4PCLA

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sam and a manganese ion.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
LSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum str. hge1
molecule tags Transferase
total genus 79
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pclA00
2ESRA 3B3FA 2OZVA 3FYCA 3LSTA 4HRAA 4NECA 4EQZA 1RJEA 5K0FA 3P9IA 5KS2A 4QDJA 2DULA 4FT2A 4KIFA 5DTQA 5HIIA 3KQOA 2VZ9A 1F3LA 2AN3A 2CL5A 3GJYA 5DM1A 3PX2A 4BP3A 3B3JA 1SVUA 5E1OA 2UYHA 4YUYA 3HNRA 1UFKA 5EMJA 2Z6QA 3LCUA 5E2AA 4DF3A 3F4KA 1ORIA 5D1HA 4YUVA 3C3YA 3PFHA 3U81A 2H1RA 1VE3A 3FPEA 3LDFA 2ZW9A 2VDVE 3GRVA 3M6UA 3P9CA 2ERCA 5K09A 5LQRA 5GIPE 4HH4A 1JQEA 2PT6A 2BR5A 1EIZA 4PGGA 2CWWA 4FSXA 1H1DA 3TMAA 3HTXA 3P9NA 1NW5A 4FR0A 2OB2A 2OKCA 4E70A 1RI1A 3KR9A 2YVLA 3BWCA 4X61A 5E1DA 4XCXA 4YUZA 2JHCA 4GOOD 3BWYA 1KPHA 4E32A 5DTMA 4BP1A 4PNEA 4YV0A 3EVEA 4F86A 3A4TA 2EJUA 3G2MA 1YFJA 3GRZA 4RVDA 5FWAA 4EKIA 3HVHA 5FA5A 2V7EA 2FRXA 5ICFA 2P41A 4PYNA 5JR3A 2QE6A 5C9ZA 5LQJA 2ZCJA 2YUIA 3HVJA 1X1BA 2CKDA 1KXZA 4AX8A 3RIEA 4E2XA 3LGAA 5HIJA 3GRUA 1D2CA 1UWVA 3OU7A 2FCAA 4HC4A 3AXSA 5FHRA 5HILA 2FPOA 3TQSA 2YXEA 5EGSA 4YUWA 1ZKDA 3HCDA 5LQNA 2LD4A 3AWIA 2O05A 3G8AA 2HR1A 2AOUB 2I6GA 2F8LA 1ZGJA 5CM2Z 1MJFA 2ZZMA 2H00A 2PSSA 3C3PA 4R6XA 2C7RA 1FJXA 1TPYA 5F2KA 4ER7A 5EKUA 4BLVA 3GCZA 2FK7A 4AUKA 1KYWA 3G8BA 3I5UA 2GH1A 4BY9E 1L3IA 2UYOA 3KPUA 1WS6A 3KKZA 5E8JA 2HNKA 3PX3A 3MGGA 3TRKA 3KR1A 3DXXA 3R9XB 3QV2A 3SGLA 4QDKA 3TR6A 2IPXA 5FTWA 4GUAA 1Y8CA 3V8VA 5ICEA 4P7GA 2PWYA 3TKAA 2BM9A 5HOQA 2Y1WA 5BP7A 5K05A 3FPGA 4ER5A 4E30A 1DCTA 2Z6AA 1YUBA 4WXHA 7MHTA 3MHTA 3KQWA 4HG2A 5ICGA 4FSDA 3EVFA 4C03A 3A27A 4AZTA 4DA4A 1N7JA 4OQEA 3P97A 3VC2A 3NDJA 4E2ZA 1M6YA 2P3QA 5CVVA 2G1PA 3NVKI 2YQZA 2PVCA 3O4FA 4HGYA 5E1MA 2PY6A 3GRYA 5GM2A 3IHTA 4KIGA 3VC1A 3H2BA 3PB3A 4RTQA 2QRVB 1JR4A 3R0QA 2P8JA 3MTEA 5F2NA 4WVLA 1FP2A 1X1AA 2PXAA 2DPMA 4RVHA 4F85A 1NW7A 5GIOE 4PGHA 3R24A 2AOUA 1TW3A 3THSA 3M33A 1L9KA 4ISCA 3A26A 2B2CA 4KDRA 5C0OE 4QVKA 3KPJA 4MQ4A 3FZGA 3T7RA 1Q0TA 4X41A 3UJ9A 1XTPA 2OO3A 1KPGA 5K0LA 1I9GA 4CWAA 3UA4A 3HA3A 1OR8A 3P8ZA 1X19A 3HCFA 2Y1XA 3FTCA 5DT2A 2HV9A 4X63A 4MHTA 2G8NA 3UJAA 5CVJA 2ZZKA 3QOXA 4R05A 3E23A 3K0BA 2P7HA 3KQQA 3TM4A 3FTEA 4PIPA 1INLA 3E7PA 1XCJA 3LCVB 4R8SA 4EVIA 1I4WA 4YMHA 4RV9A 3UZUA 4GOLD 4HTFB 5FHQA 4E2WA 1EAMA 5LQKA 1R8YA 2AS0A 4O29A 2AOVA 1NKVA 1RI2A 1RJDA 5CVEA 5DWQA 1X1DA 1U2ZA 1AF7A 2EJTA 3FUUA 2NXNA 4E31A 3T7TA 4DKJA 5T67A 4YUXA 4JXJA 1QANA 1BKYA 5GWXA 3EVDA 3HCBA 5IKMA 3MCZA 3Q7EA 5FADA 1WXXA 5DSXA 4RTMA 3REOA 5T6BA 4K6MA 3EVBA 2YXDA 5DRYA 1XCLA 3HA7A 5HIMA 1VQ1A 1XVAA 1QAMA 1EQAA 2QRVA 4HGZA 1O54A 1IM8A 4GC5A 5EEHA 4A6EA 5EPEA 3PS9A 4C05A 3LBFA 3SR4A 3GXOA 4X60A 2AOXA 2XVAA 5FA8A 1XJ5A 2IIPA 2FYTA 5E2BA 1T43A 2QYOA 2OXTA 3TLJA 3CJQA 4PYKA 2A14A 3ELUA 4P7KA 4DCMA 3MQ2A 2ZIGA 4RTLA 3KQSA 1M0EA 5H02A 5F2OA 4M38A 1FP1D 2H11A 4Z2YA 1KIAA 3R3HA 3NVMB 1XDSA 1RJFA 5KYGA 1R18A 2ORED 3DR5A 2P3LA 2EX4A 2ZULA 3EMBA 3MCTA 2I9KA 4LG1A 2R3SA 3DH0A 1QAQA 3GRRA 2Z6UA 2B78A 3HEMA 4HTFA 4BLUA 4MWZA 3PT9A 3IYLW 4DZRA 1JQ3A 4RTJA 1AQIA 3NTVA 2ZLBA 1NV8A 4LWPA 1AV6A 4KVZA 4QVGA 3LPMA 2AVNA 4ER3A 3SSNA 5HIKA 3EMDA 3HP7A 3OZSA 5EHIA 1VBFA 2JHAA 3KPYA 4C08A 5GINE 5GOZA 3UJ8A 3M6VA 1Q0SA 2WA1A 3CBGA 5LSAA 1NW3A 1N7IA 2BZGA 4GBED 4GQBA 4CTJA 4EMSA 2NNWB 4E2YA 1WXWA 3P2IA 4CKEA 3P71T 1AQJA 4RTSA 2I7CA 4LECA 5LQAA 3TOSA 4AZWA 4X1OA 3KHKA 3CJTA 3B89A 3OZTA 4XUEA 5B1SA 4EK9A 5EQJB 5K03A 1VLMA 4C04A 1VP3A 2IGTA 2GPYA 2YR0A 3FUWA 4PCAA 1L1EA 1R8XA 1R6AA 3B7PA 3C6KA 3DTNA 5EKXA 3OFJA 4P7JA 5BW5A 1SUSA 2PXXA 2O07A 3EEYA 4P7FA 3R6TA 1JTEA 2P35A 2GA9A 1JG1A 2PX4A 2XYQA 3CGGA 3FUVA 3KPVA 5GM1A 3TKYA 1BHJA 4RTNA 2P3OA 2ZTHA 2CMHA 5FUBA 1SKMA 3LECA 2BH2A 1NT2A 2O0LA 3LCCA 1RI5A 3BKWA 3E8SA 3KR0A 2ZIEA 3NDIA 3A25A 5FULA 5E9QA 3SXJA 4ATNA 1ORHA 1KR5A 2YX1A 1EG2A 5K01A 2WK1A 2ZIFA 2AOTB 2YXLA 3PVCA 2B9EA 3KQMA 2JJQA 3SSOA 10MHA 1G8AA 1WY7A 3LKZA 4G56A 3UWPA 3BZBA 4GOMD 5LQCA 3LDGA 4U7TB 1JTFA 4PINA 2JH9A 2XVMA 3JWJA 4QQKA 3DXZA 3T0IA 3BXOA 5EG5A 4YMGA 3DP7A 3KQVA 5ERGB 5EMLA 2QM3A 3IEIA 3G2OA 1KYZA 5MHTA 3NW9A 3EPPA 1SUIA 3DLCA 4KRGA 4QQNA 3EGEA 1XDZA 2IDKA 3NJRA 2IP2A 4QTTB 1O9GA 5HFJA 2PGXA 3JWGA 4A6DA 2AN5A 4MTLA 3A7DA 2IDJA 2P40A 1L3BA 2PV0A 2PWPA 3FPJA 3IV6A 4QPPA 4RYLA 1KPIA 3MTIA 4IKPA 1BOOA 2XYRA 4PYLA 2BR4A 3G89A 4GF5A 1DUSA 1NW8A 5EMKA 3ERCA 2XBMA 2IFTA 2OY0A 5FQNA 5HZMA 1N2XA 4PYMA 1G60A 1PJZA 2ZWVA 5DXJA 3UA3A 3C0KA 3V97A 4AZVA 2PJDA 5FQOA 2P1DA 5DTRA 3ELWA 4B17A 4YV2A 1JQDA 3M4XA 1V39A 3HCAA 2GAFA 5K8VA 3B3GA 2O57A 2V74B 2ONYA 5C1IA 2AOTA 3ME5A 3AJDA 1JG3A 1IXKA 3G2PA 5E1BA 3KPWA 3EEOA 3ER8A 2FHPA 2ZBPA 2PXCA 3FYDA 2PLWA 4C07A 5CCXA 1FPQA 4OA5A 5ICCA 3SSMA 4PCLA 3P9KA 3KQPA 4H0NA 1M6EX 5EZSA 4XUCA 5BW4A 3ANXA 2PBFA 3EGIA 1VPTA 4OBXA 1P1BA 3FTDA 5CVUA 1XDUA 1R00A 2NXEA 3LHDA 4FZVA 5E8RA 4IV0A 1JG2A 2AZTA 5E9JA 5EHGA 3SVZA 3A7EA 1UIRA 1KHHA 1QYRA 3OFKA 4RX1A 3OE4A 4IWNA 2OYRA 3UJ7A 3B5IA 2IBSA 3G7UA 2IH5A 3PLAE 2PX5A 2E5WA 4Y2HA 4PYOA 1RJGA 5DLYA 5FWDA 1R74A 2GS9A 3M70A 3UJCA 1G55A 3O7WA 2GB4A 5DM2A 3M6WA 2KW5A 2AN4A 2EG5A 5DM4A 3OU2A 5EEGA 1DL5A 2NXJA 2O06A 3HVKA 5LR6A 1X1CA 1YZHA 4OQDA 5HEKA 2ZFUA 3NWBA 5DM0A 3OZRA 1YB2A 1HNNA 3UBTA 2NXCA 4RWZA 5EZQA 2C7QA 2FK8A 5K0EA 1VL5A 4M37A 3CKKA 2GLUA 5U4XA 1QAOA 5CVDA 4POOA 2IH4A 3D2LA 3G5TA 4HSGA 4F84A 2Q41A 3GIWA 4GEKA 4M7RA 2YTZA 9MHTA 3G88A 3BKXA 3CJRA 4E33A 1XXLA 2OBFA 3DMGA 4OA8A 3VSEA 4CKCA 4OX9Y 5EIWA 3PTAA 3LKDA 1KP9A 2NYUA 5K0BA 3OPNA 1BC5A 2N47A 3JWHA 4FGZA 3OU6A 1P91A 2AR0A 3FPFA 3G5LA 3EVZA 1NBIA 3HCEA 2JG3A 2BR3A 1JG4A 1FBNA 3C6MA 1NE2A 3T7SA 5LQUA 4PYQA 1IY9A 5T64A 3DUWA 4P58A 3KQYA 3TPZA 1D2HA 2PX8A 3JWIA 1VIDA 2ZWAA 5KQRA 2PT9A 3EGVA 4KDCA 3I58A 2UYCA 4RSRA 2B3TA 5DX0A 1EJ6A 3S68A 2XYVA 4V0RA 5CD1A 1G8SA 5K0CA 2C7OA 3GDHA 3THRA 4LWOA 3GNLA 4RTKA 3O31A 3UJ6A 3KQTA 3DXYA 3LL7A 4CKBA 1ZGAA 1RI4A 4BLWA 5BXYA 1YFLA 2NP6A 3BWMA 3ER9A 1NBHA 5CUQA 3BWBA 1Z3CA 5DXAA 5EIFA 1P39A 5D1NA 2I62A 3G2QA 3DLIA 3BGIA 3MB5A 4C4AA 1HMYA 4OBWA 4PYIA 2OPBA 2PKWA 4XUDA 5EOVA 2HMYB 1MHTA 3X0DA 5KVAA 3EVAA 3UJBA 4FS8A 5EVJA 3RW9A 2VDWA 3E05A 5K0NA 3FTFA 3ELDA 1YZ3A 1G38A 3P2KA 4R8RA 2JH8A 4DQ0A 4EKGA 3HA5A 1PRYA 4DMGA 1EJ0A 2ZBRA 5M5BA 2IH2A 4IV8A 3WSTA 3QOWA 4RVGA 3L8DA 2VDUE 2UYQA 3DOUA 2C7PA 1SQFA 2ZSUA 1NV9A 1L3CA 2PX2A 3CCFA 3I9FA 3K6RA 3KR2A 3P2EA 1ZQ9A 3GWZA 3SM3A 5JUWA 2IBTA 3NWEA 1QZZA 3PFGA 2ONZA 2HTEA 2OB1A 5G02A 3GU3A 3SX0A 3FRIA 4KW7A 4AZSA 1WZNA 2QY6A 1YF3A 1F38A 5P8WA 2BM8A 3KU1A 2G72A 4PWYA 3CVOA 4QPNA 2NP7A 4CTKA 1D2GA 1JSXA 3FPHA 5EC8A 4C06A 3Q87B 3FRHA 4Y30A 1SG9A 3ORHA 5KQSA 3TM5A 2HWKA 3ELYA 4QTUB 3SMQA 2UZ4A 3UJDA 1SQGA 3AY0A 4ER0A 5FCDA 4KWCA 4FT4A 2R6ZA 3GO4A 4YV1A 3LBYA 2CMGA 2AOWA 3HVIA 3UFBA 4FP9A 5CIYA 3OCJA 3DULA 4GC9A 2K4MA 4M36A 2JHPA 2WA2A 5DSTA 1P1CA 3EVCA 4ER6A 4RTRA 3GGDA 3BGVA 3RODA 1O9HA 2B25A 4GOND 3HCCA 3M6XA 3DMFA 3EVGA 2VP3A 3VYWA 3ID6C 5DRTA 4DCGA 2AVDA 1TW2A 2VS1A 3MERA 5DX8A 4DM3A 5CCBA 3FUTA 1NW6A 3LDUA 5K0GA 4RTOA 4PONA 2ADMA 3HM2A 2G71A 5DPMA 2P7IA 3I53A 3FUXA 4L7VA 1G6Q1 4MIKA 3BT7A 4ZTBA 3NMUF 5IH3A 1B42A 4UOEA 5EMMA 3DMHA 3BUSA 2ZBQA 3LX6A 3AXTA 5E9WA 2ZVJA 3MAGA 4PYJA 4V0QA 1JSZA 4U7PB 4RTPA 2EFJA 1WG8A 1ZHFA 4PIMA 2G70A 4RVFA 5GP1A 1RI3A 2ZZNA 3TFWA 5K0JA 3BGDA 3CC8A 8MHTA 4R6WA 3I64A 1ZG3A 4CXMA 3OE5A 1I1NA 5DX1A 1VP9A
chains in the Genus database with same CATH superfamily
3WWZA 5D5PA 3AWDA 3BK2A 4PBTA 1DSSG 4JGBA 2QQ5A 4E88A 3VKWA 2FWJA 2CL5A 3GJYA 3IILA 4CFZA 4MAFA 1GGNA 1SCJA 4PN7A 4ITRC 3DQQA 2AJDA 821PA 1RWMA 4IOLA 1QYCA 1RQGA 4EUEA 2C5FA 3QF7A 2GK4A 3DBIA 5I3CA 2J33A 4NCAA 1E9BA 3GYBA 2GVZC 2WILA 3P9CA 2JRLA 3RJ9A 4ZO6A 5K09A 1X9GA 4HUJA 1EM8A 2O2CA 4WKBA 3VKVA 3VZBA 7MDHA 4G0WA 1TFRA 1U8YA 1WE2A 2E4WA 4RIGA 5E4YA 5DN6D 3G9ZA 3ROXA 3GCXA 3OZIA 3W5BA 2PD3A 2Z43A 4BE4A 3G0HA 4MS1B 2J46A 3BWCA 1ZIPA 3E27A 1Z2EA 3FF1A 3L7IA 2JHCA 4FXPA 4GOOD 2ZYSA 3QEBZ 3FWZA 4EJSC 1SRQA 4NESA 3V42A 3A4TA 4K0KB 3TSAA 4ZRNA 1F12A 3H1FA 3IVMA 1L4GA 1Q91A 2PJUA 3D6UA 2OQVA 4E15A 3VNAA 1G6KA 3EPJA 1P4JA 2XGMA 2BUAA 4ZOBA 1DO8A 5FA5A 1Q2UA 3BE8A 3OD1A 4QU9A 1GGJA 1D8TA 1U5BA 1YVUA 4UOZA 3CNBA 4ALKA 2RHCA 1Y4ZA 4HVAA 3R8CA 3LGAA 4M3NA 5HIJA 1G4AE 1KF0A 3FWKA 1RBZA 1XVLA 1T9ZA 2VL7A 4X93A 5JQWA 4DMUB 1B0ZA 1O87A 1JVSA 3AWIA 3E2MA 2RBEA 2QRKA 4EA9A 3ISTA 3WIVA 5JT1A 3PQ8A 1K7YA 1T3TA 3M2TA 4EELA 5KNBD 3ESBA 3EZXA 5A4FS 3U4QA 3GCZA 4D45A 2Q5LA 3SC4A 4KFCA 4BNDB 1KO7A 2QOEA 1AMOA 2DLNA 2JLRA 1QB7A 3I2YX 1EP1B 1P72A 2JW5A 2RGWA 4LRYA 2OESA 2UYOA 4A27A 4DFDA 5EFZA 4KDEA 4RQAA 4RVSA 1DQPA 1E89A 1RR6A 4O2AB 1EWVA 4Z54A 4D41A 1AHPA 4QELA 1EX6A 3GN1A 4RLQA 4H18A 1TYDE 1HMPA 5K05A 5K8UA 2UV8A 4UW9A 4E5KA 2EYQA 1H3FA 1MV8A 5IVHA 1IHDA 4X71A 5ELXA 2Z6AA 3Q85A 5ICGA 1U8TA 4GBGA 4DMHA 3IXMA 3QP9A 2AD5A 3I4CA 4U6NA 3S1LA 3UUWA 1R10A 3QEMB 1FFAA 2BGMA 2OO7A 3QFTA 3RRZA 3WRXC 4IAOA 3E9QA 4BECA 4I3HA 3RT7A 3PDCA 4KQ2A 4DPKA 4X64B 4CDGA 4EM6A 2BTOA 2C98A 3OCVA 4G0YA 4MIEA 4OMUA 3UV3A 1MGPA 4BO6A 1KTVA 2DPMA 2IHTA 4GYJA 1T29A 1HQCA 4BGVA 621PA 1SIBE 1TW3A 2AI1A 5LZ5A 4QJ3A 3PWZA 2B2CA 2YZGA 4QVKA 3MJEA 2ZYHA 4M99A 2OP0A 3QVJA 3GLHB 3PNLA 1QFJA 2XH8A 3NEAA 1EEXB 1ANKA 1RRKA 1ZJZA 3B20A 3FTCA 4YT5A 4HZUB 2HHJA 2QTWB 1JDNA 4DGQA 4GS5A 2XF2A 3FTEA 1N0HA 4PIPA 5JAUA 1R0ZA 5BRNA 1MN6A 1D1QA 1NURA 1KYTA 4RY9A 3K5PA 2DTXA 2QU8A 2Y67A 2G1JA 1TEXA 1YXMA 2XQJA 2ID7A 1JE1A 1ORVA 2YS6A 4IWYA 4KO8A 5DBIA 5FHQA 2Q28A 4IDNA 2GR9A 2PZBA 2IHYA 4HUQB 4N7RA 5CDTA 4ZVNA 2WDPA 4LDZA 1U2ZA 1U0RA 5LLDA 1POXA 1W34A 1GOTA 1LI5A 2GCNA 3IT1A 4BMZA 2IU3A 4PM4A 1JEJA 2AHOA 2O3UA 1P2UA 4R3WA 3TLGA 5LU9A 3W06A 1N3LA 3HKBA 2UUAB 2HW8A 3ZK8A 1EJBA 2QRVA 1A9OA 1GSAA 1I5OA 3PXUA 3MELA 4H7IA 4QYXA 1MC1A 4RACA 4UD2A 2V6FA 4ZRMA 3WJ7A 3W5DA 3ONVA 1E3EA 1YD7A 3SR4A 3K1AB 3ENQA 4LZJA 1DINA 1FFXA 4S2UA 3LP5A 1SKBA 3WQRA 2O0KA 3KCNA 1MT3A 1OQAA 4KMSA 2BGNA 2CNWA 1FE8A 3WP0A 1V6AA 4BC1A 1QRRA 2O8BB 4TKUA 2CEKA 4PPGA 3SSAA 5IABA 4PYKA 3BD8A 3ELUA 1K7EB 3DC2A 3PZBA 4QEKA 4TT3A 5IN5A 1KFJB 1ZI6A 4BO4A 3NHFA 4JP3A 1Y3IA 4YN3A 3IALA 4DYDA 1D0VA 1KU6A 5ALMA 2X6RA 2VQSA 2X0DA 3TNDA 4P82A 3OPYA 4J6EA 4Q03A 4Q93A 3UMFA 1P2FA 1YDGA 1L4HA 1C50A 3ODPA 1BVUA 3GMIA 3H13A 1A72A 4LG1A 5ETJA 1SKAA 4EOGA 3EDOA 3KVOA 4UAGA 4D8WA 2BFCA 4IJWA 1KU0A 2QRUA 3PPVA 1YHYA 3PT9A 3E9NA 4L2IA 5JBIA 3U7HB 4DNOA 2E4UA 1Q0PA 2FSPA 1NV8A 3EQZA 3UH1A 4JSRA 3ZK7A 4W5QA 3THXB 1TYAE 1QH8B 3EH2A 4IIFA 2NQTA 4Q21A 1M33A 1NQVA 2E2WA 3BWVA 4OBEA 1RIIA 5AM5A 5HIKA 3KL4A 3W4IA 5FPPA 1H66A 2FW7A 2IEIA 1LBIA 3MSXA 4DMRA 1V95A 2JF0A 4INJA 2NGRA 4UHCA 5GY7A 4C0HA 3L6EA 2QGFA 4DLVA 1K7FB 2P4UA 1L4MA 1DKUA 2PGDA 4JZKA 4ZVLA 3TVTA 1M6NA 2JIQA 2OZLB 1N2GA 1QG6A 3JD4A 1RHQA 2UYYA 4JLBA 4M8NE 1XPRA 2ACKA 4UULA 2JATA 1DUVG 4IUDS 4MQUA 5ALEA 5IZCA 2HQOA 1DKQA 2GFQA 3UAOA 2N1MA 3OZTA 3B48A 2QYSA 1VLMA 5HDBB 1N1EA 3CE6A 3DAYA 2V97A 1FB5A 4NAUA 4ND8A 2A78A 1K5PA 3B7PA 2F1RA 1VHLA 3D3WA 3E18A 4C9BA 4TTQA 1XMQB 1O96B 1ZU5A 3TSZA 4EY7A 1TO1E 3BMCB 4A23A 4BNVA 1JG1A 1X2BA 1RQLA 5ED4A 2BE7A 3AX6A 4G9EA 4PZAA 4YP6A 3EVTA 4HSEA 2J85A 3PICA 2BH2A 3NONA 3O03A 2I3BA 3WDLA 3ZE6A 4KAJA 5AESA 1XEFA 2IZ7A 1H5QA 2G17A 4LS3A 1NY5A 3LRXA 1F0KA 1AO3A 3FZNA 1DRVA 1FJGB 2DR2A 4MR7A 3PDHA 3QIVA 1XNRB 2J0QA 3H1EA 3PVCA 4BKUA 4CMEA 1QZXA 4AWAA 5TIIA 3KYCA 2H4XA 4MS3A 3ESAA 1YJQA 4YJ3B 3DCNA 3SPXA 1X7WA 3VR3A 2XITA 1P74A 1GRRA 1VYTA 3CRZA 4PLYA 1R9NA 2MSWA 3LSYA 4C22A 1H23A 3P0JA 2AL7A 4IPTA 3NEYA 2SBTA 3GCGA 4QAJA 1R1DA 2A35A 1Z68A 5ERGB 3K2BA 1IZ7A 4L3VA 3UC9A 2GYWA 5C31A 1GQYA 3NKFA 4FZRA 3RWBA 1BRTA 1MO6A 4WZAB 4EUNA 2L2QA 1TYBE 1WD5A 1YJ5A 3AQIA 3NH6A 2IUYA 3NUQA 4R1SA 5I9LA 1C7IA 3G82C 5JQGB 2AN5A 1NDHA 4MTLA 5AXCA 3SQOA 5B12A 5A3RA 4LKRA 3EFEA 2BDUA 5DSZA 4TV9F 1MA0A 5MFPA 1X2EA 5DI3B 3A4NA 3QMMA 2L0XA 4PYLA 2GCGA 3AIIA 1DLIA 1JR3A 1T2DA 2BMWA 4IO0A 2RC5A 1NW8A 4JHLA 1CD5A 2WAOA 2FEXA 1NKSA 5HZMA 1NPYA 1UBUS 1JIVA 2M9MA 5FQNA 2C5BA 4CTNA 3EAQA 3QWIA 3AM5A 4N7MA 4B8YA 4PAMA 1K5GA 2MJLA 3B2NA 3SFZA 4EYEA 2R2AA 3HB5X 3HP1A 3NQ41 4FD3A 2XOKD 1IJKA 4ROSA 3FGPA 5B2EA 5EP2A 1TTQB 1HOTA 4DA7A 4FFVA 4CPDA 2XAAA 3BE5A 3IP3A 3KZCA 3H4TA 2A9FA 2GERA 3JWPA 3N7TA 5E1BA 2QX7A 3BE4A 2PLWA 2ODTX 3L8MA 2UDPA 4I50F 3WMEA 5IUNC 1QR6A 5ICCA 3RTBA 5DYTA 3S1AA 1TNDA 2F1JA 4KAFA 4PRZA 1Z0SA 3RROA 4DTIA 3EMKA 5CA1A 2I1WA 1NQTA 2N46A 3FSEA 3ML1A 2OKGA 1DVRA 1ZYUA 2PA3A 3EGIA 3LBHA 3ON5A 2C8JA 4MGKR 2MTBA 2QD2A 5I51A 1MAWA 2FCRA 1RT9A 2NT3A 1CY6A 3NX4A 4TV8B 4ZYWA 3AZPA 3G0OA 3HHEA 1H2XA 4KK3A 3BH0A 4CCSA 2DSTA 4OOFA 1Q92A 4HN4B 3TTTA 4PTZA 4RD0A 1G55A 5DM2A 3TLAA 3UF0A 1ESDA 5JMTA 2B8NA 5AHWA 1UP7A 2P2SA 3QU5A 4UMVA 4HAZA 3RBZA 4EY4A 3SBOA 2VJKA 2Y27A 2JLUA 4KN6A 2GRJA 1ZVMA 1ECPA 1BVHA 2N42A 2HQRA 3ZZTA 4Q9AA 5I4IA 5AVTA 2NXCA 5EKSA 3A9UA 4WPGA 2VWPA 4MPPA 4MA0A 3WIOA 1VKJA 4IW3B 1Y1QA 1F5NA 3NHRA 1B6TA 4JLNA 4KWTA 1GAQA 5T8KA 2C9YA 3LE8A 1O5IA 4MWOA 1D2NA 4Q3NA 3L7NA 4F2PA 4TYQA 1Q6YA 4XLTA 5CNJA 5JXWA 3IDQA 5G3ZA 2OBFA 4FMPA 5KYYA 1AQNA 5ULLA 5JSZA 3LK6A 3PTAA 1UBCA 3UOWA 4OOEA 4MR9A 4WTOA 1GV0A 2AEJA 4G8BA 6ABPA 1RDFA 2XGJA 3UHOA 1X1SA 3FCYA 1F2VA 1XP8A 2FWMX 4UXJA 4WXPA 3RKSA 5IYZA 1GAJA 3T9CA 4U9UA 2BIFA 5L7TA 1J25A 1QK3A 4QXRA 4DLPA 3K8QA 4J03A 1L8QA 1NNSA 3V1UA 2QNBA 4ALJA 3HADA 4B43A 5I4CA 1QFYA 2RGAA 2ZWAA 3O83A 5LD2C 2KX7A 3QYJA 5FH9A 4F5WA 1IYZA 4G5XA 2QIPA 2ZVPX 4RSRA 4WFKA 5C5IA 1ZX1A 4MO2A 1U7HA 4AJEA 4DV6B 5HR5A 2Q29A 1NUHA 5IBRA 1ZK3A 2O1SA 2OFFA 3O75A 2G6TA 4G1CA 3GAMA 3OZEA 2KE5A 3QLUA 4CKBA 4BNXA 4XH9B 1UXHA 5L8VA 5KSOA 2P4QA 1Z2DA 1Y6RA 4LY9A 5JH7A 2PAFA 3G2QA 4DLBA 2H1WA 2WHRA 2R1VA 3I1IA 4KWEA 4LI3X 1OU4A 2WJHA 2ZQ5A 4P0TA 4GMFA 4NU8X 3K9HA 3LT0A 5FI0B 1EVZA 2FZVA 1ULSA 3OP4A 4S04A 1K7CA 3KJEA 5I8ZA 4I55B 3E4CA 2PSFA 3P2KA 4PXSA 2F7SA 4JCCA 3E22B 1KIFA 2A88A 3DAGA 4TUYB 2VZ8A 3SS9X 2OFPA 4MS4B 2IEBA 3AR6A 2COUA 3DVQX 3VH4A 4D92A 3O2NA 3AF2A 3KVYA 4CIAA 4L5CA 1KI2A 2JAOA 1RKQA 1ZD8A 1N6IA 4QREA 4Z4FA 2IXDA 1JL3A 2P6UA 4F92B 3SFTA 3FG9A 4O2BA 4ARBA 3KWMA 3WYBA 1IN8A 3UYKA 2O8EA 3JASA 3GPLA 2JGDB 4D43A 3W6OA 1WCYA 2XWQA 2RJ3A 3EUEA 3OLYA 3QY0A 4QEZA 4XIIA 4AJKA 3QY9A 2ODQA 3ENNA 3QKTA 4UE6A 1IXSB 4YRKA 1C3VA 3DPUA 1CT9A 4MVXA 2Q6LA 4YCJA 4OXQA 4ARVA 1RACA 1XNHA 3V3KA 1KY4A 1SG9A 1XGKA 4LZNA 2GZAA 1PVOA 5AJWA 1UKAA 4MV3A 4V39A 5AD1A 3BFJA 2EW1A 5BN4A 3HBJA 1R4MB 3L41A 5CB6A 3FNEA 3UFBA 2G0NA 4WK2B 2VATA 4LY0A 1P1CA 2W42A 1Y5MA 2PH3A 3OCZA 4W6QA 3RAFC 3SQDA 2ZAYA 1H0KA 1KOFA 1KVQA 2WE7A 1L7PA 3GGSA 1X13A 2BFEB 2EFHB 4KU4A 4XIJA 2ZSKA 1B7GO 2G6BA 2R65A 4GSYA 4KE7A 5JXGA 5LVAA 3PTLA 5DX8A 3X43A 5HZKA 1RM0A 1U2DC 2I91A 5ECYA 1SBCA 1EFVB 2FXIA 1MOSA 1NU8A 5DPMA 5KSWB 4DCVA 1XAHA 3MW8A 1E7MA 1DAFA 1NP6A 2ZXEA 3K0FB 1TX4B 1ZFNA 3EGXB 4OH1A 3ILXA 3RIXA 2WHYA 5FWNA 1W4LA 1M3SA 1US8B 4QG3A 1LX7A 5GONB 2RGBA 1NLFA 3EXG2 3HPQA 5MF6A 2G5TA 2ZBVA 1W0CA 2YJGA 3VTFA 2FPRA 1BGXT 1U7XA 4QGFA 1Y3CE 4GOKA 4XWWA 2FGKA 2I80A 4KIJA 3LQ2A 4U7FA 5GP1A 1EB8A 1E61A 2H8KA 3IB3A 4K6OA 4RK7A 2W2QA 2H0RA 4DCOA 3KXIA 4MW5A 1ZG3A 2BSXA 2QWXA 3VU9B 4ZO9A 5JU6A 4HAUA 5MN4A 3KHUA 3E3AA 2A94A 3CLUC 1PU2A 4NBVA 2R6CA 3VSCA 2VDMB 2JAQA 5IVPA 3UXYA 2VZ9A 1Z47A 1TD9A 2HHCA 4ZIRA 3RHTA 3P5BA 5CG2A 2X9GA 3VKFA 2IXTA 4JEMA 4ZVRA 1PL0A 1UK7A 3DB1A 3WBKA 2REBA 2H7VA 2RGUA 4Z5XA 1ZD9A 4TSKA 3V1LA 2B0CA 3JQPA 3F3SA 4AULA 3A1VA 4PVDA 1NFRA 2H1RA 1YCGA 4YP1A 4QT0A 3HZOA 2A0WA 1G5TA 3I28A 5JS8A 3OPXA 1QDUA 2BR5A 4TL6A 3GLKA 3OPQA 3GRKA 1QCYA 5BWCA 1UOPA 1Q50A 1WXQA 2H7CA 2NX2A 2O5RA 2P2YA 2ZAIA 3KAKA 1HR0B 3PJRA 1PT7A 2Q5IA 2VTKA 3KBOA 2JJ2A 3KR9A 4X61A 4OJKA 1T0IA 3ZD6A 1FTWA 3SEFA 3W8EA 4F4UA 3HYNA 4AECA 2FMHA 2VZLA 5DMHA 1DWUA 4W5TA 4G8CA 2PMWB 3V32A 2FLKA 1OOEA 3ORSA 3W05A 1AA6A 5L53A 3HNPA 1O58A 1IE3A 4GE0A 1GV1A 4MR8B 4JJ6A 421PA 4O5OA 4ZMBA 1E66A 4UBMA 3WGGA 1PZHA 2GZHA 2VYNA 1PZNA 1SVWA 2ZANA 3KJNA 3PHLA 4HQNA 2ZCJA 3B3QA 1A71A 1KXZA 4M6WB 5HWSA 2OHFA 4KPUA 3WGZA 1JEYB 2RG7A 2A4MA 3IULA 4DLWA 4A6PA 3DPSA 2HMUA 3GRUA 4LV5B 4YR7A 4HC4A 4QO8A 4I5EA 1Y48E 1VG1A 5FO1A 2F3QA 3RK4A 1QRDA 3QOYA 1CFJA 2R1UA 5CM2Z 4UEKA 2HCFA 2E6UX 3OX2A 3GY0A 2Q3EA 3L7LA 4L9RA 3L9WA 4NZMA 2C9BA 5B4VA 3T7AA 5CDGA 3VPAA 2VYVA 2O5VA 4LOAA 1DJPA 2X5KO 4QYTA 2NVWA 3NM5A 4N5IX 4UOQA 1GTG1 4XDYA 2QRPA 5AJTA 5CLFA 4R1OA 4Z4QA 1DBQA 2BFBB 2FPLA 3JARB 4QM6A 4KE6A 4IIHA 3S44A 4DMFA 3X2EA 2FPUA 1U1DA 4GH5A 5TQ0B 3TR6A 5M29A 2QQ0A 1ICIA 3HKDA 2XCSB 2FEWB 2RCYA 3KT8A 4YP5A 3RUPA 3JQ9A 1ZM3A 1IOVA 5EFOA 3WIEA 5BVGA 2QR3A 3CLHA 1P60A 1QG2A 4Y2TA 2OOKA 4KV7A 1UJBA 1XMXA 4DGSA 3AFNA 5BSGA 3V2HA 1XWFA 3VPGA 2XQKA 2ZWIA 2F3PA 3M49A 2RHDA 5DYIA 2PBRA 3I01A 2P9BA 3C24A 1SAYA 3LLVA 1ZDMA 1YK0A 2Q49A 4YXWA 4ZT3A 5BN5A 2Z8YA 2EHDA 3F96A 3ZGNA 5THXA 2FF7A 2JEYA 2GJAA 2QUAA 4TOIA 5B37A 5CVTA 1ZR2A 1KO1A 5LMZA 4N3GA 1MVLA 2Z9CA 1X1AA 2FMKA 1J5PA 1D2AA 2LPMA 4KQCA 3GEHA 1OX5A 3KQLA 1C3JA 2CXQA 4TXLA 4DAEA 3U4AA 2OBNA 2LGJA 4FDVA 4BLPA 4NV3A 1TO2E 2GLTA 4MLZA 4YJHA 2WABA 5FRDA 3SBDA 1GYRA 3LUPA 3A2MA 1KPGA 4CMBA 3OTOB 1VL2A 4CWAA 3T5BA 1TO6A 4J4TA 1G21B 4MQMA 5EWLA 2HU7A 3D1JA 3QA9A 1VYVA 2HV9A 5HJ7A 2C2OA 2B20A 4L28A 3AP2A 4Q9IA 5DHUA 5BUQA 2HBQA 1E8NA 1U4SA 1YDFA 3DLAA 4WZBA 3I9KA 2VLBA 3ONFA 4R05A 2I1LA 2C61A 2NUTB 5C35A 5KWJA 1INLA 5A9TA 4LJYA 2PEYA 4IOJA 3UAGA 1IM2A 1I4WA 2EC5A 3UHPA 4CG1A 5C52B 3IE1A 1HTBA 3AEKB 2RGRA 4FHGA 1DHTA 1W8DA 1USIA 3UZUA 4TWJA 3GFPA 1NWHA 3CT6A 3THWB 2OC9A 3A6PC 1ATZA 3BL6A 1SQSA 2Q45A 3D5QA 5HF8A 5GADl 2B1JA 1TYCA 5IP5A 3T5PA 2DQ4A 2H2FA 4YUXA 2RIRA 5GWXA 3QOFA 2UYGA 2ZUWA 4LJKA 3PVZA 4WACA 3R3JA 2Q1UA 1GZ5A 2YV2A 4AN1A 4C0JA 2Z9DA 5T6BA 5CXQA 2R5NA 5K0ZA 4Z4EA 2V55B 3U7QA 3GH1A 4EGQA 2V96A 3WL8A 3P0IA 1LZKA 4DARA 3H99A 3BXPA 1NI5A 1L8LA 1PBTA 3SD7A 4JASB 1E7YA 5EERA 3HM9A 1T43A 4OHZA 4BB9A 2IYNA 3W6NA 1MX3A 1YQUA 2WTXA 4QL3A 3STHA 4U2CA 2QN2A 3NASA 4HEQA 4LHVA 4TWZA 4U7GA 4RZ2A 2BEVB 2ZIWB 2GUGA 2CMDA 4Q4JB 1A27A 1GFZA 3C4JA 5EWJA 4N1AA 2JS7A 5F9HA 4B79A 4LTDA 4TZTA 3PTZA 2CDBA 1T4BA 2KYRA 1YBVA 1II8B 3D3KA 1EX7A 4HMQA 1PTJC 3R3YA 1DCFA 4Y8VA 1EWKA 4AP5A 3F7TA 1D2EA 1ND6A 4HDRA 2IYLD 1MTOA 1Y1KE 1Y9EA 2A7XA 3IVGA 4FJ0A 4WLOA 3VHXA 2V1UA 1NQOA 4PLTA 3F90A 4GYKA 3TX6A 1DO0A 3G0BA 1C29B 1QE0A 5CAEB 4ER3A 1OAOA 4HDAA 4MRRA 3IDFA 4GZ5A 3QLEA 4HAYA 5AVQA 1TCUA 2B4KA 3T41A 2BUBA 4YRAA 2WHPB 3CIOA 3S29A 3OT4A 5B58C 4YMVA 1M1XB 1VCHA 4I5DA 4YJDA 4G5RA 4Z9YA 4OXXA 1S5PA 3OMXA 2ISCA 1A5AB 4RIEA 1DIAA 4UAVA 1VPVA 1PT6A 3KE9A 4IY1A 3WKAA 5AXAA 1N2CB 3UK2A 3OEHD 4D0LB 4XQCA 4B3XA 2FEKA 1B4DA 4RD6A 4MRVA 4W99A 4I1UA 1XTUA 2BDTA 2FXVA 2IVZA 1O95D 3AR7A 3C5HA 1BWPA 4QPDA 5AHOA 3TRDA 3LQ4A 3T52A 4AQYB 2F4VB 1FJ2A 1XHEA 1FCJA 4CM7A 3OFNA 2G1KA 2HA5A 4IF4A 5AUNB 4RTLA 1W1IA 5M5BA 3FNIA 3OFJA 2G9VA 1TDJA 3PHCA 1TQHA 3NDBB 2GA9A 3Q0EA 3HRKA 3KEOA 1B41A 3L8CA 5AICA 1BTOA 1CC1S 4FCCA 3TKYA 4ZVUA 4RD4A 3WYAA 3VTKA 1TKCA 3D1LA 4QSHA 1P7VA 1FU8A 3LECA 5FOTA 5I5GA 1YCFA 4EPTA 2JIOA 1XAJA 1D6MA 2GARA 1GCOA 2EOAA 3JZFA 1EDZA 1NHWA 2RCNA 2YX1A 3K8YA 5CBPB 4BQRA 4BCCA 3QW2A 2MDTA 2YXLA 4FI3F 3KQMA 2BV3A 4MWTA 4MWBA 1B6GA 3BTVA 1AOXA 1WY7A 2QG9A 4QBIA 5K3BA 3IP9A 3RK0A 2L19A 1YVPA 4U7TB 2H51A 1QM5A 4C0LA 3GMDA 4BVJA 4U7HA 1TF2A 3C6XA 4PW0A 3G2KA 4V24A 4YCMA 3H7AA 3W3ZB 5EG5A 4WKCA 5GJWC 1B76A 6CHYA 3LTEA 1RSZA 4M1YA 2ZB4A 3PC6A 1T8YA 3V8QA 1A4IA 1QVZA 2HF8A 1OFUA 3JAWB 1XDZA 4X7PA 3G2HA 4GDFA 1P2TA 3EWNA 4KB5A 3UJ3X 1OX4B 1GTVA 4GKBA 2MCFA 1XTVA 1UXKA 3ZHCA 1M2GA 5FLXA 1T5SA 2Y68A 4U5QA 3DDSA 2I2DA 5HKKD 1ZN7A 4UTXA 4LVCA 1CS0B 1NDQA 1MFPA 4X6UA 5IARA 5EMKA 2M6RA 4ZO8A 1G20E 1YZQA 4PZEA 3LX8A 4RULA 1E5XA 1PW5A 4X97A 3G85A 2QM8A 4RLFA 2OM2A 1AE1A 1YMUA 4TYNA 1IK6A 3ANSA 1JEQA 3K9LA 4PPFA 2FB9A 4RC9A 4QLAA 1DV2A 4LXYA 4Q05A 5DASA 5DISB 5FUVA 3WMGA 2DBYA 4AF6A 1P33A 4GXQA 5KB3A 3TFOA 2Q2NA 2O4UX 1H65A 5JC1A 2P5YA 4WASA 5J2TA 3FHOA 3G0CA 4LZPA 3ZR4B 5F98A 2GBIA 5L3QA 5H70A 1IXKA 1YA4A 3GJQA 4J4HA 2XXBA 4G89A 2ZBPA 2PXCA 3RVSA 2BKXA 1NVGA 1PJRA 2QRLA 2WT4A 1UT5A 3KQPA 1J4AA 3R9KA 4RBNA 3EA0A 1SB8A 3AUSA 3SX2A 2GK6A 4D8UA 4DR4B 2PBFA 1G7RA 2FY8A 5B1EA 2E82A 4JDPA 1S7GA 2ZI7A 1KOLA 2AJLI 4KR0A 2I3DA 3K0KA 2X4DA 3CFYA 3K1JA 4IV0A 5E6RA 2XZLA 4YREA 1RWNA 2JL1A 1MNAA 3T3PB 3IOCA 3TLBA 2GZRA 2J4DA 2ACVA 5T5QA 4ZCTA 2IH5A 3NT5A 3RT9A 1X8XA 5EJ6A 1ACMA 3IDAA 2VPZA 3CUKA 1J23A 3D8SA 3ONEA 4DN6A 3INYA 1PJSA 4LF9B 1W36D 1Z07A 2H54A 5L3SA 4BN5A 1CG6A 2EWVA 3T3GA 3JQAA 1G41A 4RPGA 2BD0A 1W76A 3WKDA 1L7EA 1SY7A 2CFCA 4XGRA 1V3UA 3N0WA 4OMDA 4TMKA 2X76A 3BMOA 1DMSA 2GLUA 3EC7A 1X80B 4HNRA 4U2KA 3RRYA 1PNVA 2QT9A 2YOHA 3D2LA 3G5TA 4FPXA 4HSGA 3GIWA 1E2UA 5CURA 2XOXA 3PSAA 3X1MA 5A7GA 5F5NA 2QN3A 3HV0A 1ZGGA 1HL3A 4OX9Y 9ABPA 1L4YA 1MPXA 3H5WA 4Q9LA 1RPTA 4G01B 3UMRA 1SG6A 3NBXX 2XT6A 2VPWA 1VBNA 3EIFA 1PJ3A 1DNPA 1WXIA 3GHYA 4JUDX 5EP3A 3ZWPA 5EJIA 1J70A 4L9SA 1Q17A 4TMVA 1QK5A 3D2CA 1NBIA 3HCEA 3NBZC 4D74A 4V1CA 1JG4A 1Y3DE 4KO2S 4Q4AA 4C30A 3IQZA 2OLEA 4D3ZA 5KX5F 3C6MA 3G68A 4NBSA 5LQUA 1CX9B 1JGTA 4MUBA 5FT9A 5J2UA 2PPLA 1P7PA 4HXFB 2WQZA 3GVCA 4CKWA 2P4EA 3UMMA 4IYJA 2P8SA 2W98A 3T9AA 3C3JA 3FPCA 4H17A 4J4BA 5DX0A 5LOVA 4NFYA 3I37X 3CLVA 3ZJ5A 1PT5A 2C7BA 2GYVA 2K87A 3E5HA 3ZU4A 3V4OA 1XZMA 2GDJA 2ODNA 1EHYA 1UPTA 3UJPA 1J0BA 3EXHA 4FGJA 4HXGA 1DRKA 4EDHA 4HMPA 1C7RA 1IZZA 1GXSA 4UU7A 4YRSA 2A0UA 1WZEA 2ZDHA 1I3MA 1CB7A 1GG9A 1SIOA 4ZOLB 4GLJA 1PSZA 5EE0A 4ARAA 2I2BA 1QJCA 4IHAA 1H1LA 2EWWA 4P8RA 5KVAA 3G49A 3L0YA 4RA9B 3LXRA 2OOSA 1H6CA 3DVAB 3V8RA 1ZUNB 3MS2A 1SD2A 3UBMA 2ZYDA 5C5DA 2IU0A 1NVBA 4M89A 4AZ0B 4UBKA 1WBBA 3AOEA 4KQIA 2AW3A 3GK3A 4ZA2A 3LYAA 2XB9A 2C5AA 3PJEA 4PNZA 2B4RO 2IYTA 1R15A 2PR2A 3P32A 4O0LA 3WGYA 2VDUE 4EYGA 2V7QD 3DNFA 2AH5A 2QUZA 3LF1A 2QX6A 3GWZA 3T95A 4B3SB 1U81A 2ZXFA 3KXPA 5KMGA 1X1TA 4JR2A 2VYQA 5G02A 1T5HX 3JVUA 1XTTA 5I7SA 3ZIAA 1LPSA 3WRWA 2RONA 2YKGA 1HTWA 4M0LA 1VJCA 1MO3A 1E1LA 1ETUA 2ZITA 4UHEA 1OYOA 4PPYA 3NH9A 5AI9A 5A0TA 3WTCA 4I55F 2ZR8A 3DO5A 4BO3A 1KFEB 2V65A 3VBEA 2REQB 2NP7A 2ZBEA 2I87A 4DV0B 2YHAA 3I9OA 1ZJ4A 2FEPA 2XTAA 1NNI1 4A26A 4CLDA 1QWSA 4J7UA 1O94C 4Z1MA 5BT9A 3GFVA 4FKMA 3OO1A 1U04A 2GSDA 5KVCA 3RG2A 3OFVA 4X8LA 2IYEA 3DMNA 2G4VA 3KUXA 2FQWA 2XE6A 3TAHA 1N1DA 4FYVA 2FMTA 2J5QA 4CU2A 5JJBA 1N8SA 5FOWA 5J4VA 4NE2A 1WV1A 1QIIA 4G85A 4PZCA 1DJOA 3B9PA 3QJ5A 1IAQA 1S02A 3V4VB 4Y2RA 1CQPA 6AT1A 2H52A 4DCGA 2HBZA 5AK4A 3SC3A 1LRKA 1RAHA 2M2IA 3E7XA 2OV4A 2QN1A 3HDHA 4RESA 3THYA 1P1FA 3L8EA 2VDNB 2ZRJA 5MFZA 1EB9A 4W5HA 3DHEA 3FFAA 4OHWA 4HTAA 2FFRA 3KB1A 5IH3A 1H2RS 2HCTA 2G7MC 3IAUA 2Z58A 2O3JA 2W6JD 1VLZA 3L1KA 3PDJA 1XEXA 1EGAA 4D1YA 5IUJC 3NZEA 1VA4A 3AXTA 3NAQA 3P4UA 4AUEA 1PGPA 1U0BB 4FE7A 3FSGD 2QTNA 4IXTA 3NFYA 2EFJA 4A8JB 4L5YA 4B7UA 3X2FA 1SOVA 3I64A 2X13A 2WC1A 4LYYA 4PXYA 5DYWA 1IEXA 2XXJA 1V9CA 1X7ZB 3BFPA 2R7AA 3B3FA 3OWHA 2P2DA 2QAGA 3G9XA 4LHWA 3SKVA 3OIGA 1J9GA 3QG1A 2BISA 3PRKE 2C9ZA 5DTQA 1I7DA 5HIIA 1P0CA 4CQMB 5JNTA 4DCCA 3ACBA 5KSYA 3QYPA 1JIXA 4YAUA 5DM1A 4A8TA 1JYFA 1VIYA 2RHRA 3CF0A 2DQYA 3PNPA 5TGTA 4O4JF 1O6FA 3AJ8A 3RC2A 1B8NA 1ONSA 5CYGA 3V34A 4HO1X 1XMPA 1QHHB 2BGJA 4LYFA 4X6YA 5FAXA 2CNKA 2V7VA 2QYHA 3M6UA 1NR7A 1QIEA 3FVVA 1UZNA 1G63A 2PT6A 2ZSHA 4MVJD 3ZTTA 2V3CC 1XE3A 4LDQA 2NZVG 1EVYA 2QP3A 5CT6A 1WWKA 4MVWA 5DNWA 4E70A 2OB2A 4LYJA 3WGHA 4NVRA 1CVIA 1L5HA 2AW5A 2WU0A 4LGVA 4OHOA 5E1DA 2RHBA 4JWKA 4ZV9A 1XC7A 3T5CA 3WJAA 2PFSA 4CF6A 5JS6A 5E6SB 2W4MA 4IJ5A 4DSUA 2XGGA 4QUEA 5CNIA 1K2WA 3KKLA 1EFPB 5F77A 4PYNA 5DHAA 5KJ6A 1YRHA 5I7VA 4EHAA 4PBSA 5IJ9A 1PQYA 4YFVA 1H2WA 1E7QA 1U94A 4LX0A 5D2CA 2O54A 4L9WA 2Z1MA 3UGQA 3HFRA 4OV6B 3ZE9A 5AVWA 2I54A 1QP8A 2WWIA 1O1YA 3NBUA 4WMLA 4XSVA 1ZJ5A 3BRCA 1LPBB 4C14A 1N3IA 1AKYA 2I7DA 2W6NA 4GLBA 4HS4A 2H00A 3L2OB 4FOTA 4LNUB 2C1XA 3L18A 4WXYB 5T3UA 4NZOA 1E2DA 1XZLA 1NYLA 1BE8A 2HRBA 4QICA 4IQ4A 4D5EA 721PA 2UZ3A 3IURA 4JR1A 2DLCX 4N3BA 1E2HA 1C81A 4IIBA 1TQ6A 2PZMA 4HR7A 3E53A 1CIPA 5IVIA 4EKDA 5A4KA 1BXRB 1E60A 3JQ7B 3PGKA 4YJGA 1ZEMA 2OXRA 2G0AA 4MUNA 3OF5A 1W0KA 2XQFA 3U13A 5CFNA 3SGLA 4Y2YA 4OHXA 4D9FA 2V7GA 4AKTA 2D1YA 5IVDA 4EFNA 1NX6A 2ZTUA 2D8MA 3GHHA 3MWEA 1NVMB 4G65A 4EW6A 2YYZA 1R4AA 2IUFA 1FDSA 2XWJI 3JYQA 5BSHA 4GE3A 5HOQA 4CMEC 3C2QA 1XJWA 3MOSA 3NM4A 4UM9B 7MHTA 1NQWA 1ADGA 5GMOA 1RC1A 2X41A 5B5SA 1GZ3A 1PG0A 3EVFA 4PC1A 1PZXA 3WC4A 3UT6A 4R0VA 3WOVA 3KZXA 1HBJA 3QE4A 5ALZA 1YFKA 2AK2A 2ZUDA 5KEIA 2XXAA 2C5EA 3U9LA 4Q3LA 4DG8A 2YQZA 1N2HA 4X84A 5E1MA 4EMTA 2XB2A 1E7SA 2ALJA 5T4HA 3EFOA 2RI6A 2LDBA 5JFOA 5ITVA 2NTEA 1L5FA 2BKLA 2Z4RA 3R0QA 4YJKA 2B4TO 4M0KA 5EKTA 3SZGA 1V1JA 4EHJA 4I8IA 3GRPA 4O4LF 1T36A 4WVLA 1NBMD 5CIQA 4B5LA 1XXHB 2LE0A 1PSWA 1L9KA 4CM4A 3DV0B 1JMKC 4I7EA 4QHTA 1V5WA 3RC8A 1B0UA 2FW6A 2QRZA 3DEZA 4BN4A 1G3MA 4MCJA 2W8BA 1DKPA 1FFSA 1GLVA 1WUKS 3PUWA 3CCBA 5BVHA 2ZM6B 3S8MA 3GQVA 5ISMA 3HCFA 1KHTA 3NT2A 4Y9RA 2HHAA 3LPLA 4TWAA 5LBTA 2D5BA 3T12A 2BFNA 1VGVA 4LOKA 5AW2A 2X0JA 4AIIA 4JT2A 4LF8B 1BVYF 1X1RA 3VR1A 1FX0B 1U3FA 4HCJA 1U4NA 4R8SA 3FCAA 3VH2A 4FYKA 4RV9A 5ES4B 5TF4A 5KWEA 3ZE2B 5FUWA 4E2WA 4PU0A 5HF6A 1AT1A 2HEGA 3GRAA 3MTJA 2EATA 1FTSA 3BIOA 3V55A 2ZE6A 5L4NA 1NG9A 1W1WA 4DRXA 3FUUA 4E31A 1IUNA 2HA2A 4JXJA 1TTTA 2PZ8A 2O7QA 2Y0DA 4I36A 2ZJAA 5GPBA 1Q44A 1SG0A 4LE2A 2YXDA 3W3AD 3GOQA 4FJ2A 1EQAA 1X14A 5EEHA 1O54A 3BL8A 4QJ4A 2VFAA 2C3PA 2PWBA 5KKCA 1K97A 3HN6A 2XNSA 5DHFA 3STXA 3W2GA 2R8OA 2PUDA 4I4LA 4MUKA 3NGMA 1KEEA 2GA8A 3BCUA 4FCVA 5CH8A 1EJ2A 4CJXA 2OSBA 1LTQA 4A4DA 1W2WB 1XU7A 4Z99A 5DHTA 3E15A 3WISA 3ETNA 3TLJA 5EHZA 2QD4A 1VI5A 1Q7EA 3P2MA 1S2LA 5JNUA 4J94A 4URZR 1S8OA 2NO6A 4FDAA 4MYUA 4GLOA 3MA0A 4Y2VA 2GPNA 1FP1D 4GX1A 4KSBA 4EITA 2NG1A 5AUOB 1PHPA 3C7CB 2LXNA 3OQVA 4PHFA 5FO0A 1RLOA 2C0CA 3UYLA 1RXIA 2CV1A 5JJLA 3HI4A 1Q16A 3ABIA 4ZGWA 4QNMA 1W48A 3B85A 1RYFA 2WMNB 4Z9BA 4HPWA 1KEUA 4MUIA 3SBXA 4URVR 1N1GA 3QFRA 4BU1A 5K8CA 4L95C 4CL8A 4LZOA 1OYVA 1C30A 4HNHA 3W90A 1L7XA 1RQRA 4LSZA 1UR5A 2CLSA 1N5JA 2JAUA 4QRIA 1KMHA 3ZTWA 2XMZA 5IBCA 5HMMA 1E5TA 3F1LA 1IJEA 2B7CA 2DOKA 2R4UA 1U9IC 3PHGA 5BRAA 1DEXA 3IA2A 3RD5A 2B6NA 3TBFA 1YDEA 2RJNA 4BNIA 1WSBA 2BMVA 4XCVA 3RNOA 5A02A 2JVKA 3M4JA 4EZBA 5B55A 1OLUB 3KQNA 4GBED 4EI7A 4J29A 1LBEA 3MGAA 3RQSA 3WWCA 2JIRA 4XASA 4FB5A 4M1ZA 2M6KA 4DV5B 5E7IA 3WSWA 2X1VA 5EP4A 3PCXA 3WIBA 2X3UA 5EXSA 3TOZA 4BB5A 1CERA 4MQLA 3O8RA 2H1OA 3CR8A 1HGXA 4K87A 1V6SA 1EFAA 5BNFA 1BH6A 1JG6A 2IGTA 1UJ2A 2FW9A 3O2JA 2C59A 4F5EA 1R6BX 4BX3A 4CKZA 5HKAA 1FX1A 3TMKA 3EQ2A 4KPFC 1CDOA 5IDQA 3QVGA 2WAMA 1AQYA 2IKQA 3ED1A 1UMBA 3RFXA 1U65A 4YQYA 2RGYA 3JQBA 1UDAA 3QPBA 5AP9A 1U7DA 1D4ZA 2JGIA 2QTFA 3Q1LA 4KLAA 4LBVA 3TE6A 3U3RA 2OZEA 4MRAA 2GN9A 2HJRA 1BCSB 5JSUA 1FNDA 2HF9A 4EGSA 3G17A 1UKVY 1CCWA 3WMWA 4YX9A 2RHJA 4IGKA 1WNTA 2R1TB 3BD9A 3MRTA 4K46A 4NOJA 3FKQA 2HF7A 1E5LA 2II6A 3AFMA 3FPBA 4OHUA 1Q21A 1A77A 2WK1A 1FFWA 2OA0A 3TRHA 2BEWA 5B4UA 3VO1A 2EQAA 4D2IA 1MAAA 3BZBA 1EWYA 4MHOA 3TNJA 1GR0A 3LDGA 5LXTF 3J81A 2XGSA 2ZKIA 3T15A 3AB7A 5K6RA 4RCVA 1JHQA 1HFJA 1ZLYA 2WYVA 4NCHA 1ZNYA 1XT6A 4XVUA 3HJRA 1W44A 3DXZA 3L0IB 1E94E 1KC3A 1SUPA 3UWDA 2FJPA 4YA6A 2ANBA 3FFTA 1T2UA 2QM3A 3DONA 3GARA 3I2IA 2DY0A 4YJFB 4NZPA 2MT9A 3RSGA 5HS4A 3K70B 3NW9A 1NXQA 4FEAA 1BHQ1 4QOSA 2EFGA 2EBHX 1TIBA 2TYSB 2A9RA 4OLJA 3FHCB 4A6DA 2BTQA 4NTZA 2O2IA 4Q39A 4ZO7A 3PCRB 4QTYA 1TCBA 3GFSA 3ORRA 1Q84A 4YRQA 1JHUA 2WSIA 1O6GA 3DFMA 1QV9A 4IZHA 5JS2A 4DR2B 2ZJ4A 2Q6IA 1TUIA 4Q4LA 4RM2A 1G2PA 1SD5A 4R4JA 1XAGA 5FOXA 2YZKA 5JYEA 1O6ZA 5BV8A 5IAOA 1DIBA 5CGZA 2R11A 4W1PA 3QFSA 3SC2B 1GD1O 4NK4A 4UZEA 1HYHA 1Z2PX 4J7CA 1XCBA 3MAJA 4KGZA 4E1VA 2NOAA 1JQDA 3EG9B 5CH3A 1BWSA 5JADA 1DC6A 1YR7A 2NSHA 3R7DA 5BNTA 2V59A 2R44A 3NUZA 2YH2A 2F8MA 4IGAA 5SY4A 4TV9A 3G2PA 1VCIA 5IKPA 3PHJA 2C9CA 4LXXA 3FCXA 1GNTA 2MSLA 1V4NA 3LFHA 2QGNA 4PCLA 4ZAFA 5D3ZA 1O6BA 1TMKA 3ZYZA 2AA3A 5F7OA 4PFQA 3LVRE 1COWA 3HA2A 2XYHA 3GLGA 2CW5A 3HU2A 2A92A 1Y1SA 3LC0A 5H9WA 5J1SB 3LOQA 4R54A 3E61A 2FEMA 3N5CA 4A8PA 1L8OA 2RAVA 3IO3A 4J3JA 2VF5X 4K9LA 5TT1A 1QO0D 1YR1A 2AZTA 1XEWX 2IY7A 2W2KB 3FPSA 5ERXA 2PWAA 2GJ4A 2YL2A 3DCIA 4DADA 2H9AA 3MCUA 2C77A 3NHJA 1NY6A 2AZXA 1BYIA 5DOVA 2ZM5A 5CB4B 2PX5A 1N0UA 2ZVQX 1OHHD 3JYLA 3IJEB 2D0OB 4M0MA 4N01A 1O0BA 3CY6A 4B8WA 2D5AA 2FFBA 3CEPB 4I50A 3W7BA 3LY9A 4Y2PA 2F67A 3H42B 3FPKA 5KYWA 4JA0A 2MYUA 1E79D 1TJ4A 3LY7A 4ODIA 2O06A 2OD7A 3AL3A 3HVKA 4IRXA 2IYRA 5HEKA 1HYEA 3DEIA 3RJMA 3GLSA 4JBHA 1E4EB 2JAPA 3WLOA 1FUIA 1NQXA 2E49A 4GWLA 4MP8A 1N4AA 2EL7A 5GGYA 3DBLA 4R2JA 4WCFA 4BFCA 1OWNA 3EWSA 3PIIA 1SOAA 3CKKA 5JROA 5CVDA 1GZ4A 3E5NA 3SIXA 2UXBB 1E6WA 1T5IA 3RCBA 3CGWA 1M1NA 2X2EA 5AKGA 5BYAA 1VIVA 2R751 4WY2A 3W2EA 3WL3A 3C4VA 3CSDA 1FRVA 4JLAA 5EUMA 2AJ8A 1GPYA 3KVRA 4UNNA 1OLXA 2IHZA 3EGCA 1U2PA 1KYQA 2JIMA 1E0KA 3V9PA 3DMTC 4HX2A 5TEVA 3OPNA 4FZJA 3JWHA 3ICCA 2AR0A 4MYSA 2BY4A 2O2GA 3GCWA 5EYPA 2AGVA 1EDEA 1M8JA 1Y8RB 4KR9A 2ZIXB 3WFJA 2FKNA 1NXWA 2CLIB 3C15C 4FMDB 4G37A 4JLUA 1FSSA 4PPNA 1PG2A 4CETA 1OI3A 2E5FA 4QUDA 4HB4A 2CUTA 2Q4TA 2SICE 3INGA 3QK7A 4H7KA 4Q6WA 1E77A 4WESB 8ABPA 2YOFA 4B3HA 3AOGA 2H92A 2E85A 2E4VA 2XCOA 3R09A 2BFFA 1IIRA 2L18A 1JKFA 16PKA 3WBJA 2B3TA 3CO5A 4BNZA 4BKMA 1DDGA 4H6VA 5IULC 2WIDA 1TXGA 1WDLA 2BLNA 2E6KA 3G7SA 2WB4A 5K6AA 1SELA 3QU4A 3OOHA 3W5JA 4H6XA 5BSMA 4DMCA 2NP6A 1SKYB 2CJWA 3ITKA 1UWKA 5CVCA 1NBHA 3D4LA 5ES3A 3WP1B 3IPXA 1WMBA 1PS8A 3ZLVA 4DIOA 5HRUA 3RAEC 2I62A 4RKWA 3MJVA 3ZBPA 5JANA 3BGIA 4QU0A 1D5CA 2FJUA 2H29A 4PYIA 2WKSA 4OHRA 1YJCA 2ZSDA 3PFBA 2XE8A 3TN7A 1ZW6A 2Y71A 1PNRA 4LF4B 4BVFA 4XVHA 2VDWA 4PLGA 4AFNA 2DUJA 1VSQA 1YR6A 2XUPA 4IG4A 2YWGA 1B8UA 4J1TA 2BF4A 1A5SB 3DBRB 4UVEA 2ZBRA 3KZOA 3TGPA 2HD4A 3QOWA 2QSZA 4BMXA 3C14C 2WLSA 4BNNA 2Q6VA 3KKPA 1GNVA 2DE0X 5FIUA 5IMBA 5ITZA 1PG5A 3P26A 4MTCA 5JUWA 3SM3A 4EARA 2JI9A 4GKKB 1JNYA 4B73A 1P62B 4KPYA 4R0NA 1AMNA 3A06A 2HTEA 4OU5A 3T8YA 1QWOA 3I83A 1GPKA 2EFYA 3FRIA 2O2ZA 4X0EA 5E9AA 3WR5A 4EHKA 5B3KA 1U8ZA 5IFLA 3TK1A 1U7WA 5F5LA 2VHEA 1YF3A 2PLNA 1SXJD 2FKAA 3ADCA 1Z4JA 2JEZA 2F17A 1ML4A 2ZSBA 2J3HA 1U28A 3WL7A 1VE1A 1DKLA 1ZGCA 4LBZA 5EL0A 1R3DA 5B30A 4WW0A 4YS6A 4CTOA 3UJDA 3V46A 5FCDA 3AHEA 3FLEA 1WHSB 4KWCA 4A1OA 4RGYA 4LN1A 4ENSA 3E58A 4CUZA 1XLTA 1PFUA 1V47A 2GF0A 2R8PA 2K4MA 1ETHA 2JHPA 2WTEA 2WU1A 3DULA 3GBPA 3LX5A 1TKRA 3OCWA 3EEFA 4W7HA 4DG9A 2B25A 3OQMA 4GOND 1Y1RA 2FA9A 1QDLB 3GB9A 4TRJA 4J3NA 5IJ0B 1L0BA 5I9TA 4ND2A 1Z5GA 2E55A 2O9JA 3MHPA 4I46A 2F8TA 2G0TA 1Z4IA 3PD1A 2FR0A 3EWAA 3KTAA 1XVTA 3PRHA 4N0QA 5AVSA 3WNVA 4W5OA 1QFMA 4OKSA 1M5UA 1PL8A 3VYRB 4I3FA 2QLNA 2IP4A 1OA1A 5F51A 3UAVA 2G4LA 2GPSA 1Z8DA 4JOBA 2J5KA 4UARA 1S89A 2CHVA 3CUEF 4XX0A 5DK4A 1S9HA 5TMBA 3G9UA 1Z16A 3OPMA 1DPFA 5FFNA 2HGZA 1OH6A 1CNEA 2P30A 1J21A 1N25A 1NKTA 1TL7C 5K0JA 4PGFA 1YL7A 4B4DA 1JH9A 1F9EA 1XPJA 1J7JA 4IVQA 2BGTA 2ESRA 4QOIA 1RJEA 1N34B 4NNJA 1QO7A 3JQ8A 2QUJA 3AHHA 3DDZX 4KIFA 2YFQA 2W00A 1W5TA 2SKEA 3F67A 4ZOCA 3H0EA 1M2OA 1T91A 3G23A 2FZCA 5IW8A 4FR2A 4K0RA 1C2YA 2DGDA 2E4ZA 2XRZA 5AMXA 3E84A 4S0XA 1D1PA 2CVHA 1NI4B 3BWEA 2GYUA 2I2AA 4DLXA 2PRKA 3QXHA 1LVHA 1EWRA 1D9ZA 4TSFA 2HU5A 2Q4OA 1GM5A 1XOIA 2JK0A 2VF2A 4FKZA 1ULBA 1DKOA 3IBCA 3V4FA 4RF2A 3CR7A 5JD3A 4Q7MB 1ZAKA 5HCNA 2QUIA 4PV7A 2YNMD 4WOBA 1DX4A 4FSXA 3ZWBA 1H1DA 4MGEA 5C51B 3HTXA 3ANNA 1URPA 4G41A 1AG9A 3ZQ6A 5ED0A 3VXKA 4AN4A 4CR6A 2CLCX 2YVLA 2FPSA 3BXGA 4L7QA 4E08A 1MC5A 1QUEA 4P35A 5LA6A 5DW0A 1T1GA 3FCOA 5TPWB 4E32A 1KK2A 1O9BA 4CMGA 1CP3A 3EVEA 1MNQA 1RQXA 4MVJM 5L4LA 1ZHHA 2EJUA 2HIGA 4MA5A 4K81B 1L7DA 1VE7A 2QXUA 2G82A 3DBHB 1RHUA 3COZA 4INOA 4UJ3A 2ZS8A 3ZWWA 3QTTA 4DT1A 1QRTA 3O73A 4L27A 4LZWA 4ZARA 3B9BA 4X9XA 3N39C 4AX8A 1TPZA 5LP6A 3L7AA 2WD9A 1IZ9A 1UEIA 5ALJA 3NTXA 4J16A 1ZPDA 1S9DA 1N2OA 1Z7WA 2Z08A 1AKEA 1GL3A 4IMIB 5G0SA 5JYCA 3JZMA 4HPJB 2OHJA 3ZJYA 5EGSA 4E13A 5I7EA 1GQSA 4AW9A 1NUQA 1R0WA 3C7TA 5KNDD 3KS9A 4DEXA 1ZGJA 4N18A 5DBEX 2OORA 4JJ7A 4OG2A 5KKAA 4IJ6A 2JKZA 2QJRA 1CZHA 2C84A 4X1KA 5LNK6 1SVKA 1KEWA 1XBTA 2EYUA 3W78A 3Q8KA 3H2IA 3RSZA 1SCDA 3QE2A 3KPUA 3TL6A 4F9TA 1FDUA 3PX3A 4JBXA 2MOKA 4WOJA 5CEEA 3U19A 4FU0A 3CNHA 1NOKA 4Z1OA 4MS1A 2ODEA 3GJTA 3TKAA 3ZW9A 3KXLA 4FBGA 1D7OA 4M9RA 2JH3A 1JEOA 3KD2A 2RAFA 3F9RA 4WXHA 3TDKA 3NAZA 4BGUA 3L5OA 1AM4D 4IEEA 4FSDA 1CEYA 4IV5A 4EEKA 4CF5A 1P0PA 1T1JA 5IAGA 2MSKA 4DA4A 2OK7A 3QVTA 4X7MA 5FLEX 4CIDA 1ENZA 1S1CA 2E37A 4II3A 2HH9A 4W9NC 1GT91 1UMCB 3GJ8A 4M7WA 4OO3A 1G2QA 3FTQA 3GRYA 2HCJB 2VJPA 4P4TA 4UE3S 3CUUA 3RAPR 5CLJA 4ALMA 4Z51A 3ENWA 3ETHA 1U0OC 4RTQA 4YHHB 2PUAA 2VDPB 4EJ6A 3OICA 2WMYA 2A1TS 4JS0A 3AR3A 1IRXA 5DDIP 4BP9A 1TM5E 5AFSA 2DPYA 1U8AA 1IM5A 3D8BA 2WT9A 4FBMA 3SJAA 3ZX4A 2OFOA 2PYZA 4PGHA 2BGRA 4BX8A 2O2SA 3DLPX 1XCMA 1MABB 4WGFA 2OECA 3T5TA 1UT6A 4RF3A 3DV2A 4QNRA 4RQUA 4Y2GA 4DYVA 2ZSIA 4BNDA 1I6KA 2DPGA 1HE8B 3KBBA 4R9UC 4US0R 3O91A 1MB0A 1U3UA 1E98A 4WFJA 521PA 2LW7A 3VDNB 1TM1E 3SOPA 2E4XA 4RANA 3G7NA 3UJAA 5CVJA 2AWOA 1UPUA 2ZZKA 4OHPA 4AK9A 4EZIA 1DTEA 1EUCA 2P7HA 4QUAA 1C4KA 1A8QA 2MIIA 2WU8A 1UC8A 5CFZA 1A2BA 4FHFA 4A5OA 5G1OA 5I4KA 2CL7X 3U0VA 4KQEA 1JFVA 3W8DA 4O4IF 3H5NA 3BA1A 4L22A 3IEPA 4BFUA 3TIFA 1USUA 2AS0A 5IWCA 2XSZD 2ISSD 3N6VA 4RGBA 5FAKA 1U0FA 5JHGB 3I8OA 3PC8A 4DKJA 1L8XA 3VV2A 5K0TA 1LZLA 1QANA 2C97A 2IGBA 1LJUA 3BB3A 1NN0A 1RRMA 1F7VA 1BU8A 2Y1GA 3HKCA 3QEMA 1Q74A 4M54A 1RADA 2V6GA 2ZS9A 2OAQ1 3QEJA 3CX4A 3IUBA 4DC9A 1K3UB 4PQRA 1NRJB 2CHUA 4FYPA 3S28A 4CQMD 1CJTC 2D2VA 2VRWA 5M2QA 1LX6A 3BVPA 2AKEA 2ZI3A 1PYDA 2XVAA 3NCTA 1SPBS 1HLFA 2QE7A 2OORC 4P08A 2B8JA 2CLDX 4HNSA 1ZCJA 1QGZA 3AC0A 3VZPA 1CUAA 2RKOA 3K31A 1W59A 5DP1A 4EJMA 3GLHA 4BAGA 3O9MA 4EKEA 1Q14A 3DFKA 2ZIGA 1Q1BA 5ESDA 1JKJA 5F73A 4MVJE 3CS3A 2E5LB 4GX0A 3WLIA 4DJ5X 2G5GX 4HZUA 5DYNA 3OETA 1UPAA 1HM5A 4TWBA 2XV1A 3SLGA 1CQJA 1XZ8A 1KMNA 3ESZA 4GOXA 5I9IA 5IT9A 4JI2B 2AMVA 3DR5A 3OJXA 4G9GA 1SVNA 3MCTA 4U3JB 4YUAA 4YLGA 1HLPA 4BAUA 2WZCA 3KYDA 4PAWA 4TRRA 3ADBA 3TG8A 4FNGA 3HB0A 4D5GA 4WH0A 2IXFA 3FGZA 4L4SA 3D4PA 4HUQA 4JC5A 3QKRB 3WLFA 3TPFA 1SU6A 5E2IA 2ZLBA 5K3FB 4LNAA 3E8MA 4QPZA 1KMCA 3J7AC 4P92A 1H22A 1WSWA 4ABTA 3TOCA 1LJLA 5LLTA 2A9PA 4MW0A 1IN6A 1HA3A 4PO3X 1W85B 5EHIA 1VBFA 4L15A 4YASA 3OZUA 3ZDQA 5GOZA 3GA0A 3RU3A 1P2SA 4O3MA 4U2DA 3FBGA 4KNVA 1YQEA 8ADHA 3HVUA 4GI5A 3UOGA 2PKXA 4RW0A 4EZEA 5A06A 2C4KA 1AA9A 2V3VA 4Y6LA 4ZDIA 2VR1A 1CUXA 4G4JA 4Y1EA 4AMBA 2F8SA 1BE1A 5F3DA 2BFOA 1GCIA 3OM9A 4NRDA 1T6YA 4KUEA 4CM8B 2QTMA 1R4NB 3T61A 2J3LA 2JVIA 1ZUD1 2O8BA 1I24A 1O95C 1V8DA 1OILA 1WZCA 1IN5A 2BELA 3TOSA 1T4CB 5ER6A 1VZ3A 3U4HA 4I8DA 3ZLJA 1BROA 2YR0A 1E3TA 2Y2UA 1R6AA 3GJSA 4QYSA 4P7JA 2DHCA 2Q5FA 3E1GA 4E14A 3H97A 3A6KA 4G67A 4NCJA 1DWQA 3FUVA 1T9DA 4F3RA 2Q2VA 4R2LA 1BEZA 2ZYRA 4NJMB 3RVRA 2LR0A 4OPMA 4PO8A 3TWOA 4LYEA 1BDJA 1P75A 5L7WA 4OUKX 4UM9D 3OTGA 4UKDA 3E8SA 2ZIEA 2L69A 3A25A 1NBAA 1RZUA 4B3CA 1KR5A 1QH8A 1Z5VA 1EG2A 2JDIA 1XZQA 2VPYA 3D81A 4I9NA 5K01A 3OLQA 3FZQA 1Z5NA 1RABA 5KCMA 1XJ0A 4NWIA 3MT7A 3RHFA 3RS9A 2BPOA 4TM8A 3VUEA 2O0JA 5T57A 2JGEA 3LWZA 4RSGA 2AFIE 3U7IA 1PK8A 2OQRA 2QRNA 4AP9A 5A7HA 2PRZA 3D7NA 2GGSA 2E89A 1FMFA 3AI2A 3QVWA 5SZJA 5B57C 4L1KA 1RLMA 1Z5WA 1MOQA 3EPPA 3MF4A 3B1XA 3BXXA 3UV7A 5DHSA 2JEOA 1G5HA 1QCDA 1FK8A 2DJ5A 5FKJA 1U02A 3JYOA 4PXAA 2PBLA 3KLNA 1VM6A 5E4JA 3U3XA 1E9RA 2MSNA 3A7DA 4UM7A 4HWKA 2BKAA 5FWYA 5BR8B 2BM0A 1RJWA 3NTLA 3SEQA 4HEJA 4G86A 4QPPA 5FBQB 1O96A 4D9HA 1GITA 3BMCA 1YBFA 2DMRA 3FKSD 3HV2A 3O4VA 3I9V1 4D3SA 2WUWE 2NYRA 2O8CB 1Q83A 4YRDA 1JHPA 4KLZA 4TTJA 2G3YA 1RS0A 3OC0A 4HD8A 2XIJA 4ARCA 4RXTA 4NAVA 3FZEA 5DTRA 3NTRA 1PZEA 3S1SA 2Y1LA 2WD7B 4JU8A 4A2WA 2JGNA 1SU8A 2GAFA 3PUIA 2ZQZA 1LRJA 1QVVA 3LFUA 3Q88A 4RLSA 3UKDA 4FEGA 5EWMA 3ZBUA 4YR9A 3IOBA 2I76A 2EIHA 2QTZA 4NBTA 3F73A 2HRQA 4RGQA 3KYIB 1J0EA 3GDOA 4WXEA 1ST2A 5J5CA 3TZEA 3GJXC 3ZK9A 2DBZA 4C07A 4BWVA 4QHYA 4K5QA 1EM8B 4O08A 1R27A 1Z37A 3JRNA 3MINA 4CT0A 2XA9A 3ZVRA 2QPAA 4NATA 2HGSA 3TE7A 3T06B 4ENRA 4OBXA 2DFDA 4L4RA 4PZPA 1Z88A 4WZAA 4F93B 5JAOA 1OBFO 4W5RA 1EFRD 1XUOA 2BMAA 2IYUA 3HYTA 4ESVA 1NRWA 4C0WA 1UIRA 1CF9A 1XROA 2Q1SA 1K9VF 3VDRA 3CE9A 3OFKA 4ESEA 5FTWA 1H9AA 3ZDAA 4E0BA 5IASA 1E9SA 3OUZA 5DI3A 1JAXA 3SYRA 7REQA 3FVTA 2X7XA 2HCRA 1WP9A 1T6BY 1U5BB 1ICEA 1BS9A 1QFZA 1TTPB 2IP1A 2NXJA 3K5IA 3LG2A 4RAQA 5FI3A 3T1OA 4ZHSA 5B6PA 2IHBA 4GPZA 1OI7A 4J0KA 2PUFA 1YB2A 3NHBA 4KNWA 4P36A 3PA6A 2H1IA 3KM0A 1A2OA 5IFKA 4INPA 2JANA 4L78A 2OP1A 1DO2A 2C7QA 3B1WA 1PW7A 2OO5C 4LKOA 4NF2A 2WWXA 3M0EA 1OTXA 2G9QA 4G36A 4ZVVA 4W8GA 1MTZA 2OSVA 4BNYA 3I5XA 4GEKA 1WVIA 1GPBA 3HXQA 3X1KA 1UINA 1UK8A 4B9EA 1JYEA 4DC1A 3PQ5A 4ROTA 4JLSA 3C5CA 1J8VA 3COVA 3NAGA 4JJKA 4EHDA 4LTNA 5IM4A 1O5OA 3MPOA 1U1EA 4J0IA 3U7EB 1YC2A 2OAGA 3CUYA 4IKOA 4HEA1 3IUEA 1N6KA 2V8BA 1ZQ1A 3AGPA 3MRVA 2L17A 4MUEA 4Q00A 1PNTA 5J4KA 2W6JA 1E2EA 1E5DA 5JEDA 1YJ8A 1HT1E 2AMYA 2HQBA 3P20A 3UG6A 2NYVA 2ZUCA 4Y3UA 3LQ1A 1IZ0A 3A3OA 4PFSA 4AKEA 1QP7A 2FQYA 2V4UA 4XFKA 1YASA 1KY2A 3NDPA 1D0SA 1V4VA 2OPHA 1ZOLA 3K9CA 3MS4A 4N5NA 4UPEA 2HXGA 1TJYA 1EXDA 5FFMA 5F21A 1ZGAA 1JI3A 1PL7A 1LLFA 2FWRA 2KS6A 2RHHA 3R3SA 1IMOA 2PKWA 3GRCA 4ZN6A 1DBWA 1W30A 2IDMA 2X15A 3E81A 3LYHA 5J47A 1XI2A 2BJVA 3RSCA 4XYLA 2LKDA 4DA0A 4FS8A 3LOUA 1HYQA 4NH4A 4B35A 1XN4A 1W49A 4AY3A 2Z2IA 4BNJA 4Q34A 1NVVQ 4MB2A 4MWDA 1A9XB 3RBAA 6GPBA 1HNZB 5FPYA 1C5KA 1J8MF 5TS3A 5BWNA 3M4ZA 4N5LA 4HWOA 3K70D 2FPWA 4GMXA 5CLQA 1GNQA 1RVDA 1SQFA 1YI8A 3KKQA 4FK8A 2IWRA 2IV7A 3TPCA 3MILA 1LSUA 5KJCA 2VHZA 3C74A 3F98A 5KSPA 3MSCA 4P0PB 1F8YA 2GZ1A 2H0QA 2ONZA 1MA3A 2GEBA 2V03A 1QHGA 3H87A 3QELA 3R4CA 3WZMA 5A3QA 1GNSA 4JX9A 1GG8A 4YMGA 3SZUA 5E0KB 3DE0X 1OLSB 1YB1A 5DKFA 3UKJA 4KVGA 2BM8A 3GZJA 2G72A 4CGZA 2BHLA 1NATA 4DR1B 3TLGB 2BBWA 1SBYA 1OXXK 2HKIA 3PYMA 3HKBB 3UENA 4E09A 1QVAA 2AKAB 1U2RA 2HWKA 1EFDN 3Q8MA 1KAMA 4DWVA 1E5VA 1NMQA 2BBTA 4TZ0A 3OZAA 2FFAA 5JAPA 4LHZA 1GZVA 1WABA 2VKTA 3ESYA 5JVDF 1DFHA 1Z83A 2AQIA 1IUKA 3ESDA 5HRCA 1SQ6A 2GZ3A 2O14A 2YRWA 4RS4A 1QZTA 1YE5A 4BB0A 3WGUA 4CDMA 1M67A 1PJCA 5BUZA 2WYHA 5FDFA 3Q10A 4I55A 2HUPA 1Y9ZA 121PA 4AS3A 2GZDA 3E22A 4YMUA 4MW9A 4TUYA 1MVOA 3AEUB 5DRTA 4MS4A 1UKBA 3MERA 5AJZA 3UVEA 3VR2D 2VNIA 5K0GA 3BREA 3PKJA 3UOAB 3H6HA 1H8HD 1JBKA 1CIVA 1F06A 3RSSA 4ECAA 1K8QA 1NDUA 1GAWA 1OT3A 3RVQA 3EDMA 1QS0B 2QX8A 4GPAA 1B42A 1J5EB 2OBXA 4BO2A 2XMSA 2W2TA 3DMHA 5IHPA 3O4HA 3HJHA 4IKEA 5ECDA 4L2IB 3F7NA 1XYGA 1OT5A 1T2VA 3PEWA 1U99A 3R3XA 5BURA 4F8JA 4Z7JA 2XODA 4I6EA 4QXQA 1EXWA 3NIBA 3LQFA 1HY3A 1QBKC 3H2JA 3GA7A 1QRUA 2YHSA 1ZUHA 1EZ1A 3ZY2A 1HLDA 3KX2A 3TQQA 3AH8A 2WSYB 3FDXA 4UTRA 2HO4A 4NBLA 3DKKA 2JJMA 4U63A 1Z0KA 3AILA 3B38A 2JASA 3JAMA 1HO3A 4CMJA 2GF2A 2RIPA 4GRIA 3TS1A 1QRAA 1TM2A 2EKPA 1V2HE 3ZV3A 1ORIA 2BFEA 4BJ6A 3ZCPA 4MOWA 3T7DA 3EGDB 4ND8B 3NKVA 3QBTA 4UVIA 1TYEB 5DNDA 2QKYA 2G08A 1IBLB 4CM5A 4PFJA 2P69A 4YT4A 2DCMA 1RRCA 1OZAA 4YEDA 3G2IA 1QG4A 3EDRA 3JSAA 1Z8HA 4KR7A 3K0FA 4MMXB 4YPVA 3P5SA 4CLEA 2OKCA 1EZ4A 1HE2A 2FGJA 2GT1A 2JK1A 4OKIA 1P1KA 5AI6A 3M4YA 3O3CA 5GONA 4UBIA 1PJQA 5AXDA 4H59A 2DPXA 2M6LA 4RK1A 1KS9A 2JIPA 2QN8A 3LT4A 4JVLA 1BXZA 1ZMXA 3BQ9A 5KOJB 3KZNA 1DEKA 1KFKB 4G97A 4UDXX 1XN1A 1G4HA 1Z5UA 2V7EA 2NO1A 3IBSA 2DQZA 2V7WA 3BEOA 4V0MA 3EPLA 2FP4B 3HUDA 1X7WB 3IP5A 2WJVA 4DG5A 1UQTA 3IPRA 4MV5A 2JCXA 5HX7A 3U2QA 5BWLA 3F1KA 1KMMA 2GJKA 1P1IA 4P81A 2WJYA 1GGKA 1VOTA 3A1DA 3A1UA 3KDAA 4Y9SA 3H17A 1CUIA 4ZQIA 3RVPA 4BHTA 5DGXA 3IVAA 2BMDA 3GJ4A 1PJAA 1W2GA 3HCDA 1LK7A 3CYFA 3V8EA 1CETA 1A3CA 1CXZA 1K7XB 5A4JA 3MTAA 3S8YA 2JLYA 2FPIA 2MSDB 4HDSB 2FLVA 3L82B 2C7RA 2NO5A 4M0DA 3RV3A 2NVOA 3N75A 3NXKA 5CM9C 3HR4A 4DSOA 2BSQA 3P27A 1FUKA 3CVJA 3P2YA 4LIPD 5EXXA 2AUMA 2R6AA 2H65A 2GH1A 2QRMA 3I5UA 4MV4A 4EHIA 1IVSA 1OFHA 4KKVA 2HNBA 1OXBB 1T8RA 3GLQA 3TLMA 5BOVA 2QXTA 3WTBA 2J0SA 1WL8A 2UUCB 9GPBA 4DLAA 2YCLA 1DC8A 2GN4A 4QX6A 1F3OA 2MYTA 1NVAA 1MO4A 3IPAA 1SXJE 2DEUA 4HQFA 2DQKA 4XGIA 3SIRA 3KQWA 2XR1A 2TS1A 3LNTA 4TN5A 3A3YA 5HKBA 4BGIA 1MH9A 2X22A 4TQAA 3MJDA 3K0SA 4E07A 4OX9B 2P27A 2Q3LA 1MB2A 1S1MA 4MR8A 2I5PO 4D4IA 2X14A 1MO5A 1SWVA 2A0FA 1MG5A 3M1LA 1VHQA 1OU0A 1GL6A 3IVXA 4FFWA 4TTPA 2P3QA 5A5DA 4ZTZB 3O4FA 2PVCA 1CZUA 3CINA 1L5KA 1GTSA 4AB1A 4CCYB 1F20A 4H4DA 2NZXA 1E2PA 1GEGA 1FU7A 5CA1B 1GRQA 3BERA 4YB8A 5JNLA 3IAM1 4EHFA 1LPAB 4B2YA 3UMYA 2Q0XA 1E1RD 1Y7IA 1CK4A 5B7PA 4UVDA 2EWMA 5KC8A 4XR9A 5C0OE 1KL7A 4LXIA 3R7NA 3SIPA 2WP8J 1CY7A 3V1KA 1U9JA 4YALA 4FM9A 3CRMA 4DR6B 4L4UA 3IAS1 4WD3A 1X19A 3LLMA 3Q0IA 3AT1A 4J0QA 4LDAA 4JUCA 2QZPA 1FRZA 3PC7A 2G8NA 5HJ2A 1N0V