4PC0A

Structure of the human rbap48-mta1(670-711) complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
402
structure length
402
Chain Sequence
b'DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-binding protein RBBP4
publication title Insight into the architecture of the NuRD complex: Structure of the RbAp48-MTA1 sub-complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 94
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4pc0A00
5H1MA 3PVWB 2AGWA 4GQ2P 5FXYA 3EI4B 4BH6A 3PXSD 3U4YA 3PE7A 2P9NC 5A2Qg 3PVUB 3K27A 4AOWA 5IJ7E 4ESGA 2O9KA 3UKRC 4J79A 3UVOA 2BCJB 5TF2A 4J81A 2P9IC 2CO0A 4GQBB 5HE2B 5FKTA 4A0AA 5AMSA 3RN0D 3SN6B 3IIYA 5SXMA 3NVXA 3C99A 3DXKC 5HQGA 3EWEA 3DM0A 1N6DA 3OKYB 2QXVA 2J56H 3IJ0A 2OVRB 2YNOA 4XYHA 2OK6A 1PBYB 4D6VA 1S4UX 4L9OA 4L1QD 3SVWD 5IJ8E 2PM7B 5FKSA 5EALA 4H5IA 4U7AA 3SXTD 2P9PC 3A0FA 5CXBA 5THAA 4PSXB 2YNNA 3C5MA 3VGZA 5IC7A 3ORVD 4GGDA 3I7HA 2OIZA 2B5LA 5HE0B 4A11A 3OL2B 3MKQA 2CN2A 3EI3B 4Y7RA 5FQDA 5EARA 3RSEC 3ODTA 4JXMA 3RMZD 3JZNA 4R7AB 3EI2B 4G56B 4JD2C 4QL1A 3DSMA 4HDJA 4X3EA 3P4FA 3AH8B 4E5ZA 5GXHA 3SWSD 3PSLA 2IURA 2GNQA 1TBGA 5JWZA 4ZOVA 4FWWA 3SMRA 2QC5A 3EG6A 5GSAA 5I5IA 4FB1D 3I7LA 3GREA 5I5MA 5AFU3 1GOTB 3KRWB 2Z2OA 4FHLA 4FA9D 3N0EA 3OW8A 5TEEA 4X63B 3AL9A 2PBIB 2YMUA 3EU7A 5FKQA 4J78A 4O45A 4X61B 3ULEC 2YNPA 3VA6A 2XL2A 3EI4A 3JPXA 2HKRA 1JMZB 4I79A 4QT8A 3I7KA 4X60B 5HE3B 4FAND 1U2VC 3HFQA 4GGCA 4E54B 2YB8B 5I5JA 3EI1B 3F3PA 3PXTD 2IWKA 4CY5A 5GMKn 1PGUA 2B4EA 1K8KC 2OVQB 1XKSA 3RN1D 2PM9B 3NVQA 5TEFA 4TZ4A 4A09A 5EM2B 4JSVC 2H13A 3I8CA 3FM0A 4L3HD 4J8GA 5IGOA 3PSCB 4GZ8A 4A08B 5AJAA 4CY1A 2H6KA 4PSWB 1TYQC 2H6NA 4JSNC 2HJBA 3SBRA 4ES0A 3J81g 4FA4D 4CZVA 2YBAA 4JSXC 3KRXB 4A0BB 3IJ1A 3FRXA 1FWXA 2CNXA 3K26A 2MTAH 1XIPA 3UR4A 3AL8A 4LGNA 2AGLA 3JRPA 5KDOB 1PEVA 5B4WA 3MMYA 4K3ID 3OL2A 4GM8A 5CXCA 3EI3A 4MK0B 4OZUA 4PBZA 4J84A 2XL3A 3EI2A 1GG2B 3JROA 2OVPB 2HYEA 2HKMA 4CI1A 3SCYA 2GC7A 2H9LA 4JT5C 2H9PA 1N6FA 1N6EA 2UZXB 5C2VB 2B5MA 4CC9A 4ERQA 4N14A 2HJ4A 4J82A 3BG0A 4AEZA 4NSXA 1GP2B 2OK4A 4PXWA 5K19A 1JMXB 3IJCA 3C75H 3MXXA 1SQ9A 4O3UB 5HYNB 2AH1A 4BL0A 3JZGA 2TRCB 2H14A 3I7PA 4CZXA 5CXBB 5EMLB 5EAMA 1YFQA 4K3JB 3V9FA 3SBPA 3I2NA 1PI6A 1R5MA 4LG8A 4BUJC 3UVMA 4E54A 3EI1A 4JSPC 2HXCA 5EAPA 1VYHC 4ZOYA 4PC0A 2HESX 1P22A 2I0TA 3JB9L 3CIKB 3DWLC 5EMKB 2I3SA 5HE1B 2W18A 3SJLD 5EM2A 3SBQA 2G9AA 4PNKB 3L4MD 2IUQA 4J0WA 5H17A 4XEIC 3DXMC 2IUPA 2I0SA 3UVKA 4FAVD 1U4CA 4O3TB 3J80g 2CN3A 3EMHA 3UVLA 1SQJA 3JZHA 4ERZA 5IT9g 3I89A 4J8BA 5C9ZB 1JJUB 3F3FA 3BWSA 4J77A 2BBKH 5TDHB 4FA5D 3I7NA 3IIWA 5CYKB 4GGAA 3E0CA 3PXWD 1RI6A 4A2MA 2P9KC 4A0BA 1OLZA 4Y5RD 5FLXg 3OKYA 3UKUC 1MDAH 2PM6B 3OTTA 2I0RA 1A0RB 2UZYB 3RFHA 1K32A 5C2WB 2AGZA 4QRJA 4OWRA 3L4OD 4U1EI 2CE8A 4CY2A 4D0KA 1Q47A 4EWRA 4A09B 1MG2A 3RFGA 2GC4A 4LG9A 2CE9A 4CY3A 2P9LC 2P9UC 3F3GA 3I8EA 4O1QD 4CI2A 1XHMA 4GM3A 3VH0A 3FGBA 1NR0A 4A0AB 4L3GD 4XYIA 3SHFA 4ERYA 4IA9A 3GFCA 3BG1A 1OMWB 2H9MA 2Q7QA 4CI8A 4H5JA 3V7DB 4J0XA 5EMMB 1QNIA 1NEXB 4J86A 4CZYA 2Z2NA 3MZLA 5K1CC 3V5WB 2AH0A 2B5NA 2I3TA 3NVNA 2Z2PA 4QQEA 2OJYA 3AL8B 3SLED 1B9YA 2EBSA 2IWFA 3AFCA 3W15A 2AGXA 4KFMB 2IUVA 4ZOXA 5CXCB 4O9DA 4GM9A 3ZWLB 2J57G 2H47A 4A2LA 3I7OA 3CFVA 2H9NA 3JAMg 4CI3A 5H14A 3MKSB 4UI9R 4Z8LA 2XYIA 3N0DA 2CO0C 3C9CA 5EMJB 4A11B 4IMMA 3UVNA 5IGQA 5GXIA 3SFZA 1GXRA 4JT6C 5FA5B 3B7FA 2PM9A 3RLMD 4ZOZA 4E5ZB 2AQ5A 3OKTA 2H68A 2H3XA 5CYKA 4GMBA 3IKOA 2XU7A 4GQ1A 5FKRA 1MG3A 4A08A 1ERJA 2IAAA 2P9SC 4YVDA 1SHYB 4ZN4A 3RRMC 2G99A 1B9XA 3OKWA 3MZKA 1JOFA 3CFSB 2H6QA 4A7JA 2J55H 2AGYA 4FA1D 4PBYA 4J87A 4J73A 1L0QA
chains in the Genus database with same CATH superfamily
5H1MA 3PVWB 2AGWA 4GQ2P 5FXYA 3EI4B 4BH6A 3PXSD 3U4YA 3PE7A 2P9NC 3GC3B 3IVMA 1VE6A 5A2Qg 3PVUB 4D9SA 3K27A 4WJKA 4AOWA 5IJ7E 4Z7QA 1L5GA 4ESGA 2O9KA 3UKRC 2XZGA 3O4GA 4J79A 3UVOA 2BCJB 5TF2A 4J81A 2P9IC 4Z7NA 2CO0A 4G1EA 2JKXA 4GQBB 5HE2B 4Z7OA 3T3MA 5FKTA 3QHYB 4A0AA 5AMSA 3RN0D 3SN6B 3IIYA 5SXMA 3NVXA 5M5SA 2VDQA 1H2WA 3C99A 5C86A 3DXKC 5HQGA 2VZ1A 3EWEA 3DM0A 2VDOA 1N6DA 3OKYB 2QXVA 2J56H 3IJ0A 2OVRB 2YNOA 4XYHA 2HU8A 2OK6A 4D6VA 1S4UX 4L9OA 4L1QD 2WQ8A 3SVWD 5IJ8E 2PM7B 5FKSA 5EALA 4H5IA 3EQ9A 4U7AA 3SXTD 2P9PC 3A0FA 5CXBA 5THAA 4PSXB 2YNNA 1VZ3A 3C5MA 3VGZA 5IC7A 3ORVD 4GGDA 3I7HA 2OIZA 2EIEA 2B5LA 5HE0B 4A11A 3IULA 2VDRA 3OL2B 3MKQA 1A12A 3IUMA 2CN2A 3EI3B 4Y7RA 5FQDA 5EARA 3RSEC 1H2XA 2VC2A 5M5RA 3ODTA 4JXMA 5HDBA 3RMZD 3JZNA 4R7AB 3EI2B 4WK2A 4G56B 4JD2C 5E6SA 1T2XA 4QL1A 4BCCA 3DSMA 4HDJA 4X3EA 3P4FA 3AH8B 4E5ZA 4BCDA 5GXHA 3SWSD 3PSLA 2IURA 1O6FA 4O02A 2GNQA 3IUJA 5C92A 1TBGA 5JWZA 4ZOVA 4FWWA 3SMRA 2QC5A 3EG6A 1H2YA 5GSAA 1JV2A 5I5IA 4FB1D 3I7LA 3GREA 5I5MA 5AFU3 1GOTB 3KRWB 4MMYA 4IRZA 2Z2OA 3QI0A 4FHLA 4FA9D 3N0EA 3OW8A 5TEEA 2VDKA 4X63B 1K3IA 3AL9A 2PBIB 2YMUA 3EU7A 5FKQA 4AMZA 1QFMA 4J78A 4O45A 4X61B 3ULEC 2YNPA 4L1MA 3VA6A 2XL2A 3EI4A 3JPXA 5FFGA 2HKRA 1JMZB 4I79A 4QT8A 3I7KA 5M61A 4X60B 5HE3B 4FAND 1U2VC 1U8CA 3HFQA 4GGCA 4E54B 4J73A 4UM8A 2YB8B 5I5JA 3EI1B 3F3PA 1UOQA 3PXTD 4NENA 3ZDXA 2IWKA 4CY5A 5GMKn 1PGUA 1TYEA 1UOOA 3DDUA 2B4EA 2VDPA 4WK4A 1K8KC 2OVQB 1XKSA 3RN1D 2PM9B 3NVQA 5TEFA 4TZ4A 4A09A 5EM2B 3VI3A 4JSVC 2H13A 3I8CA 3FM0A 4J8GA 4L3HD 5IGOA 3PSCB 4GZ8A 4A08B 1UOPA 5AJAA 4BCBA 4WK0A 4CY1A 2H6KA 4PSWB 4UM9A 1TYQC 2H6NA 4JSNC 2HJBA 3SBRA 4ES0A 5E6UA 3J81g 4FA4D 4CZVA 1M1XA 2YBAA 4JSXC 3KRXB 1YR2A 4A0BB 3IJ1A 3IURA 3FRXA 1FWXA 2CNXA 3K26A 2MTAH 1XIPA 3UR4A 1JTDB 3AL8A 4LGNA 3K71A 2AGLA 3JRPA 5KDOB 1PEVA 5B4WA 3MMYA 3ZE2A 4K3ID 3OL2A 4GM8A 3GD1I 5CXCA 3EI3A 4MK0B 4OZUA 4PBZA 4J84A 2XL3A 3EI2A 4NC4A 3NIDA 5M5TA 4AX4A 1GG2B 2BKLA 3JROA 3V4VA 2OVPB 2HYEA 2HKMA 4CI1A 3SCYA 2GC7A 2H9LA 4JT5C 3O4JA 2H9PA 1O6GA 3FCUA 1N6FA 1N6EA 2UZXB 1VZ2A 5C2VB 4MMZA 2B5MA 4CC9A 4ERQA 4N14A 2HJ4A 4J82A 3BG0A 4AEZA 4BP9A 4NSXA 1GP2B 2OK4A 4PXWA 1I2MB 5K19A 1JMXB 3IJCA 3C75H 2XE4A 3MXXA 1SQ9A 3MUNA 4O3UB 5HYNB 2AH1A 4MMXA 3JZGA 4BL0A 1GOHA 2TRCB 2H14A 3I7PA 4G1MA 4CZXA 3NIGA 5CXBB 5EMLB 5EAMA 1E8NA 1YFQA 4K3JB 3V9FA 3SBPA 3I2NA 1PI6A 1R5MA 4LG8A 4BUJC 3UVMA 2XDWA 3K72A 4E54A 3EI1A 4JSPC 4RE6A 2HXCA 5EAPA 1VYHC 4ZOYA 4PC0A 2HESX 4DNWA 4NAAA 1P22A 2I0TA 3JB9L 3ZE1A 3CIKB 1GOFA 1E5TA 3DWLC 2HU7A 5EMKB 2I3SA 5HE1B 3EQ7A 1H2ZA 2VDNA 2W18A 3SJLD 5EM2A 3SBQA 4G55A 2G9AA 4PNKB 3L4MD 2IUQA 4J0WA 3EQ8A 2VDLA 5H17A 4XEIC 3DXMC 2VZ3A 1E8MA 2IUPA 3MUOA 2I0SA 3UVKA 4FAVD 1U4CA 4O3TB 3J80g 2CN3A 3EMHA 3UVLA 1SQJA 3JZHA 4ERZA 5IT9g 3I89A 4J8BA 5C9ZB 1JJUB 1BPOA 3F3FA 3BWSA 4J77A 2BBKH 5TDHB 4FA5D 3I7NA 3IIWA 5CYKB 4GGAA 3E0CA 3PXWD 5E6RA 5M5UA 1RI6A 4A2MA 2P9KC 3MVDK 3ZDZA 4A0BA 1OLZA 4Y5RD 5FLXg 4AMYA 3OKYA 3UKUC 1MDAH 2PM6B 3OTTA 4O2WA 2I0RA 3OF7A 1A0RB 2UZYB 2EIBA 3RFHA 4JHPC 1K32A 5C2WB 4DNVA 2AGZA 4QRJA 4OWRA 4AN1A 3L4OD 2QZPA 4U1EI 2CE8A 4CY2A 4D0KA 1Q47A 4EWRA 4A09B 1MG2A 3O4IA 3RFGA 2GC4A 4LG9A 2CE9A 1C9LA 4CY3A 2P9LC 3KCIA 5M5VA 2P9UC 3F3GA 3I8EA 4O1QD 4RE5A 4CI2A 4AN0A 1XHMA 4GM3A 3VH0A 3FGBA 1NR0A 4A0AB 4L3GD 4XYIA 1QFSA 3V4PA 3SHFA 4ERYA 4IA9A 3IUQA 3GFCA 3BG1A 1OMWB 2H9MA 2Q7QA 4CI8A 4H5JA 3V7DB 4J0XA 5EMMB 1QNIA 1NEXB 4J86A 4CZYA 2Z2NA 3MZLA 1C9IA 5K1CC 3V5WB 2AH0A 2B5NA 2I3TA 3NVNA 2Z2PA 2EIDA 4QQEA 2OJYA 1UTCA 3AL8B 1B9YA 3SLED 3T3PA 2EBSA 4QAMA 2IWFA 3AFCA 3W15A 2AGXA 4JHNA 4KFMB 2IUVA 4ZOXA 5CXCB 4O9DA 5FFOA 4GM9A 3ZWLB 2J57G 2H47A 4A2LA 1VE7A 3I7OA 3ZDYA 3CFVA 2H9NA 3JAMg 4CI3A 5H14A 3MKSB 4UI9R 4Z8LA 2XYIA 3N0DA 3IJEA 2CO0C 3C9CA 5EMJB 1GOGA 4A11B 4IMMA 3UVNA 2QR5A 5IGQA 5GXIA 3FCSA 4DNUA 3SFZA 1GXRA 4NBMA 4JT6C 5FA5B 3B7FA 2PM9A 3RLMD 4ZOZA 4E5ZB 2AQ5A 3NIFA 2H68A 3OKTA 3O4HA 2H3XA 5CYKA 3ZE0A 4GMBA 3IKOA 2XU7A 4GQ1A 5FKRA 1MG3A 2EICA 4A08A 4BP8A 1ERJA 2IAAA 2P9SC 4YVDA 1SHYB 4ZN4A 3RRMC 2G99A 1B9XA 3IUNA 3OKWA 3MZKA 1JOFA 3CFSB 3K6SA 2HU5A 2H6QA 4A7JA 2J55H 2AGYA 4FA1D 3VI4A 4PBYA 2VDMA 4J87A 1PBYB 1L0QA
chains in the Genus database with same CATH topology
5H1MA 3PVWB 2AGWA 4GQ2P 5FXYA 3EI4B 4BH6A 3PXSD 3U4YA 3PE7A 2P9NC 5A2Qg 3PVUB 3K27A 4AOWA 5IJ7E 4ESGA 2O9KA 3UKRC 4J79A 3UVOA 2BCJB 5TF2A 4J81A 2P9IC 2CO0A 4GQBB 5HE2B 5FKTA 4A0AA 5AMSA 3RN0D 3SN6B 3IIYA 5SXMA 3NVXA 3C99A 3DXKC 5HQGA 3EWEA 3DM0A 1N6DA 3OKYB 2QXVA 2J56H 3IJ0A 2OVRB 2YNOA 4XYHA 2OK6A 1PBYB 4D6VA 1S4UX 4L9OA 4L1QD 3SVWD 5IJ8E 2PM7B 5FKSA 5EALA 4H5IA 4U7AA 3SXTD 2P9PC 3A0FA 5CXBA 5THAA 4PSXB 2YNNA 3C5MA 3VGZA 5IC7A 3ORVD 4GGDA 3I7HA 2OIZA 2B5LA 5HE0B 4A11A 3OL2B 3MKQA 2CN2A 3EI3B 4Y7RA 5FQDA 5EARA 3RSEC 3ODTA 4JXMA 3RMZD 3JZNA 4R7AB 3EI2B 4G56B 4JD2C 4QL1A 3DSMA 4HDJA 4X3EA 3P4FA 3AH8B 4E5ZA 5GXHA 3SWSD 3PSLA 2IURA 2GNQA 1TBGA 5JWZA 4ZOVA 4FWWA 3SMRA 2QC5A 3EG6A 5GSAA 5I5IA 4FB1D 3I7LA 3GREA 5I5MA 5AFU3 1GOTB 3KRWB 2Z2OA 4FHLA 4FA9D 3N0EA 3OW8A 5TEEA 4X63B 3AL9A 2PBIB 2YMUA 3EU7A 5FKQA 4J78A 4O45A 4X61B 3ULEC 2YNPA 3VA6A 2XL2A 3EI4A 3JPXA 2HKRA 1JMZB 4I79A 4QT8A 3I7KA 4X60B 5HE3B 4FAND 1U2VC 3HFQA 4GGCA 4E54B 2YB8B 5I5JA 3EI1B 3F3PA 3PXTD 2IWKA 4CY5A 5GMKn 1PGUA 2B4EA 1K8KC 2OVQB 1XKSA 3RN1D 2PM9B 3NVQA 5TEFA 4TZ4A 4A09A 5EM2B 4JSVC 2H13A 3I8CA 3FM0A 4L3HD 4J8GA 5IGOA 3PSCB 4GZ8A 4A08B 5AJAA 4CY1A 2H6KA 4PSWB 1TYQC 2H6NA 4JSNC 2HJBA 3SBRA 4ES0A 3J81g 4FA4D 4CZVA 2YBAA 4JSXC 3KRXB 4A0BB 3IJ1A 3FRXA 1FWXA 2CNXA 3K26A 2MTAH 1XIPA 3UR4A 3AL8A 4LGNA 2AGLA 3JRPA 5KDOB 1PEVA 5B4WA 3MMYA 4K3ID 3OL2A 4GM8A 5CXCA 3EI3A 4MK0B 4OZUA 4PBZA 4J84A 2XL3A 3EI2A 1GG2B 3JROA 2OVPB 2HYEA 2HKMA 4CI1A 3SCYA 2GC7A 2H9LA 4JT5C 2H9PA 1N6FA 1N6EA 2UZXB 5C2VB 2B5MA 4CC9A 4ERQA 4N14A 2HJ4A 4J82A 3BG0A 4AEZA 4NSXA 1GP2B 2OK4A 4PXWA 5K19A 1JMXB 3IJCA 3C75H 3MXXA 1SQ9A 4O3UB 5HYNB 2AH1A 4BL0A 3JZGA 2TRCB 2H14A 3I7PA 4CZXA 5CXBB 5EMLB 5EAMA 1YFQA 4K3JB 3V9FA 3SBPA 3I2NA 1PI6A 1R5MA 4LG8A 4BUJC 3UVMA 4E54A 3EI1A 4JSPC 2HXCA 5EAPA 1VYHC 4ZOYA 4PC0A 2HESX 1P22A 2I0TA 3JB9L 3CIKB 3DWLC 5EMKB 2I3SA 5HE1B 2W18A 3SJLD 5EM2A 3SBQA 2G9AA 4PNKB 3L4MD 2IUQA 4J0WA 5H17A 4XEIC 3DXMC 2IUPA 2I0SA 3UVKA 4FAVD 1U4CA 4O3TB 3J80g 2CN3A 3EMHA 3UVLA 1SQJA 3JZHA 4ERZA 5IT9g 3I89A 4J8BA 5C9ZB 1JJUB 3F3FA 3BWSA 4J77A 2BBKH 5TDHB 4FA5D 3I7NA 3IIWA 5CYKB 4GGAA 3E0CA 3PXWD 1RI6A 4A2MA 2P9KC 4A0BA 1OLZA 4Y5RD 5FLXg 3OKYA 3UKUC 1MDAH 2PM6B 3OTTA 2I0RA 1A0RB 2UZYB 3RFHA 1K32A 5C2WB 2AGZA 4QRJA 4OWRA 3L4OD 4U1EI 2CE8A 4CY2A 4D0KA 1Q47A 4EWRA 4A09B 1MG2A 3RFGA 2GC4A 4LG9A 2CE9A 4CY3A 2P9LC 2P9UC 3F3GA 3I8EA 4O1QD 4CI2A 1XHMA 4GM3A 3VH0A 3FGBA 1NR0A 4A0AB 4L3GD 4XYIA 3SHFA 4ERYA 4IA9A 3GFCA 3BG1A 1OMWB 2H9MA 2Q7QA 4CI8A 4H5JA 3V7DB 4J0XA 5EMMB 1QNIA 1NEXB 4J86A 4CZYA 2Z2NA 3MZLA 5K1CC 3V5WB 2AH0A 2B5NA 2I3TA 3NVNA 2Z2PA 4QQEA 2OJYA 3AL8B 3SLED 1B9YA 2EBSA 2IWFA 3AFCA 3W15A 2AGXA 4KFMB 2IUVA 4ZOXA 5CXCB 4O9DA 4GM9A 3ZWLB 2J57G 2H47A 4A2LA 3I7OA 3CFVA 2H9NA 3JAMg 4CI3A 5H14A 3MKSB 4UI9R 4Z8LA 2XYIA 3N0DA 2CO0C 3C9CA 5EMJB 4A11B 4IMMA 3UVNA 5IGQA 5GXIA 3SFZA 1GXRA 4JT6C 5FA5B 3B7FA 2PM9A 3RLMD 4ZOZA 4E5ZB 2AQ5A 3OKTA 2H68A 2H3XA 5CYKA 4GMBA 3IKOA 2XU7A 4GQ1A 5FKRA 1MG3A 4A08A 1ERJA 2IAAA 2P9SC 4YVDA 1SHYB 4ZN4A 3RRMC 2G99A 1B9XA 3OKWA 3MZKA 1JOFA 3CFSB 2H6QA 4A7JA 2J55H 2AGYA 4FA1D 4PBYA 4J87A 4J73A 1L0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1M A;  3PVW B;  2AGW A;  4GQ2 P;  5FXY A;  3EI4 B;  4BH6 A;  3PXS D;  3U4Y A;  3PE7 A;  2P9N C;  5A2Q g;  3PVU B;  3K27 A;  4AOW A;  5IJ7 E;  4ESG A;  2O9K A;  3UKR C;  4J79 A;  3UVO A;  2BCJ B;  5TF2 A;  4J81 A;  2P9I C;  2CO0 A;  4GQB B;  5HE2 B;  5FKT A;  4A0A A;  5AMS A;  3RN0 D;  3SN6 B;  3IIY A;  5SXM A;  3NVX A;  3C99 A;  3DXK C;  5HQG A;  3EWE A;  3DM0 A;  1N6D A;  3OKY B;  2QXV A;  2J56 H;  3IJ0 A;  2OVR B;  2YNO A;  4XYH A;  2OK6 A;  1PBY B;  4D6V A;  1S4U X;  4L9O A;  4L1Q D;  3SVW D;  5IJ8 E;  2PM7 B;  5FKS A;  5EAL A;  4H5I A;  4U7A A;  3SXT D;  2P9P C;  3A0F A;  5CXB A;  5THA A;  4PSX B;  2YNN A;  3C5M A;  3VGZ A;  5IC7 A;  3ORV D;  4GGD A;  3I7H A;  2OIZ A;  2B5L A;  5HE0 B;  4A11 A;  3OL2 B;  3MKQ A;  2CN2 A;  3EI3 B;  4Y7R A;  5FQD A;  5EAR A;  3RSE C;  3ODT A;  4JXM A;  3RMZ D;  3JZN A;  4R7A B;  3EI2 B;  4G56 B;  4JD2 C;  4QL1 A;  3DSM A;  4HDJ A;  4X3E A;  3P4F A;  3AH8 B;  4E5Z A;  5GXH A;  3SWS D;  3PSL A;  2IUR A;  2GNQ A;  1TBG A;  5JWZ A;  4ZOV A;  4FWW A;  3SMR A;  2QC5 A;  3EG6 A;  5GSA A;  5I5I A;  4FB1 D;  3I7L A;  3GRE A;  5I5M A;  5AFU 3;  1GOT B;  3KRW B;  2Z2O A;  4FHL A;  4FA9 D;  3N0E A;  3OW8 A;  5TEE A;  4X63 B;  3AL9 A;  2PBI B;  2YMU A;  3EU7 A;  5FKQ A;  4J78 A;  4O45 A;  4X61 B;  3ULE C;  2YNP A;  3VA6 A;  2XL2 A;  3EI4 A;  3JPX A;  2HKR A;  1JMZ B;  4I79 A;  4QT8 A;  3I7K A;  4X60 B;  5HE3 B;  4FAN D;  1U2V C;  3HFQ A;  4GGC A;  4E54 B;  2YB8 B;  5I5J A;  3EI1 B;  3F3P A;  3PXT D;  2IWK A;  4CY5 A;  5GMK n;  1PGU A;  2B4E A;  1K8K C;  2OVQ B;  1XKS A;  3RN1 D;  2PM9 B;  3NVQ A;  5TEF A;  4TZ4 A;  4A09 A;  5EM2 B;  4JSV C;  2H13 A;  3I8C A;  3FM0 A;  4L3H D;  4J8G A;  5IGO A;  3PSC B;  4GZ8 A;  4A08 B;  5AJA A;  4CY1 A;  2H6K A;  4PSW B;  1TYQ C;  2H6N A;  4JSN C;  2HJB A;  3SBR A;  4ES0 A;  3J81 g;  4FA4 D;  4CZV A;  2YBA A;  4JSX C;  3KRX B;  4A0B B;  3IJ1 A;  3FRX A;  1FWX A;  2CNX A;  3K26 A;  2MTA H;  1XIP A;  3UR4 A;  3AL8 A;  4LGN A;  2AGL A;  3JRP A;  5KDO B;  1PEV A;  5B4W A;  3MMY A;  4K3I D;  3OL2 A;  4GM8 A;  5CXC A;  3EI3 A;  4MK0 B;  4OZU A;  4PBZ A;  4J84 A;  2XL3 A;  3EI2 A;  1GG2 B;  3JRO A;  2OVP B;  2HYE A;  2HKM A;  4CI1 A;  3SCY A;  2GC7 A;  2H9L A;  4JT5 C;  2H9P A;  1N6F A;  1N6E A;  2UZX B;  5C2V B;  2B5M A;  4CC9 A;  4ERQ A;  4N14 A;  2HJ4 A;  4J82 A;  3BG0 A;  4AEZ A;  4NSX A;  1GP2 B;  2OK4 A;  4PXW A;  5K19 A;  1JMX B;  3IJC A;  3C75 H;  3MXX A;  1SQ9 A;  4O3U B;  5HYN B;  2AH1 A;  4BL0 A;  3JZG A;  2TRC B;  2H14 A;  3I7P A;  4CZX A;  5CXB B;  5EML B;  5EAM A;  1YFQ A;  4K3J B;  3V9F A;  3SBP A;  3I2N A;  1PI6 A;  1R5M A;  4LG8 A;  4BUJ C;  3UVM A;  4E54 A;  3EI1 A;  4JSP C;  2HXC A;  5EAP A;  1VYH C;  4ZOY A;  4PC0 A;  2HES X;  1P22 A;  2I0T A;  3JB9 L;  3CIK B;  3DWL C;  5EMK B;  2I3S A;  5HE1 B;  2W18 A;  3SJL D;  5EM2 A;  3SBQ A;  2G9A A;  4PNK B;  3L4M D;  2IUQ A;  4J0W A;  5H17 A;  4XEI C;  3DXM C;  2IUP A;  2I0S A;  3UVK A;  4FAV D;  1U4C A;  4O3T B;  3J80 g;  2CN3 A;  3EMH A;  3UVL A;  1SQJ A;  3JZH A;  4ERZ A;  5IT9 g;  3I89 A;  4J8B A;  5C9Z B;  1JJU B;  3F3F A;  3BWS A;  4J77 A;  2BBK H;  5TDH B;  4FA5 D;  3I7N A;  3IIW A;  5CYK B;  4GGA A;  3E0C A;  3PXW D;  1RI6 A;  4A2M A;  2P9K C;  4A0B A;  1OLZ A;  4Y5R D;  5FLX g;  3OKY A;  3UKU C;  1MDA H;  2PM6 B;  3OTT A;  2I0R A;  1A0R B;  2UZY B;  3RFH A;  1K32 A;  5C2W B;  2AGZ A;  4QRJ A;  4OWR A;  3L4O D;  4U1E I;  2CE8 A;  4CY2 A;  4D0K A;  1Q47 A;  4EWR A;  4A09 B;  1MG2 A;  3RFG A;  2GC4 A;  4LG9 A;  2CE9 A;  4CY3 A;  2P9L C;  2P9U C;  3F3G A;  3I8E A;  4O1Q D;  4CI2 A;  1XHM A;  4GM3 A;  3VH0 A;  3FGB A;  1NR0 A;  4A0A B;  4L3G D;  4XYI A;  3SHF A;  4ERY A;  4IA9 A;  3GFC A;  3BG1 A;  1OMW B;  2H9M A;  2Q7Q A;  4CI8 A;  4H5J A;  3V7D B;  4J0X A;  5EMM B;  1QNI A;  1NEX B;  4J86 A;  4CZY A;  2Z2N A;  3MZL A;  5K1C C;  3V5W B;  2AH0 A;  2B5N A;  2I3T A;  3NVN A;  2Z2P A;  4QQE A;  2OJY A;  3AL8 B;  3SLE D;  1B9Y A;  2EBS A;  2IWF A;  3AFC A;  3W15 A;  2AGX A;  4KFM B;  2IUV A;  4ZOX A;  5CXC B;  4O9D A;  4GM9 A;  3ZWL B;  2J57 G;  2H47 A;  4A2L A;  3I7O A;  3CFV A;  2H9N A;  3JAM g;  4CI3 A;  5H14 A;  3MKS B;  4UI9 R;  4Z8L A;  2XYI A;  3N0D A;  2CO0 C;  3C9C A;  5EMJ B;  4A11 B;  4IMM A;  3UVN A;  5IGQ A;  5GXI A;  3SFZ A;  1GXR A;  4JT6 C;  5FA5 B;  3B7F A;  2PM9 A;  3RLM D;  4ZOZ A;  4E5Z B;  2AQ5 A;  3OKT A;  2H68 A;  2H3X A;  5CYK A;  4GMB A;  3IKO A;  2XU7 A;  4GQ1 A;  5FKR A;  1MG3 A;  4A08 A;  1ERJ A;  2IAA A;  2P9S C;  4YVD A;  1SHY B;  4ZN4 A;  3RRM C;  2G99 A;  1B9X A;  3OKW A;  3MZK A;  1JOF A;  3CFS B;  2H6Q A;  4A7J A;  2J55 H;  2AGY A;  4FA1 D;  4PBY A;  4J87 A;  4J73 A;  1L0Q A; 
#chains in the Genus database with same CATH topology
 5H1M A;  3PVW B;  2AGW A;  4GQ2 P;  5FXY A;  3EI4 B;  4BH6 A;  3PXS D;  3U4Y A;  3PE7 A;  2P9N C;  3GC3 B;  3IVM A;  1VE6 A;  5A2Q g;  3PVU B;  4D9S A;  3K27 A;  4WJK A;  4AOW A;  5IJ7 E;  4Z7Q A;  1L5G A;  4ESG A;  2O9K A;  3UKR C;  2XZG A;  3O4G A;  4J79 A;  3UVO A;  2BCJ B;  5TF2 A;  4J81 A;  2P9I C;  4Z7N A;  2CO0 A;  4G1E A;  2JKX A;  4GQB B;  5HE2 B;  4Z7O A;  3T3M A;  5FKT A;  3QHY B;  4A0A A;  5AMS A;  3RN0 D;  3SN6 B;  3IIY A;  5SXM A;  3NVX A;  5M5S A;  2VDQ A;  1H2W A;  3C99 A;  5C86 A;  3DXK C;  5HQG A;  2VZ1 A;  3EWE A;  3DM0 A;  2VDO A;  1N6D A;  3OKY B;  2QXV A;  2J56 H;  3IJ0 A;  2OVR B;  2YNO A;  4XYH A;  2HU8 A;  2OK6 A;  4D6V A;  1S4U X;  4L9O A;  4L1Q D;  2WQ8 A;  3SVW D;  5IJ8 E;  2PM7 B;  5FKS A;  5EAL A;  4H5I A;  3EQ9 A;  4U7A A;  3SXT D;  2P9P C;  3A0F A;  5CXB A;  5THA A;  4PSX B;  2YNN A;  1VZ3 A;  3C5M A;  3VGZ A;  5IC7 A;  3ORV D;  4GGD A;  3I7H A;  2OIZ A;  2EIE A;  2B5L A;  5HE0 B;  4A11 A;  3IUL A;  2VDR A;  3OL2 B;  3MKQ A;  1A12 A;  3IUM A;  2CN2 A;  3EI3 B;  4Y7R A;  5FQD A;  5EAR A;  3RSE C;  1H2X A;  2VC2 A;  5M5R A;  3ODT A;  4JXM A;  5HDB A;  3RMZ D;  3JZN A;  4R7A B;  3EI2 B;  4WK2 A;  4G56 B;  4JD2 C;  5E6S A;  1T2X A;  4QL1 A;  4BCC A;  3DSM A;  4HDJ A;  4X3E A;  3P4F A;  3AH8 B;  4E5Z A;  4BCD A;  5GXH A;  3SWS D;  3PSL A;  2IUR A;  1O6F A;  4O02 A;  2GNQ A;  3IUJ A;  5C92 A;  1TBG A;  5JWZ A;  4ZOV A;  4FWW A;  3SMR A;  2QC5 A;  3EG6 A;  1H2Y A;  5GSA A;  1JV2 A;  5I5I A;  4FB1 D;  3I7L A;  3GRE A;  5I5M A;  5AFU 3;  1GOT B;  3KRW B;  4MMY A;  4IRZ A;  2Z2O A;  3QI0 A;  4FHL A;  4FA9 D;  3N0E A;  3OW8 A;  5TEE A;  2VDK A;  4X63 B;  1K3I A;  3AL9 A;  2PBI B;  2YMU A;  3EU7 A;  5FKQ A;  4AMZ A;  1QFM A;  4J78 A;  4O45 A;  4X61 B;  3ULE C;  2YNP A;  4L1M A;  3VA6 A;  2XL2 A;  3EI4 A;  3JPX A;  5FFG A;  2HKR A;  1JMZ B;  4I79 A;  4QT8 A;  3I7K A;  5M61 A;  4X60 B;  5HE3 B;  4FAN D;  1U2V C;  1U8C A;  3HFQ A;  4GGC A;  4E54 B;  4J73 A;  4UM8 A;  2YB8 B;  5I5J A;  3EI1 B;  3F3P A;  1UOQ A;  3PXT D;  4NEN A;  3ZDX A;  2IWK A;  4CY5 A;  5GMK n;  1PGU A;  1TYE A;  1UOO A;  3DDU A;  2B4E A;  2VDP A;  4WK4 A;  1K8K C;  2OVQ B;  1XKS A;  3RN1 D;  2PM9 B;  3NVQ A;  5TEF A;  4TZ4 A;  4A09 A;  5EM2 B;  3VI3 A;  4JSV C;  2H13 A;  3I8C A;  3FM0 A;  4J8G A;  4L3H D;  5IGO A;  3PSC B;  4GZ8 A;  4A08 B;  1UOP A;  5AJA A;  4BCB A;  4WK0 A;  4CY1 A;  2H6K A;  4PSW B;  4UM9 A;  1TYQ C;  2H6N A;  4JSN C;  2HJB A;  3SBR A;  4ES0 A;  5E6U A;  3J81 g;  4FA4 D;  4CZV A;  1M1X A;  2YBA A;  4JSX C;  3KRX B;  1YR2 A;  4A0B B;  3IJ1 A;  3IUR A;  3FRX A;  1FWX A;  2CNX A;  3K26 A;  2MTA H;  1XIP A;  3UR4 A;  1JTD B;  3AL8 A;  4LGN A;  3K71 A;  2AGL A;  3JRP A;  5KDO B;  1PEV A;  5B4W A;  3MMY A;  3ZE2 A;  4K3I D;  3OL2 A;  4GM8 A;  3GD1 I;  5CXC A;  3EI3 A;  4MK0 B;  4OZU A;  4PBZ A;  4J84 A;  2XL3 A;  3EI2 A;  4NC4 A;  3NID A;  5M5T A;  4AX4 A;  1GG2 B;  2BKL A;  3JRO A;  3V4V A;  2OVP B;  2HYE A;  2HKM A;  4CI1 A;  3SCY A;  2GC7 A;  2H9L A;  4JT5 C;  3O4J A;  2H9P A;  1O6G A;  3FCU A;  1N6F A;  1N6E A;  2UZX B;  1VZ2 A;  5C2V B;  4MMZ A;  2B5M A;  4CC9 A;  4ERQ A;  4N14 A;  2HJ4 A;  4J82 A;  3BG0 A;  4AEZ A;  4BP9 A;  4NSX A;  1GP2 B;  2OK4 A;  4PXW A;  1I2M B;  5K19 A;  1JMX B;  3IJC A;  3C75 H;  2XE4 A;  3MXX A;  1SQ9 A;  3MUN A;  4O3U B;  5HYN B;  2AH1 A;  4MMX A;  3JZG A;  4BL0 A;  1GOH A;  2TRC B;  2H14 A;  3I7P A;  4G1M A;  4CZX A;  3NIG A;  5CXB B;  5EML B;  5EAM A;  1E8N A;  1YFQ A;  4K3J B;  3V9F A;  3SBP A;  3I2N A;  1PI6 A;  1R5M A;  4LG8 A;  4BUJ C;  3UVM A;  2XDW A;  3K72 A;  4E54 A;  3EI1 A;  4JSP C;  4RE6 A;  2HXC A;  5EAP A;  1VYH C;  4ZOY A;  4PC0 A;  2HES X;  4DNW A;  4NAA A;  1P22 A;  2I0T A;  3JB9 L;  3ZE1 A;  3CIK B;  1GOF A;  1E5T A;  3DWL C;  2HU7 A;  5EMK B;  2I3S A;  5HE1 B;  3EQ7 A;  1H2Z A;  2VDN A;  2W18 A;  3SJL D;  5EM2 A;  3SBQ A;  4G55 A;  2G9A A;  4PNK B;  3L4M D;  2IUQ A;  4J0W A;  3EQ8 A;  2VDL A;  5H17 A;  4XEI C;  3DXM C;  2VZ3 A;  1E8M A;  2IUP A;  3MUO A;  2I0S A;  3UVK A;  4FAV D;  1U4C A;  4O3T B;  3J80 g;  2CN3 A;  3EMH A;  3UVL A;  1SQJ A;  3JZH A;  4ERZ A;  5IT9 g;  3I89 A;  4J8B A;  5C9Z B;  1JJU B;  1BPO A;  3F3F A;  3BWS A;  4J77 A;  2BBK H;  5TDH B;  4FA5 D;  3I7N A;  3IIW A;  5CYK B;  4GGA A;  3E0C A;  3PXW D;  5E6R A;  5M5U A;  1RI6 A;  4A2M A;  2P9K C;  3MVD K;  3ZDZ A;  4A0B A;  1OLZ A;  4Y5R D;  5FLX g;  4AMY A;  3OKY A;  3UKU C;  1MDA H;  2PM6 B;  3OTT A;  4O2W A;  2I0R A;  3OF7 A;  1A0R B;  2UZY B;  2EIB A;  3RFH A;  4JHP C;  1K32 A;  5C2W B;  4DNV A;  2AGZ A;  4QRJ A;  4OWR A;  4AN1 A;  3L4O D;  2QZP A;  4U1E I;  2CE8 A;  4CY2 A;  4D0K A;  1Q47 A;  4EWR A;  4A09 B;  1MG2 A;  3O4I A;  3RFG A;  2GC4 A;  4LG9 A;  2CE9 A;  1C9L A;  4CY3 A;  2P9L C;  3KCI A;  5M5V A;  2P9U C;  3F3G A;  3I8E A;  4O1Q D;  4RE5 A;  4CI2 A;  4AN0 A;  1XHM A;  4GM3 A;  3VH0 A;  3FGB A;  1NR0 A;  4A0A B;  4L3G D;  4XYI A;  1QFS A;  3V4P A;  3SHF A;  4ERY A;  4IA9 A;  3IUQ A;  3GFC A;  3BG1 A;  1OMW B;  2H9M A;  2Q7Q A;  4CI8 A;  4H5J A;  3V7D B;  4J0X A;  5EMM B;  1QNI A;  1NEX B;  4J86 A;  4CZY A;  2Z2N A;  3MZL A;  1C9I A;  5K1C C;  3V5W B;  2AH0 A;  2B5N A;  2I3T A;  3NVN A;  2Z2P A;  2EID A;  4QQE A;  2OJY A;  1UTC A;  3AL8 B;  1B9Y A;  3SLE D;  3T3P A;  2EBS A;  4QAM A;  2IWF A;  3AFC A;  3W15 A;  2AGX A;  4JHN A;  4KFM B;  2IUV A;  4ZOX A;  5CXC B;  4O9D A;  5FFO A;  4GM9 A;  3ZWL B;  2J57 G;  2H47 A;  4A2L A;  1VE7 A;  3I7O A;  3ZDY A;  3CFV A;  2H9N A;  3JAM g;  4CI3 A;  5H14 A;  3MKS B;  4UI9 R;  4Z8L A;  2XYI A;  3N0D A;  3IJE A;  2CO0 C;  3C9C A;  5EMJ B;  1GOG A;  4A11 B;  4IMM A;  3UVN A;  2QR5 A;  5IGQ A;  5GXI A;  3FCS A;  4DNU A;  3SFZ A;  1GXR A;  4NBM A;  4JT6 C;  5FA5 B;  3B7F A;  2PM9 A;  3RLM D;  4ZOZ A;  4E5Z B;  2AQ5 A;  3NIF A;  2H68 A;  3OKT A;  3O4H A;  2H3X A;  5CYK A;  3ZE0 A;  4GMB A;  3IKO A;  2XU7 A;  4GQ1 A;  5FKR A;  1MG3 A;  2EIC A;  4A08 A;  4BP8 A;  1ERJ A;  2IAA A;  2P9S C;  4YVD A;  1SHY B;  4ZN4 A;  3RRM C;  2G99 A;  1B9X A;  3IUN A;  3OKW A;  3MZK A;  1JOF A;  3CFS B;  3K6S A;  2HU5 A;  2H6Q A;  4A7J A;  2J55 H;  2AGY A;  4FA1 D;  3VI4 A;  4PBY A;  2VDM A;  4J87 A;  1PBY B;  1L0Q A; 
#chains in the Genus database with same CATH homology
 5H1M A;  3PVW B;  2AGW A;  4GQ2 P;  5FXY A;  3EI4 B;  4BH6 A;  3PXS D;  3U4Y A;  3PE7 A;  2P9N C;  5A2Q g;  3PVU B;  3K27 A;  4AOW A;  5IJ7 E;  4ESG A;  2O9K A;  3UKR C;  4J79 A;  3UVO A;  2BCJ B;  5TF2 A;  4J81 A;  2P9I C;  2CO0 A;  4GQB B;  5HE2 B;  5FKT A;  4A0A A;  5AMS A;  3RN0 D;  3SN6 B;  3IIY A;  5SXM A;  3NVX A;  3C99 A;  3DXK C;  5HQG A;  3EWE A;  3DM0 A;  1N6D A;  3OKY B;  2QXV A;  2J56 H;  3IJ0 A;  2OVR B;  2YNO A;  4XYH A;  2OK6 A;  1PBY B;  4D6V A;  1S4U X;  4L9O A;  4L1Q D;  3SVW D;  5IJ8 E;  2PM7 B;  5FKS A;  5EAL A;  4H5I A;  4U7A A;  3SXT D;  2P9P C;  3A0F A;  5CXB A;  5THA A;  4PSX B;  2YNN A;  3C5M A;  3VGZ A;  5IC7 A;  3ORV D;  4GGD A;  3I7H A;  2OIZ A;  2B5L A;  5HE0 B;  4A11 A;  3OL2 B;  3MKQ A;  2CN2 A;  3EI3 B;  4Y7R A;  5FQD A;  5EAR A;  3RSE C;  3ODT A;  4JXM A;  3RMZ D;  3JZN A;  4R7A B;  3EI2 B;  4G56 B;  4JD2 C;  4QL1 A;  3DSM A;  4HDJ A;  4X3E A;  3P4F A;  3AH8 B;  4E5Z A;  5GXH A;  3SWS D;  3PSL A;  2IUR A;  2GNQ A;  1TBG A;  5JWZ A;  4ZOV A;  4FWW A;  3SMR A;  2QC5 A;  3EG6 A;  5GSA A;  5I5I A;  4FB1 D;  3I7L A;  3GRE A;  5I5M A;  5AFU 3;  1GOT B;  3KRW B;  2Z2O A;  4FHL A;  4FA9 D;  3N0E A;  3OW8 A;  5TEE A;  4X63 B;  3AL9 A;  2PBI B;  2YMU A;  3EU7 A;  5FKQ A;  4J78 A;  4O45 A;  4X61 B;  3ULE C;  2YNP A;  3VA6 A;  2XL2 A;  3EI4 A;  3JPX A;  2HKR A;  1JMZ B;  4I79 A;  4QT8 A;  3I7K A;  4X60 B;  5HE3 B;  4FAN D;  1U2V C;  3HFQ A;  4GGC A;  4E54 B;  2YB8 B;  5I5J A;  3EI1 B;  3F3P A;  3PXT D;  2IWK A;  4CY5 A;  5GMK n;  1PGU A;  2B4E A;  1K8K C;  2OVQ B;  1XKS A;  3RN1 D;  2PM9 B;  3NVQ A;  5TEF A;  4TZ4 A;  4A09 A;  5EM2 B;  4JSV C;  2H13 A;  3I8C A;  3FM0 A;  4L3H D;  4J8G A;  5IGO A;  3PSC B;  4GZ8 A;  4A08 B;  5AJA A;  4CY1 A;  2H6K A;  4PSW B;  1TYQ C;  2H6N A;  4JSN C;  2HJB A;  3SBR A;  4ES0 A;  3J81 g;  4FA4 D;  4CZV A;  2YBA A;  4JSX C;  3KRX B;  4A0B B;  3IJ1 A;  3FRX A;  1FWX A;  2CNX A;  3K26 A;  2MTA H;  1XIP A;  3UR4 A;  3AL8 A;  4LGN A;  2AGL A;  3JRP A;  5KDO B;  1PEV A;  5B4W A;  3MMY A;  4K3I D;  3OL2 A;  4GM8 A;  5CXC A;  3EI3 A;  4MK0 B;  4OZU A;  4PBZ A;  4J84 A;  2XL3 A;  3EI2 A;  1GG2 B;  3JRO A;  2OVP B;  2HYE A;  2HKM A;  4CI1 A;  3SCY A;  2GC7 A;  2H9L A;  4JT5 C;  2H9P A;  1N6F A;  1N6E A;  2UZX B;  5C2V B;  2B5M A;  4CC9 A;  4ERQ A;  4N14 A;  2HJ4 A;  4J82 A;  3BG0 A;  4AEZ A;  4NSX A;  1GP2 B;  2OK4 A;  4PXW A;  5K19 A;  1JMX B;  3IJC A;  3C75 H;  3MXX A;  1SQ9 A;  4O3U B;  5HYN B;  2AH1 A;  4BL0 A;  3JZG A;  2TRC B;  2H14 A;  3I7P A;  4CZX A;  5CXB B;  5EML B;  5EAM A;  1YFQ A;  4K3J B;  3V9F A;  3SBP A;  3I2N A;  1PI6 A;  1R5M A;  4LG8 A;  4BUJ C;  3UVM A;  4E54 A;  3EI1 A;  4JSP C;  2HXC A;  5EAP A;  1VYH C;  4ZOY A;  4PC0 A;  2HES X;  1P22 A;  2I0T A;  3JB9 L;  3CIK B;  3DWL C;  5EMK B;  2I3S A;  5HE1 B;  2W18 A;  3SJL D;  5EM2 A;  3SBQ A;  2G9A A;  4PNK B;  3L4M D;  2IUQ A;  4J0W A;  5H17 A;  4XEI C;  3DXM C;  2IUP A;  2I0S A;  3UVK A;  4FAV D;  1U4C A;  4O3T B;  3J80 g;  2CN3 A;  3EMH A;  3UVL A;  1SQJ A;  3JZH A;  4ERZ A;  5IT9 g;  3I89 A;  4J8B A;  5C9Z B;  1JJU B;  3F3F A;  3BWS A;  4J77 A;  2BBK H;  5TDH B;  4FA5 D;  3I7N A;  3IIW A;  5CYK B;  4GGA A;  3E0C A;  3PXW D;  1RI6 A;  4A2M A;  2P9K C;  4A0B A;  1OLZ A;  4Y5R D;  5FLX g;  3OKY A;  3UKU C;  1MDA H;  2PM6 B;  3OTT A;  2I0R A;  1A0R B;  2UZY B;  3RFH A;  1K32 A;  5C2W B;  2AGZ A;  4QRJ A;  4OWR A;  3L4O D;  4U1E I;  2CE8 A;  4CY2 A;  4D0K A;  1Q47 A;  4EWR A;  4A09 B;  1MG2 A;  3RFG A;  2GC4 A;  4LG9 A;  2CE9 A;  4CY3 A;  2P9L C;  2P9U C;  3F3G A;  3I8E A;  4O1Q D;  4CI2 A;  1XHM A;  4GM3 A;  3VH0 A;  3FGB A;  1NR0 A;  4A0A B;  4L3G D;  4XYI A;  3SHF A;  4ERY A;  4IA9 A;  3GFC A;  3BG1 A;  1OMW B;  2H9M A;  2Q7Q A;  4CI8 A;  4H5J A;  3V7D B;  4J0X A;  5EMM B;  1QNI A;  1NEX B;  4J86 A;  4CZY A;  2Z2N A;  3MZL A;  5K1C C;  3V5W B;  2AH0 A;  2B5N A;  2I3T A;  3NVN A;  2Z2P A;  4QQE A;  2OJY A;  3AL8 B;  3SLE D;  1B9Y A;  2EBS A;  2IWF A;  3AFC A;  3W15 A;  2AGX A;  4KFM B;  2IUV A;  4ZOX A;  5CXC B;  4O9D A;  4GM9 A;  3ZWL B;  2J57 G;  2H47 A;  4A2L A;  3I7O A;  3CFV A;  2H9N A;  3JAM g;  4CI3 A;  5H14 A;  3MKS B;  4UI9 R;  4Z8L A;  2XYI A;  3N0D A;  2CO0 C;  3C9C A;  5EMJ B;  4A11 B;  4IMM A;  3UVN A;  5IGQ A;  5GXI A;  3SFZ A;  1GXR A;  4JT6 C;  5FA5 B;  3B7F A;  2PM9 A;  3RLM D;  4ZOZ A;  4E5Z B;  2AQ5 A;  3OKT A;  2H68 A;  2H3X A;  5CYK A;  4GMB A;  3IKO A;  2XU7 A;  4GQ1 A;  5FKR A;  1MG3 A;  4A08 A;  1ERJ A;  2IAA A;  2P9S C;  4YVD A;  1SHY B;  4ZN4 A;  3RRM C;  2G99 A;  1B9X A;  3OKW A;  3MZK A;  1JOF A;  3CFS B;  2H6Q A;  4A7J A;  2J55 H;  2AGY A;  4FA1 D;  4PBY A;  4J87 A;  4J73 A;  1L0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...