4PC0A

Structure of the human rbap48-mta1(670-711) complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
402
structure length
402
Chain Sequence
DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the architecture of the NuRD complex: Structure of the RbAp48-MTA1 sub-complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Histone-binding protein RBBP4
total genus 94
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4pc0A00
4LG8A 3CFSB 5HE0B 4BL0A 4L3HD 4A09A 4FHLA 4J86A 4X61B 3MXXA 5FKTA 2QXVA 3V5WB 5EMKB 4GM3A 3MZLA 4FA1D 5AJAA 2HKRA 3SWSD 4FB1D 2PM6B 2BBKH 4O3TB 4GGAA 2TRCB 1XKSA 2YNNA 1JMXB 4CY1A 4D0KA 3AFCA 1B9YA 1L0QA 2AQ5A 4TZ4A 1SQ9A 2IAAA 3N0DA 4PSWB 2UZYB 3UVOA 4CI2A 4GM8A 4GM9A 4PNKB 3ODTA 3RMZD 4YVDA 2IWFA 4A0BA 2YNPA 3J81g 2IUVA 3SXTD 3RN1D 3UKUC 2HESX 2AGYA 5EALA 4CI1A 3PSLA 4L9OA 3F3PA 3L4OD 4ERZA 3EI1A 1TYQC 4J79A 5CXCA 4O3UB 2CE8A 4OZUA 4HDJA 4EWRA 2J55H 2Q7QA 3I7PA 5FXYA 4FA4D 3JRPA 4I79A 3EG6A 5FKRA 3B7FA 1XIPA 3C9CA 4E54B 3I7KA 1PI6A 2J56H 3JROA 2YNOA 3UVKA 2OVRB 4A09B 3F3FA 2CO0C 4Y7RA 2H6NA 5EM2A 3EI2A 5CXBB 1OMWB 3BG1A 5FLXg 5GXIA 4O45A 1PBYB 3FGBA 3GREA 3SVWD 2UZXB 2O9KA 2AGLA 4O1QD 5TDHB 2GC4A 5HYNB 4QT8A 5FA5B 5IT9g 3OKTA 3ORVD 3NVNA 2OK6A 3EU7A 3IJ1A 4JT5C 3V9FA 2OJYA 2B5LA 4PC0A 3AL9A 5THAA 3SCYA 4A11B 1A0RB 4CC9A 4NSXA 4GQBB 1NR0A 1NEXB 1N6EA 4IMMA 2H6QA 2CNXA 3RSEC 2OVQB 4ZOXA 1MDAH 1S4UX 4CZXA 1U2VC 2I0SA 1GXRA 1XHMA 3F3GA 4J87A 5EMLB 3RN0D 2H68A 5HE2B 3SN6B 1PEVA 3BWSA 3PSCB 3BG0A 5TF2A 4JSXC 3I7NA 3N0EA 1OLZA 3SBRA 3EI2B 4JSPC 2H14A 3JAMg 3OL2A 2Z2NA 4J73A 3JZNA 1K32A 1MG2A 2Z2OA 3GFCA 2G9AA 2XL3A 2IURA 3DWLC 5TEFA 3I8CA 2I3TA 1Q47A 4A2LA 5KDOB 5IGOA 4PBYA 5SXMA 3MZKA 4QRJA 3HFQA 3SBPA 4UI9R 4MK0B 4A0AA 2OK4A 3CFVA 4A08A 5JWZA 2B5NA 4GQ1A 3I7OA 1JMZB 3J80g 3MKQA 4JT6C 2P9PC 5B4WA 2HJBA 2P9SC 3IKOA 3OTTA 3V7DB 3I2NA 2P9NC 3C75H 1GG2B 3SMRA 4Z8LA 4FAND 2AGXA 4ESGA 2I0RA 5HE1B 3IIYA 3MKSB 4ZOZA 3OKWA 4KFMB 3EI3B 2HJ4A 5GSAA 5A2Qg 2I3SA 3EI4A 5GXHA 3VH0A 4OWRA 3C5MA 3I8EA 5TEEA 2I0TA 1JOFA 3KRXB 4JD2C 2AH1A 3RRMC 5CYKA 1N6FA 3DXKC 4L1QD 3ULEC 4CZVA 3PXSD 2AGWA 2GC7A 2IUPA 4G56B 4GGCA 1U4CA 4E5ZA 4CY2A 4A7JA 4J0WA 5EMMB 2GNQA 2OIZA 1K8KC 4FWWA 2CN3A 4O9DA 3SHFA 3JZGA 4U7AA 5FQDA 1VYHC 4BH6A 4A0AB 1SHYB 4A08B 4J78A 1JJUB 2H9LA 4FA5D 2HKMA 2PM7B 3UVMA 1YFQA 3I7LA 4L3GD 4U1EI 2H3XA 2PBIB 4H5JA 5EAMA 2YBAA 3RLMD 4X60B 3UVNA 5H1MA 2CE9A 1QNIA 3IJ0A 4AEZA 4J8GA 5EM2B 5GMKn 4PXWA 5CXBA 2MTAH 3A0FA 2B5MA 3EI1B 4K3JB 4K3ID 3PXTD 5I5IA 1R5MA 5CYKB 5EARA 3ZWLB 2IWKA 2B4EA 4IA9A 4PBZA 3DSMA 3CIKB 4N14A 5IGQA 3NVQA 3DXMC 2BCJB 5C2WB 4CY3A 3OKYB 1TBGA 4ZN4A 5EAPA 2P9KC 4GGDA 4J77A 1GP2B 3K27A 4J8BA 5HE3B 2XYIA 3JZHA 2H9PA 2P9IC 4J0XA 4Y5RD 1SQJA 3UKRC 4A2MA 5K19A 1B9XA 3MMYA 2AH0A 5K1CC 3OW8A 3PVWB 1P22A 2IUQA 5HQGA 4ZOYA 3UVLA 4XEIC 2Z2PA 5H14A 2HXCA 2P9LC 3IIWA 3SFZA 2XL2A 3RFGA 5H17A 3PVUB 3E0CA 2CO0A 4BUJC 2QC5A 4ERQA 4A11A 4X3EA 3IJCA 2HYEA 4QQEA 2PM9B 3K26A 3RFHA 3PXWD 2H13A 1FWXA 3AL8A 3NVXA 2AGZA 4FAVD 4JSVC 2H47A 3KRWB 2EBSA 4XYIA 1GOTB 4FA9D 3SLED 3JPXA 4X63B 5FKSA 2H6KA 4LG9A 3SJLD 4PSXB 2H9NA 3AH8B 3OKYA 2G99A 4CI3A 3I89A 3OL2B 5AMSA 4GQ2P 4ZOVA 2YMUA 5I5JA 3FM0A 2OVPB 3W15A 3VGZA 5I5MA 3SBQA 1MG3A 4LGNA 4J84A 4CY5A 4XYHA 5IJ7E 3C99A 1RI6A 4AOWA 3DM0A 5EMJB 4R7AB 2P9UC 4ES0A 4H5IA 4D6VA 3U4YA 5FKQA 3UR4A 3EMHA 3FRXA 4GZ8A 2XU7A 4A0BB 2W18A 2H9MA 2YB8B 4ERYA 3I7HA 1ERJA 3EI3A 4JXMA 3PE7A 5IC7A 2PM9A 3EI4B 3EWEA 4QL1A 3VA6A 5CXCB 2J57G 3AL8B 5C2VB 3P4FA 1PGUA 4J81A 1N6DA 3L4MD 5C9ZB 5AFU3 2CN2A 4JSNC 4CZYA 4CI8A 4J82A 3JB9L 4GMBA 4E5ZB 5IJ8E 4E54A
chains in the Genus database with same CATH superfamily
4LG8A 3CFSB 5HE0B 4BL0A 3MUOA 4L3HD 4A09A 4NAAA 4FHLA 4J86A 4X61B 3VI4A 3MXXA 5FKTA 2QXVA 4DNVA 3V5WB 3GD1I 5EMKB 3NIFA 4GM3A 3MZLA 4FA1D 5AJAA 2HKRA 3SWSD 4FB1D 2PM6B 2BBKH 4WK0A 4O3TB 4GGAA 2TRCB 1XKSA 2YNNA 1JMXB 3NIDA 4CY1A 4D0KA 1M1XA 5M5RA 3AFCA 1B9YA 1L0QA 3EQ7A 4JHNA 2AQ5A 4TZ4A 1SQ9A 2IAAA 3N0DA 4PSWB 3FCSA 2VZ3A 2UZYB 3UVOA 4CI2A 4GM8A 3ZDXA 4GM9A 4PNKB 3ODTA 3RMZD 4YVDA 1C9IA 2IWFA 4A0BA 1VZ3A 2YNPA 3J81g 2IUVA 3SXTD 3RN1D 3UKUC 1C9LA 2HESX 4BP8A 2AGYA 5EALA 4CI1A 3PSLA 4BCDA 4L9OA 3F3PA 3L4OD 3VI3A 4ERZA 3EI1A 1TYQC 4J79A 5CXCA 4O3UB 2CE8A 1I2MB 4OZUA 4HDJA 4EWRA 2J55H 2Q7QA 3I7PA 5FXYA 4FA4D 3JRPA 4I79A 3EG6A 3O4JA 5FKRA 3B7FA 1XIPA 3C9CA 4E54B 3I7KA 1PI6A 2J56H 3JROA 2YNOA 3UVKA 1GOGA 2OVRB 4A09B 3F3FA 4IRZA 2CO0C 4Y7RA 2H6NA 5EM2A 1A12A 5CXBB 3EI2A 1OMWB 3BG1A 5FLXg 5GXIA 4O45A 1PBYB 3FGBA 3GREA 3SVWD 2UZXB 2O9KA 2AGLA 4O1QD 5TDHB 1JTDB 2GC4A 1QFSA 5HYNB 4QT8A 5FA5B 4MMYA 5IT9g 4L1MA 3OKTA 3ORVD 3T3PA 3NVNA 2OK6A 3EU7A 3IJ1A 4JT5C 3V9FA 2VC2A 2OJYA 2B5LA 1O6GA 5M5TA 4G1MA 4PC0A 3AL9A 5THAA 4Z7QA 3SCYA 4A11B 1A0RB 4CC9A 4NSXA 1TYEA 4GQBB 1NR0A 1NEXB 1N6EA 4QAMA 4IMMA 2H6QA 2CNXA 3RSEC 2OVQB 4ZOXA 4AX4A 1MDAH 1S4UX 4CZXA 3IJEA 1U2VC 2I0SA 1U8CA 1GXRA 1XHMA 3IULA 1UTCA 3F3GA 4J87A 5EMLB 3RN0D 2VDKA 2H68A 5HE2B 4Z7OA 3SN6B 5M5UA 2QR5A 1PEVA 3BWSA 3ZE1A 4AMYA 3PSCB 3BG0A 5TF2A 4JSXC 4DNUA 3I7NA 3KCIA 3N0EA 1OLZA 5E6SA 3SBRA 3EI2B 4JSPC 2H14A 3JAMg 3OL2A 5C92A 3V4VA 4BCCA 2Z2NA 2EIDA 5E6UA 4J73A 4RE5A 3JZNA 2JKXA 1K32A 1MG2A 2Z2OA 3GFCA 2HU7A 2G9AA 2XL3A 1H2WA 2IURA 3DWLC 5TEFA 3I8CA 2I3TA 1Q47A 4A2LA 5KDOB 5IGOA 2VDRA 4PBYA 5SXMA 1E8MA 3MZKA 4QRJA 3HFQA 1T2XA 3SBPA 2EIEA 4UI9R 4MK0B 4A0AA 2OK4A 3CFVA 4A08A 5JWZA 2B5NA 4GQ1A 3I7OA 1JMZB 1H2XA 3J80g 2WQ8A 3MKQA 4JT6C 3K72A 4O2WA 2P9PC 5B4WA 2HJBA 2P9SC 3IKOA 3OTTA 3V7DB 3I2NA 1UOPA 2P9NC 4NENA 3C75H 4BP9A 1GG2B 3SMRA 4Z8LA 4FAND 2AGXA 4ESGA 1VE6A 2I0RA 5HE1B 3IIYA 3MKSB 4ZOZA 2EICA 3OKWA 2VDOA 4KFMB 3EI3B 2HJ4A 5GSAA 5A2Qg 2I3SA 3EI4A 5GXHA 3VH0A 4OWRA 3C5MA 3I8EA 5TEEA 4JHPC 2I0TA 1JOFA 3KRXB 4JD2C 2AH1A 3RRMC 5CYKA 1N6FA 3DXKC 1JV2A 4L1QD 3ULEC 5M5VA 4CZVA 3PXSD 2AGWA 1UOOA 3FCUA 2GC7A 2IUPA 4BCBA 4G56B 4GGCA 1U4CA 4E5ZA 4CY2A 4A7JA 5C86A 2VDNA 4J0WA 5EMMB 2GNQA 2OIZA 1K8KC 1GOHA 4FWWA 3K71A 2CN3A 4O9DA 3SHFA 2XZGA 3JZGA 4U7AA 5FQDA 1VYHC 4BH6A 1QFMA 4MMZA 1VZ2A 4A0AB 3IURA 1BPOA 1SHYB 4A08B 3DDUA 4J78A 1JJUB 3O4HA 5M61A 2H9LA 3ZE2A 4FA5D 2HKMA 2PM7B 3UVMA 1YFQA 4MMXA 3I7LA 4L3GD 4U1EI 4G1EA 2H3XA 2PBIB 2VDQA 4H5JA 2YBAA 5EAMA 3RLMD 4X60B 3UVNA 3V4PA 2VDPA 5H1MA 2CE9A 1QNIA 5HDBA 3IJ0A 4AEZA 4J8GA 5EM2B 5GMKn 4PXWA 5CXBA 2MTAH 3A0FA 1YR2A 2B5MA 5FFGA 3EI1B 4K3JB 4K3ID 3PXTD 4WK2A 5I5IA 1R5MA 4DNWA 5CYKB 5EARA 3ZWLB 2IWKA 2B4EA 3MVDK 4IA9A 4PBZA 1L5GA 3DSMA 3CIKB 4N14A 3OF7A 5IGQA 3NVQA 3DXMC 2BCJB 5C2WB 4CY3A 3OKYB 1TBGA 4ZN4A 3IUQA 2P9KC 5EAPA 4GGDA 2VDMA 4J77A 4AMZA 1GP2B 3K27A 4J8BA 5HE3B 3O4GA 2XYIA 3JZHA 2H9PA 2P9IC 3MUNA 1O6FA 4J0XA 3ZDZA 4Y5RD 1SQJA 3UKRC 3EQ9A 4A2MA 5K19A 1B9XA 3MMYA 2AH0A 5K1CC 3OW8A 1H2ZA 3PVWB 1P22A 2IUQA 5HQGA 4ZOYA 3NIGA 3UVLA 4NBMA 4XEIC 2Z2PA 5H14A 2HXCA 2P9LC 3IIWA 5FFOA 3K6SA 3SFZA 2XL2A 3RFGA 5H17A 3PVUB 3E0CA 2CO0A 2EIBA 4BUJC 4Z7NA 2QC5A 4ERQA 4A11A 4X3EA 4UM8A 1E5TA 3IJCA 2HYEA 4QQEA 2PM9B 3K26A 4RE6A 3RFHA 3PXWD 3T3MA 1UOQA 2H13A 1FWXA 3AL8A 4AN0A 3NVXA 2AGZA 4WJKA 4FAVD 4WK4A 3IUJA 4JSVC 3IVMA 2H47A 3KRWB 2EBSA 4XYIA 1GOTB 3QI0A 4FA9D 3SLED 3JPXA 4X63B 5FKSA 4D9SA 2H6KA 1H2YA 4LG9A 2XE4A 3QHYB 3SJLD 4PSXB 2XDWA 2H9NA 3AH8B 3OKYA 2G99A 4G55A 2HU8A 4CI3A 3I89A 4UM9A 3OL2B 5AMSA 4GQ2P 4ZOVA 2YMUA 5I5JA 3FM0A 2OVPB 3W15A 3ZE0A 1E8NA 3VGZA 5I5MA 3EQ8A 3SBQA 1MG3A 4LGNA 4J84A 4CY5A 3O4IA 4XYHA 5IJ7E 2BKLA 3C99A 1RI6A 4AOWA 3DM0A 5EMJB 4AN1A 1K3IA 1VE7A 2VDLA 3GC3B 4R7AB 4O02A 5M5SA 2P9UC 3IUNA 4ES0A 2VZ1A 4H5IA 4D6VA 3U4YA 5FKQA 3UR4A 3EMHA 3FRXA 4GZ8A 2XU7A 4A0BB 2W18A 3IUMA 5E6RA 2H9MA 2HU5A 2YB8B 3ZDYA 4ERYA 3I7HA 2QZPA 1ERJA 3EI3A 4JXMA 3PE7A 5IC7A 1GOFA 2PM9A 3EI4B 3EWEA 4QL1A 3VA6A 5CXCB 2J57G 3AL8B 5C2VB 3P4FA 1PGUA 4J81A 1N6DA 3L4MD 5C9ZB 5AFU3 2CN2A 4JSNC 4CZYA 4CI8A 4J82A 3JB9L 4GMBA 4NC4A 4E5ZB 5IJ8E 4E54A
chains in the Genus database with same CATH topology
4LG8A 3CFSB 5HE0B 4BL0A 4L3HD 4A09A 4FHLA 4J86A 4X61B 3MXXA 5FKTA 2QXVA 3V5WB 5EMKB 4GM3A 3MZLA 4FA1D 5AJAA 2HKRA 3SWSD 4FB1D 2PM6B 2BBKH 4O3TB 4GGAA 2TRCB 1XKSA 2YNNA 1JMXB 4CY1A 4D0KA 3AFCA 1B9YA 1L0QA 2AQ5A 4TZ4A 1SQ9A 2IAAA 3N0DA 4PSWB 2UZYB 3UVOA 4CI2A 4GM8A 4GM9A 4PNKB 3ODTA 3RMZD 4YVDA 2IWFA 4A0BA 2YNPA 3J81g 2IUVA 3SXTD 3RN1D 3UKUC 2HESX 2AGYA 5EALA 4CI1A 3PSLA 4L9OA 3F3PA 3L4OD 4ERZA 3EI1A 1TYQC 4J79A 5CXCA 4O3UB 2CE8A 4OZUA 4HDJA 4EWRA 2J55H 2Q7QA 3I7PA 5FXYA 4FA4D 3JRPA 4I79A 3EG6A 5FKRA 3B7FA 1XIPA 3C9CA 4E54B 3I7KA 1PI6A 2J56H 3JROA 2YNOA 3UVKA 2OVRB 4A09B 3F3FA 2CO0C 4Y7RA 2H6NA 5EM2A 3EI2A 5CXBB 1OMWB 3BG1A 5FLXg 5GXIA 4O45A 1PBYB 3FGBA 3GREA 3SVWD 2UZXB 2O9KA 2AGLA 4O1QD 5TDHB 2GC4A 5HYNB 4QT8A 5FA5B 5IT9g 3OKTA 3ORVD 3NVNA 2OK6A 3EU7A 3IJ1A 4JT5C 3V9FA 2OJYA 2B5LA 4PC0A 3AL9A 5THAA 3SCYA 4A11B 1A0RB 4CC9A 4NSXA 4GQBB 1NR0A 1NEXB 1N6EA 4IMMA 2H6QA 2CNXA 3RSEC 2OVQB 4ZOXA 1MDAH 1S4UX 4CZXA 1U2VC 2I0SA 1GXRA 1XHMA 3F3GA 4J87A 5EMLB 3RN0D 2H68A 5HE2B 3SN6B 1PEVA 3BWSA 3PSCB 3BG0A 5TF2A 4JSXC 3I7NA 3N0EA 1OLZA 3SBRA 3EI2B 4JSPC 2H14A 3JAMg 3OL2A 2Z2NA 4J73A 3JZNA 1K32A 1MG2A 2Z2OA 3GFCA 2G9AA 2XL3A 2IURA 3DWLC 5TEFA 3I8CA 2I3TA 1Q47A 4A2LA 5KDOB 5IGOA 4PBYA 5SXMA 3MZKA 4QRJA 3HFQA 3SBPA 4UI9R 4MK0B 4A0AA 2OK4A 3CFVA 4A08A 5JWZA 2B5NA 4GQ1A 3I7OA 1JMZB 3J80g 3MKQA 4JT6C 2P9PC 5B4WA 2HJBA 2P9SC 3IKOA 3OTTA 3V7DB 3I2NA 2P9NC 3C75H 1GG2B 3SMRA 4Z8LA 4FAND 2AGXA 4ESGA 2I0RA 5HE1B 3IIYA 3MKSB 4ZOZA 3OKWA 4KFMB 3EI3B 2HJ4A 5GSAA 5A2Qg 2I3SA 3EI4A 5GXHA 3VH0A 4OWRA 3C5MA 3I8EA 5TEEA 2I0TA 1JOFA 3KRXB 4JD2C 2AH1A 3RRMC 5CYKA 1N6FA 3DXKC 4L1QD 3ULEC 4CZVA 3PXSD 2AGWA 2GC7A 2IUPA 4G56B 4GGCA 1U4CA 4E5ZA 4CY2A 4A7JA 4J0WA 5EMMB 2GNQA 2OIZA 1K8KC 4FWWA 2CN3A 4O9DA 3SHFA 3JZGA 4U7AA 5FQDA 1VYHC 4BH6A 4A0AB 1SHYB 4A08B 4J78A 1JJUB 2H9LA 4FA5D 2HKMA 2PM7B 3UVMA 1YFQA 3I7LA 4L3GD 4U1EI 2H3XA 2PBIB 4H5JA 5EAMA 2YBAA 3RLMD 4X60B 3UVNA 5H1MA 2CE9A 1QNIA 3IJ0A 4AEZA 4J8GA 5EM2B 5GMKn 4PXWA 5CXBA 2MTAH 3A0FA 2B5MA 3EI1B 4K3JB 4K3ID 3PXTD 5I5IA 1R5MA 5CYKB 5EARA 3ZWLB 2IWKA 2B4EA 4IA9A 4PBZA 3DSMA 3CIKB 4N14A 5IGQA 3NVQA 3DXMC 2BCJB 5C2WB 4CY3A 3OKYB 1TBGA 4ZN4A 5EAPA 2P9KC 4GGDA 4J77A 1GP2B 3K27A 4J8BA 5HE3B 2XYIA 3JZHA 2H9PA 2P9IC 4J0XA 4Y5RD 1SQJA 3UKRC 4A2MA 5K19A 1B9XA 3MMYA 2AH0A 5K1CC 3OW8A 3PVWB 1P22A 2IUQA 5HQGA 4ZOYA 3UVLA 4XEIC 2Z2PA 5H14A 2HXCA 2P9LC 3IIWA 3SFZA 2XL2A 3RFGA 5H17A 3PVUB 3E0CA 2CO0A 4BUJC 2QC5A 4ERQA 4A11A 4X3EA 3IJCA 2HYEA 4QQEA 2PM9B 3K26A 3RFHA 3PXWD 2H13A 1FWXA 3AL8A 3NVXA 2AGZA 4FAVD 4JSVC 2H47A 3KRWB 2EBSA 4XYIA 1GOTB 4FA9D 3SLED 3JPXA 4X63B 5FKSA 2H6KA 4LG9A 3SJLD 4PSXB 2H9NA 3AH8B 3OKYA 2G99A 4CI3A 3I89A 3OL2B 5AMSA 4GQ2P 4ZOVA 2YMUA 5I5JA 3FM0A 2OVPB 3W15A 3VGZA 5I5MA 3SBQA 1MG3A 4LGNA 4J84A 4CY5A 4XYHA 5IJ7E 3C99A 1RI6A 4AOWA 3DM0A 5EMJB 4R7AB 2P9UC 4ES0A 4H5IA 4D6VA 3U4YA 5FKQA 3UR4A 3EMHA 3FRXA 4GZ8A 2XU7A 4A0BB 2W18A 2H9MA 2YB8B 4ERYA 3I7HA 1ERJA 3EI3A 4JXMA 3PE7A 5IC7A 2PM9A 3EI4B 3EWEA 4QL1A 3VA6A 5CXCB 2J57G 3AL8B 5C2VB 3P4FA 1PGUA 4J81A 1N6DA 3L4MD 5C9ZB 5AFU3 2CN2A 4JSNC 4CZYA 4CI8A 4J82A 3JB9L 4GMBA 4E5ZB 5IJ8E 4E54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG8 A;  3CFS B;  5HE0 B;  4BL0 A;  4L3H D;  4A09 A;  4FHL A;  4J86 A;  4X61 B;  3MXX A;  5FKT A;  2QXV A;  3V5W B;  5EMK B;  4GM3 A;  3MZL A;  4FA1 D;  5AJA A;  2HKR A;  3SWS D;  4FB1 D;  2PM6 B;  2BBK H;  4O3T B;  4GGA A;  2TRC B;  1XKS A;  2YNN A;  1JMX B;  4CY1 A;  4D0K A;  3AFC A;  1B9Y A;  1L0Q A;  2AQ5 A;  4TZ4 A;  1SQ9 A;  2IAA A;  3N0D A;  4PSW B;  2UZY B;  3UVO A;  4CI2 A;  4GM8 A;  4GM9 A;  4PNK B;  3ODT A;  3RMZ D;  4YVD A;  2IWF A;  4A0B A;  2YNP A;  3J81 g;  2IUV A;  3SXT D;  3RN1 D;  3UKU C;  2HES X;  2AGY A;  5EAL A;  4CI1 A;  3PSL A;  4L9O A;  3F3P A;  3L4O D;  4ERZ A;  3EI1 A;  1TYQ C;  4J79 A;  5CXC A;  4O3U B;  2CE8 A;  4OZU A;  4HDJ A;  4EWR A;  2J55 H;  2Q7Q A;  3I7P A;  5FXY A;  4FA4 D;  3JRP A;  4I79 A;  3EG6 A;  5FKR A;  3B7F A;  1XIP A;  3C9C A;  4E54 B;  3I7K A;  1PI6 A;  2J56 H;  3JRO A;  2YNO A;  3UVK A;  2OVR B;  4A09 B;  3F3F A;  2CO0 C;  4Y7R A;  2H6N A;  5EM2 A;  3EI2 A;  5CXB B;  1OMW B;  3BG1 A;  5FLX g;  5GXI A;  4O45 A;  1PBY B;  3FGB A;  3GRE A;  3SVW D;  2UZX B;  2O9K A;  2AGL A;  4O1Q D;  5TDH B;  2GC4 A;  5HYN B;  4QT8 A;  5FA5 B;  5IT9 g;  3OKT A;  3ORV D;  3NVN A;  2OK6 A;  3EU7 A;  3IJ1 A;  4JT5 C;  3V9F A;  2OJY A;  2B5L A;  4PC0 A;  3AL9 A;  5THA A;  3SCY A;  4A11 B;  1A0R B;  4CC9 A;  4NSX A;  4GQB B;  1NR0 A;  1NEX B;  1N6E A;  4IMM A;  2H6Q A;  2CNX A;  3RSE C;  2OVQ B;  4ZOX A;  1MDA H;  1S4U X;  4CZX A;  1U2V C;  2I0S A;  1GXR A;  1XHM A;  3F3G A;  4J87 A;  5EML B;  3RN0 D;  2H68 A;  5HE2 B;  3SN6 B;  1PEV A;  3BWS A;  3PSC B;  3BG0 A;  5TF2 A;  4JSX C;  3I7N A;  3N0E A;  1OLZ A;  3SBR A;  3EI2 B;  4JSP C;  2H14 A;  3JAM g;  3OL2 A;  2Z2N A;  4J73 A;  3JZN A;  1K32 A;  1MG2 A;  2Z2O A;  3GFC A;  2G9A A;  2XL3 A;  2IUR A;  3DWL C;  5TEF A;  3I8C A;  2I3T A;  1Q47 A;  4A2L A;  5KDO B;  5IGO A;  4PBY A;  5SXM A;  3MZK A;  4QRJ A;  3HFQ A;  3SBP A;  4UI9 R;  4MK0 B;  4A0A A;  2OK4 A;  3CFV A;  4A08 A;  5JWZ A;  2B5N A;  4GQ1 A;  3I7O A;  1JMZ B;  3J80 g;  3MKQ A;  4JT6 C;  2P9P C;  5B4W A;  2HJB A;  2P9S C;  3IKO A;  3OTT A;  3V7D B;  3I2N A;  2P9N C;  3C75 H;  1GG2 B;  3SMR A;  4Z8L A;  4FAN D;  2AGX A;  4ESG A;  2I0R A;  5HE1 B;  3IIY A;  3MKS B;  4ZOZ A;  3OKW A;  4KFM B;  3EI3 B;  2HJ4 A;  5GSA A;  5A2Q g;  2I3S A;  3EI4 A;  5GXH A;  3VH0 A;  4OWR A;  3C5M A;  3I8E A;  5TEE A;  2I0T A;  1JOF A;  3KRX B;  4JD2 C;  2AH1 A;  3RRM C;  5CYK A;  1N6F A;  3DXK C;  4L1Q D;  3ULE C;  4CZV A;  3PXS D;  2AGW A;  2GC7 A;  2IUP A;  4G56 B;  4GGC A;  1U4C A;  4E5Z A;  4CY2 A;  4A7J A;  4J0W A;  5EMM B;  2GNQ A;  2OIZ A;  1K8K C;  4FWW A;  2CN3 A;  4O9D A;  3SHF A;  3JZG A;  4U7A A;  5FQD A;  1VYH C;  4BH6 A;  4A0A B;  1SHY B;  4A08 B;  4J78 A;  1JJU B;  2H9L A;  4FA5 D;  2HKM A;  2PM7 B;  3UVM A;  1YFQ A;  3I7L A;  4L3G D;  4U1E I;  2H3X A;  2PBI B;  4H5J A;  5EAM A;  2YBA A;  3RLM D;  4X60 B;  3UVN A;  5H1M A;  2CE9 A;  1QNI A;  3IJ0 A;  4AEZ A;  4J8G A;  5EM2 B;  5GMK n;  4PXW A;  5CXB A;  2MTA H;  3A0F A;  2B5M A;  3EI1 B;  4K3J B;  4K3I D;  3PXT D;  5I5I A;  1R5M A;  5CYK B;  5EAR A;  3ZWL B;  2IWK A;  2B4E A;  4IA9 A;  4PBZ A;  3DSM A;  3CIK B;  4N14 A;  5IGQ A;  3NVQ A;  3DXM C;  2BCJ B;  5C2W B;  4CY3 A;  3OKY B;  1TBG A;  4ZN4 A;  5EAP A;  2P9K C;  4GGD A;  4J77 A;  1GP2 B;  3K27 A;  4J8B A;  5HE3 B;  2XYI A;  3JZH A;  2H9P A;  2P9I C;  4J0X A;  4Y5R D;  1SQJ A;  3UKR C;  4A2M A;  5K19 A;  1B9X A;  3MMY A;  2AH0 A;  5K1C C;  3OW8 A;  3PVW B;  1P22 A;  2IUQ A;  5HQG A;  4ZOY A;  3UVL A;  4XEI C;  2Z2P A;  5H14 A;  2HXC A;  2P9L C;  3IIW A;  3SFZ A;  2XL2 A;  3RFG A;  5H17 A;  3PVU B;  3E0C A;  2CO0 A;  4BUJ C;  2QC5 A;  4ERQ A;  4A11 A;  4X3E A;  3IJC A;  2HYE A;  4QQE A;  2PM9 B;  3K26 A;  3RFH A;  3PXW D;  2H13 A;  1FWX A;  3AL8 A;  3NVX A;  2AGZ A;  4FAV D;  4JSV C;  2H47 A;  3KRW B;  2EBS A;  4XYI A;  1GOT B;  4FA9 D;  3SLE D;  3JPX A;  4X63 B;  5FKS A;  2H6K A;  4LG9 A;  3SJL D;  4PSX B;  2H9N A;  3AH8 B;  3OKY A;  2G99 A;  4CI3 A;  3I89 A;  3OL2 B;  5AMS A;  4GQ2 P;  4ZOV A;  2YMU A;  5I5J A;  3FM0 A;  2OVP B;  3W15 A;  3VGZ A;  5I5M A;  3SBQ A;  1MG3 A;  4LGN A;  4J84 A;  4CY5 A;  4XYH A;  5IJ7 E;  3C99 A;  1RI6 A;  4AOW A;  3DM0 A;  5EMJ B;  4R7A B;  2P9U C;  4ES0 A;  4H5I A;  4D6V A;  3U4Y A;  5FKQ A;  3UR4 A;  3EMH A;  3FRX A;  4GZ8 A;  2XU7 A;  4A0B B;  2W18 A;  2H9M A;  2YB8 B;  4ERY A;  3I7H A;  1ERJ A;  3EI3 A;  4JXM A;  3PE7 A;  5IC7 A;  2PM9 A;  3EI4 B;  3EWE A;  4QL1 A;  3VA6 A;  5CXC B;  2J57 G;  3AL8 B;  5C2V B;  3P4F A;  1PGU A;  4J81 A;  1N6D A;  3L4M D;  5C9Z B;  5AFU 3;  2CN2 A;  4JSN C;  4CZY A;  4CI8 A;  4J82 A;  3JB9 L;  4GMB A;  4E5Z B;  5IJ8 E;  4E54 A; 
#chains in the Genus database with same CATH topology
 4LG8 A;  3CFS B;  5HE0 B;  4BL0 A;  3MUO A;  4L3H D;  4A09 A;  4NAA A;  4FHL A;  4J86 A;  4X61 B;  3VI4 A;  3MXX A;  5FKT A;  2QXV A;  4DNV A;  3V5W B;  3GD1 I;  5EMK B;  3NIF A;  4GM3 A;  3MZL A;  4FA1 D;  5AJA A;  2HKR A;  3SWS D;  4FB1 D;  2PM6 B;  2BBK H;  4WK0 A;  4O3T B;  4GGA A;  2TRC B;  1XKS A;  2YNN A;  1JMX B;  3NID A;  4CY1 A;  4D0K A;  1M1X A;  5M5R A;  3AFC A;  1B9Y A;  1L0Q A;  3EQ7 A;  4JHN A;  2AQ5 A;  4TZ4 A;  1SQ9 A;  2IAA A;  3N0D A;  4PSW B;  3FCS A;  2VZ3 A;  2UZY B;  3UVO A;  4CI2 A;  4GM8 A;  3ZDX A;  4GM9 A;  4PNK B;  3ODT A;  3RMZ D;  4YVD A;  1C9I A;  2IWF A;  4A0B A;  1VZ3 A;  2YNP A;  3J81 g;  2IUV A;  3SXT D;  3RN1 D;  3UKU C;  1C9L A;  2HES X;  4BP8 A;  2AGY A;  5EAL A;  4CI1 A;  3PSL A;  4BCD A;  4L9O A;  3F3P A;  3L4O D;  3VI3 A;  4ERZ A;  3EI1 A;  1TYQ C;  4J79 A;  5CXC A;  4O3U B;  2CE8 A;  1I2M B;  4OZU A;  4HDJ A;  4EWR A;  2J55 H;  2Q7Q A;  3I7P A;  5FXY A;  4FA4 D;  3JRP A;  4I79 A;  3EG6 A;  3O4J A;  5FKR A;  3B7F A;  1XIP A;  3C9C A;  4E54 B;  3I7K A;  1PI6 A;  2J56 H;  3JRO A;  2YNO A;  3UVK A;  1GOG A;  2OVR B;  4A09 B;  3F3F A;  4IRZ A;  2CO0 C;  4Y7R A;  2H6N A;  5EM2 A;  1A12 A;  5CXB B;  3EI2 A;  1OMW B;  3BG1 A;  5FLX g;  5GXI A;  4O45 A;  1PBY B;  3FGB A;  3GRE A;  3SVW D;  2UZX B;  2O9K A;  2AGL A;  4O1Q D;  5TDH B;  1JTD B;  2GC4 A;  1QFS A;  5HYN B;  4QT8 A;  5FA5 B;  4MMY A;  5IT9 g;  4L1M A;  3OKT A;  3ORV D;  3T3P A;  3NVN A;  2OK6 A;  3EU7 A;  3IJ1 A;  4JT5 C;  3V9F A;  2VC2 A;  2OJY A;  2B5L A;  1O6G A;  5M5T A;  4G1M A;  4PC0 A;  3AL9 A;  5THA A;  4Z7Q A;  3SCY A;  4A11 B;  1A0R B;  4CC9 A;  4NSX A;  1TYE A;  4GQB B;  1NR0 A;  1NEX B;  1N6E A;  4QAM A;  4IMM A;  2H6Q A;  2CNX A;  3RSE C;  2OVQ B;  4ZOX A;  4AX4 A;  1MDA H;  1S4U X;  4CZX A;  3IJE A;  1U2V C;  2I0S A;  1U8C A;  1GXR A;  1XHM A;  3IUL A;  1UTC A;  3F3G A;  4J87 A;  5EML B;  3RN0 D;  2VDK A;  2H68 A;  5HE2 B;  4Z7O A;  3SN6 B;  5M5U A;  2QR5 A;  1PEV A;  3BWS A;  3ZE1 A;  4AMY A;  3PSC B;  3BG0 A;  5TF2 A;  4JSX C;  4DNU A;  3I7N A;  3KCI A;  3N0E A;  1OLZ A;  5E6S A;  3SBR A;  3EI2 B;  4JSP C;  2H14 A;  3JAM g;  3OL2 A;  5C92 A;  3V4V A;  4BCC A;  2Z2N A;  2EID A;  5E6U A;  4J73 A;  4RE5 A;  3JZN A;  2JKX A;  1K32 A;  1MG2 A;  2Z2O A;  3GFC A;  2HU7 A;  2G9A A;  2XL3 A;  1H2W A;  2IUR A;  3DWL C;  5TEF A;  3I8C A;  2I3T A;  1Q47 A;  4A2L A;  5KDO B;  5IGO A;  2VDR A;  4PBY A;  5SXM A;  1E8M A;  3MZK A;  4QRJ A;  3HFQ A;  1T2X A;  3SBP A;  2EIE A;  4UI9 R;  4MK0 B;  4A0A A;  2OK4 A;  3CFV A;  4A08 A;  5JWZ A;  2B5N A;  4GQ1 A;  3I7O A;  1JMZ B;  1H2X A;  3J80 g;  2WQ8 A;  3MKQ A;  4JT6 C;  3K72 A;  4O2W A;  2P9P C;  5B4W A;  2HJB A;  2P9S C;  3IKO A;  3OTT A;  3V7D B;  3I2N A;  1UOP A;  2P9N C;  4NEN A;  3C75 H;  4BP9 A;  1GG2 B;  3SMR A;  4Z8L A;  4FAN D;  2AGX A;  4ESG A;  1VE6 A;  2I0R A;  5HE1 B;  3IIY A;  3MKS B;  4ZOZ A;  2EIC A;  3OKW A;  2VDO A;  4KFM B;  3EI3 B;  2HJ4 A;  5GSA A;  5A2Q g;  2I3S A;  3EI4 A;  5GXH A;  3VH0 A;  4OWR A;  3C5M A;  3I8E A;  5TEE A;  4JHP C;  2I0T A;  1JOF A;  3KRX B;  4JD2 C;  2AH1 A;  3RRM C;  5CYK A;  1N6F A;  3DXK C;  1JV2 A;  4L1Q D;  3ULE C;  5M5V A;  4CZV A;  3PXS D;  2AGW A;  1UOO A;  3FCU A;  2GC7 A;  2IUP A;  4BCB A;  4G56 B;  4GGC A;  1U4C A;  4E5Z A;  4CY2 A;  4A7J A;  5C86 A;  2VDN A;  4J0W A;  5EMM B;  2GNQ A;  2OIZ A;  1K8K C;  1GOH A;  4FWW A;  3K71 A;  2CN3 A;  4O9D A;  3SHF A;  2XZG A;  3JZG A;  4U7A A;  5FQD A;  1VYH C;  4BH6 A;  1QFM A;  4MMZ A;  1VZ2 A;  4A0A B;  3IUR A;  1BPO A;  1SHY B;  4A08 B;  3DDU A;  4J78 A;  1JJU B;  3O4H A;  5M61 A;  2H9L A;  3ZE2 A;  4FA5 D;  2HKM A;  2PM7 B;  3UVM A;  1YFQ A;  4MMX A;  3I7L A;  4L3G D;  4U1E I;  4G1E A;  2H3X A;  2PBI B;  2VDQ A;  4H5J A;  2YBA A;  5EAM A;  3RLM D;  4X60 B;  3UVN A;  3V4P A;  2VDP A;  5H1M A;  2CE9 A;  1QNI A;  5HDB A;  3IJ0 A;  4AEZ A;  4J8G A;  5EM2 B;  5GMK n;  4PXW A;  5CXB A;  2MTA H;  3A0F A;  1YR2 A;  2B5M A;  5FFG A;  3EI1 B;  4K3J B;  4K3I D;  3PXT D;  4WK2 A;  5I5I A;  1R5M A;  4DNW A;  5CYK B;  5EAR A;  3ZWL B;  2IWK A;  2B4E A;  3MVD K;  4IA9 A;  4PBZ A;  1L5G A;  3DSM A;  3CIK B;  4N14 A;  3OF7 A;  5IGQ A;  3NVQ A;  3DXM C;  2BCJ B;  5C2W B;  4CY3 A;  3OKY B;  1TBG A;  4ZN4 A;  3IUQ A;  2P9K C;  5EAP A;  4GGD A;  2VDM A;  4J77 A;  4AMZ A;  1GP2 B;  3K27 A;  4J8B A;  5HE3 B;  3O4G A;  2XYI A;  3JZH A;  2H9P A;  2P9I C;  3MUN A;  1O6F A;  4J0X A;  3ZDZ A;  4Y5R D;  1SQJ A;  3UKR C;  3EQ9 A;  4A2M A;  5K19 A;  1B9X A;  3MMY A;  2AH0 A;  5K1C C;  3OW8 A;  1H2Z A;  3PVW B;  1P22 A;  2IUQ A;  5HQG A;  4ZOY A;  3NIG A;  3UVL A;  4NBM A;  4XEI C;  2Z2P A;  5H14 A;  2HXC A;  2P9L C;  3IIW A;  5FFO A;  3K6S A;  3SFZ A;  2XL2 A;  3RFG A;  5H17 A;  3PVU B;  3E0C A;  2CO0 A;  2EIB A;  4BUJ C;  4Z7N A;  2QC5 A;  4ERQ A;  4A11 A;  4X3E A;  4UM8 A;  1E5T A;  3IJC A;  2HYE A;  4QQE A;  2PM9 B;  3K26 A;  4RE6 A;  3RFH A;  3PXW D;  3T3M A;  1UOQ A;  2H13 A;  1FWX A;  3AL8 A;  4AN0 A;  3NVX A;  2AGZ A;  4WJK A;  4FAV D;  4WK4 A;  3IUJ A;  4JSV C;  3IVM A;  2H47 A;  3KRW B;  2EBS A;  4XYI A;  1GOT B;  3QI0 A;  4FA9 D;  3SLE D;  3JPX A;  4X63 B;  5FKS A;  4D9S A;  2H6K A;  1H2Y A;  4LG9 A;  2XE4 A;  3QHY B;  3SJL D;  4PSX B;  2XDW A;  2H9N A;  3AH8 B;  3OKY A;  2G99 A;  4G55 A;  2HU8 A;  4CI3 A;  3I89 A;  4UM9 A;  3OL2 B;  5AMS A;  4GQ2 P;  4ZOV A;  2YMU A;  5I5J A;  3FM0 A;  2OVP B;  3W15 A;  3ZE0 A;  1E8N A;  3VGZ A;  5I5M A;  3EQ8 A;  3SBQ A;  1MG3 A;  4LGN A;  4J84 A;  4CY5 A;  3O4I A;  4XYH A;  5IJ7 E;  2BKL A;  3C99 A;  1RI6 A;  4AOW A;  3DM0 A;  5EMJ B;  4AN1 A;  1K3I A;  1VE7 A;  2VDL A;  3GC3 B;  4R7A B;  4O02 A;  5M5S A;  2P9U C;  3IUN A;  4ES0 A;  2VZ1 A;  4H5I A;  4D6V A;  3U4Y A;  5FKQ A;  3UR4 A;  3EMH A;  3FRX A;  4GZ8 A;  2XU7 A;  4A0B B;  2W18 A;  3IUM A;  5E6R A;  2H9M A;  2HU5 A;  2YB8 B;  3ZDY A;  4ERY A;  3I7H A;  2QZP A;  1ERJ A;  3EI3 A;  4JXM A;  3PE7 A;  5IC7 A;  1GOF A;  2PM9 A;  3EI4 B;  3EWE A;  4QL1 A;  3VA6 A;  5CXC B;  2J57 G;  3AL8 B;  5C2V B;  3P4F A;  1PGU A;  4J81 A;  1N6D A;  3L4M D;  5C9Z B;  5AFU 3;  2CN2 A;  4JSN C;  4CZY A;  4CI8 A;  4J82 A;  3JB9 L;  4GMB A;  4NC4 A;  4E5Z B;  5IJ8 E;  4E54 A; 
#chains in the Genus database with same CATH homology
 4LG8 A;  3CFS B;  5HE0 B;  4BL0 A;  4L3H D;  4A09 A;  4FHL A;  4J86 A;  4X61 B;  3MXX A;  5FKT A;  2QXV A;  3V5W B;  5EMK B;  4GM3 A;  3MZL A;  4FA1 D;  5AJA A;  2HKR A;  3SWS D;  4FB1 D;  2PM6 B;  2BBK H;  4O3T B;  4GGA A;  2TRC B;  1XKS A;  2YNN A;  1JMX B;  4CY1 A;  4D0K A;  3AFC A;  1B9Y A;  1L0Q A;  2AQ5 A;  4TZ4 A;  1SQ9 A;  2IAA A;  3N0D A;  4PSW B;  2UZY B;  3UVO A;  4CI2 A;  4GM8 A;  4GM9 A;  4PNK B;  3ODT A;  3RMZ D;  4YVD A;  2IWF A;  4A0B A;  2YNP A;  3J81 g;  2IUV A;  3SXT D;  3RN1 D;  3UKU C;  2HES X;  2AGY A;  5EAL A;  4CI1 A;  3PSL A;  4L9O A;  3F3P A;  3L4O D;  4ERZ A;  3EI1 A;  1TYQ C;  4J79 A;  5CXC A;  4O3U B;  2CE8 A;  4OZU A;  4HDJ A;  4EWR A;  2J55 H;  2Q7Q A;  3I7P A;  5FXY A;  4FA4 D;  3JRP A;  4I79 A;  3EG6 A;  5FKR A;  3B7F A;  1XIP A;  3C9C A;  4E54 B;  3I7K A;  1PI6 A;  2J56 H;  3JRO A;  2YNO A;  3UVK A;  2OVR B;  4A09 B;  3F3F A;  2CO0 C;  4Y7R A;  2H6N A;  5EM2 A;  3EI2 A;  5CXB B;  1OMW B;  3BG1 A;  5FLX g;  5GXI A;  4O45 A;  1PBY B;  3FGB A;  3GRE A;  3SVW D;  2UZX B;  2O9K A;  2AGL A;  4O1Q D;  5TDH B;  2GC4 A;  5HYN B;  4QT8 A;  5FA5 B;  5IT9 g;  3OKT A;  3ORV D;  3NVN A;  2OK6 A;  3EU7 A;  3IJ1 A;  4JT5 C;  3V9F A;  2OJY A;  2B5L A;  4PC0 A;  3AL9 A;  5THA A;  3SCY A;  4A11 B;  1A0R B;  4CC9 A;  4NSX A;  4GQB B;  1NR0 A;  1NEX B;  1N6E A;  4IMM A;  2H6Q A;  2CNX A;  3RSE C;  2OVQ B;  4ZOX A;  1MDA H;  1S4U X;  4CZX A;  1U2V C;  2I0S A;  1GXR A;  1XHM A;  3F3G A;  4J87 A;  5EML B;  3RN0 D;  2H68 A;  5HE2 B;  3SN6 B;  1PEV A;  3BWS A;  3PSC B;  3BG0 A;  5TF2 A;  4JSX C;  3I7N A;  3N0E A;  1OLZ A;  3SBR A;  3EI2 B;  4JSP C;  2H14 A;  3JAM g;  3OL2 A;  2Z2N A;  4J73 A;  3JZN A;  1K32 A;  1MG2 A;  2Z2O A;  3GFC A;  2G9A A;  2XL3 A;  2IUR A;  3DWL C;  5TEF A;  3I8C A;  2I3T A;  1Q47 A;  4A2L A;  5KDO B;  5IGO A;  4PBY A;  5SXM A;  3MZK A;  4QRJ A;  3HFQ A;  3SBP A;  4UI9 R;  4MK0 B;  4A0A A;  2OK4 A;  3CFV A;  4A08 A;  5JWZ A;  2B5N A;  4GQ1 A;  3I7O A;  1JMZ B;  3J80 g;  3MKQ A;  4JT6 C;  2P9P C;  5B4W A;  2HJB A;  2P9S C;  3IKO A;  3OTT A;  3V7D B;  3I2N A;  2P9N C;  3C75 H;  1GG2 B;  3SMR A;  4Z8L A;  4FAN D;  2AGX A;  4ESG A;  2I0R A;  5HE1 B;  3IIY A;  3MKS B;  4ZOZ A;  3OKW A;  4KFM B;  3EI3 B;  2HJ4 A;  5GSA A;  5A2Q g;  2I3S A;  3EI4 A;  5GXH A;  3VH0 A;  4OWR A;  3C5M A;  3I8E A;  5TEE A;  2I0T A;  1JOF A;  3KRX B;  4JD2 C;  2AH1 A;  3RRM C;  5CYK A;  1N6F A;  3DXK C;  4L1Q D;  3ULE C;  4CZV A;  3PXS D;  2AGW A;  2GC7 A;  2IUP A;  4G56 B;  4GGC A;  1U4C A;  4E5Z A;  4CY2 A;  4A7J A;  4J0W A;  5EMM B;  2GNQ A;  2OIZ A;  1K8K C;  4FWW A;  2CN3 A;  4O9D A;  3SHF A;  3JZG A;  4U7A A;  5FQD A;  1VYH C;  4BH6 A;  4A0A B;  1SHY B;  4A08 B;  4J78 A;  1JJU B;  2H9L A;  4FA5 D;  2HKM A;  2PM7 B;  3UVM A;  1YFQ A;  3I7L A;  4L3G D;  4U1E I;  2H3X A;  2PBI B;  4H5J A;  5EAM A;  2YBA A;  3RLM D;  4X60 B;  3UVN A;  5H1M A;  2CE9 A;  1QNI A;  3IJ0 A;  4AEZ A;  4J8G A;  5EM2 B;  5GMK n;  4PXW A;  5CXB A;  2MTA H;  3A0F A;  2B5M A;  3EI1 B;  4K3J B;  4K3I D;  3PXT D;  5I5I A;  1R5M A;  5CYK B;  5EAR A;  3ZWL B;  2IWK A;  2B4E A;  4IA9 A;  4PBZ A;  3DSM A;  3CIK B;  4N14 A;  5IGQ A;  3NVQ A;  3DXM C;  2BCJ B;  5C2W B;  4CY3 A;  3OKY B;  1TBG A;  4ZN4 A;  5EAP A;  2P9K C;  4GGD A;  4J77 A;  1GP2 B;  3K27 A;  4J8B A;  5HE3 B;  2XYI A;  3JZH A;  2H9P A;  2P9I C;  4J0X A;  4Y5R D;  1SQJ A;  3UKR C;  4A2M A;  5K19 A;  1B9X A;  3MMY A;  2AH0 A;  5K1C C;  3OW8 A;  3PVW B;  1P22 A;  2IUQ A;  5HQG A;  4ZOY A;  3UVL A;  4XEI C;  2Z2P A;  5H14 A;  2HXC A;  2P9L C;  3IIW A;  3SFZ A;  2XL2 A;  3RFG A;  5H17 A;  3PVU B;  3E0C A;  2CO0 A;  4BUJ C;  2QC5 A;  4ERQ A;  4A11 A;  4X3E A;  3IJC A;  2HYE A;  4QQE A;  2PM9 B;  3K26 A;  3RFH A;  3PXW D;  2H13 A;  1FWX A;  3AL8 A;  3NVX A;  2AGZ A;  4FAV D;  4JSV C;  2H47 A;  3KRW B;  2EBS A;  4XYI A;  1GOT B;  4FA9 D;  3SLE D;  3JPX A;  4X63 B;  5FKS A;  2H6K A;  4LG9 A;  3SJL D;  4PSX B;  2H9N A;  3AH8 B;  3OKY A;  2G99 A;  4CI3 A;  3I89 A;  3OL2 B;  5AMS A;  4GQ2 P;  4ZOV A;  2YMU A;  5I5J A;  3FM0 A;  2OVP B;  3W15 A;  3VGZ A;  5I5M A;  3SBQ A;  1MG3 A;  4LGN A;  4J84 A;  4CY5 A;  4XYH A;  5IJ7 E;  3C99 A;  1RI6 A;  4AOW A;  3DM0 A;  5EMJ B;  4R7A B;  2P9U C;  4ES0 A;  4H5I A;  4D6V A;  3U4Y A;  5FKQ A;  3UR4 A;  3EMH A;  3FRX A;  4GZ8 A;  2XU7 A;  4A0B B;  2W18 A;  2H9M A;  2YB8 B;  4ERY A;  3I7H A;  1ERJ A;  3EI3 A;  4JXM A;  3PE7 A;  5IC7 A;  2PM9 A;  3EI4 B;  3EWE A;  4QL1 A;  3VA6 A;  5CXC B;  2J57 G;  3AL8 B;  5C2V B;  3P4F A;  1PGU A;  4J81 A;  1N6D A;  3L4M D;  5C9Z B;  5AFU 3;  2CN2 A;  4JSN C;  4CZY A;  4CI8 A;  4J82 A;  3JB9 L;  4GMB A;  4E5Z B;  5IJ8 E;  4E54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...