4PC0A

Structure of the human rbap48-mta1(670-711) complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
402
structure length
402
Chain Sequence
DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the architecture of the NuRD complex: Structure of the RbAp48-MTA1 sub-complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Histone-binding protein RBBP4
total genus 94
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4pc0A00
3I7OA 5EAMA 3OKYA 5HYNB 4L1QD 2IUPA 4N14A 5C9ZB 4J8GA 5C2WB 2AGXA 1MG2A 4CZYA 4IMMA 5HE0B 3K26A 5K19A 3L4MD 2P9LC 5JWZA 2GC4A 3ZWLB 2YNOA 3MZLA 4O1QD 1XHMA 5I5IA 2CE9A 4GM8A 4FWWA 3GFCA 5IT9g 4CY5A 1PI6A 3EMHA 3SJLD 3AL9A 4J73A 1NEXB 3IJ0A 2PM6B 3CFSB 2UZYB 2H6NA 3OW8A 3AH8B 5FLXg 1S4UX 3PXTD 2OIZA 1YFQA 1JMZB 2J55H 3OKWA 2MTAH 3NVQA 4A08A 5IC7A 3JPXA 2H3XA 2P9IC 4J0WA 2YNPA 2PM7B 2EBSA 2O9KA 3SBPA 3AL8B 4CY2A 2AQ5A 4O9DA 3SCYA 4H5JA 3PSLA 4A0BB 3IIWA 1U4CA 4J79A 4OWRA 3I7NA 4A2LA 4CY1A 3PVUB 3UVOA 4J0XA 2I0TA 4TZ4A 4GZ8A 4PBYA 3KRXB 4PC0A 1GOTB 4JT5C 3OTTA 3B7FA 1JMXB 5FKTA 4IA9A 5B4WA 5GSAA 3GREA 3RN1D 5GXIA 3JZHA 2B5MA 4FA4D 3J80g 3IJCA 3EWEA 4JT6C 1TYQC 3SLED 2AGWA 4GM9A 4GQ1A 3JZGA 4ERYA 1GXRA 3BWSA 2P9UC 4A0AA 5FKQA 1N6FA 3FRXA 4O3UB 5IJ7E 4ZOXA 5HE3B 5TF2A 3DSMA 5EMLB 3EI2A 4QT8A 2HJ4A 2P9NC 2AGLA 3OL2B 2OVQB 4FAND 3C5MA 5EMKB 2IAAA 1GP2B 2J57G 3ULEC 3L4OD 5IGOA 3U4YA 2H47A 4J81A 4QRJA 5CXBA 3F3PA 3PVWB 2G9AA 2HXCA 4X60B 2HYEA 2H9NA 3SWSD 4NSXA 5EARA 3CIKB 3IIYA 4GM3A 2HKMA 5EALA 3NVNA 3RN0D 3MMYA 4A08B 1XKSA 3V5WB 4O45A 2GC7A 3I7HA 4GGDA 5AJAA 2GNQA 4PSWB 2P9KC 3EI1B 4FA1D 2OK6A 4FB1D 3RMZD 2HKRA 2H9PA 3EI4B 1QNIA 4BL0A 4OZUA 3I7KA 5HE2B 3KRWB 4QL1A 5FXYA 5H17A 3UVMA 3MKSB 5C2VB 1SQJA 3EI3A 4U1EI 2OJYA 5H1MA 4I79A 4H5IA 3SVWD 1K32A 4CI2A 3N0EA 1L0QA 4FA5D 4KFMB 5TEEA 2YBAA 2OK4A 3OKYB 2BBKH 4XYIA 5EM2A 2H9MA 2B4EA 5FKSA 3MKQA 3VA6A 5AFU3 2IUVA 1PGUA 2I0SA 4E5ZA 4L9OA 2B5NA 4J87A 1SQ9A 4Y7RA 2PM9B 4E54A 2HESX 2H14A 4L3HD 3RSEC 2H6KA 4ZOVA 4D0KA 5CXBB 2OVRB 3FM0A 2B5LA 1JJUB 2HJBA 3IJ1A 4A11A 3C75H 4J78A 2XU7A 5SXMA 2XL2A 3SMRA 2OVPB 3AL8A 5GMKn 1OLZA 1ERJA 4J77A 5EAPA 5HQGA 4JSPC 4A0BA 2YB8B 4J82A 3I8EA 3UR4A 3V7DB 4Y5RD 2Z2NA 4ZOYA 2I3SA 4GGCA 4AEZA 2I3TA 5EMMB 4CI1A 2CE8A 5THAA 4ES0A 2QC5A 4HDJA 3PXWD 2IWKA 2P9SC 3V9FA 4FA9D 3PXSD 3JB9L 2H13A 3PE7A 1GG2B 3JAMg 2Q7QA 4PNKB 3CFVA 3W15A 3VH0A 4A09A 2H6QA 2TRCB 4K3ID 3RFGA 3BG0A 4R7AB 3RLMD 4ERQA 4FHLA 3P4FA 2Z2PA 4J8BA 5H14A 3BG1A 4CI8A 5KDOB 4A09B 4UI9R 5CYKB 1N6DA 3VGZA 2H9LA 4JSNC 3UKRC 4QQEA 3K27A 3I7LA 2CO0A 3I2NA 2PBIB 3UVNA 1B9XA 3OKTA 3E0CA 4CZVA 3EG6A 3JROA 2Z2OA 1OMWB 4X61B 2H68A 1A0RB 3JZNA 4LGNA 3MZKA 1MG3A 3IKOA 4ERZA 3ORVD 4J86A 5CYKA 4X63B 3UVLA 4PXWA 3EI1A 2AGYA 1MDAH 1K8KC 1SHYB 3OL2A 4GQBB 4PBZA 3ODTA 4GMBA 4A2MA 2CO0C 4ZN4A 1R5MA 1U2VC 3FGBA 3SXTD 5HE1B 3UVKA 4A11B 3AFCA 3NVXA 5I5JA 3EI3B 4X3EA 2XL3A 1PBYB 2I0RA 4O3TB 2AGZA 3PSCB 4BH6A 5GXHA 5FA5B 2CN3A 5TEFA 1B9YA 3EU7A 3SHFA 1VYHC 4D6VA 4ESGA 4L3GD 5TDHB 3DM0A 4JSVC 4K3JB 3RFHA 4PSXB 5EM2B 5K1CC 4JSXC 3F3GA 2BCJB 3UKUC 3F3FA 4XYHA 1P22A 4GQ2P 2CNXA 3EI4A 3I7PA 4LG9A 3RRMC 5IJ8E 2PM9A 4E54B 3SBRA 3C99A 4MK0B 3DXMC 2P9PC 4LG8A 4EWRA 3JRPA 5A2Qg 3HFQA 2J56H 3N0DA 5IGQA 4A0AB 2G99A 4XEIC 5CXCB 3I8CA 2W18A 3SN6B 4JXMA 3EI2B 2UZXB 4A7JA 1Q47A 1FWXA 1XIPA 3MXXA 1N6EA 4JD2C 3I89A 5FKRA 4J84A 3DXKC 1TBGA 4BUJC 2IUQA 1JOFA 3SFZA 4ZOZA 3C9CA 5EMJB 2QXVA 5FQDA 3A0FA 5I5MA 5CXCA 2YMUA 2AH1A 4FAVD 2YNNA 2IURA 2XYIA 1RI6A 1NR0A 2CN2A 1PEVA 2AH0A 4GGAA 4G56B 4AOWA 4E5ZB 4CZXA 4YVDA 3DWLC 4U7AA 5AMSA 4Z8LA 2IWFA 4CC9A 3J81g 4CI3A 4CY3A 3SBQA
chains in the Genus database with same CATH superfamily
3I7OA 5EAMA 3OKYA 5HYNB 2XE4A 4L1QD 2IUPA 4DNWA 5M5VA 4N14A 5C9ZB 4J8GA 5C2WB 2AGXA 1MG2A 4CZYA 2VC2A 4IMMA 5HE0B 3K26A 1I2MB 5K19A 1E8MA 3L4MD 1O6FA 3IULA 2P9LC 5JWZA 2GC4A 3ZWLB 2YNOA 3MZLA 4O1QD 2EIBA 1XHMA 3O4HA 5I5IA 2CE9A 4GM8A 4FWWA 3GFCA 5IT9g 2XZGA 4CY5A 4WK0A 1PI6A 3EMHA 3SJLD 3AL9A 4J73A 1NEXB 3IJ0A 5E6RA 2PM6B 3CFSB 2HU7A 2UZYB 3V4PA 2H6NA 3OW8A 3AH8B 5FLXg 1S4UX 3PXTD 2OIZA 3OF7A 1YFQA 5HDBA 1JMZB 2J55H 3OKWA 2MTAH 1E8NA 3NVQA 4A08A 5IC7A 3JPXA 2H3XA 2P9IC 4J0WA 2YNPA 2PM7B 3ZE0A 3K72A 2EBSA 2O9KA 4NBMA 4WJKA 3SBPA 3AL8B 4CY2A 2AQ5A 4O9DA 3SCYA 3NIFA 3ZE1A 4H5JA 3PSLA 4A0BB 3IIWA 1U4CA 3FCUA 4J79A 4OWRA 3I7NA 4A2LA 4CY1A 4Z7OA 3PVUB 3IUQA 3ZDZA 3UVOA 3T3PA 4J0XA 1UOQA 2I0TA 4TZ4A 3T3MA 4GZ8A 4PBYA 3KRXB 4PC0A 1GOTB 4JT5C 3ZE2A 3OTTA 3B7FA 1JMXB 4AN1A 3MVDK 5FKTA 4IA9A 5B4WA 5GSAA 3GREA 3RN1D 5GXIA 3JZHA 1YR2A 2B5MA 2BKLA 1A12A 1H2WA 4FA4D 1E5TA 3J80g 3IJCA 3EWEA 2QR5A 1TYQC 4JT6C 3O4JA 3SLED 3GC3B 4JHNA 2AGWA 4GM9A 4GQ1A 3JZGA 4ERYA 1GXRA 3BWSA 2P9UC 4A0AA 5FKQA 1N6FA 3FRXA 4O3UB 5IJ7E 1GOHA 4ZOXA 5HE3B 5TF2A 3DSMA 5EMLB 3EI2A 4QT8A 2HJ4A 2P9NC 2AGLA 3OL2B 2OVQB 4FAND 3C5MA 5EMKB 2IAAA 1GP2B 2J57G 3IUMA 3ULEC 4BCDA 1C9IA 3L4OD 5IGOA 3U4YA 2H47A 4J81A 4QRJA 5CXBA 3F3PA 3PVWB 1VE6A 2G9AA 2HXCA 1QFSA 4X60B 2HYEA 2H9NA 3MUNA 3SWSD 4NSXA 5EARA 4BP8A 4G1EA 3CIKB 1H2ZA 3IIYA 4GM3A 2HKMA 5EALA 3NVNA 3RN0D 3MMYA 4A08B 1XKSA 3V5WB 4O45A 2GC7A 3I7HA 1JTDB 4GGDA 5AJAA 2GNQA 4PSWB 2P9KC 3EI1B 3FCSA 4FA1D 2OK6A 4FB1D 3RMZD 2HKRA 2H9PA 3EI4B 1QNIA 4BL0A 5C92A 4OZUA 3I7KA 5HE2B 1C9LA 4WK4A 3KRWB 4QL1A 5FXYA 5H17A 3UVMA 3MKSB 5C2VB 1SQJA 3EI3A 4U1EI 2OJYA 5H1MA 2HU8A 4I79A 4H5IA 4NENA 3SVWD 1K32A 4CI2A 3N0EA 4RE5A 1L0QA 4DNUA 4FA5D 4KFMB 5TEEA 2YBAA 2OK4A 3OKYB 3VI4A 2BBKH 3O4IA 2EIEA 4XYIA 2HU5A 5EM2A 2H9MA 2VZ3A 2B4EA 5FKSA 4AMZA 3MKQA 5M61A 3VA6A 5AFU3 2IUVA 1PGUA 2I0SA 2VDRA 4E5ZA 4L9OA 2B5NA 4J87A 1UOPA 1SQ9A 4Y7RA 5M5SA 4AN0A 2PM9B 4E54A 2WQ8A 2HESX 1L5GA 2H14A 1GOFA 1QFMA 2EICA 1U8CA 3MUOA 4L3HD 4RE6A 3RSEC 2H6KA 4ZOVA 4D0KA 3QI0A 2OVRB 4MMZA 3FM0A 5CXBB 2B5LA 1JJUB 2HJBA 3IJ1A 4A11A 3C75H 4J78A 2XU7A 5SXMA 2XL2A 5E6SA 3SMRA 4QAMA 2OVPB 1TYEA 3AL8A 1H2XA 5GMKn 1OLZA 1VZ3A 1ERJA 4J77A 5EAPA 5HQGA 4JSPC 3IJEA 4A0BA 3ZDXA 2YB8B 4J82A 3I8EA 3UR4A 3V7DB 4Y5RD 1O6GA 2Z2NA 4ZOYA 2I3SA 4GGCA 4AEZA 2I3TA 1VZ2A 5EMMB 4CI1A 2CE8A 2VDQA 5THAA 3EQ7A 2VDNA 4ES0A 2QC5A 4HDJA 5C86A 3PXWD 2IWKA 2P9SC 3V9FA 4FA9D 3PXSD 3JB9L 2H13A 3PE7A 1GG2B 3JAMg 4Z7NA 2VDMA 2Q7QA 4PNKB 3CFVA 3W15A 3VH0A 4A09A 2VDKA 2H6QA 2TRCB 4AMYA 3KCIA 4UM9A 4K3ID 3RFGA 3NIGA 3BG0A 1JV2A 4R7AB 3RLMD 4MMYA 4ERQA 4FHLA 3P4FA 2Z2PA 3IVMA 4J8BA 5H14A 4NAAA 3BG1A 4CI8A 1UOOA 3IUJA 5KDOB 4A09B 4UI9R 5CYKB 1N6DA 3VGZA 3VI3A 2H9LA 4JSNC 3UKRC 4QQEA 3K27A 3I7LA 2VDLA 2CO0A 3I2NA 2PBIB 5FFGA 3UVNA 1B9XA 3OKTA 3E0CA 4BCCA 4MMXA 4CZVA 4Z7QA 3EG6A 3JROA 5M5UA 2Z2OA 1OMWB 3NIDA 4X61B 2H68A 1A0RB 3JZNA 4LGNA 3MZKA 1MG3A 3IKOA 2VZ1A 4ERZA 3QHYB 3ORVD 4J86A 5CYKA 4X63B 3UVLA 4G55A 4PXWA 3EI1A 2AGYA 1MDAH 1K8KC 3O4GA 1SHYB 3OL2A 4GQBB 4PBZA 3ODTA 4GMBA 4NC4A 4A2MA 2CO0C 4ZN4A 2VDPA 1R5MA 1U2VC 3K6SA 3FGBA 1UTCA 3SXTD 5E6UA 4BCBA 4JHPC 2QZPA 5HE1B 3UVKA 4A11B 3AFCA 3NVXA 5I5JA 4G1MA 3EI3B 4X3EA 2XL3A 1PBYB 2I0RA 4O3TB 2AGZA 3PSCB 1VE7A 1H2YA 4BH6A 5GXHA 5FA5B 2CN3A 5TEFA 1B9YA 3EU7A 3SHFA 1VYHC 4D6VA 4ESGA 4L3GD 5TDHB 3DM0A 4JSVC 4K3JB 3RFHA 4PSXB 5EM2B 5K1CC 4JSXC 4WK2A 3F3GA 3IUNA 2BCJB 1BPOA 3UKUC 3F3FA 4XYHA 1P22A 1GOGA 4GQ2P 2CNXA 3EI4A 2VDOA 3K71A 3I7PA 5FFOA 4LG9A 3RRMC 4O02A 5IJ8E 3EQ8A 2PM9A 4E54B 2XDWA 3SBRA 3C99A 4MK0B 3DXMC 2P9PC 4IRZA 4LG8A 4DNVA 4EWRA 3JRPA 1M1XA 2JKXA 5A2Qg 3HFQA 2J56H 3N0DA 5IGQA 4A0AB 2G99A 4XEIC 5CXCB 3I8CA 2W18A 3SN6B 4JXMA 3EI2B 4L1MA 2UZXB 1T2XA 4A7JA 4D9SA 1Q47A 1FWXA 1XIPA 3MXXA 1N6EA 4JD2C 3V4VA 3I89A 5FKRA 2EIDA 3DDUA 3GD1I 4J84A 4O2WA 3DXKC 1TBGA 3EQ9A 4BUJC 2IUQA 1JOFA 3SFZA 4ZOZA 5M5RA 3ZDYA 3C9CA 5EMJB 2QXVA 5FQDA 3A0FA 5I5MA 5CXCA 2YMUA 2AH1A 4FAVD 2YNNA 2IURA 2XYIA 4AX4A 1RI6A 1NR0A 2CN2A 1PEVA 2AH0A 4GGAA 4G56B 4AOWA 4E5ZB 4CZXA 4YVDA 4UM8A 4BP9A 3DWLC 4U7AA 5AMSA 3IURA 1K3IA 5M5TA 4Z8LA 2IWFA 4CC9A 3J81g 4CI3A 4CY3A 3SBQA
chains in the Genus database with same CATH topology
3I7OA 5EAMA 3OKYA 5HYNB 4L1QD 2IUPA 4N14A 5C9ZB 4J8GA 5C2WB 2AGXA 1MG2A 4CZYA 4IMMA 5HE0B 3K26A 5K19A 3L4MD 2P9LC 5JWZA 2GC4A 3ZWLB 2YNOA 3MZLA 4O1QD 1XHMA 5I5IA 2CE9A 4GM8A 4FWWA 3GFCA 5IT9g 4CY5A 1PI6A 3EMHA 3SJLD 3AL9A 4J73A 1NEXB 3IJ0A 2PM6B 3CFSB 2UZYB 2H6NA 3OW8A 3AH8B 5FLXg 1S4UX 3PXTD 2OIZA 1YFQA 1JMZB 2J55H 3OKWA 2MTAH 3NVQA 4A08A 5IC7A 3JPXA 2H3XA 2P9IC 4J0WA 2YNPA 2PM7B 2EBSA 2O9KA 3SBPA 3AL8B 4CY2A 2AQ5A 4O9DA 3SCYA 4H5JA 3PSLA 4A0BB 3IIWA 1U4CA 4J79A 4OWRA 3I7NA 4A2LA 4CY1A 3PVUB 3UVOA 4J0XA 2I0TA 4TZ4A 4GZ8A 4PBYA 3KRXB 4PC0A 1GOTB 4JT5C 3OTTA 3B7FA 1JMXB 5FKTA 4IA9A 5B4WA 5GSAA 3GREA 3RN1D 5GXIA 3JZHA 2B5MA 4FA4D 3J80g 3IJCA 3EWEA 4JT6C 1TYQC 3SLED 2AGWA 4GM9A 4GQ1A 3JZGA 4ERYA 1GXRA 3BWSA 2P9UC 4A0AA 5FKQA 1N6FA 3FRXA 4O3UB 5IJ7E 4ZOXA 5HE3B 5TF2A 3DSMA 5EMLB 3EI2A 4QT8A 2HJ4A 2P9NC 2AGLA 3OL2B 2OVQB 4FAND 3C5MA 5EMKB 2IAAA 1GP2B 2J57G 3ULEC 3L4OD 5IGOA 3U4YA 2H47A 4J81A 4QRJA 5CXBA 3F3PA 3PVWB 2G9AA 2HXCA 4X60B 2HYEA 2H9NA 3SWSD 4NSXA 5EARA 3CIKB 3IIYA 4GM3A 2HKMA 5EALA 3NVNA 3RN0D 3MMYA 4A08B 1XKSA 3V5WB 4O45A 2GC7A 3I7HA 4GGDA 5AJAA 2GNQA 4PSWB 2P9KC 3EI1B 4FA1D 2OK6A 4FB1D 3RMZD 2HKRA 2H9PA 3EI4B 1QNIA 4BL0A 4OZUA 3I7KA 5HE2B 3KRWB 4QL1A 5FXYA 5H17A 3UVMA 3MKSB 5C2VB 1SQJA 3EI3A 4U1EI 2OJYA 5H1MA 4I79A 4H5IA 3SVWD 1K32A 4CI2A 3N0EA 1L0QA 4FA5D 4KFMB 5TEEA 2YBAA 2OK4A 3OKYB 2BBKH 4XYIA 5EM2A 2H9MA 2B4EA 5FKSA 3MKQA 3VA6A 5AFU3 2IUVA 1PGUA 2I0SA 4E5ZA 4L9OA 2B5NA 4J87A 1SQ9A 4Y7RA 2PM9B 4E54A 2HESX 2H14A 4L3HD 3RSEC 2H6KA 4ZOVA 4D0KA 5CXBB 2OVRB 3FM0A 2B5LA 1JJUB 2HJBA 3IJ1A 4A11A 3C75H 4J78A 2XU7A 5SXMA 2XL2A 3SMRA 2OVPB 3AL8A 5GMKn 1OLZA 1ERJA 4J77A 5EAPA 5HQGA 4JSPC 4A0BA 2YB8B 4J82A 3I8EA 3UR4A 3V7DB 4Y5RD 2Z2NA 4ZOYA 2I3SA 4GGCA 4AEZA 2I3TA 5EMMB 4CI1A 2CE8A 5THAA 4ES0A 2QC5A 4HDJA 3PXWD 2IWKA 2P9SC 3V9FA 4FA9D 3PXSD 3JB9L 2H13A 3PE7A 1GG2B 3JAMg 2Q7QA 4PNKB 3CFVA 3W15A 3VH0A 4A09A 2H6QA 2TRCB 4K3ID 3RFGA 3BG0A 4R7AB 3RLMD 4ERQA 4FHLA 3P4FA 2Z2PA 4J8BA 5H14A 3BG1A 4CI8A 5KDOB 4A09B 4UI9R 5CYKB 1N6DA 3VGZA 2H9LA 4JSNC 3UKRC 4QQEA 3K27A 3I7LA 2CO0A 3I2NA 2PBIB 3UVNA 1B9XA 3OKTA 3E0CA 4CZVA 3EG6A 3JROA 2Z2OA 1OMWB 4X61B 2H68A 1A0RB 3JZNA 4LGNA 3MZKA 1MG3A 3IKOA 4ERZA 3ORVD 4J86A 5CYKA 4X63B 3UVLA 4PXWA 3EI1A 2AGYA 1MDAH 1K8KC 1SHYB 3OL2A 4GQBB 4PBZA 3ODTA 4GMBA 4A2MA 2CO0C 4ZN4A 1R5MA 1U2VC 3FGBA 3SXTD 5HE1B 3UVKA 4A11B 3AFCA 3NVXA 5I5JA 3EI3B 4X3EA 2XL3A 1PBYB 2I0RA 4O3TB 2AGZA 3PSCB 4BH6A 5GXHA 5FA5B 2CN3A 5TEFA 1B9YA 3EU7A 3SHFA 1VYHC 4D6VA 4ESGA 4L3GD 5TDHB 3DM0A 4JSVC 4K3JB 3RFHA 4PSXB 5EM2B 5K1CC 4JSXC 3F3GA 2BCJB 3UKUC 3F3FA 4XYHA 1P22A 4GQ2P 2CNXA 3EI4A 3I7PA 4LG9A 3RRMC 5IJ8E 2PM9A 4E54B 3SBRA 3C99A 4MK0B 3DXMC 2P9PC 4LG8A 4EWRA 3JRPA 5A2Qg 3HFQA 2J56H 3N0DA 5IGQA 4A0AB 2G99A 4XEIC 5CXCB 3I8CA 2W18A 3SN6B 4JXMA 3EI2B 2UZXB 4A7JA 1Q47A 1FWXA 1XIPA 3MXXA 1N6EA 4JD2C 3I89A 5FKRA 4J84A 3DXKC 1TBGA 4BUJC 2IUQA 1JOFA 3SFZA 4ZOZA 3C9CA 5EMJB 2QXVA 5FQDA 3A0FA 5I5MA 5CXCA 2YMUA 2AH1A 4FAVD 2YNNA 2IURA 2XYIA 1RI6A 1NR0A 2CN2A 1PEVA 2AH0A 4GGAA 4G56B 4AOWA 4E5ZB 4CZXA 4YVDA 3DWLC 4U7AA 5AMSA 4Z8LA 2IWFA 4CC9A 3J81g 4CI3A 4CY3A 3SBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7O A;  5EAM A;  3OKY A;  5HYN B;  4L1Q D;  2IUP A;  4N14 A;  5C9Z B;  4J8G A;  5C2W B;  2AGX A;  1MG2 A;  4CZY A;  4IMM A;  5HE0 B;  3K26 A;  5K19 A;  3L4M D;  2P9L C;  5JWZ A;  2GC4 A;  3ZWL B;  2YNO A;  3MZL A;  4O1Q D;  1XHM A;  5I5I A;  2CE9 A;  4GM8 A;  4FWW A;  3GFC A;  5IT9 g;  4CY5 A;  1PI6 A;  3EMH A;  3SJL D;  3AL9 A;  4J73 A;  1NEX B;  3IJ0 A;  2PM6 B;  3CFS B;  2UZY B;  2H6N A;  3OW8 A;  3AH8 B;  5FLX g;  1S4U X;  3PXT D;  2OIZ A;  1YFQ A;  1JMZ B;  2J55 H;  3OKW A;  2MTA H;  3NVQ A;  4A08 A;  5IC7 A;  3JPX A;  2H3X A;  2P9I C;  4J0W A;  2YNP A;  2PM7 B;  2EBS A;  2O9K A;  3SBP A;  3AL8 B;  4CY2 A;  2AQ5 A;  4O9D A;  3SCY A;  4H5J A;  3PSL A;  4A0B B;  3IIW A;  1U4C A;  4J79 A;  4OWR A;  3I7N A;  4A2L A;  4CY1 A;  3PVU B;  3UVO A;  4J0X A;  2I0T A;  4TZ4 A;  4GZ8 A;  4PBY A;  3KRX B;  4PC0 A;  1GOT B;  4JT5 C;  3OTT A;  3B7F A;  1JMX B;  5FKT A;  4IA9 A;  5B4W A;  5GSA A;  3GRE A;  3RN1 D;  5GXI A;  3JZH A;  2B5M A;  4FA4 D;  3J80 g;  3IJC A;  3EWE A;  4JT6 C;  1TYQ C;  3SLE D;  2AGW A;  4GM9 A;  4GQ1 A;  3JZG A;  4ERY A;  1GXR A;  3BWS A;  2P9U C;  4A0A A;  5FKQ A;  1N6F A;  3FRX A;  4O3U B;  5IJ7 E;  4ZOX A;  5HE3 B;  5TF2 A;  3DSM A;  5EML B;  3EI2 A;  4QT8 A;  2HJ4 A;  2P9N C;  2AGL A;  3OL2 B;  2OVQ B;  4FAN D;  3C5M A;  5EMK B;  2IAA A;  1GP2 B;  2J57 G;  3ULE C;  3L4O D;  5IGO A;  3U4Y A;  2H47 A;  4J81 A;  4QRJ A;  5CXB A;  3F3P A;  3PVW B;  2G9A A;  2HXC A;  4X60 B;  2HYE A;  2H9N A;  3SWS D;  4NSX A;  5EAR A;  3CIK B;  3IIY A;  4GM3 A;  2HKM A;  5EAL A;  3NVN A;  3RN0 D;  3MMY A;  4A08 B;  1XKS A;  3V5W B;  4O45 A;  2GC7 A;  3I7H A;  4GGD A;  5AJA A;  2GNQ A;  4PSW B;  2P9K C;  3EI1 B;  4FA1 D;  2OK6 A;  4FB1 D;  3RMZ D;  2HKR A;  2H9P A;  3EI4 B;  1QNI A;  4BL0 A;  4OZU A;  3I7K A;  5HE2 B;  3KRW B;  4QL1 A;  5FXY A;  5H17 A;  3UVM A;  3MKS B;  5C2V B;  1SQJ A;  3EI3 A;  4U1E I;  2OJY A;  5H1M A;  4I79 A;  4H5I A;  3SVW D;  1K32 A;  4CI2 A;  3N0E A;  1L0Q A;  4FA5 D;  4KFM B;  5TEE A;  2YBA A;  2OK4 A;  3OKY B;  2BBK H;  4XYI A;  5EM2 A;  2H9M A;  2B4E A;  5FKS A;  3MKQ A;  3VA6 A;  5AFU 3;  2IUV A;  1PGU A;  2I0S A;  4E5Z A;  4L9O A;  2B5N A;  4J87 A;  1SQ9 A;  4Y7R A;  2PM9 B;  4E54 A;  2HES X;  2H14 A;  4L3H D;  3RSE C;  2H6K A;  4ZOV A;  4D0K A;  5CXB B;  2OVR B;  3FM0 A;  2B5L A;  1JJU B;  2HJB A;  3IJ1 A;  4A11 A;  3C75 H;  4J78 A;  2XU7 A;  5SXM A;  2XL2 A;  3SMR A;  2OVP B;  3AL8 A;  5GMK n;  1OLZ A;  1ERJ A;  4J77 A;  5EAP A;  5HQG A;  4JSP C;  4A0B A;  2YB8 B;  4J82 A;  3I8E A;  3UR4 A;  3V7D B;  4Y5R D;  2Z2N A;  4ZOY A;  2I3S A;  4GGC A;  4AEZ A;  2I3T A;  5EMM B;  4CI1 A;  2CE8 A;  5THA A;  4ES0 A;  2QC5 A;  4HDJ A;  3PXW D;  2IWK A;  2P9S C;  3V9F A;  4FA9 D;  3PXS D;  3JB9 L;  2H13 A;  3PE7 A;  1GG2 B;  3JAM g;  2Q7Q A;  4PNK B;  3CFV A;  3W15 A;  3VH0 A;  4A09 A;  2H6Q A;  2TRC B;  4K3I D;  3RFG A;  3BG0 A;  4R7A B;  3RLM D;  4ERQ A;  4FHL A;  3P4F A;  2Z2P A;  4J8B A;  5H14 A;  3BG1 A;  4CI8 A;  5KDO B;  4A09 B;  4UI9 R;  5CYK B;  1N6D A;  3VGZ A;  2H9L A;  4JSN C;  3UKR C;  4QQE A;  3K27 A;  3I7L A;  2CO0 A;  3I2N A;  2PBI B;  3UVN A;  1B9X A;  3OKT A;  3E0C A;  4CZV A;  3EG6 A;  3JRO A;  2Z2O A;  1OMW B;  4X61 B;  2H68 A;  1A0R B;  3JZN A;  4LGN A;  3MZK A;  1MG3 A;  3IKO A;  4ERZ A;  3ORV D;  4J86 A;  5CYK A;  4X63 B;  3UVL A;  4PXW A;  3EI1 A;  2AGY A;  1MDA H;  1K8K C;  1SHY B;  3OL2 A;  4GQB B;  4PBZ A;  3ODT A;  4GMB A;  4A2M A;  2CO0 C;  4ZN4 A;  1R5M A;  1U2V C;  3FGB A;  3SXT D;  5HE1 B;  3UVK A;  4A11 B;  3AFC A;  3NVX A;  5I5J A;  3EI3 B;  4X3E A;  2XL3 A;  1PBY B;  2I0R A;  4O3T B;  2AGZ A;  3PSC B;  4BH6 A;  5GXH A;  5FA5 B;  2CN3 A;  5TEF A;  1B9Y A;  3EU7 A;  3SHF A;  1VYH C;  4D6V A;  4ESG A;  4L3G D;  5TDH B;  3DM0 A;  4JSV C;  4K3J B;  3RFH A;  4PSX B;  5EM2 B;  5K1C C;  4JSX C;  3F3G A;  2BCJ B;  3UKU C;  3F3F A;  4XYH A;  1P22 A;  4GQ2 P;  2CNX A;  3EI4 A;  3I7P A;  4LG9 A;  3RRM C;  5IJ8 E;  2PM9 A;  4E54 B;  3SBR A;  3C99 A;  4MK0 B;  3DXM C;  2P9P C;  4LG8 A;  4EWR A;  3JRP A;  5A2Q g;  3HFQ A;  2J56 H;  3N0D A;  5IGQ A;  4A0A B;  2G99 A;  4XEI C;  5CXC B;  3I8C A;  2W18 A;  3SN6 B;  4JXM A;  3EI2 B;  2UZX B;  4A7J A;  1Q47 A;  1FWX A;  1XIP A;  3MXX A;  1N6E A;  4JD2 C;  3I89 A;  5FKR A;  4J84 A;  3DXK C;  1TBG A;  4BUJ C;  2IUQ A;  1JOF A;  3SFZ A;  4ZOZ A;  3C9C A;  5EMJ B;  2QXV A;  5FQD A;  3A0F A;  5I5M A;  5CXC A;  2YMU A;  2AH1 A;  4FAV D;  2YNN A;  2IUR A;  2XYI A;  1RI6 A;  1NR0 A;  2CN2 A;  1PEV A;  2AH0 A;  4GGA A;  4G56 B;  4AOW A;  4E5Z B;  4CZX A;  4YVD A;  3DWL C;  4U7A A;  5AMS A;  4Z8L A;  2IWF A;  4CC9 A;  3J81 g;  4CI3 A;  4CY3 A;  3SBQ A; 
#chains in the Genus database with same CATH topology
 3I7O A;  5EAM A;  3OKY A;  5HYN B;  2XE4 A;  4L1Q D;  2IUP A;  4DNW A;  5M5V A;  4N14 A;  5C9Z B;  4J8G A;  5C2W B;  2AGX A;  1MG2 A;  4CZY A;  2VC2 A;  4IMM A;  5HE0 B;  3K26 A;  1I2M B;  5K19 A;  1E8M A;  3L4M D;  1O6F A;  3IUL A;  2P9L C;  5JWZ A;  2GC4 A;  3ZWL B;  2YNO A;  3MZL A;  4O1Q D;  2EIB A;  1XHM A;  3O4H A;  5I5I A;  2CE9 A;  4GM8 A;  4FWW A;  3GFC A;  5IT9 g;  2XZG A;  4CY5 A;  4WK0 A;  1PI6 A;  3EMH A;  3SJL D;  3AL9 A;  4J73 A;  1NEX B;  3IJ0 A;  5E6R A;  2PM6 B;  3CFS B;  2HU7 A;  2UZY B;  3V4P A;  2H6N A;  3OW8 A;  3AH8 B;  5FLX g;  1S4U X;  3PXT D;  2OIZ A;  3OF7 A;  1YFQ A;  5HDB A;  1JMZ B;  2J55 H;  3OKW A;  2MTA H;  1E8N A;  3NVQ A;  4A08 A;  5IC7 A;  3JPX A;  2H3X A;  2P9I C;  4J0W A;  2YNP A;  2PM7 B;  3ZE0 A;  3K72 A;  2EBS A;  2O9K A;  4NBM A;  4WJK A;  3SBP A;  3AL8 B;  4CY2 A;  2AQ5 A;  4O9D A;  3SCY A;  3NIF A;  3ZE1 A;  4H5J A;  3PSL A;  4A0B B;  3IIW A;  1U4C A;  3FCU A;  4J79 A;  4OWR A;  3I7N A;  4A2L A;  4CY1 A;  4Z7O A;  3PVU B;  3IUQ A;  3ZDZ A;  3UVO A;  3T3P A;  4J0X A;  1UOQ A;  2I0T A;  4TZ4 A;  3T3M A;  4GZ8 A;  4PBY A;  3KRX B;  4PC0 A;  1GOT B;  4JT5 C;  3ZE2 A;  3OTT A;  3B7F A;  1JMX B;  4AN1 A;  3MVD K;  5FKT A;  4IA9 A;  5B4W A;  5GSA A;  3GRE A;  3RN1 D;  5GXI A;  3JZH A;  1YR2 A;  2B5M A;  2BKL A;  1A12 A;  1H2W A;  4FA4 D;  1E5T A;  3J80 g;  3IJC A;  3EWE A;  2QR5 A;  1TYQ C;  4JT6 C;  3O4J A;  3SLE D;  3GC3 B;  4JHN A;  2AGW A;  4GM9 A;  4GQ1 A;  3JZG A;  4ERY A;  1GXR A;  3BWS A;  2P9U C;  4A0A A;  5FKQ A;  1N6F A;  3FRX A;  4O3U B;  5IJ7 E;  1GOH A;  4ZOX A;  5HE3 B;  5TF2 A;  3DSM A;  5EML B;  3EI2 A;  4QT8 A;  2HJ4 A;  2P9N C;  2AGL A;  3OL2 B;  2OVQ B;  4FAN D;  3C5M A;  5EMK B;  2IAA A;  1GP2 B;  2J57 G;  3IUM A;  3ULE C;  4BCD A;  1C9I A;  3L4O D;  5IGO A;  3U4Y A;  2H47 A;  4J81 A;  4QRJ A;  5CXB A;  3F3P A;  3PVW B;  1VE6 A;  2G9A A;  2HXC A;  1QFS A;  4X60 B;  2HYE A;  2H9N A;  3MUN A;  3SWS D;  4NSX A;  5EAR A;  4BP8 A;  4G1E A;  3CIK B;  1H2Z A;  3IIY A;  4GM3 A;  2HKM A;  5EAL A;  3NVN A;  3RN0 D;  3MMY A;  4A08 B;  1XKS A;  3V5W B;  4O45 A;  2GC7 A;  3I7H A;  1JTD B;  4GGD A;  5AJA A;  2GNQ A;  4PSW B;  2P9K C;  3EI1 B;  3FCS A;  4FA1 D;  2OK6 A;  4FB1 D;  3RMZ D;  2HKR A;  2H9P A;  3EI4 B;  1QNI A;  4BL0 A;  5C92 A;  4OZU A;  3I7K A;  5HE2 B;  1C9L A;  4WK4 A;  3KRW B;  4QL1 A;  5FXY A;  5H17 A;  3UVM A;  3MKS B;  5C2V B;  1SQJ A;  3EI3 A;  4U1E I;  2OJY A;  5H1M A;  2HU8 A;  4I79 A;  4H5I A;  4NEN A;  3SVW D;  1K32 A;  4CI2 A;  3N0E A;  4RE5 A;  1L0Q A;  4DNU A;  4FA5 D;  4KFM B;  5TEE A;  2YBA A;  2OK4 A;  3OKY B;  3VI4 A;  2BBK H;  3O4I A;  2EIE A;  4XYI A;  2HU5 A;  5EM2 A;  2H9M A;  2VZ3 A;  2B4E A;  5FKS A;  4AMZ A;  3MKQ A;  5M61 A;  3VA6 A;  5AFU 3;  2IUV A;  1PGU A;  2I0S A;  2VDR A;  4E5Z A;  4L9O A;  2B5N A;  4J87 A;  1UOP A;  1SQ9 A;  4Y7R A;  5M5S A;  4AN0 A;  2PM9 B;  4E54 A;  2WQ8 A;  2HES X;  1L5G A;  2H14 A;  1GOF A;  1QFM A;  2EIC A;  1U8C A;  3MUO A;  4L3H D;  4RE6 A;  3RSE C;  2H6K A;  4ZOV A;  4D0K A;  3QI0 A;  2OVR B;  4MMZ A;  3FM0 A;  5CXB B;  2B5L A;  1JJU B;  2HJB A;  3IJ1 A;  4A11 A;  3C75 H;  4J78 A;  2XU7 A;  5SXM A;  2XL2 A;  5E6S A;  3SMR A;  4QAM A;  2OVP B;  1TYE A;  3AL8 A;  1H2X A;  5GMK n;  1OLZ A;  1VZ3 A;  1ERJ A;  4J77 A;  5EAP A;  5HQG A;  4JSP C;  3IJE A;  4A0B A;  3ZDX A;  2YB8 B;  4J82 A;  3I8E A;  3UR4 A;  3V7D B;  4Y5R D;  1O6G A;  2Z2N A;  4ZOY A;  2I3S A;  4GGC A;  4AEZ A;  2I3T A;  1VZ2 A;  5EMM B;  4CI1 A;  2CE8 A;  2VDQ A;  5THA A;  3EQ7 A;  2VDN A;  4ES0 A;  2QC5 A;  4HDJ A;  5C86 A;  3PXW D;  2IWK A;  2P9S C;  3V9F A;  4FA9 D;  3PXS D;  3JB9 L;  2H13 A;  3PE7 A;  1GG2 B;  3JAM g;  4Z7N A;  2VDM A;  2Q7Q A;  4PNK B;  3CFV A;  3W15 A;  3VH0 A;  4A09 A;  2VDK A;  2H6Q A;  2TRC B;  4AMY A;  3KCI A;  4UM9 A;  4K3I D;  3RFG A;  3NIG A;  3BG0 A;  1JV2 A;  4R7A B;  3RLM D;  4MMY A;  4ERQ A;  4FHL A;  3P4F A;  2Z2P A;  3IVM A;  4J8B A;  5H14 A;  4NAA A;  3BG1 A;  4CI8 A;  1UOO A;  3IUJ A;  5KDO B;  4A09 B;  4UI9 R;  5CYK B;  1N6D A;  3VGZ A;  3VI3 A;  2H9L A;  4JSN C;  3UKR C;  4QQE A;  3K27 A;  3I7L A;  2VDL A;  2CO0 A;  3I2N A;  2PBI B;  5FFG A;  3UVN A;  1B9X A;  3OKT A;  3E0C A;  4BCC A;  4MMX A;  4CZV A;  4Z7Q A;  3EG6 A;  3JRO A;  5M5U A;  2Z2O A;  1OMW B;  3NID A;  4X61 B;  2H68 A;  1A0R B;  3JZN A;  4LGN A;  3MZK A;  1MG3 A;  3IKO A;  2VZ1 A;  4ERZ A;  3QHY B;  3ORV D;  4J86 A;  5CYK A;  4X63 B;  3UVL A;  4G55 A;  4PXW A;  3EI1 A;  2AGY A;  1MDA H;  1K8K C;  3O4G A;  1SHY B;  3OL2 A;  4GQB B;  4PBZ A;  3ODT A;  4GMB A;  4NC4 A;  4A2M A;  2CO0 C;  4ZN4 A;  2VDP A;  1R5M A;  1U2V C;  3K6S A;  3FGB A;  1UTC A;  3SXT D;  5E6U A;  4BCB A;  4JHP C;  2QZP A;  5HE1 B;  3UVK A;  4A11 B;  3AFC A;  3NVX A;  5I5J A;  4G1M A;  3EI3 B;  4X3E A;  2XL3 A;  1PBY B;  2I0R A;  4O3T B;  2AGZ A;  3PSC B;  1VE7 A;  1H2Y A;  4BH6 A;  5GXH A;  5FA5 B;  2CN3 A;  5TEF A;  1B9Y A;  3EU7 A;  3SHF A;  1VYH C;  4D6V A;  4ESG A;  4L3G D;  5TDH B;  3DM0 A;  4JSV C;  4K3J B;  3RFH A;  4PSX B;  5EM2 B;  5K1C C;  4JSX C;  4WK2 A;  3F3G A;  3IUN A;  2BCJ B;  1BPO A;  3UKU C;  3F3F A;  4XYH A;  1P22 A;  1GOG A;  4GQ2 P;  2CNX A;  3EI4 A;  2VDO A;  3K71 A;  3I7P A;  5FFO A;  4LG9 A;  3RRM C;  4O02 A;  5IJ8 E;  3EQ8 A;  2PM9 A;  4E54 B;  2XDW A;  3SBR A;  3C99 A;  4MK0 B;  3DXM C;  2P9P C;  4IRZ A;  4LG8 A;  4DNV A;  4EWR A;  3JRP A;  1M1X A;  2JKX A;  5A2Q g;  3HFQ A;  2J56 H;  3N0D A;  5IGQ A;  4A0A B;  2G99 A;  4XEI C;  5CXC B;  3I8C A;  2W18 A;  3SN6 B;  4JXM A;  3EI2 B;  4L1M A;  2UZX B;  1T2X A;  4A7J A;  4D9S A;  1Q47 A;  1FWX A;  1XIP A;  3MXX A;  1N6E A;  4JD2 C;  3V4V A;  3I89 A;  5FKR A;  2EID A;  3DDU A;  3GD1 I;  4J84 A;  4O2W A;  3DXK C;  1TBG A;  3EQ9 A;  4BUJ C;  2IUQ A;  1JOF A;  3SFZ A;  4ZOZ A;  5M5R A;  3ZDY A;  3C9C A;  5EMJ B;  2QXV A;  5FQD A;  3A0F A;  5I5M A;  5CXC A;  2YMU A;  2AH1 A;  4FAV D;  2YNN A;  2IUR A;  2XYI A;  4AX4 A;  1RI6 A;  1NR0 A;  2CN2 A;  1PEV A;  2AH0 A;  4GGA A;  4G56 B;  4AOW A;  4E5Z B;  4CZX A;  4YVD A;  4UM8 A;  4BP9 A;  3DWL C;  4U7A A;  5AMS A;  3IUR A;  1K3I A;  5M5T A;  4Z8L A;  2IWF A;  4CC9 A;  3J81 g;  4CI3 A;  4CY3 A;  3SBQ A; 
#chains in the Genus database with same CATH homology
 3I7O A;  5EAM A;  3OKY A;  5HYN B;  4L1Q D;  2IUP A;  4N14 A;  5C9Z B;  4J8G A;  5C2W B;  2AGX A;  1MG2 A;  4CZY A;  4IMM A;  5HE0 B;  3K26 A;  5K19 A;  3L4M D;  2P9L C;  5JWZ A;  2GC4 A;  3ZWL B;  2YNO A;  3MZL A;  4O1Q D;  1XHM A;  5I5I A;  2CE9 A;  4GM8 A;  4FWW A;  3GFC A;  5IT9 g;  4CY5 A;  1PI6 A;  3EMH A;  3SJL D;  3AL9 A;  4J73 A;  1NEX B;  3IJ0 A;  2PM6 B;  3CFS B;  2UZY B;  2H6N A;  3OW8 A;  3AH8 B;  5FLX g;  1S4U X;  3PXT D;  2OIZ A;  1YFQ A;  1JMZ B;  2J55 H;  3OKW A;  2MTA H;  3NVQ A;  4A08 A;  5IC7 A;  3JPX A;  2H3X A;  2P9I C;  4J0W A;  2YNP A;  2PM7 B;  2EBS A;  2O9K A;  3SBP A;  3AL8 B;  4CY2 A;  2AQ5 A;  4O9D A;  3SCY A;  4H5J A;  3PSL A;  4A0B B;  3IIW A;  1U4C A;  4J79 A;  4OWR A;  3I7N A;  4A2L A;  4CY1 A;  3PVU B;  3UVO A;  4J0X A;  2I0T A;  4TZ4 A;  4GZ8 A;  4PBY A;  3KRX B;  4PC0 A;  1GOT B;  4JT5 C;  3OTT A;  3B7F A;  1JMX B;  5FKT A;  4IA9 A;  5B4W A;  5GSA A;  3GRE A;  3RN1 D;  5GXI A;  3JZH A;  2B5M A;  4FA4 D;  3J80 g;  3IJC A;  3EWE A;  4JT6 C;  1TYQ C;  3SLE D;  2AGW A;  4GM9 A;  4GQ1 A;  3JZG A;  4ERY A;  1GXR A;  3BWS A;  2P9U C;  4A0A A;  5FKQ A;  1N6F A;  3FRX A;  4O3U B;  5IJ7 E;  4ZOX A;  5HE3 B;  5TF2 A;  3DSM A;  5EML B;  3EI2 A;  4QT8 A;  2HJ4 A;  2P9N C;  2AGL A;  3OL2 B;  2OVQ B;  4FAN D;  3C5M A;  5EMK B;  2IAA A;  1GP2 B;  2J57 G;  3ULE C;  3L4O D;  5IGO A;  3U4Y A;  2H47 A;  4J81 A;  4QRJ A;  5CXB A;  3F3P A;  3PVW B;  2G9A A;  2HXC A;  4X60 B;  2HYE A;  2H9N A;  3SWS D;  4NSX A;  5EAR A;  3CIK B;  3IIY A;  4GM3 A;  2HKM A;  5EAL A;  3NVN A;  3RN0 D;  3MMY A;  4A08 B;  1XKS A;  3V5W B;  4O45 A;  2GC7 A;  3I7H A;  4GGD A;  5AJA A;  2GNQ A;  4PSW B;  2P9K C;  3EI1 B;  4FA1 D;  2OK6 A;  4FB1 D;  3RMZ D;  2HKR A;  2H9P A;  3EI4 B;  1QNI A;  4BL0 A;  4OZU A;  3I7K A;  5HE2 B;  3KRW B;  4QL1 A;  5FXY A;  5H17 A;  3UVM A;  3MKS B;  5C2V B;  1SQJ A;  3EI3 A;  4U1E I;  2OJY A;  5H1M A;  4I79 A;  4H5I A;  3SVW D;  1K32 A;  4CI2 A;  3N0E A;  1L0Q A;  4FA5 D;  4KFM B;  5TEE A;  2YBA A;  2OK4 A;  3OKY B;  2BBK H;  4XYI A;  5EM2 A;  2H9M A;  2B4E A;  5FKS A;  3MKQ A;  3VA6 A;  5AFU 3;  2IUV A;  1PGU A;  2I0S A;  4E5Z A;  4L9O A;  2B5N A;  4J87 A;  1SQ9 A;  4Y7R A;  2PM9 B;  4E54 A;  2HES X;  2H14 A;  4L3H D;  3RSE C;  2H6K A;  4ZOV A;  4D0K A;  5CXB B;  2OVR B;  3FM0 A;  2B5L A;  1JJU B;  2HJB A;  3IJ1 A;  4A11 A;  3C75 H;  4J78 A;  2XU7 A;  5SXM A;  2XL2 A;  3SMR A;  2OVP B;  3AL8 A;  5GMK n;  1OLZ A;  1ERJ A;  4J77 A;  5EAP A;  5HQG A;  4JSP C;  4A0B A;  2YB8 B;  4J82 A;  3I8E A;  3UR4 A;  3V7D B;  4Y5R D;  2Z2N A;  4ZOY A;  2I3S A;  4GGC A;  4AEZ A;  2I3T A;  5EMM B;  4CI1 A;  2CE8 A;  5THA A;  4ES0 A;  2QC5 A;  4HDJ A;  3PXW D;  2IWK A;  2P9S C;  3V9F A;  4FA9 D;  3PXS D;  3JB9 L;  2H13 A;  3PE7 A;  1GG2 B;  3JAM g;  2Q7Q A;  4PNK B;  3CFV A;  3W15 A;  3VH0 A;  4A09 A;  2H6Q A;  2TRC B;  4K3I D;  3RFG A;  3BG0 A;  4R7A B;  3RLM D;  4ERQ A;  4FHL A;  3P4F A;  2Z2P A;  4J8B A;  5H14 A;  3BG1 A;  4CI8 A;  5KDO B;  4A09 B;  4UI9 R;  5CYK B;  1N6D A;  3VGZ A;  2H9L A;  4JSN C;  3UKR C;  4QQE A;  3K27 A;  3I7L A;  2CO0 A;  3I2N A;  2PBI B;  3UVN A;  1B9X A;  3OKT A;  3E0C A;  4CZV A;  3EG6 A;  3JRO A;  2Z2O A;  1OMW B;  4X61 B;  2H68 A;  1A0R B;  3JZN A;  4LGN A;  3MZK A;  1MG3 A;  3IKO A;  4ERZ A;  3ORV D;  4J86 A;  5CYK A;  4X63 B;  3UVL A;  4PXW A;  3EI1 A;  2AGY A;  1MDA H;  1K8K C;  1SHY B;  3OL2 A;  4GQB B;  4PBZ A;  3ODT A;  4GMB A;  4A2M A;  2CO0 C;  4ZN4 A;  1R5M A;  1U2V C;  3FGB A;  3SXT D;  5HE1 B;  3UVK A;  4A11 B;  3AFC A;  3NVX A;  5I5J A;  3EI3 B;  4X3E A;  2XL3 A;  1PBY B;  2I0R A;  4O3T B;  2AGZ A;  3PSC B;  4BH6 A;  5GXH A;  5FA5 B;  2CN3 A;  5TEF A;  1B9Y A;  3EU7 A;  3SHF A;  1VYH C;  4D6V A;  4ESG A;  4L3G D;  5TDH B;  3DM0 A;  4JSV C;  4K3J B;  3RFH A;  4PSX B;  5EM2 B;  5K1C C;  4JSX C;  3F3G A;  2BCJ B;  3UKU C;  3F3F A;  4XYH A;  1P22 A;  4GQ2 P;  2CNX A;  3EI4 A;  3I7P A;  4LG9 A;  3RRM C;  5IJ8 E;  2PM9 A;  4E54 B;  3SBR A;  3C99 A;  4MK0 B;  3DXM C;  2P9P C;  4LG8 A;  4EWR A;  3JRP A;  5A2Q g;  3HFQ A;  2J56 H;  3N0D A;  5IGQ A;  4A0A B;  2G99 A;  4XEI C;  5CXC B;  3I8C A;  2W18 A;  3SN6 B;  4JXM A;  3EI2 B;  2UZX B;  4A7J A;  1Q47 A;  1FWX A;  1XIP A;  3MXX A;  1N6E A;  4JD2 C;  3I89 A;  5FKR A;  4J84 A;  3DXK C;  1TBG A;  4BUJ C;  2IUQ A;  1JOF A;  3SFZ A;  4ZOZ A;  3C9C A;  5EMJ B;  2QXV A;  5FQD A;  3A0F A;  5I5M A;  5CXC A;  2YMU A;  2AH1 A;  4FAV D;  2YNN A;  2IUR A;  2XYI A;  1RI6 A;  1NR0 A;  2CN2 A;  1PEV A;  2AH0 A;  4GGA A;  4G56 B;  4AOW A;  4E5Z B;  4CZX A;  4YVD A;  3DWL C;  4U7A A;  5AMS A;  4Z8L A;  2IWF A;  4CC9 A;  3J81 g;  4CI3 A;  4CY3 A;  3SBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...