 A;  1FSA A;  2CZI A;  1QGX A;  1NV5 A;  3T0J A;  2HXR A;  3EKI A;  4MNI A;  4PET A;  4MNP A;  5T3J A;  2F3D A;  4NHB A;  4QBA A;  2WBB A;  4HCY A;  4GBV A;  1KA0 A;  1NUZ A;  4OA4 A;  2WEF A;  4N91 A;  4MIJ A;  1IME A;  1IMD A;  4GWZ A;  4NN3 A;  4F18 A;  1KA1 A;  1IMF A;  5FBP A;  5F24 A;  4N15 A;  2F3B A;  5IZ1 A;  4OAN A;  1FJ6 A;  2JJK A;  4GWX A;  2VPO A;  4GWS A;  3B8B A;  2Q8M A;  3IFA A;  5ET5 A;  1FBE A;  4MX6 A;  1EYK A;  1NV1 A;  5J1D A;  2PFY A;  4PBH A;  2OWZ A;  2B4M A;  4P8B A;  5EQ8 A;  1LBY A;  4O7M A;  4NF0 A;  4IR8 A;  2OX3 A;  3MYU A;  4O8M A;  1NV6 A;  4GX6 A;  4XF5 A;  3MST A;  1IMB A;  1IMA A;  4PF6 A;  1IMC A;  4N4U A;  4NQ8 A;  4H45 A;  3KC1 A;  2ZZX A;  4OVQ A;  2WYP A;  3LUZ A;  2Y5L A;  2Q74 A;  1NV2 A;  4P56 A;  1FPE A;  2CZH A;  1NV7 A;  1FPF A;  3E78 A;  4O7I A;  2P3V A;  3SZP A;  4HE2 A;  1FBF A;  1CNQ A;  4N8G A;  2F5X A;  4NX1 A;  5IZ3 B;  1NI9 A;  4G61 A;  5EQ9 A;  4MHF A;  2P3N A;  2PFZ A;  1YYZ A;  2V3Q A;  1FBD A;  3FXB A;  4NAP A;  2XA5 A;  4N8Y A;  1DBZ A;  4PAK A;  4XFE A;  3HFU A;  1FPB A;  2DDK A;  5EQA A;  3KBZ A;  4UAB A;  2KR0 A;  4HE0 A;  1FPD A;  4AS4 A;  4N81 A;  3GYY A;  5DW8 A;  1FBP A;  2WBD A;  2L5V A;  1DK4 A;  3RYD A;  3W9V A;  5EYG A;  4X9T A;  4PE3 A;  3FBP A;  2VT5 A;  3LV0 A;  3D1R A;  5ESY A;  1DCU A;  4JVC A;  5EQ7 A;  4AS5 A;  2BJI A;  2HPG A;  2QVU A;  4DI4 B;  1YXI A;  4HXV A;  2CEX A;  2KQZ A;  2B4L A;  5JK4 A;  2FBP A;  1KZ8 A;  1G0H A;  2VPN A;  4H46 A;  4XEQ A;  4PFR A;  4GBW A;  1VDW A;  4MCO A;  5ET7 A;  5LDZ A;  1K9Y A;  1D9Q A;  4OVT A;  4PCD A;  2HZK A;  4MEV A;  4GWY A;  1K9Z A;  5ET8 A;  5I3S A;  5IZ3 A;  4NGU A;  4PAF A;  5IM2 A;  3E79 A;  1FPK A;  2ZZV A;  1LBV A;  1YZ0 A;  4PFB A;  2WYK A;  4PTK A;  4QXD A;  1RDY A;  1FBC A;  2FVZ A;  4MMP A;  4MNC A;  2WX9 A;  4OVR A;  4P9K A;  2FIX A;  1LBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...