4PBYA

Structure of the human rbap48-mta1(656-686) complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
409
structure length
384
Chain Sequence
DKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-binding protein RBBP4
publication title Insight into the architecture of the NuRD complex: Structure of the RbAp48-MTA1 sub-complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 107
structure length 384
sequence length 409
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4pbyA00
2H6NA 2HKMA 3PXSD 3MZKA 2B4EA 2HXCA 5K19A 2OVPB 3KRWB 3RFGA 5EM2A 2AH0A 1SQJA 2H9NA 2IAAA 2PBIB 5HE1B 4J77A 4A09A 1GOTB 4Y7RA 4J0WA 1N6DA 3VA6A 4ZOXA 3NVNA 4CZVA 5C2WB 4FA5D 4J73A 1GG2B 4PBZA 4AEZA 4J8BA 1U2VC 3BWSA 3CFSB 4GQ1A 3AL9A 3PSLA 4ZOZA 2Z2NA 5IGQA 5CXCA 3UVNA 3EI1A 4JSNC 4N14A 5HE0B 5SXMA 2AH1A 2B5MA 5IGOA 2EBSA 5KDOB 2H9PA 3I7HA 3EMHA 3K26A 2CN2A 3AFCA 4O3TB 1R5MA 2G9AA 2H47A 2J57G 4LG9A 4FAND 3K27A 3UVLA 3JRPA 1YFQA 5FQDA 2IUPA 3AL8B 3IJ0A 2HKRA 4J8GA 3EI3B 4JSVC 4E54B 2PM6B 1NEXB 3RRMC 1XKSA 4LGNA 4AOWA 2UZYB 5EARA 4FA1D 5HQGA 2IWFA 3SBRA 3OKTA 2G99A 4GGAA 4GM8A 5TF2A 3PVUB 1L0QA 1Q47A 4CY3A 3W15A 5H14A 4CC9A 1SHYB 3MZLA 3MKSB 2H13A 2CO0C 2P9UC 4A11B 3N0EA 4A08A 1XHMA 1NR0A 4L3GD 2OIZA 1B9YA 3OL2A 2AQ5A 2BCJB 3V9FA 4FA4D 4O3UB 3EWEA 3SBPA 3I89A 2BBKH 3FGBA 4ES0A 3MKQA 4JSPC 3I8EA 4CI1A 5FLXg 4IA9A 2AGZA 2OK6A 4JSXC 1PI6A 4H5IA 3ODTA 5CYKB 4X63B 2H9LA 2HESX 4YVDA 3JZNA 5H17A 4NSXA 1ERJA 4D6VA 3I8CA 3F3GA 4U1EI 2GC4A 2J55H 3HFQA 3UKUC 4ERQA 3F3FA 2IWKA 5FA5B 3I7PA 2Z2OA 3N0DA 3C5MA 4J0XA 4CI2A 1FWXA 4A7JA 3EI4B 3SCYA 3OW8A 5IC7A 4J78A 4CY1A 2OK4A 2P9NC 2I3TA 4XYIA 4A0BB 1MG2A 2UZXB 5GXIA 4CZYA 3RFHA 4QRJA 3EI2B 4CI3A 3EU7A 3SBQA 2YNNA 3C9CA 4O9DA 1K32A 3AL8A 5FKQA 1VYHC 3BG0A 3V7DB 2PM9B 2QXVA 2H9MA 3JPXA 2GNQA 1K8KC 1JMXB 2YNPA 2CE8A 4GM3A 1PEVA 3PSCB 4R7AB 2P9PC 3SVWD 2H14A 3IJCA 4ZN4A 3BG1A 1OMWB 4CI8A 3GREA 2O9KA 1MDAH 1P22A 3UVMA 3VGZA 4A11A 3RMZD 3RSEC 4GQBB 5GSAA 2QC5A 3SMRA 3ZWLB 4PSXB 4FA9D 4A2MA 2AGWA 4K3ID 3SJLD 4A09B 4OWRA 3NVXA 3UVOA 2CE9A 1PBYB 1N6EA 3F3PA 5THAA 2YB8B 4PNKB 4GMBA 2MTAH 3CIKB 3I2NA 3IKOA 2B5LA 1TYQC 5TDHB 5C9ZB 4GQ2P 4CZXA 5CYKA 5K1CC 1OLZA 4Y5RD 5IJ8E 4UI9R 4J87A 2P9SC 2IURA 3DXKC 2I3SA 3JZGA 4FHLA 5B4WA 4ERZA 4L3HD 5CXBB 3DXMC 4G56B 2XL2A 4LG8A 3C75H 3IIWA 2YBAA 2H68A 2XU7A 2CO0A 4K3JB 3OKWA 4JT5C 1SQ9A 3A0FA 2IUVA 3KRXB 4Z8LA 2I0RA 4X61B 5I5IA 4A0BA 2XYIA 4OZUA 3EI2A 4HDJA 4D0KA 3PXWD 3IJ1A 4MK0B 2YNOA 4J84A 4H5JA 5AMSA 3UR4A 3C99A 2OVRB 3OTTA 3SHFA 1XIPA 2TRCB 5JWZA 3MXXA 2H6KA 3OKYB 3GFCA 1TBGA 3DM0A 2I0SA 2PM9A 5I5MA 1GP2B 2B5NA 5IT9g 2IUQA 3PVWB 4U7AA 5HYNB 3V5WB 2HYEA 3EG6A 4KFMB 2AGLA 2P9IC 3FM0A 2YMUA 3SN6B 4XEIC 5TEFA 4E5ZB 4J82A 5EAPA 3I7OA 4O1QD 5GMKn 4O45A 5AFU3 1A0RB 4J79A 3JAMg 3EI3A 3SFZA 3L4MD 4E54A 3E0CA 4JXMA 5I5JA 3VH0A 2HJBA 5IJ7E 5EMKB 4A0AB 4FB1D 5HE2B 3PE7A 3ORVD 5A2Qg 5EMLB 2XL3A 5FKSA 3SWSD 3DWLC 4FWWA 3L4OD 1MG3A 5H1MA 4ZOYA 4EWRA 1B9XA 1JMZB 3UKRC 3JROA 3AH8B 4ZOVA 1S4UX 5EM2B 4JD2C 3IIYA 1PGUA 3JZHA 3RN1D 3NVQA 3B7FA 2I0TA 2Q7QA 1N6FA 4BH6A 2AGXA 3SLED 4L1QD 4PBYA 4ESGA 5CXBA 4GM9A 4JT6C 3MMYA 1GXRA 4J81A 4CY5A 3ULEC 5C2VB 4QL1A 5HE3B 2P9KC 2HJ4A 1RI6A 5EMJB 3UVKA 5EAMA 4BL0A 2GC7A 4GGDA 4GZ8A 5FKTA 5CXCB 2OJYA 3EI1B 1JOFA 5AJAA 4XYHA 2H3XA 2CN3A 3SXTD 3JB9L 4X60B 5EALA 3U4YA 1JJUB 3P4FA 4BUJC 3DSMA 3RLMD 5FXYA 4PC0A 4X3EA 5FKRA 4CY2A 3OKYA 4PSWB 4TZ4A 3EI4A 2H6QA 4FAVD 3I7NA 1QNIA 3PXTD 3I7LA 2PM7B 4QT8A 4E5ZA 5TEEA 2J56H 3I7KA 3J81g 3J80g 4PXWA 2AGYA 1U4CA 4ERYA 4I79A 4A08B 2OVQB 4QQEA 3OL2B 4J86A 3FRXA 4A2LA 5GXHA 3CFVA 2W18A 4A0AA 3RN0D 2Z2PA 2P9LC 4GGCA 5EMMB 4L9OA 2CNXA 4IMMA
chains in the Genus database with same CATH superfamily
2H6NA 2HKMA 3PXSD 3MZKA 2B4EA 2HXCA 5K19A 2OVPB 3KRWB 3RFGA 3EQ9A 5EM2A 2AH0A 1SQJA 2H9NA 2EIEA 2IAAA 3IULA 2PBIB 5HE1B 4J77A 1T2XA 1M1XA 4A09A 1GOTB 4Y7RA 4J0WA 5E6SA 1N6DA 3VA6A 4ZOXA 3NVNA 4CZVA 4D9SA 5C2WB 4FA5D 3DDUA 4J73A 1GG2B 4PBZA 4AEZA 4J8BA 1U2VC 3BWSA 5E6UA 3CFSB 4GQ1A 1UOPA 1UTCA 3AL9A 3PSLA 2VDOA 4ZOZA 2Z2NA 4IRZA 5IGQA 5CXCA 3UVNA 3EI1A 4JSNC 4N14A 5HE0B 5SXMA 2AH1A 2B5MA 5IGOA 4BP9A 2EBSA 5KDOB 2H9PA 3I7HA 3EMHA 3K26A 2CN2A 3AFCA 3VI4A 4O3TB 1R5MA 2G9AA 2H47A 2J57G 3IUJA 4LG9A 4FAND 3EQ7A 3K27A 3JRPA 3UVLA 1YFQA 5FQDA 5M5SA 2IUPA 3O4JA 3AL8B 1I2MB 2VDMA 5C86A 3IJ0A 4G1EA 2HKRA 4J8GA 3EI3B 3V4PA 4JSVC 4E54B 4MMZA 2PM6B 1NEXB 3RRMC 1GOGA 1XKSA 4LGNA 4AN0A 4AOWA 2UZYB 5EARA 4MMXA 4FA1D 5HQGA 2IWFA 3SBRA 3OKTA 4G55A 2G99A 4GGAA 4GM8A 5TF2A 3PVUB 1L0QA 1Q47A 3IJEA 4CY3A 3W15A 5H14A 4CC9A 1SHYB 3MZLA 3MKSB 4Z7OA 1A12A 2H13A 2CO0C 2P9UC 4A11B 4BCCA 3T3MA 3N0EA 4A08A 1XHMA 2HU8A 1NR0A 1O6FA 4L3GD 4Z7QA 2OIZA 1B9YA 3OL2A 2AQ5A 2BCJB 3V9FA 3ZDZA 4O3UB 4FA4D 3EWEA 3O4HA 3SBPA 3IURA 2BBKH 1JV2A 3I89A 4AX4A 3FGBA 4ES0A 1O6GA 3MKQA 4BCBA 4JSPC 3I8EA 4CI1A 5FLXg 4IA9A 2AGZA 2OK6A 4JSXC 1VE6A 2VZ3A 1PI6A 4H5IA 1BPOA 3ODTA 2BKLA 5CYKB 4X63B 2H9LA 2HESX 4YVDA 3JZNA 1H2ZA 5H17A 2JKXA 4NSXA 1ERJA 4D6VA 3I8CA 3F3GA 4U1EI 2GC4A 2J55H 3HFQA 3UKUC 4ERQA 1L5GA 2IWKA 3F3FA 5FA5B 3I7PA 2Z2OA 3N0DA 3C5MA 3ZE2A 4J0XA 4CI2A 1FWXA 4A7JA 3EI4B 5M5TA 3SCYA 4DNUA 3OW8A 2VDNA 5IC7A 4J78A 1GOFA 4CY1A 3K71A 2OK4A 2P9NC 2I3TA 4XYIA 4A0BB 3FCUA 1MG2A 2UZXB 5GXIA 4CZYA 3RFHA 4QRJA 3EI2B 4CI3A 3KCIA 3GC3B 3EU7A 3SBQA 2QR5A 2YNNA 3C9CA 3K72A 2HU7A 1E5TA 4O9DA 2VZ1A 1K32A 3O4IA 3AL8A 5FKQA 1VYHC 3BG0A 3V7DB 1H2XA 2PM9B 2QXVA 2H9MA 3JPXA 2GNQA 1K8KC 2VDLA 4WK2A 1JMXB 2YNPA 4WK4A 4NBMA 2CE8A 4GM3A 1PEVA 3PSCB 4R7AB 2P9PC 2VDRA 3SVWD 1VE7A 2H14A 3IJCA 4ZN4A 4AMZA 3BG1A 3IUNA 1OMWB 4CI8A 3GREA 2O9KA 2XZGA 1MDAH 1P22A 3UVMA 3VGZA 4A11A 3RMZD 3RSEC 4GQBB 5GSAA 4BCDA 2QC5A 3SMRA 3ZWLB 1H2WA 2XE4A 4PSXB 4FA9D 5FFGA 4L1MA 4A2MA 2AGWA 2EIBA 4K3ID 3SJLD 4A09B 4OWRA 3NVXA 3UVOA 2CE9A 1PBYB 1N6EA 4Z7NA 4UM9A 3NIDA 3F3PA 5THAA 2YB8B 4PNKB 3MUNA 4GMBA 3ZE0A 2MTAH 3CIKB 3I2NA 3IKOA 2B5LA 1TYQC 5TDHB 5C9ZB 1H2YA 4GQ2P 4CZXA 5CYKA 5K1CC 1OLZA 4Y5RD 3ZDYA 1QFSA 1YR2A 5IJ8E 4UI9R 4J87A 4WK0A 2P9SC 2IURA 3DXKC 2I3SA 3JZGA 4FHLA 5B4WA 4ERZA 4L3HD 1U8CA 5CXBB 3DXMC 4G56B 2XL2A 4LG8A 3C75H 2EICA 5M61A 3IIWA 4RE6A 2YBAA 2H68A 2XU7A 4UM8A 2CO0A 4K3JB 3OKWA 4JT5C 1SQ9A 3A0FA 2IUVA 2QZPA 3KRXB 4Z8LA 2I0RA 2VDKA 4X61B 5I5IA 4A0BA 4NC4A 2XYIA 2VDPA 4OZUA 3EI2A 5C92A 4HDJA 4D0KA 3PXWD 3IJ1A 4MK0B 2YNOA 4J84A 1E8MA 4H5JA 5AMSA 3UR4A 3C99A 2OVRB 3OTTA 3SHFA 1XIPA 2TRCB 4DNWA 2VDQA 5JWZA 3MXXA 2H6KA 3OKYB 3GFCA 1TBGA 2WQ8A 3DM0A 2I0SA 2PM9A 3QHYB 5I5MA 1GP2B 2B5NA 5IT9g 2IUQA 1QFMA 3PVWB 4U7AA 3EQ8A 5HYNB 3V5WB 2HYEA 3EG6A 4KFMB 2AGLA 2P9IC 3FM0A 2YMUA 5FFOA 2EIDA 3VI3A 3SN6B 2HU5A 4XEIC 5TEFA 4E5ZB 4J82A 5EAPA 3I7OA 4O1QD 5GMKn 4O45A 3OF7A 1A0RB 4G1MA 4J79A 5AFU3 3JAMg 3EI3A 3SFZA 3ZE1A 3L4MD 4E54A 3E0CA 4JXMA 5I5JA 3VH0A 2HJBA 5IJ7E 5EMKB 4A0AB 4FB1D 5HE2B 3PE7A 3ORVD 5E6RA 5M5UA 5A2Qg 5EMLB 2XL3A 4O02A 3O4GA 5FKSA 3SWSD 3DWLC 4FWWA 3L4OD 1MG3A 5H1MA 4ZOYA 4NENA 4EWRA 1B9XA 1JMZB 3UKRC 3JROA 3AH8B 4ZOVA 3MVDK 1S4UX 5EM2B 4JD2C 3IIYA 1PGUA 3IUQA 1C9IA 3JZHA 3RN1D 3NVQA 4JHNA 3B7FA 4BP8A 3V4VA 2I0TA 2Q7QA 1N6FA 1VZ2A 3IUMA 4BH6A 2AGXA 5M5RA 3SLED 4L1QD 4PBYA 4ESGA 5CXBA 4GM9A 4JT6C 3MMYA 4NAAA 1GXRA 4J81A 2VC2A 4CY5A 3ULEC 5C2VB 4QL1A 5HE3B 2P9KC 2HJ4A 1RI6A 5EMJB 3UVKA 5EAMA 4BL0A 2GC7A 4GGDA 1UOOA 4GZ8A 5FKTA 5CXCB 2OJYA 3EI1B 1JOFA 5AJAA 4WJKA 2H3XA 2CN3A 4XYHA 3SXTD 3JB9L 4X60B 5EALA 3U4YA 1JJUB 3P4FA 4BUJC 3DSMA 3NIGA 3RLMD 5FXYA 4PC0A 4X3EA 5FKRA 4CY2A 3OKYA 4PSWB 4TZ4A 3EI4A 2H6QA 5HDBA 3T3PA 4AMYA 4FAVD 3I7NA 1QNIA 5M5VA 3PXTD 3I7LA 2PM7B 4RE5A 4QT8A 4DNVA 4E5ZA 5TEEA 2J56H 3QI0A 1GOHA 3I7KA 3K6SA 3J81g 1C9LA 3J80g 3FCSA 4AN1A 4PXWA 1UOQA 2AGYA 1U4CA 4ERYA 2XDWA 4I79A 4A08B 2OVQB 3MUOA 4QQEA 3OL2B 3IVMA 3FRXA 4J86A 4A2LA 5GXHA 4O2WA 3CFVA 2W18A 4A0AA 3RN0D 2Z2PA 3ZDXA 3GD1I 1JTDB 1E8NA 2P9LC 4GGCA 5EMMB 1TYEA 1VZ3A 1K3IA 3NIFA 4L9OA 2CNXA 4JHPC 4MMYA 4QAMA 4IMMA
chains in the Genus database with same CATH topology
2H6NA 2HKMA 3PXSD 3MZKA 2B4EA 2HXCA 5K19A 2OVPB 3KRWB 3RFGA 5EM2A 2AH0A 1SQJA 2H9NA 2IAAA 2PBIB 5HE1B 4J77A 4A09A 1GOTB 4Y7RA 4J0WA 1N6DA 3VA6A 4ZOXA 3NVNA 4CZVA 5C2WB 4FA5D 4J73A 1GG2B 4PBZA 4AEZA 4J8BA 1U2VC 3BWSA 3CFSB 4GQ1A 3AL9A 3PSLA 4ZOZA 2Z2NA 5IGQA 5CXCA 3UVNA 3EI1A 4JSNC 4N14A 5HE0B 5SXMA 2AH1A 2B5MA 5IGOA 2EBSA 5KDOB 2H9PA 3I7HA 3EMHA 3K26A 2CN2A 3AFCA 4O3TB 1R5MA 2G9AA 2H47A 2J57G 4LG9A 4FAND 3K27A 3UVLA 3JRPA 1YFQA 5FQDA 2IUPA 3AL8B 3IJ0A 2HKRA 4J8GA 3EI3B 4JSVC 4E54B 2PM6B 1NEXB 3RRMC 1XKSA 4LGNA 4AOWA 2UZYB 5EARA 4FA1D 5HQGA 2IWFA 3SBRA 3OKTA 2G99A 4GGAA 4GM8A 5TF2A 3PVUB 1L0QA 1Q47A 4CY3A 3W15A 5H14A 4CC9A 1SHYB 3MZLA 3MKSB 2H13A 2CO0C 2P9UC 4A11B 3N0EA 4A08A 1XHMA 1NR0A 4L3GD 2OIZA 1B9YA 3OL2A 2AQ5A 2BCJB 3V9FA 4FA4D 4O3UB 3EWEA 3SBPA 3I89A 2BBKH 3FGBA 4ES0A 3MKQA 4JSPC 3I8EA 4CI1A 5FLXg 4IA9A 2AGZA 2OK6A 4JSXC 1PI6A 4H5IA 3ODTA 5CYKB 4X63B 2H9LA 2HESX 4YVDA 3JZNA 5H17A 4NSXA 1ERJA 4D6VA 3I8CA 3F3GA 4U1EI 2GC4A 2J55H 3HFQA 3UKUC 4ERQA 3F3FA 2IWKA 5FA5B 3I7PA 2Z2OA 3N0DA 3C5MA 4J0XA 4CI2A 1FWXA 4A7JA 3EI4B 3SCYA 3OW8A 5IC7A 4J78A 4CY1A 2OK4A 2P9NC 2I3TA 4XYIA 4A0BB 1MG2A 2UZXB 5GXIA 4CZYA 3RFHA 4QRJA 3EI2B 4CI3A 3EU7A 3SBQA 2YNNA 3C9CA 4O9DA 1K32A 3AL8A 5FKQA 1VYHC 3BG0A 3V7DB 2PM9B 2QXVA 2H9MA 3JPXA 2GNQA 1K8KC 1JMXB 2YNPA 2CE8A 4GM3A 1PEVA 3PSCB 4R7AB 2P9PC 3SVWD 2H14A 3IJCA 4ZN4A 3BG1A 1OMWB 4CI8A 3GREA 2O9KA 1MDAH 1P22A 3UVMA 3VGZA 4A11A 3RMZD 3RSEC 4GQBB 5GSAA 2QC5A 3SMRA 3ZWLB 4PSXB 4FA9D 4A2MA 2AGWA 4K3ID 3SJLD 4A09B 4OWRA 3NVXA 3UVOA 2CE9A 1PBYB 1N6EA 3F3PA 5THAA 2YB8B 4PNKB 4GMBA 2MTAH 3CIKB 3I2NA 3IKOA 2B5LA 1TYQC 5TDHB 5C9ZB 4GQ2P 4CZXA 5CYKA 5K1CC 1OLZA 4Y5RD 5IJ8E 4UI9R 4J87A 2P9SC 2IURA 3DXKC 2I3SA 3JZGA 4FHLA 5B4WA 4ERZA 4L3HD 5CXBB 3DXMC 4G56B 2XL2A 4LG8A 3C75H 3IIWA 2YBAA 2H68A 2XU7A 2CO0A 4K3JB 3OKWA 4JT5C 1SQ9A 3A0FA 2IUVA 3KRXB 4Z8LA 2I0RA 4X61B 5I5IA 4A0BA 2XYIA 4OZUA 3EI2A 4HDJA 4D0KA 3PXWD 3IJ1A 4MK0B 2YNOA 4J84A 4H5JA 5AMSA 3UR4A 3C99A 2OVRB 3OTTA 3SHFA 1XIPA 2TRCB 5JWZA 3MXXA 2H6KA 3OKYB 3GFCA 1TBGA 3DM0A 2I0SA 2PM9A 5I5MA 1GP2B 2B5NA 5IT9g 2IUQA 3PVWB 4U7AA 5HYNB 3V5WB 2HYEA 3EG6A 4KFMB 2AGLA 2P9IC 3FM0A 2YMUA 3SN6B 4XEIC 5TEFA 4E5ZB 4J82A 5EAPA 3I7OA 4O1QD 5GMKn 4O45A 5AFU3 1A0RB 4J79A 3JAMg 3EI3A 3SFZA 3L4MD 4E54A 3E0CA 4JXMA 5I5JA 3VH0A 2HJBA 5IJ7E 5EMKB 4A0AB 4FB1D 5HE2B 3PE7A 3ORVD 5A2Qg 5EMLB 2XL3A 5FKSA 3SWSD 3DWLC 4FWWA 3L4OD 1MG3A 5H1MA 4ZOYA 4EWRA 1B9XA 1JMZB 3UKRC 3JROA 3AH8B 4ZOVA 1S4UX 5EM2B 4JD2C 3IIYA 1PGUA 3JZHA 3RN1D 3NVQA 3B7FA 2I0TA 2Q7QA 1N6FA 4BH6A 2AGXA 3SLED 4L1QD 4PBYA 4ESGA 5CXBA 4GM9A 4JT6C 3MMYA 1GXRA 4J81A 4CY5A 3ULEC 5C2VB 4QL1A 5HE3B 2P9KC 2HJ4A 1RI6A 5EMJB 3UVKA 5EAMA 4BL0A 2GC7A 4GGDA 4GZ8A 5FKTA 5CXCB 2OJYA 3EI1B 1JOFA 5AJAA 4XYHA 2H3XA 2CN3A 3SXTD 3JB9L 4X60B 5EALA 3U4YA 1JJUB 3P4FA 4BUJC 3DSMA 3RLMD 5FXYA 4PC0A 4X3EA 5FKRA 4CY2A 3OKYA 4PSWB 4TZ4A 3EI4A 2H6QA 4FAVD 3I7NA 1QNIA 3PXTD 3I7LA 2PM7B 4QT8A 4E5ZA 5TEEA 2J56H 3I7KA 3J81g 3J80g 4PXWA 2AGYA 1U4CA 4ERYA 4I79A 4A08B 2OVQB 4QQEA 3OL2B 4J86A 3FRXA 4A2LA 5GXHA 3CFVA 2W18A 4A0AA 3RN0D 2Z2PA 2P9LC 4GGCA 5EMMB 4L9OA 2CNXA 4IMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6N A;  2HKM A;  3PXS D;  3MZK A;  2B4E A;  2HXC A;  5K19 A;  2OVP B;  3KRW B;  3RFG A;  5EM2 A;  2AH0 A;  1SQJ A;  2H9N A;  2IAA A;  2PBI B;  5HE1 B;  4J77 A;  4A09 A;  1GOT B;  4Y7R A;  4J0W A;  1N6D A;  3VA6 A;  4ZOX A;  3NVN A;  4CZV A;  5C2W B;  4FA5 D;  4J73 A;  1GG2 B;  4PBZ A;  4AEZ A;  4J8B A;  1U2V C;  3BWS A;  3CFS B;  4GQ1 A;  3AL9 A;  3PSL A;  4ZOZ A;  2Z2N A;  5IGQ A;  5CXC A;  3UVN A;  3EI1 A;  4JSN C;  4N14 A;  5HE0 B;  5SXM A;  2AH1 A;  2B5M A;  5IGO A;  2EBS A;  5KDO B;  2H9P A;  3I7H A;  3EMH A;  3K26 A;  2CN2 A;  3AFC A;  4O3T B;  1R5M A;  2G9A A;  2H47 A;  2J57 G;  4LG9 A;  4FAN D;  3K27 A;  3UVL A;  3JRP A;  1YFQ A;  5FQD A;  2IUP A;  3AL8 B;  3IJ0 A;  2HKR A;  4J8G A;  3EI3 B;  4JSV C;  4E54 B;  2PM6 B;  1NEX B;  3RRM C;  1XKS A;  4LGN A;  4AOW A;  2UZY B;  5EAR A;  4FA1 D;  5HQG A;  2IWF A;  3SBR A;  3OKT A;  2G99 A;  4GGA A;  4GM8 A;  5TF2 A;  3PVU B;  1L0Q A;  1Q47 A;  4CY3 A;  3W15 A;  5H14 A;  4CC9 A;  1SHY B;  3MZL A;  3MKS B;  2H13 A;  2CO0 C;  2P9U C;  4A11 B;  3N0E A;  4A08 A;  1XHM A;  1NR0 A;  4L3G D;  2OIZ A;  1B9Y A;  3OL2 A;  2AQ5 A;  2BCJ B;  3V9F A;  4FA4 D;  4O3U B;  3EWE A;  3SBP A;  3I89 A;  2BBK H;  3FGB A;  4ES0 A;  3MKQ A;  4JSP C;  3I8E A;  4CI1 A;  5FLX g;  4IA9 A;  2AGZ A;  2OK6 A;  4JSX C;  1PI6 A;  4H5I A;  3ODT A;  5CYK B;  4X63 B;  2H9L A;  2HES X;  4YVD A;  3JZN A;  5H17 A;  4NSX A;  1ERJ A;  4D6V A;  3I8C A;  3F3G A;  4U1E I;  2GC4 A;  2J55 H;  3HFQ A;  3UKU C;  4ERQ A;  3F3F A;  2IWK A;  5FA5 B;  3I7P A;  2Z2O A;  3N0D A;  3C5M A;  4J0X A;  4CI2 A;  1FWX A;  4A7J A;  3EI4 B;  3SCY A;  3OW8 A;  5IC7 A;  4J78 A;  4CY1 A;  2OK4 A;  2P9N C;  2I3T A;  4XYI A;  4A0B B;  1MG2 A;  2UZX B;  5GXI A;  4CZY A;  3RFH A;  4QRJ A;  3EI2 B;  4CI3 A;  3EU7 A;  3SBQ A;  2YNN A;  3C9C A;  4O9D A;  1K32 A;  3AL8 A;  5FKQ A;  1VYH C;  3BG0 A;  3V7D B;  2PM9 B;  2QXV A;  2H9M A;  3JPX A;  2GNQ A;  1K8K C;  1JMX B;  2YNP A;  2CE8 A;  4GM3 A;  1PEV A;  3PSC B;  4R7A B;  2P9P C;  3SVW D;  2H14 A;  3IJC A;  4ZN4 A;  3BG1 A;  1OMW B;  4CI8 A;  3GRE A;  2O9K A;  1MDA H;  1P22 A;  3UVM A;  3VGZ A;  4A11 A;  3RMZ D;  3RSE C;  4GQB B;  5GSA A;  2QC5 A;  3SMR A;  3ZWL B;  4PSX B;  4FA9 D;  4A2M A;  2AGW A;  4K3I D;  3SJL D;  4A09 B;  4OWR A;  3NVX A;  3UVO A;  2CE9 A;  1PBY B;  1N6E A;  3F3P A;  5THA A;  2YB8 B;  4PNK B;  4GMB A;  2MTA H;  3CIK B;  3I2N A;  3IKO A;  2B5L A;  1TYQ C;  5TDH B;  5C9Z B;  4GQ2 P;  4CZX A;  5CYK A;  5K1C C;  1OLZ A;  4Y5R D;  5IJ8 E;  4UI9 R;  4J87 A;  2P9S C;  2IUR A;  3DXK C;  2I3S A;  3JZG A;  4FHL A;  5B4W A;  4ERZ A;  4L3H D;  5CXB B;  3DXM C;  4G56 B;  2XL2 A;  4LG8 A;  3C75 H;  3IIW A;  2YBA A;  2H68 A;  2XU7 A;  2CO0 A;  4K3J B;  3OKW A;  4JT5 C;  1SQ9 A;  3A0F A;  2IUV A;  3KRX B;  4Z8L A;  2I0R A;  4X61 B;  5I5I A;  4A0B A;  2XYI A;  4OZU A;  3EI2 A;  4HDJ A;  4D0K A;  3PXW D;  3IJ1 A;  4MK0 B;  2YNO A;  4J84 A;  4H5J A;  5AMS A;  3UR4 A;  3C99 A;  2OVR B;  3OTT A;  3SHF A;  1XIP A;  2TRC B;  5JWZ A;  3MXX A;  2H6K A;  3OKY B;  3GFC A;  1TBG A;  3DM0 A;  2I0S A;  2PM9 A;  5I5M A;  1GP2 B;  2B5N A;  5IT9 g;  2IUQ A;  3PVW B;  4U7A A;  5HYN B;  3V5W B;  2HYE A;  3EG6 A;  4KFM B;  2AGL A;  2P9I C;  3FM0 A;  2YMU A;  3SN6 B;  4XEI C;  5TEF A;  4E5Z B;  4J82 A;  5EAP A;  3I7O A;  4O1Q D;  5GMK n;  4O45 A;  5AFU 3;  1A0R B;  4J79 A;  3JAM g;  3EI3 A;  3SFZ A;  3L4M D;  4E54 A;  3E0C A;  4JXM A;  5I5J A;  3VH0 A;  2HJB A;  5IJ7 E;  5EMK B;  4A0A B;  4FB1 D;  5HE2 B;  3PE7 A;  3ORV D;  5A2Q g;  5EML B;  2XL3 A;  5FKS A;  3SWS D;  3DWL C;  4FWW A;  3L4O D;  1MG3 A;  5H1M A;  4ZOY A;  4EWR A;  1B9X A;  1JMZ B;  3UKR C;  3JRO A;  3AH8 B;  4ZOV A;  1S4U X;  5EM2 B;  4JD2 C;  3IIY A;  1PGU A;  3JZH A;  3RN1 D;  3NVQ A;  3B7F A;  2I0T A;  2Q7Q A;  1N6F A;  4BH6 A;  2AGX A;  3SLE D;  4L1Q D;  4PBY A;  4ESG A;  5CXB A;  4GM9 A;  4JT6 C;  3MMY A;  1GXR A;  4J81 A;  4CY5 A;  3ULE C;  5C2V B;  4QL1 A;  5HE3 B;  2P9K C;  2HJ4 A;  1RI6 A;  5EMJ B;  3UVK A;  5EAM A;  4BL0 A;  2GC7 A;  4GGD A;  4GZ8 A;  5FKT A;  5CXC B;  2OJY A;  3EI1 B;  1JOF A;  5AJA A;  4XYH A;  2H3X A;  2CN3 A;  3SXT D;  3JB9 L;  4X60 B;  5EAL A;  3U4Y A;  1JJU B;  3P4F A;  4BUJ C;  3DSM A;  3RLM D;  5FXY A;  4PC0 A;  4X3E A;  5FKR A;  4CY2 A;  3OKY A;  4PSW B;  4TZ4 A;  3EI4 A;  2H6Q A;  4FAV D;  3I7N A;  1QNI A;  3PXT D;  3I7L A;  2PM7 B;  4QT8 A;  4E5Z A;  5TEE A;  2J56 H;  3I7K A;  3J81 g;  3J80 g;  4PXW A;  2AGY A;  1U4C A;  4ERY A;  4I79 A;  4A08 B;  2OVQ B;  4QQE A;  3OL2 B;  4J86 A;  3FRX A;  4A2L A;  5GXH A;  3CFV A;  2W18 A;  4A0A A;  3RN0 D;  2Z2P A;  2P9L C;  4GGC A;  5EMM B;  4L9O A;  2CNX A;  4IMM A; 
#chains in the Genus database with same CATH topology
 2H6N A;  2HKM A;  3PXS D;  3MZK A;  2B4E A;  2HXC A;  5K19 A;  2OVP B;  3KRW B;  3RFG A;  3EQ9 A;  5EM2 A;  2AH0 A;  1SQJ A;  2H9N A;  2EIE A;  2IAA A;  3IUL A;  2PBI B;  5HE1 B;  4J77 A;  1T2X A;  1M1X A;  4A09 A;  1GOT B;  4Y7R A;  4J0W A;  5E6S A;  1N6D A;  3VA6 A;  4ZOX A;  3NVN A;  4CZV A;  4D9S A;  5C2W B;  4FA5 D;  3DDU A;  4J73 A;  1GG2 B;  4PBZ A;  4AEZ A;  4J8B A;  1U2V C;  3BWS A;  5E6U A;  3CFS B;  4GQ1 A;  1UOP A;  1UTC A;  3AL9 A;  3PSL A;  2VDO A;  4ZOZ A;  2Z2N A;  4IRZ A;  5IGQ A;  5CXC A;  3UVN A;  3EI1 A;  4JSN C;  4N14 A;  5HE0 B;  5SXM A;  2AH1 A;  2B5M A;  5IGO A;  4BP9 A;  2EBS A;  5KDO B;  2H9P A;  3I7H A;  3EMH A;  3K26 A;  2CN2 A;  3AFC A;  3VI4 A;  4O3T B;  1R5M A;  2G9A A;  2H47 A;  2J57 G;  3IUJ A;  4LG9 A;  4FAN D;  3EQ7 A;  3K27 A;  3JRP A;  3UVL A;  1YFQ A;  5FQD A;  5M5S A;  2IUP A;  3O4J A;  3AL8 B;  1I2M B;  2VDM A;  5C86 A;  3IJ0 A;  4G1E A;  2HKR A;  4J8G A;  3EI3 B;  3V4P A;  4JSV C;  4E54 B;  4MMZ A;  2PM6 B;  1NEX B;  3RRM C;  1GOG A;  1XKS A;  4LGN A;  4AN0 A;  4AOW A;  2UZY B;  5EAR A;  4MMX A;  4FA1 D;  5HQG A;  2IWF A;  3SBR A;  3OKT A;  4G55 A;  2G99 A;  4GGA A;  4GM8 A;  5TF2 A;  3PVU B;  1L0Q A;  1Q47 A;  3IJE A;  4CY3 A;  3W15 A;  5H14 A;  4CC9 A;  1SHY B;  3MZL A;  3MKS B;  4Z7O A;  1A12 A;  2H13 A;  2CO0 C;  2P9U C;  4A11 B;  4BCC A;  3T3M A;  3N0E A;  4A08 A;  1XHM A;  2HU8 A;  1NR0 A;  1O6F A;  4L3G D;  4Z7Q A;  2OIZ A;  1B9Y A;  3OL2 A;  2AQ5 A;  2BCJ B;  3V9F A;  3ZDZ A;  4O3U B;  4FA4 D;  3EWE A;  3O4H A;  3SBP A;  3IUR A;  2BBK H;  1JV2 A;  3I89 A;  4AX4 A;  3FGB A;  4ES0 A;  1O6G A;  3MKQ A;  4BCB A;  4JSP C;  3I8E A;  4CI1 A;  5FLX g;  4IA9 A;  2AGZ A;  2OK6 A;  4JSX C;  1VE6 A;  2VZ3 A;  1PI6 A;  4H5I A;  1BPO A;  3ODT A;  2BKL A;  5CYK B;  4X63 B;  2H9L A;  2HES X;  4YVD A;  3JZN A;  1H2Z A;  5H17 A;  2JKX A;  4NSX A;  1ERJ A;  4D6V A;  3I8C A;  3F3G A;  4U1E I;  2GC4 A;  2J55 H;  3HFQ A;  3UKU C;  4ERQ A;  1L5G A;  2IWK A;  3F3F A;  5FA5 B;  3I7P A;  2Z2O A;  3N0D A;  3C5M A;  3ZE2 A;  4J0X A;  4CI2 A;  1FWX A;  4A7J A;  3EI4 B;  5M5T A;  3SCY A;  4DNU A;  3OW8 A;  2VDN A;  5IC7 A;  4J78 A;  1GOF A;  4CY1 A;  3K71 A;  2OK4 A;  2P9N C;  2I3T A;  4XYI A;  4A0B B;  3FCU A;  1MG2 A;  2UZX B;  5GXI A;  4CZY A;  3RFH A;  4QRJ A;  3EI2 B;  4CI3 A;  3KCI A;  3GC3 B;  3EU7 A;  3SBQ A;  2QR5 A;  2YNN A;  3C9C A;  3K72 A;  2HU7 A;  1E5T A;  4O9D A;  2VZ1 A;  1K32 A;  3O4I A;  3AL8 A;  5FKQ A;  1VYH C;  3BG0 A;  3V7D B;  1H2X A;  2PM9 B;  2QXV A;  2H9M A;  3JPX A;  2GNQ A;  1K8K C;  2VDL A;  4WK2 A;  1JMX B;  2YNP A;  4WK4 A;  4NBM A;  2CE8 A;  4GM3 A;  1PEV A;  3PSC B;  4R7A B;  2P9P C;  2VDR A;  3SVW D;  1VE7 A;  2H14 A;  3IJC A;  4ZN4 A;  4AMZ A;  3BG1 A;  3IUN A;  1OMW B;  4CI8 A;  3GRE A;  2O9K A;  2XZG A;  1MDA H;  1P22 A;  3UVM A;  3VGZ A;  4A11 A;  3RMZ D;  3RSE C;  4GQB B;  5GSA A;  4BCD A;  2QC5 A;  3SMR A;  3ZWL B;  1H2W A;  2XE4 A;  4PSX B;  4FA9 D;  5FFG A;  4L1M A;  4A2M A;  2AGW A;  2EIB A;  4K3I D;  3SJL D;  4A09 B;  4OWR A;  3NVX A;  3UVO A;  2CE9 A;  1PBY B;  1N6E A;  4Z7N A;  4UM9 A;  3NID A;  3F3P A;  5THA A;  2YB8 B;  4PNK B;  3MUN A;  4GMB A;  3ZE0 A;  2MTA H;  3CIK B;  3I2N A;  3IKO A;  2B5L A;  1TYQ C;  5TDH B;  5C9Z B;  1H2Y A;  4GQ2 P;  4CZX A;  5CYK A;  5K1C C;  1OLZ A;  4Y5R D;  3ZDY A;  1QFS A;  1YR2 A;  5IJ8 E;  4UI9 R;  4J87 A;  4WK0 A;  2P9S C;  2IUR A;  3DXK C;  2I3S A;  3JZG A;  4FHL A;  5B4W A;  4ERZ A;  4L3H D;  1U8C A;  5CXB B;  3DXM C;  4G56 B;  2XL2 A;  4LG8 A;  3C75 H;  2EIC A;  5M61 A;  3IIW A;  4RE6 A;  2YBA A;  2H68 A;  2XU7 A;  4UM8 A;  2CO0 A;  4K3J B;  3OKW A;  4JT5 C;  1SQ9 A;  3A0F A;  2IUV A;  2QZP A;  3KRX B;  4Z8L A;  2I0R A;  2VDK A;  4X61 B;  5I5I A;  4A0B A;  4NC4 A;  2XYI A;  2VDP A;  4OZU A;  3EI2 A;  5C92 A;  4HDJ A;  4D0K A;  3PXW D;  3IJ1 A;  4MK0 B;  2YNO A;  4J84 A;  1E8M A;  4H5J A;  5AMS A;  3UR4 A;  3C99 A;  2OVR B;  3OTT A;  3SHF A;  1XIP A;  2TRC B;  4DNW A;  2VDQ A;  5JWZ A;  3MXX A;  2H6K A;  3OKY B;  3GFC A;  1TBG A;  2WQ8 A;  3DM0 A;  2I0S A;  2PM9 A;  3QHY B;  5I5M A;  1GP2 B;  2B5N A;  5IT9 g;  2IUQ A;  1QFM A;  3PVW B;  4U7A A;  3EQ8 A;  5HYN B;  3V5W B;  2HYE A;  3EG6 A;  4KFM B;  2AGL A;  2P9I C;  3FM0 A;  2YMU A;  5FFO A;  2EID A;  3VI3 A;  3SN6 B;  2HU5 A;  4XEI C;  5TEF A;  4E5Z B;  4J82 A;  5EAP A;  3I7O A;  4O1Q D;  5GMK n;  4O45 A;  3OF7 A;  1A0R B;  4G1M A;  4J79 A;  5AFU 3;  3JAM g;  3EI3 A;  3SFZ A;  3ZE1 A;  3L4M D;  4E54 A;  3E0C A;  4JXM A;  5I5J A;  3VH0 A;  2HJB A;  5IJ7 E;  5EMK B;  4A0A B;  4FB1 D;  5HE2 B;  3PE7 A;  3ORV D;  5E6R A;  5M5U A;  5A2Q g;  5EML B;  2XL3 A;  4O02 A;  3O4G A;  5FKS A;  3SWS D;  3DWL C;  4FWW A;  3L4O D;  1MG3 A;  5H1M A;  4ZOY A;  4NEN A;  4EWR A;  1B9X A;  1JMZ B;  3UKR C;  3JRO A;  3AH8 B;  4ZOV A;  3MVD K;  1S4U X;  5EM2 B;  4JD2 C;  3IIY A;  1PGU A;  3IUQ A;  1C9I A;  3JZH A;  3RN1 D;  3NVQ A;  4JHN A;  3B7F A;  4BP8 A;  3V4V A;  2I0T A;  2Q7Q A;  1N6F A;  1VZ2 A;  3IUM A;  4BH6 A;  2AGX A;  5M5R A;  3SLE D;  4L1Q D;  4PBY A;  4ESG A;  5CXB A;  4GM9 A;  4JT6 C;  3MMY A;  4NAA A;  1GXR A;  4J81 A;  2VC2 A;  4CY5 A;  3ULE C;  5C2V B;  4QL1 A;  5HE3 B;  2P9K C;  2HJ4 A;  1RI6 A;  5EMJ B;  3UVK A;  5EAM A;  4BL0 A;  2GC7 A;  4GGD A;  1UOO A;  4GZ8 A;  5FKT A;  5CXC B;  2OJY A;  3EI1 B;  1JOF A;  5AJA A;  4WJK A;  2H3X A;  2CN3 A;  4XYH A;  3SXT D;  3JB9 L;  4X60 B;  5EAL A;  3U4Y A;  1JJU B;  3P4F A;  4BUJ C;  3DSM A;  3NIG A;  3RLM D;  5FXY A;  4PC0 A;  4X3E A;  5FKR A;  4CY2 A;  3OKY A;  4PSW B;  4TZ4 A;  3EI4 A;  2H6Q A;  5HDB A;  3T3P A;  4AMY A;  4FAV D;  3I7N A;  1QNI A;  5M5V A;  3PXT D;  3I7L A;  2PM7 B;  4RE5 A;  4QT8 A;  4DNV A;  4E5Z A;  5TEE A;  2J56 H;  3QI0 A;  1GOH A;  3I7K A;  3K6S A;  3J81 g;  1C9L A;  3J80 g;  3FCS A;  4AN1 A;  4PXW A;  1UOQ A;  2AGY A;  1U4C A;  4ERY A;  2XDW A;  4I79 A;  4A08 B;  2OVQ B;  3MUO A;  4QQE A;  3OL2 B;  3IVM A;  3FRX A;  4J86 A;  4A2L A;  5GXH A;  4O2W A;  3CFV A;  2W18 A;  4A0A A;  3RN0 D;  2Z2P A;  3ZDX A;  3GD1 I;  1JTD B;  1E8N A;  2P9L C;  4GGC A;  5EMM B;  1TYE A;  1VZ3 A;  1K3I A;  3NIF A;  4L9O A;  2CNX A;  4JHP C;  4MMY A;  4QAM A;  4IMM A; 
#chains in the Genus database with same CATH homology
 2H6N A;  2HKM A;  3PXS D;  3MZK A;  2B4E A;  2HXC A;  5K19 A;  2OVP B;  3KRW B;  3RFG A;  5EM2 A;  2AH0 A;  1SQJ A;  2H9N A;  2IAA A;  2PBI B;  5HE1 B;  4J77 A;  4A09 A;  1GOT B;  4Y7R A;  4J0W A;  1N6D A;  3VA6 A;  4ZOX A;  3NVN A;  4CZV A;  5C2W B;  4FA5 D;  4J73 A;  1GG2 B;  4PBZ A;  4AEZ A;  4J8B A;  1U2V C;  3BWS A;  3CFS B;  4GQ1 A;  3AL9 A;  3PSL A;  4ZOZ A;  2Z2N A;  5IGQ A;  5CXC A;  3UVN A;  3EI1 A;  4JSN C;  4N14 A;  5HE0 B;  5SXM A;  2AH1 A;  2B5M A;  5IGO A;  2EBS A;  5KDO B;  2H9P A;  3I7H A;  3EMH A;  3K26 A;  2CN2 A;  3AFC A;  4O3T B;  1R5M A;  2G9A A;  2H47 A;  2J57 G;  4LG9 A;  4FAN D;  3K27 A;  3UVL A;  3JRP A;  1YFQ A;  5FQD A;  2IUP A;  3AL8 B;  3IJ0 A;  2HKR A;  4J8G A;  3EI3 B;  4JSV C;  4E54 B;  2PM6 B;  1NEX B;  3RRM C;  1XKS A;  4LGN A;  4AOW A;  2UZY B;  5EAR A;  4FA1 D;  5HQG A;  2IWF A;  3SBR A;  3OKT A;  2G99 A;  4GGA A;  4GM8 A;  5TF2 A;  3PVU B;  1L0Q A;  1Q47 A;  4CY3 A;  3W15 A;  5H14 A;  4CC9 A;  1SHY B;  3MZL A;  3MKS B;  2H13 A;  2CO0 C;  2P9U C;  4A11 B;  3N0E A;  4A08 A;  1XHM A;  1NR0 A;  4L3G D;  2OIZ A;  1B9Y A;  3OL2 A;  2AQ5 A;  2BCJ B;  3V9F A;  4FA4 D;  4O3U B;  3EWE A;  3SBP A;  3I89 A;  2BBK H;  3FGB A;  4ES0 A;  3MKQ A;  4JSP C;  3I8E A;  4CI1 A;  5FLX g;  4IA9 A;  2AGZ A;  2OK6 A;  4JSX C;  1PI6 A;  4H5I A;  3ODT A;  5CYK B;  4X63 B;  2H9L A;  2HES X;  4YVD A;  3JZN A;  5H17 A;  4NSX A;  1ERJ A;  4D6V A;  3I8C A;  3F3G A;  4U1E I;  2GC4 A;  2J55 H;  3HFQ A;  3UKU C;  4ERQ A;  3F3F A;  2IWK A;  5FA5 B;  3I7P A;  2Z2O A;  3N0D A;  3C5M A;  4J0X A;  4CI2 A;  1FWX A;  4A7J A;  3EI4 B;  3SCY A;  3OW8 A;  5IC7 A;  4J78 A;  4CY1 A;  2OK4 A;  2P9N C;  2I3T A;  4XYI A;  4A0B B;  1MG2 A;  2UZX B;  5GXI A;  4CZY A;  3RFH A;  4QRJ A;  3EI2 B;  4CI3 A;  3EU7 A;  3SBQ A;  2YNN A;  3C9C A;  4O9D A;  1K32 A;  3AL8 A;  5FKQ A;  1VYH C;  3BG0 A;  3V7D B;  2PM9 B;  2QXV A;  2H9M A;  3JPX A;  2GNQ A;  1K8K C;  1JMX B;  2YNP A;  2CE8 A;  4GM3 A;  1PEV A;  3PSC B;  4R7A B;  2P9P C;  3SVW D;  2H14 A;  3IJC A;  4ZN4 A;  3BG1 A;  1OMW B;  4CI8 A;  3GRE A;  2O9K A;  1MDA H;  1P22 A;  3UVM A;  3VGZ A;  4A11 A;  3RMZ D;  3RSE C;  4GQB B;  5GSA A;  2QC5 A;  3SMR A;  3ZWL B;  4PSX B;  4FA9 D;  4A2M A;  2AGW A;  4K3I D;  3SJL D;  4A09 B;  4OWR A;  3NVX A;  3UVO A;  2CE9 A;  1PBY B;  1N6E A;  3F3P A;  5THA A;  2YB8 B;  4PNK B;  4GMB A;  2MTA H;  3CIK B;  3I2N A;  3IKO A;  2B5L A;  1TYQ C;  5TDH B;  5C9Z B;  4GQ2 P;  4CZX A;  5CYK A;  5K1C C;  1OLZ A;  4Y5R D;  5IJ8 E;  4UI9 R;  4J87 A;  2P9S C;  2IUR A;  3DXK C;  2I3S A;  3JZG A;  4FHL A;  5B4W A;  4ERZ A;  4L3H D;  5CXB B;  3DXM C;  4G56 B;  2XL2 A;  4LG8 A;  3C75 H;  3IIW A;  2YBA A;  2H68 A;  2XU7 A;  2CO0 A;  4K3J B;  3OKW A;  4JT5 C;  1SQ9 A;  3A0F A;  2IUV A;  3KRX B;  4Z8L A;  2I0R A;  4X61 B;  5I5I A;  4A0B A;  2XYI A;  4OZU A;  3EI2 A;  4HDJ A;  4D0K A;  3PXW D;  3IJ1 A;  4MK0 B;  2YNO A;  4J84 A;  4H5J A;  5AMS A;  3UR4 A;  3C99 A;  2OVR B;  3OTT A;  3SHF A;  1XIP A;  2TRC B;  5JWZ A;  3MXX A;  2H6K A;  3OKY B;  3GFC A;  1TBG A;  3DM0 A;  2I0S A;  2PM9 A;  5I5M A;  1GP2 B;  2B5N A;  5IT9 g;  2IUQ A;  3PVW B;  4U7A A;  5HYN B;  3V5W B;  2HYE A;  3EG6 A;  4KFM B;  2AGL A;  2P9I C;  3FM0 A;  2YMU A;  3SN6 B;  4XEI C;  5TEF A;  4E5Z B;  4J82 A;  5EAP A;  3I7O A;  4O1Q D;  5GMK n;  4O45 A;  5AFU 3;  1A0R B;  4J79 A;  3JAM g;  3EI3 A;  3SFZ A;  3L4M D;  4E54 A;  3E0C A;  4JXM A;  5I5J A;  3VH0 A;  2HJB A;  5IJ7 E;  5EMK B;  4A0A B;  4FB1 D;  5HE2 B;  3PE7 A;  3ORV D;  5A2Q g;  5EML B;  2XL3 A;  5FKS A;  3SWS D;  3DWL C;  4FWW A;  3L4O D;  1MG3 A;  5H1M A;  4ZOY A;  4EWR A;  1B9X A;  1JMZ B;  3UKR C;  3JRO A;  3AH8 B;  4ZOV A;  1S4U X;  5EM2 B;  4JD2 C;  3IIY A;  1PGU A;  3JZH A;  3RN1 D;  3NVQ A;  3B7F A;  2I0T A;  2Q7Q A;  1N6F A;  4BH6 A;  2AGX A;  3SLE D;  4L1Q D;  4PBY A;  4ESG A;  5CXB A;  4GM9 A;  4JT6 C;  3MMY A;  1GXR A;  4J81 A;  4CY5 A;  3ULE C;  5C2V B;  4QL1 A;  5HE3 B;  2P9K C;  2HJ4 A;  1RI6 A;  5EMJ B;  3UVK A;  5EAM A;  4BL0 A;  2GC7 A;  4GGD A;  4GZ8 A;  5FKT A;  5CXC B;  2OJY A;  3EI1 B;  1JOF A;  5AJA A;  4XYH A;  2H3X A;  2CN3 A;  3SXT D;  3JB9 L;  4X60 B;  5EAL A;  3U4Y A;  1JJU B;  3P4F A;  4BUJ C;  3DSM A;  3RLM D;  5FXY A;  4PC0 A;  4X3E A;  5FKR A;  4CY2 A;  3OKY A;  4PSW B;  4TZ4 A;  3EI4 A;  2H6Q A;  4FAV D;  3I7N A;  1QNI A;  3PXT D;  3I7L A;  2PM7 B;  4QT8 A;  4E5Z A;  5TEE A;  2J56 H;  3I7K A;  3J81 g;  3J80 g;  4PXW A;  2AGY A;  1U4C A;  4ERY A;  4I79 A;  4A08 B;  2OVQ B;  4QQE A;  3OL2 B;  4J86 A;  3FRX A;  4A2L A;  5GXH A;  3CFV A;  2W18 A;  4A0A A;  3RN0 D;  2Z2P A;  2P9L C;  4GGC A;  5EMM B;  4L9O A;  2CNX A;  4IMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...