4PBYA

Structure of the human rbap48-mta1(656-686) complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
409
structure length
384
Chain Sequence
DKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the architecture of the NuRD complex: Structure of the RbAp48-MTA1 sub-complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Histone-binding protein RBBP4
total genus 107
structure length 384
sequence length 409
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4pbyA00
3L4MD 1TYQC 4FA1D 4GQ2P 5I5IA 1JMZB 1GP2B 3OL2A 4CI8A 4IA9A 2CN3A 3ORVD 5EAPA 3PSLA 3OKYA 2H9PA 3FM0A 4ES0A 3EMHA 2Z2OA 4QL1A 2G99A 5GMKn 1ERJA 3L4OD 4J73A 4J82A 4LG8A 3UKRC 3UVMA 3SLED 4R7AB 3JRPA 2CE8A 3N0EA 1R5MA 4NSXA 5EMJB 4A11B 4CY2A 1PEVA 4K3JB 2YNNA 3EU7A 1PI6A 3EI4B 3SBPA 4BH6A 3P4FA 4L9OA 1GOTB 3JZGA 2AGXA 2I0TA 2QXVA 5EM2A 2I0RA 4K3ID 5IGOA 3SFZA 1SHYB 5CXBA 4A09B 4FAVD 5FKRA 3CFVA 1PBYB 1L0QA 4XYHA 5HQGA 2OVQB 5EAMA 2BBKH 5IT9g 3EI2B 3JB9L 2GC4A 3IKOA 3UKUC 4CY5A 3MKQA 3IIYA 1S4UX 2CE9A 3EI3A 4ERYA 4A0AA 2P9UC 1NR0A 1A0RB 1MDAH 4FWWA 5B4WA 2OK4A 3MMYA 3OL2B 4AEZA 4FAND 4QT8A 2Z2NA 4ZOXA 3VGZA 4X63B 3NVNA 5H17A 2H9NA 3RFGA 2PM6B 3UVNA 2EBSA 3A0FA 3SJLD 1XHMA 5EARA 4H5JA 4O9DA 4KFMB 2HJ4A 5EMMB 2BCJB 5SXMA 5TEFA 4X61B 4GQBB 4E54A 4L1QD 3OW8A 4HDJA 5GXHA 3V5WB 5FA5B 3SBQA 3K27A 2UZXB 3PVUB 1YFQA 4FHLA 4Y5RD 4A08A 3F3GA 4O1QD 5AMSA 4GMBA 2H3XA 3JZNA 5HE1B 4JSVC 5H14A 4CZVA 4OZUA 3UR4A 4QQEA 3PXTD 2HKMA 2W18A 4L3HD 2H6QA 2J57G 4ZOYA 4L3GD 3SBRA 3KRXB 5K1CC 3C9CA 2YMUA 5EM2B 2H9LA 4A08B 4Z8LA 4J81A 2OVPB 2I3TA 4D6VA 3FRXA 3DSMA 5IJ7E 4U1EI 2OVRB 3PE7A 3UVLA 3IJ1A 4AOWA 4A11A 4CI2A 2CO0A 2P9NC 5AFU3 1U2VC 4E54B 3B7FA 2AH1A 5I5MA 4JT6C 4XYIA 3J81g 1JMXB 3GREA 3EI1A 3DXKC 1OMWB 4J79A 1GXRA 4CY3A 1JJUB 1JOFA 5K19A 2H9MA 3JAMg 1N6FA 3OKYB 4BUJC 4A7JA 2XU7A 3PXWD 2Q7QA 4J0WA 1RI6A 3PSCB 4QRJA 2H6KA 3CFSB 2XL3A 4JT5C 2CNXA 4D0KA 5JWZA 3J80g 3MXXA 4A0AB 2B5LA 1MG3A 3U4YA 2PM9B 4A2MA 1MG2A 3VH0A 5IJ8E 3SWSD 4ERZA 4JSPC 2AGYA 2IURA 2XYIA 4FB1D 3SMRA 2HYEA 4BL0A 4FA9D 5C2WB 2Z2PA 4J87A 3I89A 4GQ1A 1TBGA 3DWLC 3F3PA 4JD2C 4YVDA 1QNIA 4PSWB 5FKTA 3RMZD 4O3TB 3PXSD 4EWRA 3ZWLB 2P9PC 3EI4A 4MK0B 5A2Qg 5KDOB 2GNQA 1NEXB 3ULEC 4XEIC 2IUQA 4GGCA 4PBZA 2OK6A 4A09A 3I7OA 2P9KC 5HE2B 4J8BA 5CXBB 4N14A 4Y7RA 1SQ9A 2H47A 5GXIA 4LG9A 4IMMA 2UZYB 5H1MA 2H6NA 3E0CA 4E5ZB 1FWXA 2PM7B 3RRMC 3AFCA 3SCYA 1XIPA 2QC5A 2B4EA 3OTTA 4O3UB 2YBAA 4CC9A 2J55H 3I7PA 5HE0B 3AL9A 5FKQA 4G56B 2AGWA 3SXTD 3BG1A 2AGZA 3RN0D 4PSXB 4ZOZA 2YNOA 3I7HA 2CN2A 3NVQA 3PVWB 2TRCB 3EWEA 3BG0A 4GM3A 5HYNB 3SN6B 2MTAH 3I8CA 4ERQA 3HFQA 2H13A 1K32A 1GG2B 3F3FA 2XL2A 4GM9A 3IIWA 2P9LC 5HE3B 3AL8A 3V7DB 3C5MA 3AL8B 2CO0C 4ESGA 2OJYA 3KRWB 4I79A 5CYKB 1N6EA 3MKSB 4CZYA 2IWKA 4J77A 3ODTA 3RLMD 3SHFA 2O9KA 3MZLA 4CY1A 3V9FA 4CI1A 5GSAA 5EALA 4U7AA 3I7LA 2B5MA 4X60B 2I0SA 3W15A 2IUPA 1P22A 3FGBA 2G9AA 1XKSA 3MZKA 2J56H 3RSEC 4GGAA 3IJ0A 4GM8A 4JSXC 5FKSA 3UVKA 3EI3B 4FA5D 4J0XA 5EMKB 2AH0A 1Q47A 3K26A 5FQDA 3SVWD 4PBYA 3EI1B 3OKTA 4GZ8A 5FXYA 2H68A 2HXCA 4UI9R 3IJCA 5CXCA 1VYHC 2HKRA 4FA4D 4J8GA 4ZN4A 3NVXA 4PC0A 5IGQA 4A0BB 3RN1D 4A0BA 3CIKB 1K8KC 4PXWA 2AGLA 1N6DA 3C99A 4LGNA 3I7KA 2OIZA 2IUVA 4E5ZA 4X3EA 2HJBA 5TF2A 4JXMA 1B9XA 3JPXA 4GGDA 2P9IC 4TZ4A 4CI3A 2P9SC 2PBIB 2B5NA 5TEEA 1B9YA 5TDHB 3BWSA 3OKWA 3EG6A 5EMLB 3I8EA 4J78A 1SQJA 5CXCB 5I5JA 3JZHA 1OLZA 4ZOVA 5THAA 2I3SA 2HESX 2YNPA 3JROA 1PGUA 3DM0A 3DXMC 3I7NA 4J84A 3I2NA 5CYKA 2H14A 3GFCA 5C2VB 2IWFA 5IC7A 4O45A 3RFHA 4J86A 1U4CA 3VA6A 4OWRA 2AQ5A 4JSNC 2PM9A 5C9ZB 5FLXg 5AJAA 3N0DA 4PNKB 2YB8B 3C75H 4H5IA 4CZXA 3UVOA 2IAAA 3AH8B 4A2LA 3EI2A 2GC7A
chains in the Genus database with same CATH superfamily
1UTCA 3L4MD 1TYQC 4FA1D 4GQ2P 1U8CA 5I5IA 1JMZB 1GP2B 1GOGA 3OL2A 4CI8A 4IA9A 3VI4A 2CN3A 3ORVD 5EAPA 1I2MB 3PSLA 1O6FA 3OKYA 2H9PA 3QI0A 3FM0A 3O4JA 4ES0A 3EMHA 5M5RA 2Z2OA 4QL1A 2G99A 5GMKn 1ERJA 3L4OD 4J73A 4J82A 3T3MA 4G1EA 4LG8A 3UKRC 2XE4A 3UVMA 3SLED 4R7AB 3JRPA 2CE8A 3N0EA 1R5MA 4NSXA 5EMJB 3OF7A 4A11B 4CY2A 5M5SA 1PEVA 4K3JB 4WK2A 4BCCA 2YNNA 1BPOA 3EU7A 1PI6A 5M5TA 3EI4B 3SBPA 4BH6A 4DNUA 4L1MA 3P4FA 4L9OA 4NAAA 1GOTB 3JZGA 2AGXA 2I0TA 3IUJA 2QXVA 5EM2A 2I0RA 2QR5A 4K3ID 5IGOA 3SFZA 1E8MA 1SHYB 5CXBA 4A09B 4FAVD 5FKRA 3CFVA 1UOOA 1PBYB 5FFGA 1L0QA 4XYHA 5HQGA 2OVQB 5EAMA 1M1XA 1YR2A 2BBKH 5IT9g 3EI2B 3JB9L 2GC4A 2VDOA 3IKOA 3UKUC 4CY5A 3K71A 3MKQA 1H2YA 3NIGA 3IIYA 1S4UX 2CE9A 3EI3A 4ERYA 4A0AA 3NIFA 4WK0A 4IRZA 2P9UC 1NR0A 1A0RB 1MDAH 4FWWA 5B4WA 2OK4A 3MMYA 3OL2B 4AEZA 4FAND 4QT8A 2Z2NA 3V4PA 4D9SA 2VDLA 4ZOXA 3VGZA 4X63B 3NVNA 5H17A 1UOQA 2H9NA 3RFGA 2PM6B 3UVNA 2EBSA 3A0FA 3SJLD 4AN1A 2EIDA 1XHMA 5EARA 4H5JA 5E6RA 5C92A 4AMZA 4O9DA 1A12A 4KFMB 3MUNA 2HJ4A 5EMMB 2BCJB 5SXMA 5TEFA 4GQBB 4X61B 4E54A 4L1QD 3OW8A 4HDJA 5GXHA 3V5WB 5FA5B 3SBQA 3KCIA 3K27A 2UZXB 3PVUB 1YFQA 4FHLA 4Y5RD 4A08A 3F3GA 4O1QD 5AMSA 4GMBA 4RE6A 2H3XA 3ZE2A 3JZNA 5HE1B 4BP9A 4JSVC 5H14A 4CZVA 4NENA 4OZUA 3UR4A 4QQEA 4NBMA 3PXTD 2HKMA 2W18A 4L3HD 2H6QA 2J57G 4ZOYA 4L3GD 3SBRA 3KRXB 3FCUA 1VE7A 5K1CC 1VZ2A 3C9CA 2YMUA 5EM2B 1QFSA 2H9LA 4A08B 4Z8LA 3IUNA 4J81A 2OVPB 5E6UA 2I3TA 4D6VA 3FRXA 3DSMA 5IJ7E 4U1EI 2OVRB 3PE7A 3UVLA 3IJ1A 4AOWA 4A11A 4CI2A 2CO0A 4MMXA 2P9NC 5AFU3 1U2VC 4E54B 4Z7OA 3B7FA 2AH1A 5I5MA 4JT6C 4XYIA 2VDNA 3J81g 1JMXB 3GREA 3O4GA 3EI1A 3DXKC 3IUQA 1OMWB 4J79A 1GXRA 4CY3A 1JJUB 3O4IA 1JOFA 5K19A 2H9MA 3JAMg 1N6FA 3OKYB 4BUJC 2JKXA 4A7JA 2XU7A 3PXWD 5M5UA 2HU8A 3FCSA 2Q7QA 4J0WA 5E6SA 1RI6A 3IURA 3PSCB 4Z7NA 4QRJA 2H6KA 3ZDYA 3CFSB 2XL3A 4JT5C 2CNXA 4D0KA 4G1MA 5JWZA 3J80g 3MXXA 4A0AB 2B5LA 1MG3A 3U4YA 2PM9B 4A2MA 1MG2A 3K6SA 5IJ8E 3SWSD 3VH0A 1JV2A 4WK4A 4ERZA 4JSPC 4Z7QA 2AGYA 2IURA 2XYIA 4FB1D 3SMRA 4AX4A 2HYEA 4BL0A 4FA9D 5C2WB 2Z2PA 1UOPA 4J87A 3I89A 4GQ1A 1TBGA 3DWLC 3F3PA 4JD2C 4YVDA 1QNIA 4PSWB 4O2WA 5FKTA 4O3TB 2QZPA 3PXSD 3RMZD 1JTDB 3IVMA 1VE6A 4EWRA 3ZWLB 2P9PC 3EI4A 4MK0B 1H2ZA 2BKLA 5A2Qg 2VC2A 2VDRA 2GNQA 5C86A 5KDOB 3IULA 2HU7A 4QAMA 1NEXB 2WQ8A 5HDBA 3ULEC 4XEIC 2IUQA 4GGCA 4PBZA 3T3PA 2OK6A 4A09A 3I7OA 2P9KC 5HE2B 4J8BA 5CXBB 4N14A 4Y7RA 1SQ9A 2H47A 5GXIA 4LG9A 4IMMA 1H2WA 2UZYB 4WJKA 5H1MA 2H6NA 3E0CA 4E5ZB 1FWXA 3ZDZA 3EQ8A 2PM7B 1VZ3A 3RRMC 3AFCA 3SCYA 1XIPA 2QC5A 2B4EA 3OTTA 4O3UB 2YBAA 4BP8A 4CC9A 2J55H 3I7PA 5HE0B 3AL9A 5FKQA 4G56B 2AGWA 3SXTD 3BG1A 2AGZA 3RN0D 4PSXB 2EICA 2YNOA 3I7HA 4ZOZA 2CN2A 3NVQA 3PVWB 2TRCB 3EWEA 3BG0A 4GM3A 5HYNB 3SN6B 4JHNA 2MTAH 3I8CA 3VI3A 5M5VA 4ERQA 3HFQA 2H13A 1K32A 1GG2B 3F3FA 1E8NA 2XL2A 4GM9A 1L5GA 3IIWA 2P9LC 5HE3B 3AL8A 3V7DB 3C5MA 3AL8B 2CO0C 4ESGA 3GC3B 2OJYA 3KRWB 4I79A 2XZGA 5CYKB 1N6EA 3MKSB 3EQ7A 4CZYA 2HU5A 2IWKA 4J77A 3ODTA 4O02A 3RLMD 3SHFA 2O9KA 3MZLA 4CY1A 3ZDXA 3V9FA 4CI1A 5GSAA 5EALA 4U7AA 3I7LA 2B5MA 4X60B 2I0SA 3W15A 2IUPA 1P22A 3FGBA 4G55A 3QHYB 2G9AA 1C9LA 1T2XA 1XKSA 3MZKA 5M61A 3MVDK 2J56H 3RSEC 1H2XA 4GGAA 3IJ0A 4GM8A 4JSXC 5FKSA 3UVKA 3EI3B 4FA5D 4J0XA 5EMKB 2AH0A 1Q47A 3K26A 4NC4A 5FQDA 3SVWD 3GD1I 4PBYA 1C9IA 3EI1B 3OKTA 4GZ8A 5FXYA 2H68A 2HXCA 4UI9R 3IJCA 5CXCA 1VYHC 2HKRA 3K72A 4FA4D 1GOHA 4J8GA 4BCDA 4ZN4A 3NVXA 4PC0A 5IGQA 4A0BB 3NIDA 2VDKA 2EIBA 3RN1D 4BCBA 4A0BA 3CIKB 4UM8A 2VZ3A 1K8KC 4PXWA 2AGLA 1N6DA 4AN0A 3C99A 4LGNA 5FFOA 3I7KA 4MMZA 3ZE0A 2OIZA 2IUVA 4E5ZA 4X3EA 2HJBA 1TYEA 3ZE1A 5TF2A 3V4VA 4JXMA 1B9XA 2VZ1A 3JPXA 2P9IC 4GGDA 4TZ4A 3O4HA 4CI3A 2P9SC 2PBIB 2VDMA 2B5NA 5TEEA 1E5TA 1B9YA 5TDHB 3BWSA 3MUOA 1K3IA 3OKWA 3EG6A 5EMLB 3I8EA 4J78A 4MMYA 1SQJA 5CXCB 2VDPA 5I5JA 2EIEA 3JZHA 3DDUA 4AMYA 1OLZA 4ZOVA 5THAA 2I3SA 2HESX 2YNPA 3JROA 1PGUA 3DM0A 3DXMC 3I7NA 3EQ9A 4J84A 3IUMA 3I2NA 5CYKA 2VDQA 2H14A 3GFCA 5C2VB 2IWFA 5IC7A 4O45A 3RFHA 4JHPC 4J86A 1U4CA 3VA6A 4OWRA 2AQ5A 4UM9A 3IJEA 4JSNC 4DNWA 2PM9A 1QFMA 5C9ZB 4RE5A 2XDWA 5FLXg 1GOFA 5AJAA 4DNVA 3N0DA 4PNKB 2YB8B 3C75H 4H5IA 4CZXA 1O6GA 3UVOA 2IAAA 3AH8B 4A2LA 3EI2A 2GC7A
chains in the Genus database with same CATH topology
3L4MD 1TYQC 4FA1D 4GQ2P 5I5IA 1JMZB 1GP2B 3OL2A 4CI8A 4IA9A 2CN3A 3ORVD 5EAPA 3PSLA 3OKYA 2H9PA 3FM0A 4ES0A 3EMHA 2Z2OA 4QL1A 2G99A 5GMKn 1ERJA 3L4OD 4J73A 4J82A 4LG8A 3UKRC 3UVMA 3SLED 4R7AB 3JRPA 2CE8A 3N0EA 1R5MA 4NSXA 5EMJB 4A11B 4CY2A 1PEVA 4K3JB 2YNNA 3EU7A 1PI6A 3EI4B 3SBPA 4BH6A 3P4FA 4L9OA 1GOTB 3JZGA 2AGXA 2I0TA 2QXVA 5EM2A 2I0RA 4K3ID 5IGOA 3SFZA 1SHYB 5CXBA 4A09B 4FAVD 5FKRA 3CFVA 1PBYB 1L0QA 4XYHA 5HQGA 2OVQB 5EAMA 2BBKH 5IT9g 3EI2B 3JB9L 2GC4A 3IKOA 3UKUC 4CY5A 3MKQA 3IIYA 1S4UX 2CE9A 3EI3A 4ERYA 4A0AA 2P9UC 1NR0A 1A0RB 1MDAH 4FWWA 5B4WA 2OK4A 3MMYA 3OL2B 4AEZA 4FAND 4QT8A 2Z2NA 4ZOXA 3VGZA 4X63B 3NVNA 5H17A 2H9NA 3RFGA 2PM6B 3UVNA 2EBSA 3A0FA 3SJLD 1XHMA 5EARA 4H5JA 4O9DA 4KFMB 2HJ4A 5EMMB 2BCJB 5SXMA 5TEFA 4X61B 4GQBB 4E54A 4L1QD 3OW8A 4HDJA 5GXHA 3V5WB 5FA5B 3SBQA 3K27A 2UZXB 3PVUB 1YFQA 4FHLA 4Y5RD 4A08A 3F3GA 4O1QD 5AMSA 4GMBA 2H3XA 3JZNA 5HE1B 4JSVC 5H14A 4CZVA 4OZUA 3UR4A 4QQEA 3PXTD 2HKMA 2W18A 4L3HD 2H6QA 2J57G 4ZOYA 4L3GD 3SBRA 3KRXB 5K1CC 3C9CA 2YMUA 5EM2B 2H9LA 4A08B 4Z8LA 4J81A 2OVPB 2I3TA 4D6VA 3FRXA 3DSMA 5IJ7E 4U1EI 2OVRB 3PE7A 3UVLA 3IJ1A 4AOWA 4A11A 4CI2A 2CO0A 2P9NC 5AFU3 1U2VC 4E54B 3B7FA 2AH1A 5I5MA 4JT6C 4XYIA 3J81g 1JMXB 3GREA 3EI1A 3DXKC 1OMWB 4J79A 1GXRA 4CY3A 1JJUB 1JOFA 5K19A 2H9MA 3JAMg 1N6FA 3OKYB 4BUJC 4A7JA 2XU7A 3PXWD 2Q7QA 4J0WA 1RI6A 3PSCB 4QRJA 2H6KA 3CFSB 2XL3A 4JT5C 2CNXA 4D0KA 5JWZA 3J80g 3MXXA 4A0AB 2B5LA 1MG3A 3U4YA 2PM9B 4A2MA 1MG2A 3VH0A 5IJ8E 3SWSD 4ERZA 4JSPC 2AGYA 2IURA 2XYIA 4FB1D 3SMRA 2HYEA 4BL0A 4FA9D 5C2WB 2Z2PA 4J87A 3I89A 4GQ1A 1TBGA 3DWLC 3F3PA 4JD2C 4YVDA 1QNIA 4PSWB 5FKTA 3RMZD 4O3TB 3PXSD 4EWRA 3ZWLB 2P9PC 3EI4A 4MK0B 5A2Qg 5KDOB 2GNQA 1NEXB 3ULEC 4XEIC 2IUQA 4GGCA 4PBZA 2OK6A 4A09A 3I7OA 2P9KC 5HE2B 4J8BA 5CXBB 4N14A 4Y7RA 1SQ9A 2H47A 5GXIA 4LG9A 4IMMA 2UZYB 5H1MA 2H6NA 3E0CA 4E5ZB 1FWXA 2PM7B 3RRMC 3AFCA 3SCYA 1XIPA 2QC5A 2B4EA 3OTTA 4O3UB 2YBAA 4CC9A 2J55H 3I7PA 5HE0B 3AL9A 5FKQA 4G56B 2AGWA 3SXTD 3BG1A 2AGZA 3RN0D 4PSXB 4ZOZA 2YNOA 3I7HA 2CN2A 3NVQA 3PVWB 2TRCB 3EWEA 3BG0A 4GM3A 5HYNB 3SN6B 2MTAH 3I8CA 4ERQA 3HFQA 2H13A 1K32A 1GG2B 3F3FA 2XL2A 4GM9A 3IIWA 2P9LC 5HE3B 3AL8A 3V7DB 3C5MA 3AL8B 2CO0C 4ESGA 2OJYA 3KRWB 4I79A 5CYKB 1N6EA 3MKSB 4CZYA 2IWKA 4J77A 3ODTA 3RLMD 3SHFA 2O9KA 3MZLA 4CY1A 3V9FA 4CI1A 5GSAA 5EALA 4U7AA 3I7LA 2B5MA 4X60B 2I0SA 3W15A 2IUPA 1P22A 3FGBA 2G9AA 1XKSA 3MZKA 2J56H 3RSEC 4GGAA 3IJ0A 4GM8A 4JSXC 5FKSA 3UVKA 3EI3B 4FA5D 4J0XA 5EMKB 2AH0A 1Q47A 3K26A 5FQDA 3SVWD 4PBYA 3EI1B 3OKTA 4GZ8A 5FXYA 2H68A 2HXCA 4UI9R 3IJCA 5CXCA 1VYHC 2HKRA 4FA4D 4J8GA 4ZN4A 3NVXA 4PC0A 5IGQA 4A0BB 3RN1D 4A0BA 3CIKB 1K8KC 4PXWA 2AGLA 1N6DA 3C99A 4LGNA 3I7KA 2OIZA 2IUVA 4E5ZA 4X3EA 2HJBA 5TF2A 4JXMA 1B9XA 3JPXA 4GGDA 2P9IC 4TZ4A 4CI3A 2P9SC 2PBIB 2B5NA 5TEEA 1B9YA 5TDHB 3BWSA 3OKWA 3EG6A 5EMLB 3I8EA 4J78A 1SQJA 5CXCB 5I5JA 3JZHA 1OLZA 4ZOVA 5THAA 2I3SA 2HESX 2YNPA 3JROA 1PGUA 3DM0A 3DXMC 3I7NA 4J84A 3I2NA 5CYKA 2H14A 3GFCA 5C2VB 2IWFA 5IC7A 4O45A 3RFHA 4J86A 1U4CA 3VA6A 4OWRA 2AQ5A 4JSNC 2PM9A 5C9ZB 5FLXg 5AJAA 3N0DA 4PNKB 2YB8B 3C75H 4H5IA 4CZXA 3UVOA 2IAAA 3AH8B 4A2LA 3EI2A 2GC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4M D;  1TYQ C;  4FA1 D;  4GQ2 P;  5I5I A;  1JMZ B;  1GP2 B;  3OL2 A;  4CI8 A;  4IA9 A;  2CN3 A;  3ORV D;  5EAP A;  3PSL A;  3OKY A;  2H9P A;  3FM0 A;  4ES0 A;  3EMH A;  2Z2O A;  4QL1 A;  2G99 A;  5GMK n;  1ERJ A;  3L4O D;  4J73 A;  4J82 A;  4LG8 A;  3UKR C;  3UVM A;  3SLE D;  4R7A B;  3JRP A;  2CE8 A;  3N0E A;  1R5M A;  4NSX A;  5EMJ B;  4A11 B;  4CY2 A;  1PEV A;  4K3J B;  2YNN A;  3EU7 A;  1PI6 A;  3EI4 B;  3SBP A;  4BH6 A;  3P4F A;  4L9O A;  1GOT B;  3JZG A;  2AGX A;  2I0T A;  2QXV A;  5EM2 A;  2I0R A;  4K3I D;  5IGO A;  3SFZ A;  1SHY B;  5CXB A;  4A09 B;  4FAV D;  5FKR A;  3CFV A;  1PBY B;  1L0Q A;  4XYH A;  5HQG A;  2OVQ B;  5EAM A;  2BBK H;  5IT9 g;  3EI2 B;  3JB9 L;  2GC4 A;  3IKO A;  3UKU C;  4CY5 A;  3MKQ A;  3IIY A;  1S4U X;  2CE9 A;  3EI3 A;  4ERY A;  4A0A A;  2P9U C;  1NR0 A;  1A0R B;  1MDA H;  4FWW A;  5B4W A;  2OK4 A;  3MMY A;  3OL2 B;  4AEZ A;  4FAN D;  4QT8 A;  2Z2N A;  4ZOX A;  3VGZ A;  4X63 B;  3NVN A;  5H17 A;  2H9N A;  3RFG A;  2PM6 B;  3UVN A;  2EBS A;  3A0F A;  3SJL D;  1XHM A;  5EAR A;  4H5J A;  4O9D A;  4KFM B;  2HJ4 A;  5EMM B;  2BCJ B;  5SXM A;  5TEF A;  4X61 B;  4GQB B;  4E54 A;  4L1Q D;  3OW8 A;  4HDJ A;  5GXH A;  3V5W B;  5FA5 B;  3SBQ A;  3K27 A;  2UZX B;  3PVU B;  1YFQ A;  4FHL A;  4Y5R D;  4A08 A;  3F3G A;  4O1Q D;  5AMS A;  4GMB A;  2H3X A;  3JZN A;  5HE1 B;  4JSV C;  5H14 A;  4CZV A;  4OZU A;  3UR4 A;  4QQE A;  3PXT D;  2HKM A;  2W18 A;  4L3H D;  2H6Q A;  2J57 G;  4ZOY A;  4L3G D;  3SBR A;  3KRX B;  5K1C C;  3C9C A;  2YMU A;  5EM2 B;  2H9L A;  4A08 B;  4Z8L A;  4J81 A;  2OVP B;  2I3T A;  4D6V A;  3FRX A;  3DSM A;  5IJ7 E;  4U1E I;  2OVR B;  3PE7 A;  3UVL A;  3IJ1 A;  4AOW A;  4A11 A;  4CI2 A;  2CO0 A;  2P9N C;  5AFU 3;  1U2V C;  4E54 B;  3B7F A;  2AH1 A;  5I5M A;  4JT6 C;  4XYI A;  3J81 g;  1JMX B;  3GRE A;  3EI1 A;  3DXK C;  1OMW B;  4J79 A;  1GXR A;  4CY3 A;  1JJU B;  1JOF A;  5K19 A;  2H9M A;  3JAM g;  1N6F A;  3OKY B;  4BUJ C;  4A7J A;  2XU7 A;  3PXW D;  2Q7Q A;  4J0W A;  1RI6 A;  3PSC B;  4QRJ A;  2H6K A;  3CFS B;  2XL3 A;  4JT5 C;  2CNX A;  4D0K A;  5JWZ A;  3J80 g;  3MXX A;  4A0A B;  2B5L A;  1MG3 A;  3U4Y A;  2PM9 B;  4A2M A;  1MG2 A;  3VH0 A;  5IJ8 E;  3SWS D;  4ERZ A;  4JSP C;  2AGY A;  2IUR A;  2XYI A;  4FB1 D;  3SMR A;  2HYE A;  4BL0 A;  4FA9 D;  5C2W B;  2Z2P A;  4J87 A;  3I89 A;  4GQ1 A;  1TBG A;  3DWL C;  3F3P A;  4JD2 C;  4YVD A;  1QNI A;  4PSW B;  5FKT A;  3RMZ D;  4O3T B;  3PXS D;  4EWR A;  3ZWL B;  2P9P C;  3EI4 A;  4MK0 B;  5A2Q g;  5KDO B;  2GNQ A;  1NEX B;  3ULE C;  4XEI C;  2IUQ A;  4GGC A;  4PBZ A;  2OK6 A;  4A09 A;  3I7O A;  2P9K C;  5HE2 B;  4J8B A;  5CXB B;  4N14 A;  4Y7R A;  1SQ9 A;  2H47 A;  5GXI A;  4LG9 A;  4IMM A;  2UZY B;  5H1M A;  2H6N A;  3E0C A;  4E5Z B;  1FWX A;  2PM7 B;  3RRM C;  3AFC A;  3SCY A;  1XIP A;  2QC5 A;  2B4E A;  3OTT A;  4O3U B;  2YBA A;  4CC9 A;  2J55 H;  3I7P A;  5HE0 B;  3AL9 A;  5FKQ A;  4G56 B;  2AGW A;  3SXT D;  3BG1 A;  2AGZ A;  3RN0 D;  4PSX B;  4ZOZ A;  2YNO A;  3I7H A;  2CN2 A;  3NVQ A;  3PVW B;  2TRC B;  3EWE A;  3BG0 A;  4GM3 A;  5HYN B;  3SN6 B;  2MTA H;  3I8C A;  4ERQ A;  3HFQ A;  2H13 A;  1K32 A;  1GG2 B;  3F3F A;  2XL2 A;  4GM9 A;  3IIW A;  2P9L C;  5HE3 B;  3AL8 A;  3V7D B;  3C5M A;  3AL8 B;  2CO0 C;  4ESG A;  2OJY A;  3KRW B;  4I79 A;  5CYK B;  1N6E A;  3MKS B;  4CZY A;  2IWK A;  4J77 A;  3ODT A;  3RLM D;  3SHF A;  2O9K A;  3MZL A;  4CY1 A;  3V9F A;  4CI1 A;  5GSA A;  5EAL A;  4U7A A;  3I7L A;  2B5M A;  4X60 B;  2I0S A;  3W15 A;  2IUP A;  1P22 A;  3FGB A;  2G9A A;  1XKS A;  3MZK A;  2J56 H;  3RSE C;  4GGA A;  3IJ0 A;  4GM8 A;  4JSX C;  5FKS A;  3UVK A;  3EI3 B;  4FA5 D;  4J0X A;  5EMK B;  2AH0 A;  1Q47 A;  3K26 A;  5FQD A;  3SVW D;  4PBY A;  3EI1 B;  3OKT A;  4GZ8 A;  5FXY A;  2H68 A;  2HXC A;  4UI9 R;  3IJC A;  5CXC A;  1VYH C;  2HKR A;  4FA4 D;  4J8G A;  4ZN4 A;  3NVX A;  4PC0 A;  5IGQ A;  4A0B B;  3RN1 D;  4A0B A;  3CIK B;  1K8K C;  4PXW A;  2AGL A;  1N6D A;  3C99 A;  4LGN A;  3I7K A;  2OIZ A;  2IUV A;  4E5Z A;  4X3E A;  2HJB A;  5TF2 A;  4JXM A;  1B9X A;  3JPX A;  4GGD A;  2P9I C;  4TZ4 A;  4CI3 A;  2P9S C;  2PBI B;  2B5N A;  5TEE A;  1B9Y A;  5TDH B;  3BWS A;  3OKW A;  3EG6 A;  5EML B;  3I8E A;  4J78 A;  1SQJ A;  5CXC B;  5I5J A;  3JZH A;  1OLZ A;  4ZOV A;  5THA A;  2I3S A;  2HES X;  2YNP A;  3JRO A;  1PGU A;  3DM0 A;  3DXM C;  3I7N A;  4J84 A;  3I2N A;  5CYK A;  2H14 A;  3GFC A;  5C2V B;  2IWF A;  5IC7 A;  4O45 A;  3RFH A;  4J86 A;  1U4C A;  3VA6 A;  4OWR A;  2AQ5 A;  4JSN C;  2PM9 A;  5C9Z B;  5FLX g;  5AJA A;  3N0D A;  4PNK B;  2YB8 B;  3C75 H;  4H5I A;  4CZX A;  3UVO A;  2IAA A;  3AH8 B;  4A2L A;  3EI2 A;  2GC7 A; 
#chains in the Genus database with same CATH topology
 1UTC A;  3L4M D;  1TYQ C;  4FA1 D;  4GQ2 P;  1U8C A;  5I5I A;  1JMZ B;  1GP2 B;  1GOG A;  3OL2 A;  4CI8 A;  4IA9 A;  3VI4 A;  2CN3 A;  3ORV D;  5EAP A;  1I2M B;  3PSL A;  1O6F A;  3OKY A;  2H9P A;  3QI0 A;  3FM0 A;  3O4J A;  4ES0 A;  3EMH A;  5M5R A;  2Z2O A;  4QL1 A;  2G99 A;  5GMK n;  1ERJ A;  3L4O D;  4J73 A;  4J82 A;  3T3M A;  4G1E A;  4LG8 A;  3UKR C;  2XE4 A;  3UVM A;  3SLE D;  4R7A B;  3JRP A;  2CE8 A;  3N0E A;  1R5M A;  4NSX A;  5EMJ B;  3OF7 A;  4A11 B;  4CY2 A;  5M5S A;  1PEV A;  4K3J B;  4WK2 A;  4BCC A;  2YNN A;  1BPO A;  3EU7 A;  1PI6 A;  5M5T A;  3EI4 B;  3SBP A;  4BH6 A;  4DNU A;  4L1M A;  3P4F A;  4L9O A;  4NAA A;  1GOT B;  3JZG A;  2AGX A;  2I0T A;  3IUJ A;  2QXV A;  5EM2 A;  2I0R A;  2QR5 A;  4K3I D;  5IGO A;  3SFZ A;  1E8M A;  1SHY B;  5CXB A;  4A09 B;  4FAV D;  5FKR A;  3CFV A;  1UOO A;  1PBY B;  5FFG A;  1L0Q A;  4XYH A;  5HQG A;  2OVQ B;  5EAM A;  1M1X A;  1YR2 A;  2BBK H;  5IT9 g;  3EI2 B;  3JB9 L;  2GC4 A;  2VDO A;  3IKO A;  3UKU C;  4CY5 A;  3K71 A;  3MKQ A;  1H2Y A;  3NIG A;  3IIY A;  1S4U X;  2CE9 A;  3EI3 A;  4ERY A;  4A0A A;  3NIF A;  4WK0 A;  4IRZ A;  2P9U C;  1NR0 A;  1A0R B;  1MDA H;  4FWW A;  5B4W A;  2OK4 A;  3MMY A;  3OL2 B;  4AEZ A;  4FAN D;  4QT8 A;  2Z2N A;  3V4P A;  4D9S A;  2VDL A;  4ZOX A;  3VGZ A;  4X63 B;  3NVN A;  5H17 A;  1UOQ A;  2H9N A;  3RFG A;  2PM6 B;  3UVN A;  2EBS A;  3A0F A;  3SJL D;  4AN1 A;  2EID A;  1XHM A;  5EAR A;  4H5J A;  5E6R A;  5C92 A;  4AMZ A;  4O9D A;  1A12 A;  4KFM B;  3MUN A;  2HJ4 A;  5EMM B;  2BCJ B;  5SXM A;  5TEF A;  4GQB B;  4X61 B;  4E54 A;  4L1Q D;  3OW8 A;  4HDJ A;  5GXH A;  3V5W B;  5FA5 B;  3SBQ A;  3KCI A;  3K27 A;  2UZX B;  3PVU B;  1YFQ A;  4FHL A;  4Y5R D;  4A08 A;  3F3G A;  4O1Q D;  5AMS A;  4GMB A;  4RE6 A;  2H3X A;  3ZE2 A;  3JZN A;  5HE1 B;  4BP9 A;  4JSV C;  5H14 A;  4CZV A;  4NEN A;  4OZU A;  3UR4 A;  4QQE A;  4NBM A;  3PXT D;  2HKM A;  2W18 A;  4L3H D;  2H6Q A;  2J57 G;  4ZOY A;  4L3G D;  3SBR A;  3KRX B;  3FCU A;  1VE7 A;  5K1C C;  1VZ2 A;  3C9C A;  2YMU A;  5EM2 B;  1QFS A;  2H9L A;  4A08 B;  4Z8L A;  3IUN A;  4J81 A;  2OVP B;  5E6U A;  2I3T A;  4D6V A;  3FRX A;  3DSM A;  5IJ7 E;  4U1E I;  2OVR B;  3PE7 A;  3UVL A;  3IJ1 A;  4AOW A;  4A11 A;  4CI2 A;  2CO0 A;  4MMX A;  2P9N C;  5AFU 3;  1U2V C;  4E54 B;  4Z7O A;  3B7F A;  2AH1 A;  5I5M A;  4JT6 C;  4XYI A;  2VDN A;  3J81 g;  1JMX B;  3GRE A;  3O4G A;  3EI1 A;  3DXK C;  3IUQ A;  1OMW B;  4J79 A;  1GXR A;  4CY3 A;  1JJU B;  3O4I A;  1JOF A;  5K19 A;  2H9M A;  3JAM g;  1N6F A;  3OKY B;  4BUJ C;  2JKX A;  4A7J A;  2XU7 A;  3PXW D;  5M5U A;  2HU8 A;  3FCS A;  2Q7Q A;  4J0W A;  5E6S A;  1RI6 A;  3IUR A;  3PSC B;  4Z7N A;  4QRJ A;  2H6K A;  3ZDY A;  3CFS B;  2XL3 A;  4JT5 C;  2CNX A;  4D0K A;  4G1M A;  5JWZ A;  3J80 g;  3MXX A;  4A0A B;  2B5L A;  1MG3 A;  3U4Y A;  2PM9 B;  4A2M A;  1MG2 A;  3K6S A;  5IJ8 E;  3SWS D;  3VH0 A;  1JV2 A;  4WK4 A;  4ERZ A;  4JSP C;  4Z7Q A;  2AGY A;  2IUR A;  2XYI A;  4FB1 D;  3SMR A;  4AX4 A;  2HYE A;  4BL0 A;  4FA9 D;  5C2W B;  2Z2P A;  1UOP A;  4J87 A;  3I89 A;  4GQ1 A;  1TBG A;  3DWL C;  3F3P A;  4JD2 C;  4YVD A;  1QNI A;  4PSW B;  4O2W A;  5FKT A;  4O3T B;  2QZP A;  3PXS D;  3RMZ D;  1JTD B;  3IVM A;  1VE6 A;  4EWR A;  3ZWL B;  2P9P C;  3EI4 A;  4MK0 B;  1H2Z A;  2BKL A;  5A2Q g;  2VC2 A;  2VDR A;  2GNQ A;  5C86 A;  5KDO B;  3IUL A;  2HU7 A;  4QAM A;  1NEX B;  2WQ8 A;  5HDB A;  3ULE C;  4XEI C;  2IUQ A;  4GGC A;  4PBZ A;  3T3P A;  2OK6 A;  4A09 A;  3I7O A;  2P9K C;  5HE2 B;  4J8B A;  5CXB B;  4N14 A;  4Y7R A;  1SQ9 A;  2H47 A;  5GXI A;  4LG9 A;  4IMM A;  1H2W A;  2UZY B;  4WJK A;  5H1M A;  2H6N A;  3E0C A;  4E5Z B;  1FWX A;  3ZDZ A;  3EQ8 A;  2PM7 B;  1VZ3 A;  3RRM C;  3AFC A;  3SCY A;  1XIP A;  2QC5 A;  2B4E A;  3OTT A;  4O3U B;  2YBA A;  4BP8 A;  4CC9 A;  2J55 H;  3I7P A;  5HE0 B;  3AL9 A;  5FKQ A;  4G56 B;  2AGW A;  3SXT D;  3BG1 A;  2AGZ A;  3RN0 D;  4PSX B;  2EIC A;  2YNO A;  3I7H A;  4ZOZ A;  2CN2 A;  3NVQ A;  3PVW B;  2TRC B;  3EWE A;  3BG0 A;  4GM3 A;  5HYN B;  3SN6 B;  4JHN A;  2MTA H;  3I8C A;  3VI3 A;  5M5V A;  4ERQ A;  3HFQ A;  2H13 A;  1K32 A;  1GG2 B;  3F3F A;  1E8N A;  2XL2 A;  4GM9 A;  1L5G A;  3IIW A;  2P9L C;  5HE3 B;  3AL8 A;  3V7D B;  3C5M A;  3AL8 B;  2CO0 C;  4ESG A;  3GC3 B;  2OJY A;  3KRW B;  4I79 A;  2XZG A;  5CYK B;  1N6E A;  3MKS B;  3EQ7 A;  4CZY A;  2HU5 A;  2IWK A;  4J77 A;  3ODT A;  4O02 A;  3RLM D;  3SHF A;  2O9K A;  3MZL A;  4CY1 A;  3ZDX A;  3V9F A;  4CI1 A;  5GSA A;  5EAL A;  4U7A A;  3I7L A;  2B5M A;  4X60 B;  2I0S A;  3W15 A;  2IUP A;  1P22 A;  3FGB A;  4G55 A;  3QHY B;  2G9A A;  1C9L A;  1T2X A;  1XKS A;  3MZK A;  5M61 A;  3MVD K;  2J56 H;  3RSE C;  1H2X A;  4GGA A;  3IJ0 A;  4GM8 A;  4JSX C;  5FKS A;  3UVK A;  3EI3 B;  4FA5 D;  4J0X A;  5EMK B;  2AH0 A;  1Q47 A;  3K26 A;  4NC4 A;  5FQD A;  3SVW D;  3GD1 I;  4PBY A;  1C9I A;  3EI1 B;  3OKT A;  4GZ8 A;  5FXY A;  2H68 A;  2HXC A;  4UI9 R;  3IJC A;  5CXC A;  1VYH C;  2HKR A;  3K72 A;  4FA4 D;  1GOH A;  4J8G A;  4BCD A;  4ZN4 A;  3NVX A;  4PC0 A;  5IGQ A;  4A0B B;  3NID A;  2VDK A;  2EIB A;  3RN1 D;  4BCB A;  4A0B A;  3CIK B;  4UM8 A;  2VZ3 A;  1K8K C;  4PXW A;  2AGL A;  1N6D A;  4AN0 A;  3C99 A;  4LGN A;  5FFO A;  3I7K A;  4MMZ A;  3ZE0 A;  2OIZ A;  2IUV A;  4E5Z A;  4X3E A;  2HJB A;  1TYE A;  3ZE1 A;  5TF2 A;  3V4V A;  4JXM A;  1B9X A;  2VZ1 A;  3JPX A;  2P9I C;  4GGD A;  4TZ4 A;  3O4H A;  4CI3 A;  2P9S C;  2PBI B;  2VDM A;  2B5N A;  5TEE A;  1E5T A;  1B9Y A;  5TDH B;  3BWS A;  3MUO A;  1K3I A;  3OKW A;  3EG6 A;  5EML B;  3I8E A;  4J78 A;  4MMY A;  1SQJ A;  5CXC B;  2VDP A;  5I5J A;  2EIE A;  3JZH A;  3DDU A;  4AMY A;  1OLZ A;  4ZOV A;  5THA A;  2I3S A;  2HES X;  2YNP A;  3JRO A;  1PGU A;  3DM0 A;  3DXM C;  3I7N A;  3EQ9 A;  4J84 A;  3IUM A;  3I2N A;  5CYK A;  2VDQ A;  2H14 A;  3GFC A;  5C2V B;  2IWF A;  5IC7 A;  4O45 A;  3RFH A;  4JHP C;  4J86 A;  1U4C A;  3VA6 A;  4OWR A;  2AQ5 A;  4UM9 A;  3IJE A;  4JSN C;  4DNW A;  2PM9 A;  1QFM A;  5C9Z B;  4RE5 A;  2XDW A;  5FLX g;  1GOF A;  5AJA A;  4DNV A;  3N0D A;  4PNK B;  2YB8 B;  3C75 H;  4H5I A;  4CZX A;  1O6G A;  3UVO A;  2IAA A;  3AH8 B;  4A2L A;  3EI2 A;  2GC7 A; 
#chains in the Genus database with same CATH homology
 3L4M D;  1TYQ C;  4FA1 D;  4GQ2 P;  5I5I A;  1JMZ B;  1GP2 B;  3OL2 A;  4CI8 A;  4IA9 A;  2CN3 A;  3ORV D;  5EAP A;  3PSL A;  3OKY A;  2H9P A;  3FM0 A;  4ES0 A;  3EMH A;  2Z2O A;  4QL1 A;  2G99 A;  5GMK n;  1ERJ A;  3L4O D;  4J73 A;  4J82 A;  4LG8 A;  3UKR C;  3UVM A;  3SLE D;  4R7A B;  3JRP A;  2CE8 A;  3N0E A;  1R5M A;  4NSX A;  5EMJ B;  4A11 B;  4CY2 A;  1PEV A;  4K3J B;  2YNN A;  3EU7 A;  1PI6 A;  3EI4 B;  3SBP A;  4BH6 A;  3P4F A;  4L9O A;  1GOT B;  3JZG A;  2AGX A;  2I0T A;  2QXV A;  5EM2 A;  2I0R A;  4K3I D;  5IGO A;  3SFZ A;  1SHY B;  5CXB A;  4A09 B;  4FAV D;  5FKR A;  3CFV A;  1PBY B;  1L0Q A;  4XYH A;  5HQG A;  2OVQ B;  5EAM A;  2BBK H;  5IT9 g;  3EI2 B;  3JB9 L;  2GC4 A;  3IKO A;  3UKU C;  4CY5 A;  3MKQ A;  3IIY A;  1S4U X;  2CE9 A;  3EI3 A;  4ERY A;  4A0A A;  2P9U C;  1NR0 A;  1A0R B;  1MDA H;  4FWW A;  5B4W A;  2OK4 A;  3MMY A;  3OL2 B;  4AEZ A;  4FAN D;  4QT8 A;  2Z2N A;  4ZOX A;  3VGZ A;  4X63 B;  3NVN A;  5H17 A;  2H9N A;  3RFG A;  2PM6 B;  3UVN A;  2EBS A;  3A0F A;  3SJL D;  1XHM A;  5EAR A;  4H5J A;  4O9D A;  4KFM B;  2HJ4 A;  5EMM B;  2BCJ B;  5SXM A;  5TEF A;  4X61 B;  4GQB B;  4E54 A;  4L1Q D;  3OW8 A;  4HDJ A;  5GXH A;  3V5W B;  5FA5 B;  3SBQ A;  3K27 A;  2UZX B;  3PVU B;  1YFQ A;  4FHL A;  4Y5R D;  4A08 A;  3F3G A;  4O1Q D;  5AMS A;  4GMB A;  2H3X A;  3JZN A;  5HE1 B;  4JSV C;  5H14 A;  4CZV A;  4OZU A;  3UR4 A;  4QQE A;  3PXT D;  2HKM A;  2W18 A;  4L3H D;  2H6Q A;  2J57 G;  4ZOY A;  4L3G D;  3SBR A;  3KRX B;  5K1C C;  3C9C A;  2YMU A;  5EM2 B;  2H9L A;  4A08 B;  4Z8L A;  4J81 A;  2OVP B;  2I3T A;  4D6V A;  3FRX A;  3DSM A;  5IJ7 E;  4U1E I;  2OVR B;  3PE7 A;  3UVL A;  3IJ1 A;  4AOW A;  4A11 A;  4CI2 A;  2CO0 A;  2P9N C;  5AFU 3;  1U2V C;  4E54 B;  3B7F A;  2AH1 A;  5I5M A;  4JT6 C;  4XYI A;  3J81 g;  1JMX B;  3GRE A;  3EI1 A;  3DXK C;  1OMW B;  4J79 A;  1GXR A;  4CY3 A;  1JJU B;  1JOF A;  5K19 A;  2H9M A;  3JAM g;  1N6F A;  3OKY B;  4BUJ C;  4A7J A;  2XU7 A;  3PXW D;  2Q7Q A;  4J0W A;  1RI6 A;  3PSC B;  4QRJ A;  2H6K A;  3CFS B;  2XL3 A;  4JT5 C;  2CNX A;  4D0K A;  5JWZ A;  3J80 g;  3MXX A;  4A0A B;  2B5L A;  1MG3 A;  3U4Y A;  2PM9 B;  4A2M A;  1MG2 A;  3VH0 A;  5IJ8 E;  3SWS D;  4ERZ A;  4JSP C;  2AGY A;  2IUR A;  2XYI A;  4FB1 D;  3SMR A;  2HYE A;  4BL0 A;  4FA9 D;  5C2W B;  2Z2P A;  4J87 A;  3I89 A;  4GQ1 A;  1TBG A;  3DWL C;  3F3P A;  4JD2 C;  4YVD A;  1QNI A;  4PSW B;  5FKT A;  3RMZ D;  4O3T B;  3PXS D;  4EWR A;  3ZWL B;  2P9P C;  3EI4 A;  4MK0 B;  5A2Q g;  5KDO B;  2GNQ A;  1NEX B;  3ULE C;  4XEI C;  2IUQ A;  4GGC A;  4PBZ A;  2OK6 A;  4A09 A;  3I7O A;  2P9K C;  5HE2 B;  4J8B A;  5CXB B;  4N14 A;  4Y7R A;  1SQ9 A;  2H47 A;  5GXI A;  4LG9 A;  4IMM A;  2UZY B;  5H1M A;  2H6N A;  3E0C A;  4E5Z B;  1FWX A;  2PM7 B;  3RRM C;  3AFC A;  3SCY A;  1XIP A;  2QC5 A;  2B4E A;  3OTT A;  4O3U B;  2YBA A;  4CC9 A;  2J55 H;  3I7P A;  5HE0 B;  3AL9 A;  5FKQ A;  4G56 B;  2AGW A;  3SXT D;  3BG1 A;  2AGZ A;  3RN0 D;  4PSX B;  4ZOZ A;  2YNO A;  3I7H A;  2CN2 A;  3NVQ A;  3PVW B;  2TRC B;  3EWE A;  3BG0 A;  4GM3 A;  5HYN B;  3SN6 B;  2MTA H;  3I8C A;  4ERQ A;  3HFQ A;  2H13 A;  1K32 A;  1GG2 B;  3F3F A;  2XL2 A;  4GM9 A;  3IIW A;  2P9L C;  5HE3 B;  3AL8 A;  3V7D B;  3C5M A;  3AL8 B;  2CO0 C;  4ESG A;  2OJY A;  3KRW B;  4I79 A;  5CYK B;  1N6E A;  3MKS B;  4CZY A;  2IWK A;  4J77 A;  3ODT A;  3RLM D;  3SHF A;  2O9K A;  3MZL A;  4CY1 A;  3V9F A;  4CI1 A;  5GSA A;  5EAL A;  4U7A A;  3I7L A;  2B5M A;  4X60 B;  2I0S A;  3W15 A;  2IUP A;  1P22 A;  3FGB A;  2G9A A;  1XKS A;  3MZK A;  2J56 H;  3RSE C;  4GGA A;  3IJ0 A;  4GM8 A;  4JSX C;  5FKS A;  3UVK A;  3EI3 B;  4FA5 D;  4J0X A;  5EMK B;  2AH0 A;  1Q47 A;  3K26 A;  5FQD A;  3SVW D;  4PBY A;  3EI1 B;  3OKT A;  4GZ8 A;  5FXY A;  2H68 A;  2HXC A;  4UI9 R;  3IJC A;  5CXC A;  1VYH C;  2HKR A;  4FA4 D;  4J8G A;  4ZN4 A;  3NVX A;  4PC0 A;  5IGQ A;  4A0B B;  3RN1 D;  4A0B A;  3CIK B;  1K8K C;  4PXW A;  2AGL A;  1N6D A;  3C99 A;  4LGN A;  3I7K A;  2OIZ A;  2IUV A;  4E5Z A;  4X3E A;  2HJB A;  5TF2 A;  4JXM A;  1B9X A;  3JPX A;  4GGD A;  2P9I C;  4TZ4 A;  4CI3 A;  2P9S C;  2PBI B;  2B5N A;  5TEE A;  1B9Y A;  5TDH B;  3BWS A;  3OKW A;  3EG6 A;  5EML B;  3I8E A;  4J78 A;  1SQJ A;  5CXC B;  5I5J A;  3JZH A;  1OLZ A;  4ZOV A;  5THA A;  2I3S A;  2HES X;  2YNP A;  3JRO A;  1PGU A;  3DM0 A;  3DXM C;  3I7N A;  4J84 A;  3I2N A;  5CYK A;  2H14 A;  3GFC A;  5C2V B;  2IWF A;  5IC7 A;  4O45 A;  3RFH A;  4J86 A;  1U4C A;  3VA6 A;  4OWR A;  2AQ5 A;  4JSN C;  2PM9 A;  5C9Z B;  5FLX g;  5AJA A;  3N0D A;  4PNK B;  2YB8 B;  3C75 H;  4H5I A;  4CZX A;  3UVO A;  2IAA A;  3AH8 B;  4A2L A;  3EI2 A;  2GC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...