4PCLA

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sam and a manganese ion.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
LSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum str. hge1
molecule tags Transferase
molecule keywords O-methyltransferase family protein
total genus 79
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pclA00
5FHRA 3LECA 2G72A 5DXAA 5DSXA 2NP6A 3T0IA 2Z6UA 1JG4A 3KQWA 2ZBRA 3KQOA 5CVDA 3TR6A 3EMDA 4F85A 3EMBA 4OQDA 3TM5A 1NE2A 3G2MA 2C7QA 1ZG3A 3TPZA 3R3HA 1ZKDA 2F8LA 2PVCA 1RJGA 3LPMA 1IY9A 3G5TA 5E8JA 5FA5A 3D2LA 3EVAA 4QPPA 4GEKA 5DM1A 1F3LA 3IHTA 3ME5A 2Z6AA 5FCDA 10MHA 4CKCA 4R8SA 5GINE 3E7PA 1QANA 3O31A 2VDUE 2I62A 2V74B 2GB4A 5CIYA 3DXYA 3G2PA 3UFBA 3PTAA 3HCAA 3IV6A 1YB2A 3GXOA 4BP1A 3NDIA 3AXTA 5K0GA 3GRZA 2CKDA 2PXXA 1KYZA 4O29A 5FTWA 3SMQA 3LGAA 2NXCA 5DM0A 3TKYA 1N7JA 3UJDA 5LQKA 2I9KA 1SVUA 4FT4A 3OE5A 1NV8A 3SGLA 1SQGA 3KPVA 4BLWA 2EFJA 2ZFUA 1VBFA 2Y1WA 2PXAA 5EKXA 4RTLA 3M4XA 2PWYA 3GRYA 2ERCA 3JWIA 2ZIGA 3LBFA 3NW9A 5M5BA 5E1DA 4FR0A 3AJDA 5FQOA 3NTVA 3DUWA 1PRYA 2OO3A 2LD4A 4OBXA 5EHGA 5T6BA 5K0CA 2PBFA 4DMGA 3MCTA 4MQ4A 5LQAA 4OA8A 2IBTA 3HP7A 1JQDA 2UYQA 4PWYA 2FPOA 1XDSA 3C0KA 5BW4A 2EX4A 2PX4A 2QE6A 2CWWA 2JJQA 4F84A 5DTMA 3GCZA 1KPIA 3MERA 4YV2A 3P9NA 3KQQA 4K6MA 3KHKA 5EC8A 1B42A 2IFTA 1NW5A 3DTNA 3NVMB 2IH5A 1KIAA 3LBYA 2ZSUA 4KDCA 3UWPA 3C6KA 2Y1XA 2PJDA 2C7OA 4C04A 5MHTA 5BXYA 3P9IA 2IP2A 2O57A 5E2BA 3UJAA 3ER8A 2WK1A 3P9CA 4HTFB 5E1BA 2HWKA 3VC2A 1XDUA 3KQSA 1JG3A 1I1NA 2HNKA 4GOND 5E8RA 2PX8A 5K05A 3NDJA 1XVAA 2OY0A 3FUVA 4LECA 2YXDA 3FPJA 1X1DA 3GRRA 3P71T 1YFLA 4H0NA 4E2WA 3BWCA 4YUWA 2OBFA 1EQAA 1OR8A 1XXLA 3LKZA 1NW7A 3LSTA 1VL5A 3EEYA 2AN3A 3FUWA 5FHQA 5K0BA 1BHJA 4HH4A 3R9XB 2OKCA 1F38A 2YVLA 4RV9A 1U2ZA 4MTLA 4QVGA 1QAQA 5EEHA 4P7KA 3I9FA 3CJTA 1G8AA 3DP7A 4DM3A 5EZSA 2EJUA 2PT9A 4HRAA 1R00A 2ZBQA 1QYRA 4HC4A 3VSEA 1AQJA 3O7WA 3V8VA 5KVAA 1DUSA 5HIMA 3KQMA 3G89A 3I53A 4V0QA 3OZRA 3GRUA 3B3FA 1TPYA 4YUVA 3ID6C 2AN4A 2GAFA 3M70A 4RTRA 2IH4A 1G55A 3DULA 3QOXA 3M6UA 2UZ4A 3M6VA 3F4KA 5F2OA 5DX1A 1ZHFA 5U4XA 2G1PA 1NW8A 4ISCA 2XVMA 2H1RA 3C3YA 2NXNA 4YUXA 2ZZMA 4C03A 1EJ0A 3G8AA 2ZIEA 2IH2A 4RTJA 2PXCA 1L9KA 3GDHA 3SXJA 3VC1A 4JXJA 1EG2A 3IYLW 1D2CA 3RW9A 2P41A 4OX9Y 1DL5A 3DLIA 4CKBA 4EQZA 2P3QA 3OU7A 2Z6QA 1KPGA 4F86A 4RTSA 1D2GA 1KHHA 3FUTA 5F2NA 5HIKA 1L3BA 1ZGJA 3PFGA 2OPBA 2FCAA 2R6ZA 1R18A 3GJYA 3REOA 4XCXA 3U81A 4AZWA 3HVHA 4C4AA 3S68A 5JR3A 3FPGA 1EJ6A 4GUAA 1M6EX 3LDFA 1I4WA 3DLCA 3H2BA 3O4FA 5HILA 2ONZA 1VIDA 5DRTA 4E30A 1X1BA 2K4MA 2BR4A 3KR0A 1BC5A 3KPYA 1R74A 4BY9E 4C06A 4WVLA 3LCVB 4C05A 2ZZNA 1N7IA 3MAGA 3TMAA 1JSXA 1G38A 2FYTA 4EK9A 2PGXA 3OZTA 2B2CA 1JSZA 3JWHA 4DF3A 4CTKA 2O06A 3R6TA 5DX8A 3HM2A 1G60A 1RJEA 2DULA 1Y8CA 2VP3A 3ELDA 3THSA 5DWQA 3KPWA 3FRIA 3PX3A 4P7FA 2Q41A 1VP3A 2FK7A 3FRHA 1O9GA 5E9QA 5F2KA 4CWAA 1WY7A 3UJ9A 3HEMA 4QTTB 4PGHA 4LWOA 5DT2A 4YV0A 2PWPA 3IEIA 3NWBA 5HIJA 2UYHA 3P9KA 1RJFA 3SSOA 3FTDA 1MJFA 2AOTA 3CGGA 1L1EA 5DM4A 3ELUA 4PNEA 2NP7A 3EVEA 3L8DA 1JR4A 4BLUA 4FGZA 1VPTA 1WG8A 2PSSA 4R6WA 1XDZA 4HG2A 2O0LA 2N47A 3DMGA 7MHTA 3HTXA 3NVKI 3HVKA 3DXXA 4IV0A 4V0RA 3DXZA 1NW3A 1Q0SA 3SM3A 2BH2A 4MHTA 2B78A 1JTFA 3ER9A 1UFKA 4PGGA 3LKDA 1EIZA 3GIWA 3FTEA 4PYIA 1QAOA 2AOWA 1NBHA 2A14A 3UA3A 3UJBA 3TQSA 5CVEA 2AZTA 4EVIA 2EJTA 3BZBA 5HOQA 4PINA 4EMSA 2JH9A 2P7HA 3MTEA 2ZLBA 3FZGA 4RVHA 4GBED 1RI3A 5EOVA 2YXLA 3K6RA 3LCUA 4X1OA 4GOLD 4E31A 2NNWB 2YUIA 3M33A 5KS2A 1SKMA 2BM8A 3EVFA 3CVOA 2WA1A 5E1OA 2I6GA 3K0BA 5C0OE 3KPUA 2G71A 4DA4A 3B3GA 5LQCA 2XVAA 3I5UA 4ER7A 5CD1A 3B7PA 3E8SA 4E2XA 1KPHA 2AS0A 2GPYA 3P8ZA 4RTKA 2NXJA 3PT9A 1FPQA 4E32A 9MHTA 5EZQA 3CCFA 1P1CA 4CTJA 3SVZA 3CKKA 3FTFA 3ELYA 2IDKA 2IBSA 2O07A 3AWIA 5CCBA 3M6XA 2IGTA 3TOSA 4QQNA 4LG1A 3OU2A 5GM2A 4KWCA 3UA4A 3CC8A 1FP2A 3ERCA 3AXSA 3DH0A 5GWXA 2JHAA 2VDWA 5DTQA 3SX0A 4DCGA 4EKIA 1NV9A 1O54A 2AOVA 2GLUA 3KR1A 3LHDA 5EGSA 4YUZA 2FHPA 2H00A 2AVNA 3CJRA 1DCTA 4R6XA 5E9WA 3BGVA 1R8XA 5HFJA 3BT7A 3FPEA 4R8RA 4OQEA 2P40A 1XJ5A 2NXEA 3P2IA 3C3PA 1P91A 4FS8A 4OA5A 5EEGA 4PYLA 1YZ3A 3OFKA 3AY0A 3GWZA 4X61A 1P39A 5JUWA 4EKGA 2PV0A 3EVZA 4YUYA 2OB2A 3Q87B 1SQFA 4OBWA 1AV6A 5K0JA 5K03A 1NBIA 5EMJA 4PYOA 1Q0TA 4X60A 5HEKA 2OZVA 5G02A 3B89A 3UJ8A 3GNLA 2IIPA 3PFHA 1WZNA 2BR3A 3KQVA 5CM2Z 2CMGA 3PS9A 4Y2HA 3HCFA 3LDGA 4RVFA 1QZZA 3BGDA 4MIKA 3R0QA 4Z2YA 3FPHA 3LDUA 3EVGA 3KU1A 5GIPE 1BOOA 4XUCA 1HNNA 4PCLA 4NECA 4DQ0A 4PYMA 5EG5A 3PB3A 1KXZA 2CL5A 2HMYB 2QYOA 5EKUA 5FADA 4RTPA 4ER3A 1INLA 3EVBA 1ORIA 1WS6A 3OCJA 5ICFA 5LQRA 5T67A 4DCMA 3HA5A 4GC9A 2ZTHA 3PVCA 5HZMA 5LQJA 1G8SA 3ANXA 2PX2A 5GP1A 3BWMA 2QRVB 1XCLA 2JHCA 1L3IA 2P3LA 2R3SA 3G7UA 4RYLA 4RVGA 1PJZA 3THRA 4GOMD 4POOA 3FUXA 4PONA 4M36A 5EMMA 3JWGA 5KYGA 4E33A 1RI1A 2C7RA 1JG1A 1NT2A 1RI4A 3ELWA 4WXHA 4AX8A 5GOZA 1X1CA 3TM4A 3GO4A 4M38A 5FQNA 5T64A 1MHTA 1IM8A 2HV9A 3HCCA 2ZWAA 5LQUA 2AOUA 5P8WA 4RTQA 1V39A 5DSTA 1Z3CA 3DOUA 3HCDA 1QAMA 5FWAA 1KR5A 3DR5A 3BWYA 3EGVA 3EPPA 2HTEA 3G88A 3NWEA 3NMUF 1TW3A 4AZTA 3MHTA 4HGZA 1ZGAA 2KW5A 3KR2A 4FSXA 2O05A 2P8JA 2QRVA 4BP3A 5LQNA 3QOWA 2OXTA 3OZSA 5DRYA 3LCCA 1VQ1A 2YX1A 5H02A 1T43A 4PYQA 5D1HA 2QY6A 1YFJA 3A27A 4XUDA 5EQJB 3X0DA 5DM2A 5EVJA 3GRVA 5CVUA 2GS9A 1YZHA 4HTFA 2G8NA 3OE4A 2ZIFA 4GOOD 4HSGA 3TKAA 2XYVA 4QVKA 4QDJA 3VYWA 3TFWA 4UOEA 3PLAE 3KQPA 4FT2A 5CVVA 5E2AA 2IPXA 8MHTA 5K09A 2PY6A 5BP7A 4E2ZA 5K0NA 3A7DA 3MB5A 2YTZA 3HNRA 1X19A 4PIMA 2G70A 2YXEA 3FPFA 2PKWA 3OPNA 4FZVA 5CUQA 4X41A 4A6DA 3ORHA 3OFJA 4C07A 4QTUB 5C1IA 3P2EA 3UZUA 4DKJA 2UYOA 1JTEA 4IWNA 3A7EA 4AZSA 4RTMA 4X63A 2CMHA 5FULA 2VDVE 5IKMA 2QM3A 1YF3A 1XTPA 4HGYA 1FBNA 1YUBA 2OB1A 5DLYA 2OYRA 3UJCA 2ZCJA 4KIFA 4RTNA 5CVJA 2AN5A 2ZWVA 3EGIA 1R6AA 4IKPA 2AOXA 4PCAA 2FRXA 1IXKA 2AR0A 5EIFA 3I64A 2P1DA 2DPMA 4FP9A 2V7EA 1ORHA 2ZVJA 3B3JA 2BM9A 5ERGB 3RIEA 5C9ZA 1UIRA 4FSDA 3HCBA 3LL7A 5BW5A 5DPMA 5GIOE 2P3OA 4YV1A 1BKYA 3KKZA 4GF5A 5ICCA 3T7SA 5E9JA 2PX5A 2B9EA 3BUSA 4ER0A 2NYUA 2P35A 2YQZA 5ICGA 4M7RA 1XCJA 2AOUB 3G2QA 5E1MA 3WSTA 1M0EA 3KQTA 5K8VA 4P7GA 5CCXA 1RJDA 1NKVA 3A4TA 2XYRA 4U7TB 3A26A 3V97A 3TRKA 3P97A 1FJXA 4P7JA 3B5IA 1JQEA 3G2OA 5B1SA 3EEOA 5FWDA 2ONYA 1VP9A 2I7CA 2BR5A 3FTCA 4G56A 5K0FA 2H11A 4ER5A 5LSAA 2YR0A 3MGGA 4R05A 3BKWA 2ZBPA 3CJQA 1VE3A 3DMFA 3FYCA 3HA3A 2JG3A 4RX1A 5EHIA 2JH8A 3HCEA 1FP1D 4QPNA 5FA8A 5K0LA 4B17A 2AOTB 3KQYA 4M37A 3A25A 5GM1A 2HR1A 3UBTA 1ZQ9A 4KRGA 5DXJA 4P58A 3FUUA 2P7IA 1X1AA 1KYWA 2B25A 3BGIA 5ICEA 5HIIA 1JG2A 3UJ6A 4CXMA 4QQKA 1O9HA 4KW7A 4AZVA 1HMYA 4A6EA 3EVCA 1WXXA 4YMHA 1R8YA 1SUSA 3E23A 2EG5A 1M6YA 3HVJA 2ADMA 4LWPA 4BLVA 3E05A 2UYCA 3CBGA 2AVDA 3G5LA 3QV2A 2GH1A 3I58A 4PYJA 2PLWA 3BWBA 3R24A 4E2YA 1P1BA 3PX2A 4KIGA 5EMKA 3SSNA 1TW2A 5D1NA 3T7RA 4E70A 1SG9A 2VS1A 4DZRA 3EVDA 4ZTBA 2B3TA 2C7PA 1N2XA 5EMLA 2GA9A 4ATNA 1AQIA 3HA7A 3JWJA 4XUEA 4AUKA 1EAMA 3NJRA 4YMGA 3C6MA 1VLMA 5FUBA 3MCZA 1SUIA 4GQBA 1H1DA 3SR4A 3P2KA 4CKEA 1KP9A 2XYQA 3MTIA 2BZGA 1RI5A 4PYNA 2E5WA 4U7PB 4RSRA 4Y30A 3BKXA 3G8BA 4QDKA 4MWZA 4C08A 5IH3A 3DMHA 1NW6A 1AF7A 3KR9A 3Q7EA 4IV8A 2ZW9A 4KDRA 2ESRA 4PYKA 3MQ2A 5K01A 5KQRA 5DX0A 5KQSA 2ZZKA 1RI2A 3FYDA 3HVIA 3KPJA 5K0EA 4RWZA 3RODA 3TLJA 2IDJA 3M6WA 4PIPA 3BXOA 2ZULA 3SSMA 5EPEA 5LR6A 1JQ3A 1L3CA 1I9GA 3GGDA 4GC5A 1G6Q1 5DTRA 2ORED 3GU3A 3LX6A 4KVZA 1D2HA 4RTOA 3UJ7A 2XBMA 3EGEA 2WA2A 3T7TA 5EIWA 2JHPA 4L7VA 2PT6A 4ER6A 2FK8A 3OU6A 4RVDA 1WXWA 2VZ9A 1UWVA
chains in the Genus database with same CATH superfamily
4Z9YA 4NYIR 5EUBA 2W90A 4IJVA 1B41A 1BE1A 1T36A 1KSGA 4JLPA 3OPQA 1ZR4A 4JJIA 2ZBUA 4WK6A 1ZONA 3EMDA 1ISHA 1BH2A 1EZ1A 2R8YA 3IP9A 3IPYA 4JWTA 4TTQA 2NQ2C 1QH1B 1M1UA 1MX1A 2ENWA 3IMFA 3TPZA 4N18A 3U56A 1JE0A 4A23A 5K6AC 3DZCA 2CLEB 3H9JA 1ZNZA 4J91A 1I01A 1EA7A 2G1JA 4JQYA 1V9CA 5KDLA 3MPOA 4OH7A 3T5MA 4KK4A 3D2LA 1AKUA 4TWJA 2J85A 1TT7A 5DM1A 3CMMA 3GLGE 1GG5A 1XMOB 4P93A 4D9CA 1NJ2A 3F5DA 1DRVA 1NW4A 3MTDA 1RQGA 3BCUA 3O8RA 3IP3A 3NALA 4N0PA 5JYBA 1K8ZB 1IG0A 5G1PA 2N1MA 3PTAA 1J9GA 1VHLA 1D1SA 1VL0A 3DVAB 4YFYA 2RHWA 4MUKA 4RESA 3X1JA 3VAZA 2NXCA 2HMAA 4QXAA 5G0UA 4CR8A 4Q05A 3UJDA 3OAAA 1JVSA 2PD4A 4FT4A 1RLIA 3QF4A 3GP5A 3WLPA 4QJIA 1HDZA 3TL6A 1Y1PA 4KU4A 1GEEA 4JL5A 3UG6A 1ZUD1 2J3KA 3BF8A 1BXRA 3NU1A 3EYWA 1E2EA 1LC3A 3UWKA 1C14A 3WGZA 1U7DA 2YHBA 3NTVA 4H17A 2RBEA 1E2IA 4WN9A 5K0CA 3H2YA 1IZ8A 3PQ8A 3G5UA 1CULC 1XZ8A 1VMKA 2GUGA 2Y76A 2UYQA 3R3SA 4OGWA 2RFLA 4BNMA 5JJCA 5KSOA 3O8LA 1IN4A 3V6LA 1V95A 2JI6A 4PPYA 4LS3A 2JJQA 3EXEA 4P4GA 5C8YA 8LDHA 5ESDA 3GCZA 4KP7A 2YJZA 3JZIA 3IAM1 4J49A 5EC8A 3WDKA 1XP8A 2HBQA 2ZXEA 2FMUA 3VKFA 4DIEA 4LYFA 4GPIB 5DHTA 1RWBA 4OOEA 3KQHA 1QHXA 4GHWA 2M9MA 2Q8PA 2ZSUA 5HP4A 3HYRA 1E7WA 3MLBA 3A6EA 3IXLA 1PZFA 3HXMA 1PDOA 1T2NA 1HTWA 3OOEA 5EMHA 3FOWA 4P08A 5J2TA 1R2QA 1YK1A 1EHYA 1IATA 1HDOA 1XDUA 2HWKA 4CIDA 3K0CC 1UPTA 1H65A 6REQA 1EJBA 5JATA 4DQXA 1XVAA 4GMKA 2CC2A 2Y4NA 3BJZA 3QY9A 5D01A 5C3UA 4E7PA 4E13A 1OTXA 4YUWA 4GDFA 3C87A 3VU9B 2C42A 1NW7A 3TRJA 1NULA 1YR2A 1CJTC 2H06A 1NMEA 3EEYA 3VJRA 3FUWA 3K6SB 2R4QA 5GOTA 5HG0A 1BWQA 1GIAA 1K4KA 2WNSA 2I71A 5FUQA 3I04A 5ICMA 4TXMA 3PHGA 1RLMA 4N3NA 4NABA 4TXLA 4RMGA 3AHGA 2DRIA 4NQRA 2ZTSA 1I7PA 1SCNE 3B6IA 3K30A 2IP4A 4KLNA 4OHUA 1USVA 4M1MA 5TVGA 3KKLA 1K08A 5KVAA 2PCJA 4G4JA 4LDPA 2R1UA 4M1QA 3L05A 4NI5A 1NPTO 1RMTA 2RAFA 1B93A 4K9QA 4LV8B 1JBEA 4N3CA 3ZTWA 3ID6C 3LTNC 3R5TA 3H6KA 4AF7A 1NVDA 3CLRC 1XLUA 4FMBB 4QBIA 2MSLA 4U7HA 1D2EA 2EAUA 4XM1A 1JA0A 2WSYB 2VR1A 1GITA 1K75A 4PXAA 4WI1A 2KS6A 1EK1A 2A9FA 5IBQA 4RS3A 3IVCA 2C57A 2B82A 2WJ6A 2W43A 4L5BA 3WTCA 2PH5A 2PKXA 4G5GA 3VC1A 2Q9BA 3TW8A 1QRUA 1YQXA 3IYLW 3C6BA 4EB6B 1I30A 1C29B 4LWZA 4QTXA 3W8RA 2FWRA 1T4GA 4H6XA 3RAGA 4KIUA 4UHBA 2WNHA 2BCJQ 4KFCA 4YPOA 1C8KA 5E0KB 3TB6A 5EHNA 5A0FA 4ZHQA 2ZVPX 1E6CA 4WNAB 1JR3E 4QOFA 1P72A 3REOA 2QB5A 4MWGA 4XCXA 1L7RA 1TYDE 1HRDA 1X74A 4BQQA 1QJCA 1LS6A 5CT9A 5L3SA 4LTMA 2ZYRA 3G2IA 2PMBA 3W8DA 3HYNA 2W2OA 2K4MA 1DQNA 3AQ4A 3O0DA 2B1QA 3O26A 1N2JA 2WFLB 5KWEA 3W6ZA 4PV7A 5KNBH 3N39C 3ZI4A 2DP4E 1BU8A 2O2EA 4PBRA 5ALKA 4LK2A 4ETWA 5HZHA 3U6BA 4R51A 1G38A 4J2TA 4CQMB 1NSYA 1UK7A 3H8JA 4DCTA 1ZJJA 3HRIA 3OZTA 1ZK2A 4CMIB 4EJMA 5D3ZA 2NU9B 1NURA 1UKEA 4C3ZA 1ZGGA 1KBZA 1SZJG 3B9BA 2QYHA 3HM2A 2C4TA 3LGSA 4RQUA 4AS3A 3SJUA 1FEZA 2FN9A 1QIDA 1A9TA 4WERA 5DHRA 5KNDH 1QZXA 1QGUA 1TM1E 2D74A 3FYSA 4LJYA 1S2GA 1VP3A 5EY5B 2ZRFA 3OJOA 1UDXA 1WABA 2NUAA 3T7DA 2QPAA 1B8OA 1Z13A 2DSTA 4Q1DA 3NWBA 5J3JA 3QPCA 1Q6ZA 5A3RA 1EGVB 2BWJA 3E81A 1GPNA 4AKGA 2WFZA 2XOKD 1VPTA 4BB0A 3TMYA 4R6WA 1Z33A 2GKOA 1Z83A 3MD0A 1E79A 2N47A 3EG5A 4KPGA 4IG9A 1N2ZA 4MVJI 2MSKA 4L28A 4XVCA 4Y1GA 2BV3A 3H05A 1AKMA 5EI5A 4ARCA 3DXXA 1EE1A 2QTNA 1UMDA 2GCNA 3PHIA 1P60A 1Z6GA 1SPBS 3CA8A 1UFKA 2H4XA 2NZ8A 3OZWA 4K9DA 1VFPA 4TKVB 4ZXFA 3TLCA 3ZJUA 4G8CA 2FGKA 1XU9A 4ZYYA 5HOQA 2NPOA 2VT3A 3DHEA 4PQGA 2KLBA 1FYVA 4Z7JA 3GDWA 3PEYA 2PX0A 3ROGA 2P69A 1M5UA 4RVHA 4EZIA 3MWEA 4KLZA 5IT9A 1FUYB 5JCPA 5HUHA 1TMKA 2JIOA 4LRWA 1V7PC 3OUUA 3UXHA 1G59A 2H63A 1X42A 3K0BA 4QYSA 5C0OE 2VHWA 2NXWA 3WL7A 2PAAA 3BD6A 3SLRA 1F9EA 1HA3A 2J6BA 3BIXA 4DA4A 3HJUA 1DWPA 1CBUA 3EFEA 3TFQA 1FJGB 3HBFA 3RKRA 1JEEA 3B36A 1QB7A 4QYIA 5JHGB 3DJFA 3FSGA 3L82B 1SOUA 3D5QA 1WB5A 2H1HA 1D03A 4UVGA 2MJLA 1VYHA 2D13A 2UAGA 2GBGA 4V0MA 1OI3A 1RXEA 1PN3A 3ND7A 2RKWA 3TH5A 3TRHA 3VR4H 3ZNNA 1EM6A 2A5GA 4A0SA 1FVXA 4QU0A 4AJ1A 4Z4IA 3NDRA 5FLYA 1XVIA 1AG9A 2I3ZA 4DLXA 1CUAA 4II3A 4DY6A 1CVRA 3VX4A 3QG5A 1BMTA 4LTDA 1U6KA 3GCGA 3EZGA 2F90A 4XYMA 3UWMA 3OVMA 3KB8A 2V6IA 2ZAOA 4OATA 3L9XA 2NXEA 1ZN9A 4L8WB 1HZZC 2XCIA 3U3KA 4DA6A 4DLKA 4AN1A 2XXAA 1JJAA 1UKCA 1BJKA 1U8AA 3D5EA 4M6WB 1Q1GA 4WZBA 3Q40A 3VTKA 2XTJA 5JARA 2JFPA 5C46F 2Y0PA 2OD2A 3OOJA 4OBWA 5EP3A 5K03A 4X6UA 3L41A 2A0YA 2M6LA 5JWHA 1Q0TA 3CNQS 4INZA 4PZYA 3TO5A 1T35A 2AN9A 2IIPA 1KK2A 1WZNA 4GE0A 1WKCA 1DEXA 1MBZA 4JDPA 3TD6A 2RI1A 3TK1A 3VRHA 3ZY3A 1GTJ1 2X8BA 2PZLA 1WUIS 3JSXA 1NFRA 1KZ1A 3QMWA 4I1UA 3W0LB 2VWHA 2BT4A 2X22A 1U8FO 1BOOA 3DZGA 3PFBA 1Z16A 4QGSA 2BF7A 2NUAB 4GAEA 1OLUA 5DB4A 3UTCA 3OA0A 1YUNA 1HT0A 4D1YA 3BREA 4QJ3A 4TMTA 3HQ4O 1ORIA 4QBTA 5ICFA 5EIEA 4Y6OA 4YCBA 1BJTA 4L3OA 5FI3A 2Q5FA 6GPBA 2GEFA 2OAQ1 1H1TA 1EVQA 1G8SA 1UWLA 2CHFA 2PYIA 3JARB 4RFVA 3ROZA 2B8JA 3IT3A 4P2BA 4HV4A 3QW2A 4I5IA 2BJWA 2HSEA 4X5OA 2IYZA 4GOMD 4LY9A 3AC0A 4MB0A 4DFDA 2C7RA 3ZHRA 1RXCA 4K3UA 4C4TA 1U0LA 1X1CA 2L42A 4LBWA 4BQFA 1UBNA 3DUFB 4EYSA 1JT9A 2YVKA 3KLMX 3RQIA 4EB3A 4R2LA 4KUEA 2PZBA 4GOKA 1T5IA 4IEFB 4CIBA 1J70A 1R10A 2R8XA 3INTA 5SZIA 5K4AA 1LCIA 3U9SA 4DR2B 1FP4B 2HLHA 2E1PA 4GLOA 3UHJA 3CYFA 4EUFA 2F3QA 4N7MA 3JQ7A 4DCSA 2UVDA 3WZ2A 3IXMA 1YFJA 3A27A 4ZOLB 2OGZA 1A8HA 4F3NA 1IIRA 2NU7B 5EVJA 1BMQA 3JQQA 4K05A 2L69A 1Z74A 2JFUA 1U0FA 4LOJA 5K8TA 4HSGA 2NTVA 1KI7A 3B2QA 1H4VB 3GMIA 3LVQE 1AGYA 2FTKE 3UJPA 2C58A 2ZR0A 5K0NA 3KYDB 1TK9A 1PBNA 4PTZA 5GONB 4ENSA 2G70A 1N5KA 4JC8A 5KQLA 3ONDA 3ROFA 3K16A 3TE7A 4DKXA 3ORHA 3IOEA 3IBSA 2JA2A 2ZSAA 3C41J 2ZYAA 2G28A 3R9IA 1M76A 3WO1A 3L5OA 4Q9IA 4ARSA 4ZPJA 3AL0C 5IAJA 1KKUA 2D5LA 2IOFA 2EJCA 3S44A 3ZXUB 2DH5A 4RTMA 1KDOA 1U8YA 4IIYA 3NRBA 4JKYA 5BR1A 2V8OA 3LQ1A 2OYRA 2X8AA 3QVWA 3TQFA 1W34A 2Z30A 1P3DA 5B3AA 4FW9A 3ESRA 3WK5A 4LX0A 5J9FA 4AKSA 5CA1A 1HR0B 3JTEA 2R1TA 3JQAD 3F6SA 3IIMA 1IXKA 2CXQA 1U4OA 2A33A 3JALA 1DKUA 1MORA 1JF8A 2ECOA 2O8VA 1T2CA 2EBUA 2C2KA 2V7EA 3I6QA 3OX3A 4XX0A 3RIEA 1XO1A 4JI8B 4O1MA 4UDYX 3DFFA 5L53A 1M1ZA 1ZMBA 4WDRA 3BHNA 1YRAA 3N0RA 4DIOA 1WOYA 4QYXA 4XGKA 4C4ZA 4PX9A 3SPXA 2HDHA 4C0QC 3NCHA 1GCIA 1SIWA 1N5MA 2NYUA 4Y2PA 1B8VA 4MS3B 3WSTA 5KNDA 1B14A 2RI6A 3T7JA 1DFHA 1I0IA 2B1RA 4GX2A 5E4JA 3SYLA 1R9NA 4U7TB 4EKYA 3LUCA 4Q93A 4UU7A 2DQYA 5JG7A 4L4RA 4Y6SA 3STXA 4CF6A 3EEOA 1PYGA 3FDJA 3AONB 2X8WA 3TUJC 2DBYA 4CYMA 4DUGD 1XZBA 5LLTA 3NIDB 3KJHA 1W88B 5DHAA 3RU7A 5EHIA 2IY9A 2OWDA 3OIDA 4G07A 2IU0A 4DE5A 5GTDA 3T1QA 3FMOB 3MIIA 5MN4A 4J43A 4JIMA 2EW8A 2AW5A 2P6RA 1N2EA 3MGAA 5AICA 1OGIA 4BBAA 1R4AA 3PCRB 4LVUA 5ALXA 4ERXA 4QQKA 2OENG 4H6WA 1DI0A 1DIHA 1ZBDA 4H1VA 2W6PA 4A5OA 2GHQA 4BLVA 4B3TB 3HO1A 4HAYA 3CLTD 3ZTTA 2X5OA 3F90A 3W3AA 4IICA 1Z88A 2H16A 2OSBA 4JBLA 4RZQA 4RIGA 5B6JA 2ZI4A 4WV3A 2I4LA 3MB8A 1CQZA 3FLAA 3J81A 5I4KA 4YHBA 4HO1X 4RS4A 1U0SY 3HCWA 5I8ZA 2Y9MB 1YZUA 1QK5A 2PJZA 4NAUA 1Y1SA 2AMJA 4HTAA 4AUKA 3KCQA 5M34A 2EFDB 1GG2A 2J3QA 2Q2NA 4XA8A 1PK7A 5FUBA 4P0QB 4UXHA 4G5YA 4JH0A 3S8EA 1RI5A 2I8LA 1T9AA 4N82A 1GFWA 4JLBA 3G1UA 4WZ6A 4C08A 3PTZA 3K6KA 4PVDA 1P0CA 4QUEA 3COWA 3LT2A 4IV8A 5EN4A 1FY2A 2ZW9A 2ESRA 1WF3A 2BFPA 3UC5A 5TS3A 1S4QA 4EENA 5FLEX 3N2YA 2VDJA 3H9BA 1VCHA 3K31A 2I2XB 4MZXA 5CNKA 3HM9A 2HQSA 1YE8A 3S2IA 4A5SA 3ODGA 3TGLA 3D3JA 2AKEA 4FWTA 4CQLA 2P65A 3FNIA 4X6XA 4GPEA 1QH8A 3KXKA 1YQWA 1UODA 5EIWA 1L7NA 2PT6A 3C16C 1XA4A 4JELA 2W9XA 6AT1A 1X7WA 1CLEA 3K96A 4JLSA 3MUNA 5JDIA 3F97A 2A9QA 4UOQA 4RVOA 1A7JA 1WMDA 2MSNA 1EFPA 1DEOA 2UZIR 2JCBA 1LI7A 1NY5A 3A9WA 4TWBA 2J9XB 3LC2O 1YB7A 2IY7A 4BX0A 5C80A 3LKVA 5DI3A 3FPBA 1MOQA 3ZY2A 5BN5B 1NZFA 2YINC 1E3EA 4J03A 4RCVA 2AJ8A 2XNJA 1PGQA 5E7JA 1F0NA 4U5XA 4BP9A 1G4HA 4LKRA 2RGUA 3LPMA 4N0QA 1PG5A 2AMYA 5FA5A 4WTOA 2UV8A 1P2DA 2AK3A 4BLSA 3DCIA 4WOPA 2B2NA 4XYLA 1I7DA 1ESNA 4QU8A 5M3BA 3KDSE 4B6GA 3AGQA 1WP4A 2VUTA 3RYFB 3CPSA 3BDAA 3HFRA 4BX8A 1RTKA 5KYNA 2AK2A 4HFRA 1NKTA 3FGNA 1H9BA 1L8QA 1VL2A 1KZ7B 2CSUA 1Z9BA 3D2BA 1OLOA 4IIXA 4U2BA 3IV6A 4ENVA 1IN7A 3KOZA 3CX6A 2G9VA 3GF4A 3HB9A 4MYCA 4WZBE 1FZQA 2HPZA 4KQ1A 2JAWA 4AJPA 1DC3A 4IXNA 4J1NA 4C14A 4BQOA 2OHIA 1UJMA 3PLNA 1RQNA 1CEQA 3E4DA 4HAIA 5EQDA 1NVVQ 2EBFX 1NV8A 2M98A 1A71A 1SQGA 3EEBA 3ZW7A 1ZIYA 2VSQA 3HWSA 1KGSA 3OLVA 3QI7A 3UMSA 3CB2A 2PWYA 4O33A 1URPA 2J46A 4A26A 4ETIA 1KK3A 2V3VA 3OM0A 5J2UB 3SC2B 5JLJA 4CLHA 2OA0A 1LVUA 2PBFA 3MINA 4DMGA 2Y66A 1LLCA 2YVUA 3HJHA 2XPCA 1T0HB 2BSXA 3UUGA 3O9VA 4CLDA 2ZPUA 2WAXA 4CKZA 5AW6A 5KOHB 1XK6A 4JB3A 5BW4A 1CUVA 2CUTA 4O5AA 5B2FA 1T6XA 3AI2A 2OBLA 3L46A 3U3DA 4TWZA 4DNPA 1W85A 1WWKA 2QR2A 3HB1A 4MGEA 4QQFA 3WRVA 4DEYA 2BFOA 3G17A 4ZJUA 1KIAA 3T5BA 3UIEA 4HAWA 3LBYA 4F7WA 4X1IA 2VJMA 3D7SA 4MROA 1ODTC 4I50F 4CM5A 3WB1A 3VKHA 1Y7TA 2YOGA 4EO9A 4LC0A 1S4MA 1U31A 1AKYA 2XDQA 3NOVA 5CM8B 3KL2A 3L4BA 3FMIA 4R40A 4RY2A 2O8NA 3TDNA 1HSZA 4WCVA 1JAHA 1FU8A 3DZJA 1Z5VA 1VLHA 2QW8A 3WLMA 3I8SA 5L8VA 4P5EA 2C9YA 2ZI3A 4ROSA 3K05A 3BWCA 2I2AA 4ALJA 4P4NA 2O2GA 1MB2A 2PRYA 3R44A 2CB9A 4HDSB 3I9V1 3DHWC 3ILYA 4OQYA 1PFGA 4A16A 4DJEC 3AX6A 2ZUTA 3VI4B 1XQ1A 3I39X 2YBEA 4R9SA 3HPRA 5ECWA 5B1IA 4X71A 5BSRA 1TZJA 1U7TA 2YJ3A 2QMQA 1PP4A 3ND6A 6CHYA 4LE1A 2PKEA 4IDGA 2YVLA 4AN0A 3MJRA 3PWZA 4B09A 1NQ5A 1UFVA 2G1AA 2VNJA 4HGRA 1A8UA 5CHEA 5EZSA 3VR4D 4WGGA 1KQGA 3FGOA 2JLSA 3LC0A 4H6VA 2ZQYA 4HC4A 2BM0A 2LWIA 1HETA 4GMXA 5KQMA 5JVDF 4HXYA 4ZHQB 4LDZA 3BD8A 4E11A 3QOXA 2HRCA 1BRTA 3CUUA 1F8FA 5F2OA 4B6EA 1KU6A 5FWXB 2QRNA 5K8CA 1XQWA 1T8YA 2ADFA 2VPXA 3CRMA 4NENB 4EHLA 4IWYA 4PXYA 2O20A 3NPMA 5BVGB 2QRJA 3K94A 3G7SA 4LHEA 4HH1A 5KTYA 4GFDA 3ZX4A 2X9VA 4QYMA 1XZGA 2O0MA 3H3FA 4DMCA 3P7MA 1YZTA 2JLQA 4QJ4A 4Z2AA 4KO4S 3W6NA 4AICA 4HAZA 3F3MA 3H16A 2JAPA 1LXCA 4MVJM 3I42A 3RSZA 4CQMA 5HW0A 4E15A 1KMMA 5M04A 3COYA 2EWVA 2PLFA 3D31A 2JATA 2NU9A 2WTXA 2Y1LA 3HL0A 4YCNA 4IINA 4OHFA 2WIDA 1CD5A 3H9QA 5TMPA 1NXOA 2GPTA 4QUIA 1ZD4A 2DSNA 4W1QA 2VPYA 4R1OA 2G82A 4G25A 2VYNA 3W2GA 2IVFA 4RA9B 2J0VA 3I8OA 4K6CA 4PPQA 1L5GB 3IERA 3VR3A 5JD4A 1U9IC 2PCLA 4Q03A 2IEBA 1C1HA 3CPHA 2WVJA 2YIJA 1TU0A 4QEDA 1XA3A 4B40A 5AIBA 5JISA 2M32A 1F8UA 3A4NA 1OC2A 3ZGNA 4DSOA 4AN4A 4R3WA 3GGGA 3VR6A 3CX3A 3D8RA 3T7AA 4IIDA 1V96A 1DRUA 2FFQA 1IAQA 4YC7A 1GA6A 3OD1A 4KMMA 4HB0A 5KOHA 1RHRA 3GGJA 2B1GA 3A37A 4HXGA 3CO0S 1SVNA 1NG1A 1S1MA 1PT7A 1R0BA 1XMIA 1V6AA 1Z6ZA 2FPKA 2OBNA 2C77A 5F2KA 1WY7A 3PGMA 1QH0A 3ZXSA 2ZXFA 4B4VA 1GZUA 1KO1A 1LPMA 4WLEA 5JSQA 4F3RA 5C7OO 3MNFA 2D06A 3P9KA 1KZHA 5GJBA 1DOAA 1Z17A 3ZDYB 3TZHA 5ETJA 2Y8EA 4TMZA 2QV7A 3IBCA 2GFHA 1RYZA 5DMHA 3AR4A 3OCYA 2QGZA 3AF4A 3L8DA 4S0XA 1J2EA 1NR1A 4TV9A 1H2HA 2VXOA 3D8TA 1IY8A 4PGFA 5EIHA 4OL0A 4B83A 3AP1A 5IUKC 4AQYB 2Z95A 4WMLA 4NBNA 4O4JB 1QQTA 3SYRA 4C20A 4Q4CA 4YDSA 1RAAA 3Q8WA 5B12A 4D9JA 2CXOA 2PPLA 4HPXB 4L2IA 5AI6A 2M6KA 3SZOA 2FRDA 4Y1RB 2CMFA 4BNUA 1I8TA 5KTKA 1K63A 2ZJBA 4L57A 3OZVA 3SLGA 2P30A 2QJFA 3CNOA 1T3ZA 3UT5A 3ZE0B 4BGEA 3U16A 2WD7B 1WAMA 1DIAA 3UJBA 1Z18A 1WUHS 4UVHA 3VR6H 2ZGVA 1QTQA 1WNTA 2NGRA 5E3JA 2P7HA 3MTEA 4N7JA 1L7AA 2ZLBA 1CG6A 2QLLA 1UPCA 1XBTA 1MA3A 4DMUB 4X1OA 1DUVG 4BBZA 1CUIA 4ONEA 2JLXA 4D43A 2RG1A 2FWMX 3ZVMA 2BFEB 1WKVA 1I7NA 3FNRA 4JNCA 5TNXA 4M0LA 1GDHA 1O97C 5A5VA 2P9CA 3TZQA 1BXRB 1DXOA 5IYZA 1KO5A 4ER7A 3QXGA 2X40A 3A1SA 1JGTA 1KPHA 1OCEA 2GPYA 3E9DA 1YS7A 4IF4A 4RTKA 1FPQA 3LXRA 9MHTA 2C7GA 1N0HA 4LYJA 3CCFA 3L8YA 3C39A 4MP3A 2W2LA 1ZL0A 4D9MA 2I6TA 5K5EA 1JIIA 3ELYA 3N59A 5FT9A 3G9QA 3KVNA 2OPHA 4E3ZA 5JWRA 4MYUA 2FFHA 4BFZA 4YXWD 2VBIA 3Q3GE 1B43A 2RSLA 1M8GA 4LRUA 1HZJA 4UM5A 4UTPA 3N3BC 4M83A 3DT8A 3KXLA 2GEDA 5HDBB 3MJVA 2PS3A 5HFJA 4KIWA 5FIUA 1YOBA 2GASA 1NTOA 1XTKA 4RXTA 1CJVC 3RS5A 2ZJ7A 2VQEB 4MPRA 1EM8A 4UNIA 3CNEA 2VLBA 3SDBA 1Z56C 3I45A 1K89A 4S1OA 1WV0A 2O6LA 2JVKA 1RIFA 2ZRLA 3DHVA 4YUYA 3TVYA 1FSFA 1AXGA 4TSKA 1PJLA 4JYPA 4BECA 3DT6A 1J39A 4V3CA 1Y5RA 5C18A 2E6KA 4NWIA 1BCRA 2P5SA 4DBZA 1J5PA 1L8XA 5U4QA 4NJOA 1KFEB 1H8HA 1U28C 3GUYA 3KQVA 4RVFA 1D6NA 2BSAA 2QUIA 2B8TA 2DQKA 2CDCA 3LCMA 3FOZA 4XD7D 3Q3HA 3R4VA 3BEOA 3CWCA 1E9SA 1NLMA 4W5RA 1EU1A 1INLA 1U7WA 1DX9A 2JFFA 4AF6A 4OQPA 1CCWA 3UYKA 3G0GA 1J24A 1M6VA 2PX2A 2AFRA 1HT3A 2CXNA 3AESA 3I01M 2ACKA 3ABZA 1L7MA 3CNHA 3RRMA 2GBLA 2OGTA 2GKGA 1GG9A 3C6YA 3EQZA 4RGVA 5DNUA 2J6IA 4OO3A 3DZBA 4TROA 5MGNA 4L2IB 2Y71A 1HY3A 1T25A 5TQ0B 1PE0A 1DWUA 1VA5A 2F67A 1GA4A 3TQHA 3UT5B 4BP8A 3ZJYA 3FOFC 2D0DA 1VLZA 4ML3A 1QP4A 4E5KA 1O1YA 3WFIA 5DGDA 5I8PA 1K6EA 1DINA 1H22A 1GFSA 3L79A 5L40A 2Q9AA 1UUFA 2ZTLA 4TRRA 2O5VA 3Q8KA 2UUCB 1YO6A 3NONA 2H9YA 2O05A 2R62A 1S8OA 2XCUA 4PX2A 2WY2D 1J8YF 3SHOA 3UUFA 4BP3A 4C6TB 5CFQA 4AY4A 1ZH4A 5JAPA 2PUGA 3K20A 3PUZA 1G6HA 2HY7A 2LIVA 3R2JA 4LJ8A 4IIEA 4UBKA 5EQJB 4N5IX 2XMGA 3FCOA 1AGNA 3UICA 2QN8A 5B36A 4YRSA 5AYVA 2BFEA 3W5VA 1YR3A 1SXGA 4R3UC 5COBA 4D9GA 5LMUB 1H2BA 4B48A 3A9RA 2FF7A 2O7VA 3TRIA 4X3CA 5BVHB 4ZYZA 5L3VA 5K8JB 1IIBA 1RKVA 2YXEA 3BMQB 5KBYA 1OFVA 5AK6A 1ZAYA 1QLWA 5C1PA 4CM9A 3RLIA 4TTJA 4C07A 3FHTA 5ALVA 3TG2A 1X7GA 4A8JB 1YRQA 5J1TB 5G4KA 2J7PD 3K9HA 1A50B 1ONBA 1PIWA 3KSUA 2EZ4A 3CNNA 4PZDA 3R5HA 4DUPA 5DLPA 3TI9A 5C1DA 4J0HA 5B58T 1XP5A 1FIUA 2H7CA 3KELA 2C2WA 2N75A 4M1KA 3BA1A 4N41A 5TMBA 4PFSA 1LD3A 1N9GB 5ALUA 4F8YA 5BPFA 4MGZR 2GEVA 1P3JA 4HP8A 4X44A 4RF3A 4EG7A 2HJGA 1FS6A 1L1QA 1MB4A 2P1DA 3PE4A 1RKUA 2CNNA 5H7XA 1PV2A 2O3SA 3LL7A 4NV1A 4DR6B 3ZLJA 3K70B 3HUUA 1G8KA 3W1WA 1PJAA 2OP0A 4UNRA 1EDZA 4YAIA 1TM2A 1X3SA 3D6TB 4GF5A 3EQ2A 4YQYA 2RE8A 3CIFA 4NXMB 2WLSA 4CW7A 3W5JA 2H7XA 4DCCA 2FOXA 2C7VA 2ZSDA 3MRXA 4DANA 4A0GA 4O3MA 3GLIE 1J56A 4DR4B 1KI6A 3A1WA 1E1RD 1OJLA 2BBWA 2YRFA 3UC9A 3A6FA 1NQUA 3HB5X 3IDFA 4O2BB 2P9HA 4EX7A 3NVAA 1RWOA 3W4IA 1QVWA 2CJWA 3FYCA 4MGHA 2VT2A 4WX2B 4YRPA 2HA3A 4A10A 4QHSA 3A32A 1QWSA 3RARA 3RRFA 2XE7A 2FSGA 5DZSA 4DNFA 2AQIA 2XVZA 1NMZA 1S8FA 3QEMA 2AC4A 4H27A 3BMOA 3GZNA 2BPOA 2EARA 2HDWA 4BV3A 1Z2NX 1RBYA 1SRRA 3DC7A 4GQAA 4W99A 1IJEA 1JQAA 1TXGA 5ICEA 2Z57A 5FTKA 5DH9A 5AVVA 4A6EA 3L40A 1L1RA 1RBMA 2C0CA 3TQTA 4KMRA 1GU1A 3HACA 1MAUA 4K46A 3IO3A 1U3TA 3GC6A 3B3AA 4MEJA 4PYJA 3AHFA 1XVUA 3CQ9A 2DE0X 4FFNA 1EP1B 4DJJA 3ESXA 1BXZA 3ESDA 5C3MA 2QTVB 1SG9A 3CBQA 2Z8ZA 3DPUA 4QFCA 5AI0A 4NYIQ 2XXAB 1Z6YA 3TJZA 4OI2A 3GJXC 4O08A 3TEFA 1N5IA 5JNWA 4BPRA 3CVUA 2ECFA 1OKKD 5IXJA 3DEZA 1DJPA 4HQFA 1W87A 2UXCB 4QL3A 2NYAA 1GQ2A 3PGLA 5IC5A 3NHWA 4OIFA 2HRZA 2Z4RA 4QGHA 3WB0A 3WHLA 1AHPA 3KETA 3I4LA 3JVIA 3AY6A 1SUIA 1H85A 1BN6A 3QE3A 3T1HB 3GDFA 1JFVA 1JUDA 1U65A 1GGMA 4K9OA 1U9YA 3KKMA 1NY6A 4MYHA 5ICSA 5IH3A 3DMHA 5TQ2B 3GR6A 3T7CA 1ACMA 2O7SA 4WECA 3S7ZA 5HKAA 3MQ2A 3S8MA 2EL9A 1V3VA 2YWRA 3VYVA 3B82A 1M6HA 1YS4A 4ZAZA 4RWZA 4Q9NA 4HB2A 2IDJA 4PR3A 1NVFA 1N78A 3A1EA 3WDSA 2VIIA 1XK7A 5EPEA 4WINA 3IDSA 2O8BA 1R8JA 2GSDA 4KQWA 4KVZA 3BXZA 4K7JA 4MCIA 2PUAA 1MDFA 1W75A 1SC1A 2B98A 2WTAA 1R4MB 2JFXA 3EUAA 3G2HA 4F3CA 4TLBA 2PUCA 3PJGA 4IXDA 3AEXA 4RF4A 1GKLA 5HCUA 1U3UA 4FOTA 4ZCRA 3LECA 4B45A 1EVKA 1NMXA 1MU0A 1PQWA 3H5AA 2PMWB 4IZ6A 4TS9A 3S29A 3GY0A 5CVDA 5E7QA 2IV3A 5H4HA 1R0KA 1P5HA 3EOZA 4RXMA 1CUWA 4B75A 2G88A 4AULA 4RL4A 3PDUA 5FV7A 2VYCA 1ORDA 3BQMB 5FUVA 4BWYA 1T0BA 2J33A 5C1OA 1DPGA 4ZV7A 4DLYA 4ESHA 4AXBA 2AN1A 1CDOA 8GPBA 5FCDA 2OV3A 1OUMA 4NFHA 3QVVA 2C04A 5EAIA 1NQVA 2EJWA 1VLLA 1Y7HA 3IE1A 1CEXA 1EDEA 4K03A 4ZGGA 1NNEA 3B6MA 3U7QA 1CY4A 1SG0A 3C85A 3KUXA 2XZLA 1PV4A 1FMTA 5F73A 3ETGA 4PPNA 1TMYA 3MMZA 5KWVA 1Z4QA 3EY9A 4UMDA 1YB2A 2V96A 2XMDA 3GRZA 2PO7A 3FYHA 3IRUA 2NU7A 3LPNA 4QOSA 1TEZA 2A1TR 2ZR9A 4N6GA 1OY1A 3TBKA 3FI0A 1A95A 3A31A 2H2GA 1L4YA 2VSOA 3R7LA 3DTVD 1FRZA 3Q7IA 2CUNA 1NYTA 2HO4A 2ZVQX 2OHJA 1PTJA 2VJOA 3ONEA 1V7ZA 4Y2JA 4ND4A 5JSYA 4ZZIA 2J9RA 5AJTA 4ZT5A 1E7RA 3H13A 3LOPA 1MVOA 1QJ4A 1N8SA 3G2JA 5EHGA 3O84A 2B4AA 1JQBA 2PQ0A 1DKMA 3COSA 1QSGA 3NUZA 5G0SA 5L3ZA 4B3IA 1V4NA 1UWCA 2FHSA 1L5SA 5EUCA 5JPCA 1PUXA 5A04A 2G1UA 5I9SA 1Y4DE 1A04A 4PBSA 2PG3A 2AT1A 2GPWA 1PI3A 1QKIA 3QELB 4V0OA 4DCVA 4K6MA 2E3JA 2GI4A 3T6KA 3WLSA 4F06A 3DF9A 3GJ8A 3U4CA 2X19A 1JLLB 1GARA 1GWNA 2Y0EA 3NBZC 1U3GA 3B12A 2VHVA 2WC1A 2X5KO 3ETEA 3RI3A 1DIRA 1YBFA 3DW1X 3IKJA 1UMBB 5JBQA 4BQIA 5C5DA 2EKLA 3I4FA 2AJBA 2IP2A 1FC0A 4EX6A 1KU0A 1MW8X 2VP5A 2ORVA 2WICA 4L0CA 3SFVA 3UK6A 1RYDA 3KKQA 4JI7B 4JC4A 3I73A 2PLRA 4MUIA 1RYEA 1YFLA 4Y6PA 5JS6A 1XRMA 3OJWA 4MQ5A 3AUXA 1SBTA 1L0BA 4EL5A 3IJ5A 3KZOA 3DL4A 4QPCA 3G9UA 3TSAA 1FDIA 3JZDA 1CR0A 3WLNA 4CIVA 4F72A 1Y7IA 5LPNA 3C1UA 1KY3A 1SO8A 1O0SA 5EMNA 1M66A 4BU1A 4ZHQF 2J1LA 4P8RA 3H2JA 1YXMA 1BHJA 2ZQZA 4FBGA 5DNVA 3V4PB 1RWWA 1U94A 2JC3A 5JVDB 2LUOA 2IF0A 2VQ3A 2R6GA 1Z73A 3TDKA 2DHEA 3AR5A 2RH5A 1XNJA 4B71A 5EIXA 1J2RA 2DETA 2WYWA 3WL6A 1MTZA 2PGOA 3U1TA 1KKMA 5IJ0B 2UXBB 4QGFA 3FYUA 1J42A 1GA1A 3H2IA 3KJFA 4KGXA 1WQ4A 4U63A 4D0RA 4DQVA 2IH4A 3LFHA 4YDRA 2D7DA 4MVXA 2AI2A 2QU7A 1E89A 3WRWA 3E82A 3LVBA 3RO7A 1GT91 3EWAA 1ZHFA 5F5XA 2QNIA 1SBYA 1KO7A 2HO5A 3LPDA 1K88A 3MMPA 1BU5A 1VPDA 1YI1A 4OP3A 5CDFA 3TAXA 3TL3A 1XKTA 4UM9D 4BLTA 2LCIA 4H7HA 4J1SA 4L07A 1U1GA 2ZRAA 1JZSA 1V3TA 3RUPA 6ABPA 4JXJA 4Q12A 2G9NA 4R9RA 3UF0A 4HSEA 4YCAA 2DT5A 5HE8A 4KK3A 1T2VA 3TD9A 2ZB8A 1LY1A 2IYTA 4MV5A 4OX9Y 3OU7A 1R3DA 3VO9A 4BFTA 1FXUA 3UJNA 1D2GA 4R16A 3MF4A 2GCGA 2H51A 3LUAA 2CBXA 1G5IA 1PX2A 4EW6A 1QLJA 1A9RA 5EERA 1U8EA 4C4AA 4N65A 5EWJB 1M6EX 3PLRA 2ZB4A 4JNKA 3G0HA 1B8PA 3NR2A 4XIJA 2V7BA 3I9KA 1WXIA 3DE6X 3EZLA 2VOJA 4L95C 2XUHA 2FEAA 4KWEA 5DE3A 2VTBB 1OV6A 4P3NA 3DYBA 4HVTA 3I6MA 1Q83A 2OK7A 4MWDA 4LQ4A 1JLRA 2CFCA 4YN3A 5T4EA 1SELA 1YA6A 2W7TA 4MQFB 4KFSA 1UM8A 4YREA 4E03A 1EWKA 3OIUA 3UFXB 3TTVA 2BELA 2G9ZA 2B2CA 3LC7O 1JSZA 1KWGA 4O4JA 5A5EA 1N7GA 1VJ1A 3FNFA 4RW0A 1LJLA 2IXDA 2O3QA 4MARA 3VHXB 5TY0A 3W5AA 3GVHA 2VQSA 3D7LA 1SQ5A 2ECKA 3LYLA 4MVJH 4NK4A 1WCV1 5DCWA 1KSFX 1W29A 4AK9A 4L4UA 4RYDA 3G9ZA 4KVAA 3IR7A 5DP2A 1E0KA 4F5ZA 4FW8A 4Z4FA 3LT1A 3TQQA 5SICE 4AZ3B 1LI5A 4PNEA 3Q12A 3N58A 5ES3A 5BUZA 2WKSA 3SF8B 5H81A 2EEPA 3T4PA 4D5GA 4ZC8A 5EZ5A 8ATCA 4G1BA 1T0JB 3WBFA 1HG1A 4AJLA 2AMVA 1QHHA 1PD1A 4MV0A 5JO9A 1N5RA 4B5LA 4XD7A 4E6PA 3F8WA 5JALA 4TMXA 2C99A 4LW8A 4ND7A 4Y2QA 3CSUA 1XEXB 3M9XA 4OJTA 4U2CA 3SHQA 1Q3KA 1Q0SA 2IHUA 3GGCA 3WDLA 5ED4A 1IY1A 1GUBA 4XB6B 3I3SR 3O4IA 3X1KA 3GA0A 1NBHA 4DQLA 5E0OA 1TC2A 2Z9CA 4YONB 3W2TA 3MTJA 4DUGA 1ZU5A 2XD4A 3A2NA 2ODEA 1V11A 2O1XA 3IUBA 3ONWA 3C97A 2QD4A 4Q7EA 1M7HA 3E9ZA 4P4TA 5HKOA 3IL2A 1GQRA 1SKMA 1NLZA 3DVSX 2O7NA 1Q0UA 3FLBA 1F7VA 1EUYA 3HCRA 3M9LA 4NULA 4DUZB 3KUCA 3EDCA 5FFNA 2J7KA 2HPAA 1UJ2A 4AKEA 1PNRA 3D4NA 1TT5B 5JJBA 1II8B 3B3GA 2I5PO 4JR2A 2XB8A 2E4VA 3PQ5A 2G7ZA 3PT9A 2D1TA 3GFSA 4DIMA 4DLNA 4E32A 4A92A 3O1JC 3OC0A 1DDGA 2QAJA 1HDCA 3CKKA 3R7WB 2IDKA 2O07A 2TSYB 1PJTA 3CZ5A 2PMFA 5HTKA 2HQ1A 5IT0A 3HH8A 4DCGA 3L1VA 1SD1A 1SRQA 1X80B 2VDWA 1E2HA 3H1AA 4IIJF 5EJ5A 1KRHA 3GT4A 1JNXX 3MT0A 3FUCA 4D4LA 2QXUA 1NHGA 1SAYA 4ERNA 2ZI9A 4BGVA 1M2FA 1JXMA 3SHVA 2K7FA 2ZIWB 3DHNA 5GZ6A 5LIPA 5A4MS 1SQ0A 4TT8A 3RR2A 2C1XA 3ISVA 3ND8A 4DMMA 3C3PA 1HRKA 4FINA 1QH1A 3O4RA 3ODPA 3GWZA 2W98A 1ZOSA 2RC5A 4EKGA 2PJUA 4MGYR 3E0XA 1J5XA 2D2XA 1KSJA 1PYOA 1ZJ4A 2XAAA 3PEUA 4XQCA 3VNUA 3D54D 2IHKA 1IZ0A 3DGFC 4E5UA 1V8OA 2WE7A 2W8ZA 4D6YA 2VHTA 3B89A 2RDMA 5AW5A 4J94A 2BR3A 2CMGA 2ZYVX 4AJHA 4U2DA 3WIDA 2CKMA 3ZWNA 1DRKA 3CO5A 1RC0A 1K7XB 2R84A 2RG7A 3FPHA 2CD9A 1UBMS 3EVGA 4D9HA 5C5CA 5AKJA 1NX6A 1NUSA 1T1JA 3L4BC 1E2DA 3D4LA 4IIUA 2GO7A 3HB0A 4KSYA 1KXZA 2FPPA 3DM5A 5JSZB 5LQDA 2QA5A 4FNAA 2NU6B 2R5FA 4B6QA 3KBBA 3A58B 3PSHA 4LUCA 1RRPA 2DHRA 4HDKA 2TS1A 2HK6A 3IX7A 3N2NA 3NNNA 1MXHA 3GRKA 3N2KB 4RQTA 3QKRB 1G66A 1PFKA 4E5YA 2OCKA 1PJQA 2WEKA 4BQNA 2L2QA 2I6XA 3G7UA 5CK5A 2G63A 2P9GA 5H8WA 3MJ4A 1OV4A 3OE1A 4OHXA 3FIUA 4LAFA 2RAPA 3FUXA 3PHBE 1Z4LA 2WYVA 1PFQA 4Z1MD 2P9BA 3F7OA 3NWPA 1XKQA 2WSBA 4UHDA 3VBEA 2QU8A 4M54A 3TM4A 3W8EA 2QVLA 2IYFA 2QVGA 1BHSA 4RMJA 1JJIA 3TZCA 1FU7A 1H8EA 1RAEA 3LQRA 5DHFA 3W5UA 5FWAA 1QO0D 1JEDA 3WNCA 2I1QA 3BWYA 3G88A 4I99A 1XNGA 4N9WA 4XWWA 4QVIA 2ACWA 1TEXA 2QTAA 3K5IA 3AEUA 1W0JA 3GUCA 3KLOA 3PPWA 2NV6A 4YLEA 2P8JA 2QNRA 1PR1A 3IUYA 3CZAA 3CUSA 5AWFC 3VISA 4YP9A 3ADCA 4EOGA 3E2PA 2G6TA 3QVKA 4L5YA 3NFYA 5FWYA 3N7TA 2AHOA 3NHYA 3I9V6 1G7RA 1ENYA 5BMVA 1OZFA 1R4NB 2GS9A 3E53A 3GBVA 3K2EA 4A1FA 1VJTA 3EQ6A 3LUBA 2DFNA 1W6RA 5FPTA 2R8EA 2J0UA 5ADWA 3K70C 1ZJ5A 1XDGA 3KQPA 2H1SA 1L4FA 1P1RA 1YI0A 1P9WA 1UP7A 3BJRA 3G13A 2ZDHA 2PV7A 5JAUA 3ONFA 1J9ZA 3A6JA 2JGDA 4OFZA 4RGYA 4B87A 3Q2KA 1KVSA 4C6SA 1JLMA 3FPFA 3V4FA 5EINA 2HHCA 3UWOA 2QGFA 3S1LA 3O1LA 2FW6A 2IF2A 2Y1CA 3N8KA 4KQIA 1CEEA 4Z7NB 3G2LA 2XVYA 1VB3A 1PR4A 3SVLA 1JHAA 3PC3A 2ID7A 1OA0A 2WILA 1VJ5A 4W9MC 1YIDA 3W3AH 3DNPA 4BVJA 3BFXA 4CN8A 3AVWA 1MNQA 2C1EA 1JW9B 5A4IS 1R3UA 2OCIA 2Q28A 1C30A 1FBNA 1TMOA 5ALRA 2B20A 4MR8B 4EI9A 1SCIA 4MJ3A 3S27A 2ZRIA 4RTNA 1V4BA 3U44A 1EUCA 1TYCA 2IXGA 3EDOA 4IKPA 4EG4A 3OCUA 1ZJYA 2VOEA 4KO3S 3MT7A 4Q7LA 4CR7A 2FJUA 2JGMA 3MC1A 3NHJA 3ZYCA 1L5OA 1UDBA 3Q7TA 4MYTA 2DPMA 2A1UB 4F56A 4P4UA 1Z47A 2PH1A 2C5BA 5MN6A 3DE7X 2GRJA 4KFUA 1KEKA 5JHHB 1CY6A 5DPMA 1AXRA 3RAEC 3ZD7A 1QK3A 2RKOA 5ICCA 1SA0A 4CT4B 4EMUA 1A8QA 2NOAA 2NVBA 2G5CA 2ZUSA 3BXEA 1ZXLA 3LWBA 4QO8A 3WLTA 5FTNA 3CLSD 1ETUA 1M0EA 1UJ6A 2GWRA 2H4WA 1YJ5A 1RWVA 2RC6A 2YQ5A 3R3ZA 2ZBDA 3UK1A 5DYNA 4BGDA 3EZ6A 5DBIA 1CUXA 2YHSA 4RHUA 3TLAA 3UMGA 4ANFA 4D3SA 5IN4A 4CI0B 3JVVA 3ZHUA 4MI3A 3HKCA 3OWXA 3V46A 1SZCA 2G4VA 4J1QA 4MYDA 2MOKA 1RLTA 1UPFA 3AEYA 1XPOA 1DLJA 2AG1A 4FGLA 2QTVA 3HMKA 2WAAA 1I5RA 2WFLA 4IH1A 5FLKA 3DBVO 3A28A 4WASA 2QN9A 1ADFA 1T1EA 4H3SA 2DKOA 4YXFA 3CXRA 4ZZ3A 1FCJA 3EGDA 3UBTA 2WTNA 2ANCA 2V58A 4M8SA 4JI3B 2PT5A 1RNLA 2PT7A 3MSXA 1MV8A 4QNRA 5DBGA 3V5NA 5AW1A 1A7AA 2GOYA 1RWNA 2H2DA 4KW7A 1V41E 1YL5A 2P2GA 4CEHA 1K5DA 1XNHA 1GAQA 2EG5A 3VDXA 3WL3A 3DDHA 3DPIA 2HAEA 3OC6A 3CBGA 3Q2OA 3RVSA 3H1GA 4TVSA 2MSDB 4LE0A 1OWNA 4QGAA 1Z7YA 4ZAVA 2W83A 3A06A 5DU2A 4B0PA 1E2NA 2B3TA 3L1HA 3PYXA 3EJWA 1J00A 1DJQA 2G17A 3C3CA 3N2EA 4GNRA 1MVNA 5AJVB 3H42B 4CTNA 3OX4A 4LHYA 4W7HA 3VC3A 4BZXA 5T57A 3X1YA 1GPWB 3L0PA 4JVMA 2Q2OA 2OGSA 1TCBA 1YFKA 2EYUA 4Y1EA 3ZOKA 1H1DA 2L18A 3PK0A 1DBVO 2VYND 3QLUA 2C5AA 2XUOA 2BZGA 4WADA 4EIWA 2W6ID 3GA5A 2WWXA 4LMBA 2B4RO 4D46A 2R65A 1HE2A 2P2YA 3EHEA 4HJXA 4ZTUB 3OD5A 3ANTA 3EZXA 4FZJA 1DQSA 1M0TA 4WAUA 4FGKA 2BFDA 3EA5A 3ECSA 1RI2A 3KPJA 4MRPA 1IH8A 4KR7A 3A70A 1JPUA 3LLVA 2JKZA 5KB3A 2QX7A 1Z4MA 3SSMA 1B74A 4PGMA 3L8ZA 1GZSA 621PA 5IM4F 4HX5A 4Y1FA 2C8LA 4DMRA 5J5VA 1ECJA 4RD4A 1ZW1A 2IRWA 4KV7A 4GSYA 4RF5A 1T15A 4KN6A 1I51A 4W5QA 4OAPA 2XNKA 4NBTA 3B70A 1WXWA 2SKEA 4HCJA 5FPSA 4ENUA 3HXOA 4G5FA 3VTZA 3G7NA 4K86A 2OXIA 5IJZA 3BFKA 1E2GA 5LWQA 4N49A 3FI9A 4Q3BA 5DSXA 3O3OB 4WK4B 5TPZA 5IF9A 2XZOA 2PUBA 1JG4A 1DWQA 5LCXA 2IUFA 3C2QA 2GJ8A 4OG2A 4F85A 2B7BA 4JJAA 3ITKA 1XN1A 4BNYA 1ZC3A 1NRWA 2X0RA 5THXA 1VHDA 2EV9A 2AE2A 4G01B 4O1HA 3W8NA 10MHA 4HDNA 3RUIA 4RKRA 2FPWA 1NZJA 3WYCA 1DXQA 3Q7RA 1SN7A 1WW8A 5A03A 2CNDA 2EGGA 5IUNC 2I29A 4HBZA 3K9BA 4XWYA 4B46A 2IC5A 3S40A 2GYVA 4MUGA 2XXBA 1U1DA 2FLWA 3HBMA 3JQCA 2I1VB 3AUAA 3FKSD 4P35A 4MP8A 4QU5A 4EBFA 1IXYA 3HZZA 1W52X 1U1CA 4D82A 2HN9A 1XMQB 5AKGA 2GB4A 5I7SA 5ALHA 3UFBA 1PWEA 2K87A 3UAXA 3LGXA 3P5SA 2GAIA 2I6FA 3CY6A 3MOSA 4EPYA 2X77A 3GXOA 4BBPA 3QKWA 3EH1A 3PDIB 1SY7A 2PXXA 3B2NA 4NRDA 2J7PA 4LVOA 3I9MA 4J16A 4RPKA 1OPRA 2IJGX 3NWJA 1GXSB 2XW6A 1M7GA 2QTWB 5ALPA 5DGTA 5I5GA 3U13A 5AUNB 5HGXA 1FF9A 1VKZA 4ZCLA 2G9UA 1CERA 3MFYA 2R8RA 1SUDA 1PJ3A 2A9JA 5F1YA 4CEIA 3D3QA 1GAXA 1H4SA 3GJ0A 1O89A 5EWMA 1O2DA 4RK6A 3MCTA 3A6GA 3NT2A 4UAUA 4WIAA 4GGPA 1TZCA 2AW3A 2C4WA 1ZD2P 4FILA 2QE6A 1DMSA 2GVZC 1SXJD 2WM8A 4I66A 3QUAA 4MJ7A 2CLLB 2HDOA 2C7BA 1A96A 1XU4A 2IKSA 4KCGA 2B5OA 4PZAA 1ZCZA 4MCHA 1O3YA 4PHGA 3RC1A 4LCBA 3VPFA 3IUNA 3EK2A 2PZFA 3I09A 2D6FA 3MJCA 2EXXA 1DAIA 7ADHA 1I6MA 4KPUA 4KDCA 4LHSA 5FA6A 1IOLA 3BICA 2O57A 4H0CA 1LFDB 1YACA 2J9FB 5E1BA 5SY6A 4ARVA 4ZDIA 3KQSA 1I1NA 2W2TA 3D0RA 2OSVA 1LF5A 1E79D 2ODPA 3A9CA 4EPVA 3KKOA 4B3GA 3AUTA 4X20A 2J08A 1J0XO 2KYRA 2WYHA 1E5QA 5DYYA 5FWNA 5BR4A 5LUAA 3A05A 2WJZB 4MA4A 3CVJA 3PR1A 4QT4A 1CVLA 1N0WA 1CR2A 1MO4A 2I2CA 2TRSB 4JA2A 1A5SB 4X24A 3DOJA 1SB9A 2LPMA 2WUGA 4FWIB 2AG0A 2CBZA 3ZCTA 3VVMA 3OJEA 1QX3A 1LTQA 5TF0A 4KR0A 2JLRA 4Q82A 3PFNA 1NR7A 4X8LA 1QIFA 1PT9A 1U3FA 4KBYA 4XLLA 2FETA 1Q0ZA 3HP4A 2KSQA 4TRJA 3LCRA 1GDDA 3KSZO 3I4CA 4RDIA 4F4HA 3TLGB 1YI8A 1KYYA 2HJ9A 2HNBA 3L6UA 5EJAA 4X62B 4HXFB 2XUQA 3EWIA 3OFVA 4HDNB 4QHYA 4RKYA 1DZIA 1JDBC 4NMXB 5KTRA 1EB8A 3ZVNA 3FHOA 5FOXA 4AWAA 2JCSA 3M6UA 5A6SA 1DBRA 4ZMSA 2YN4A 5U4XA 4KQHA 3OQNA 1ORRA 3CLRD 1GQOA 4ISCA 3U7GA 3C3BA 3KDPA 3HWRA 4RDCA 5CFNA 2A30A 1V5WA 4P5PA 1ZD1A 2HMWA 2J07A 2ZUDA 3A9VA 3DAFA 1Y9EA 3QE4A 4QTYA 1X0XA 5A4KA 2J0QA 2ZPAA 1QHNA 5LP6A 1RBZA 3F46A 5ALMA 5TGTA 3FZQA 2OFFA 3U5TA 4RZIA 2X6TA 1THZA 2PLAA 3JQ7B 1K86A 3Q0IA 1Z0DA 4NCJA 1O95C 3UK7A 1XD8A 2W6JA 5IKOA 1L3BA 1ZGJA 3L7MA 2GDZA 4ZP1A 4AZWA 5IABA 2F3PA 1AURA 1GL7A 3OPYI 5CA1B 2HMVA 2IYSA 3IVGA 1NKSA 3QKUA 5B3JC 4G0YA 5IX8A 1OBHA 4E30A 1VIDA 5JQGA 1HE3A 3BK7A 1GTG1 3CINA 1Q0LA 1CHNA 1N3YA 1XTVA 3BXHA 2CEAA 4R1PA 1YJ8A 3PQFA 4XTRA 2R8ZA 1FFYA 3DAYA 1G98A 2CLOB 1GY8A 1YBHA 4D4GA 3VNAA 2YMLA 3L6EA 3HE3A 2JA1A 4RHXA 4UEOA 5JJ5A 4O25A 3U7FB 3GG9A 1C7RA 1PX0A 3OY7A 2FYTA 2GZSA 1EX7A 1PR0A 3BORA 3OZCA 4YI3A 1WMBA 1BX1A 4OY3A 1HWYA 2JCYA 5BSUA 5L6MB 3ICCA 2G25A 4CNQA 3GEGA 1QFJA 1Y8CA 4RJKA 4X8OA 5LVAA 3PX3A 4LQLA 1HNWB 4IAOA 1YL7A 4AZ0B 1XD9A 4TLEA 4WEOA 5FRDA 1L5LA 1C7QA 5DT2A 5H3LA 3D3NA 1AM4D 1PD0A 3AHEA 4Y8VA 1KQPA 4KTVE 3NATA 2PQ2A 3UB4A 1NBAA 1MOPA 4ENQA 1UQUA 2QQFA 3U4GA 5IRCD 4NG5A 3EUEA 1EH5A 1Z22A 2ZAYA 4EPWA 2ZUCA 3IQHX 4EMBA 3JQPA 3O8NA 3A6DA 4D92A 4TQ9A 4QYWA 4RVSA 4DLLA 5IAOA 5HNKA 4IOLA 3GRAA 1T6NA 121PA 3GEPA 3E03A 4KAXA 3BHIA 2F43A 1F9AA 2YWHA 3C70A 3OURA 4RFSB 4AS2A 4MHTA 1U0TA 3WGKA 2BEJA 4F60A 4W6ZA 1AUOA 1G5TA 3BAZA 3IJPA 3DXFA 2NV2B 3TNDA 1JI3A 4H60A 4FZ3A 3ILVA 5JAOA 3PFIA 3N1UA 4WCFB 3V34A 3IAS1 3WAGA 2JH9A 3QI2A 5DWDA 4IYJA 4YMVA 4K0KB 2C8VA 1B1CA 2X9QA 3ETJA 3QE2A 4GBED 4WDQA 3UT0A 1P0FA 1TUBA 2JL1A 2H9AA 2NNWB 3LH5A 5JRDS 1Y3BE 1MC5A 2DLNA 3EVFA 4IXMA 5E1OA 2JIQA 4Z1MA 1N6PA 4DREA 1F3OA 2D2VA 4BE7B 3UM9A 3IUMA 5KUTA 2XBUA 3CRNA 1ZN7A 2EP5A 4Q00A 2KB0A 2XVAA 4GIBA 1JHQA 2R85A 4WBXC 4EDFA 1Q57A 2WD8A 2AS0A 4Q3AA 2PKRA 2NXJA 5LP6B 1ETHA 1PWHA 3CEJA 2O3UA 1KYTA 1X7ZA 3QKSB 3KOYA 4RLQA 3ICPA 1ORTA 1ZMTA 3M6XA 3SZUA 2RCYA 3TIIA 4GGMX 3OU2A 3TJRA 4EUKA 5KEIA 4G0MA 1UADA 3DE2X 3MWDA 5K05A 2AX4A 3MWJA 2SECE 2I3GA 2F8SA 2H00A 1HNXB 3HDJA 4US0R 2A0WA 4QZVA 3DDNA 1U2GC 1UXJA 4Z3KA 4Q19A 1AT1A 1VI6A 1VPVA 2KBFA 4DMLA 1E6UA 4KX3A 3K4QA 3M7IA 3ZWQA 1H0SA 3AKYA 3OFKA 5EE1A 1LDYA 2VDOB 1H5QA 1OJ7A 4GVXA 4J6EA 5L4SA 3IB3A 3R6WA 2VDQB 3ZDDA 1FSSA 4BNVA 1NUPA 2EERA 1NVWQ 5EMJA 5MDHA 3NV7A 4X7BA 4X60A 3UWDA 1HDEA 5SYAA 3ZYZA 2D1QA 2XNSA 3TIVA 4DMFA 1EK2A 2LE0A 5H83A 2W2KB 4Q1BA 1Y7LA 4P4SA 3NXSA 3PS9A 3WL5A 5BN3A 4HDMA 3VNBA 5LYJF 3BGDA 4XVQA 4Y6GB 1ZCJA 4ZQGA 3R0QA 2DTXA 2JLYA 3UO8B 2O8EB 1HORA 2LXNA 2QSUA 4HD8A 2XMCA 3VJLA 4NECA 3G1TA 2O3JA 2HRQA 2HMYB 4J7UA 5LBIA 1K9SA 4B74A 2WSSD 3EIWA 1VSTA 2NTEA 5EXDA 2YW2A 4ND1A 3N2GB 1TK3A 2ICAA 2OV1A 3STYA 2C03A 4CLEA 5JO0A 3EXHC 3Q11A 4NCIA 1OH8A 4EYQA 1Z8DA 3QJ5A 3ETLA 4HGNA 3UNXA 1C1DB 1UFOA 1PJSA 3NKVA 4YLGA 3LXXA 3F8SA 4MW1A 4YPFA 1GPAA 1AKWA 1P4AA 3IR6A 1VKRA 1MJGA 1U04A 3NIBA 2BGUA 2P2DA 4GYYA 3HRKA 4I55B 3SM9A 4ALIA 4BU0A 4EAQA 2IV7A 5IU6A 2FMIA 1D5CA 2PD6A 5BUSA 1HT1E 4C1BA 5A3JA 1V4VA 1ULZA 4PG6A 5KNLA 5DNAA 2POCA 1CXZA 3QFHA 4WKOA 5GV7A 1Z3CA 4YO8A 3ZPXA 2DZDA 1PJ4A 2WF5A 4Z6KA 1E1QA 5H59A 1ZVVA 3KZ1E 5IZ4A 1HKUA 3LVFO 5JC1A 4JI5B 2G83A 4RQAA 3VOTA 4Q47A 3JWPA 4H4EA 1X6VA 3NGMA 3PNPA 3NWOA 2PL3A 3R3YA 4JBYA 4M76B 3N7UA 1O58A 2JD0A 5ENDA 2J5XA 5FOWA 1B6GA 1G6KA 3C3MA 5CPBA 3GP8A 3CZRA 3DWIA 2FX2A 2ZYDA 3KXDA 4GOOD 4J7AA 2Q3BA 4QVKA 1SC9A 1XNQB 1ULHA 1WO8A 1N2CB 1Y82A 1HTTA 2VATA 3TFWA 3OWHA 4EF4A 5AUPB 4PC3A 1HOTA 2FZLA 4HVAA 5I7WA 4B3FX 4C0HA 5I9LA 1U7PA 2F17A 1NA5A 1XEAA 1Q0RA 2MYTA 4OM8A 1X19A 4H7KA 3FWHA 3GFOA 5FF9A 2YCBA 3V1UA 3PRJA 1D04A 4BNHA 3LNTA 4LX8A 3WSWA 2ZJFA 3ROTA 4BYGA 4WLNA 2BMWA 5I7AA 3M3DA 3WGHA 5BPHA 4XDYA 2OKGA 2UYOA 1JBQA 2ZBGA 2HU2A 4MUYA 3MD9A 3MMXA 5I9MA 1X8KA 1MHPA 4RIIA 5KNCD 2QM3A 5JS2A 2QWXA 2J0SA 1YUBA 4NEQA 4RJ2A 1T36B 2WAYA 1OPXA 3SF8A 2CDRA 1FVOA 4FOPA 3ITEA 4RADA 3PI7A 5GPBA 1RHKA 3RHSA 2JIBA 3MJSA 3I64A 2QUHA 3OCWA 1GTSA 1GL9B 3OBIA 1XX6A 2AJCA 3AR7A 3VV2A 4AF8A 1UIRA 4D5EA 1WUYA 5L7WA 2JF0A 2SKCA 3C4QA 5TF4A 5ARDA 3W3ZB 2VF8A 2XKKA 3I04M 2YQZA 1P7PA 3HGQA 1BWPA 1XCJA 1GD1O 4L1KA 4Q1CA 3B9PA 3B9QA 3KQTA 2YJTD 3FWNA 3DAHA 3B8EA 3U0VA 1YNSA 3WGNA 4B3JA 3A4TA 1E8NA 2AR7A 1FJXA 5K3FA 3KK0A 4B81A 3CZ4A 4EW3A 4KHPB 4G1MB 3I1FA 3I0ZA 4BO8A 2JZOA 5FWDA 1P8JA 2QN2A 3ANNA 3EIXA 3LT0A 1L5HB 4FIZA 4M99A 4G56A 3MQ4A 2P9TA 1VSQA 2GRAA 5K8UA 3O21A 3CJQA 2HGZA 2R48A 3HA3A 3BTVA 4J0FA 4YRKA 3V6MA 1XJWA 3RF6A 3C8ZA 1M2GA 4X1KB 2C97A 3QX7A 1BTOA 2EZTA 3A1UA 4BKQA 4J0KA 5BNIA 2VSFA 2Q50A 5AVZA 1CIJA 4O4HB 3O92A 1BCSB 1FRFS 3WLHA 1GZ4A 1XYYA 3FUUA 1Z5GA 3AIIA 3ICWA 1X1AA 4NJMB 3VXKA 3X1ZA 1NJ5A 3K1YA 4UM8B 1XRPA 1KO4A 3O8OA 2R1VB 4J0CA 3IB6A 2JCXA 3HJFA 2JFQA 2ZTMA 3V8NA 5CB0A 3WY9A 3H7AA 2IEYA 4ZGBA 1S96A 3I2JA 1DMRA 3E05A 1NXSA 3KALA 4RHTA 2DQZA 4BYMA 5IG2A 4A15A 5J43A 3NUGA 1DC5A 1OX6A 2ZRGA 4D0GA 1OREA 4DA9A 1GGVA 3BCHA 2IWRA 4G85A 3SIXA 4EP1A 4J2OA 1H2FA 4BN5A 5FTLA 1U8ZA 1A4IA 2CLKB 4NBRA 3IALA 3ZBQA 1MF7A 1AJEA 4ZVLA 5BNZA 1TKRA 3E9YA 4N0DA 2FXVA 2P68A 1U11A 1V71A 4HPJB 4IQ4A 5FYDA 2OAEA 3GLSA 1Z4OA 2WQ6A 2GK6A 2ID4A 1BCSA 3C6MA 5ERXA 4Q15A 2P2ZA 3D6UA 2P5YA 3VSCA 3GFBA 5EESA 2AEFA 1YB1A 4XWGA 2O48X 2QDXA 3PNSA 4G4GA 5ECDA 5KSZA 3OFSA 2JJ2D 4PS0A 1E9CA 1OT5A 2NO9A 4L8LA 1ULTA 2C54A 4D9BA 3HYCA 3Q7PA 2Q5QA 1ODLA 3B7WA 4DBVO 4D98A 1TD9A 3P2OA 5IXSA 4R3NA 1NXTA 5K0EA 3IDQA 5J58A 3P9RA 3MILA 3TLJA 5IKPA 5IVPA 3NTOA 1N5OX 1V0JA 1IQ0A 2ZULA 2DPHA 3HU3A 3QTBA 1SCDA 1U5CA 1U0OC 2OXRA 3OPYA 1F8YA 3RHFA 1Z12A 1UT8A 1TD1A 1D2HA 3TPCA 2RHDA 3T7TA 4TV8F 3D6AA 3AKDA 3PPVA 2NUTB 4OD0A 3PR2B 3MGKA 4HBGA 1ZUWA 1D8TA 2C0QA 1SBHA 3I9LA 4Q4AB 4YRDA 2V7WA 2AR9A 1O6BA 2BW0A 1M33A 1RQ2A 3KVRA 4WXMA 2NP6A 1T3SA 3FYUC 5JXIA 3H5OA 4ARZA 1H5UA 5IEBA 4BLRA 3LF2A 1Q20A 1KEEB 3G2MA 1N2OA 1ORVA 3WK4A 1LUAA 3ZLUA 4WKNA 5IDVA 4S12A 3O2NA 1O0BA 1UZAA 5KCMA 5CFOA 4PFJA 2O50A 4MB6A 4F9GA 1ZVJA 3DYIA 2QUAA 5HF8A 1TZ2A 3NAZA 1F6DA 1I10A 3EVAA 1QP8A 3RIXA 2WKRA 3WB9A 3SEQA 2BKVA 4CEIB 3PSAA 4NMLA 2PEZA 4XZ3A 1FX1A 2FMKA 2I6QA 3STVA 1PBTA 1JDJA 1G9TA 3ABRB 2BGGA 1LH0A 1NP7A 1TQ8A 2G5GX 1SOAA 1WULS 2PX3A 1DQYA 3N5CA 4O2BF 4TRMA 5K0TA 4I7EA 3CZQA 4K9NA 1XAHA 2PDAA 3JVUA 4ICIA 4OJNA 4PG7A 3EIFA 2HA5A 4K81B 2FMTA 4Q9AA 1GO2A 5AESA 4O0LA 1P9RA 2VHZA 3L06A 1KIFA 1RPZA 4F7DA 3T1OA 2O2DA 1QNFA 4OVKA 2EFJA 2R68A 2YVAA 3BD9A 4ZZ2A 4R1MA 2ZI7A 5EA2A 5BQ5A 3JWIA 2Z5GA 4JJ6A 3VZDA 2DFVA 2R6HA 4L85A 2BFBB 1BG6A 1XLTA 3O93A 3QXXA 2G06A 4LCJA 4MKRA 1TQDA 4WPGA 2QL9A 3IQZA 3ZNOA 1K06A 4DDWA 2VP2A 5BT8A 2V1UA 1WE2A 5AKIA 1UANA 4FHDA 3DEHA 3N87A 2KI5A 3L7OA 3NFRA 4OA8A 2CLCX 2CZCA 2JGKA 3HP7A 2ZK7A 1N92A 1BNCA 4EB0A 1X1EA 3PHJA 4AFNA 1NYRA 1MAWA 3JQRA 2WNIA 2Q1TA 3NHUA 2AV6A 3WIBA 5CA1F 1Z5PA 2IX3A 1KPIA 1EDBA 1HI9A 5LMCA 3CR8A 3RBVA 4ZJZA 1CW2B 1HGXA 1JFRA 2VPQA 1OIVA 4YAJA 1SG6A 3QSGA 3S99A 4YMWA 2IX9A 1LSJA 4FWBA 4MLZA 4YCDA 5CXUA 1RXYA 2Y1XA 5G1NA 3DBOB 1BQ4A 5JT1A 3IEXA 1J8FA 2XCRB 1THGA 2AZMA 2OEPA 3NIGB 2VTDA 5MHTA 1EFVA 1JXOA 1RWXA 1KK1A 3GVIA 4BFXA 1PS8A 1U81A 1UXKA 4EITA 1JB9A 5FBHA 3CT4A 3ABIA 1W73A 2WJYA 5AKZA 1RFLA 2OUKA 2XE8A 5AT1A 4OH1A 3A6LA 3AGPA 1I6KA 2NLOA 4XX0B 1V9LA 3INGA 4G8BA 1THMA 4B32A 3O4HA 1YHZA 5FYQA 1A5AB 3GFGA 2VF4X 3EGWA 3E1GA 3PFKA 2HMUA 5IXYA 4P33A 2FUCA 4U5QA 1U5AA 4OAQA 4UUBA 5F78A 2O14A 2OHXA 1LK0A 1W2HA 1RHUA 3E5NA 2EHJA 1FDVA 3L7DA 2Y93A 3N8NA 4P7KA 5CB4B 1Z7WA 1RQ7A 5AVKA 4QOJA 2F59A 3NEAA 3RV4A 1X1TA 4M22A 1AQJA 4PQFA 1ZUNA 3KT3A 2FW0A 3E2MA 5DGXA 2AF4C 4L5CA 4KPUB 4MVJE 4TZTA 5JDCC 2QAGC 4OXXA 4HUTA 4BNJA 4ADSG 4IG4A 5H4GA 2GAFA 3FLEA 3CONA 3S2ZA 2IEDA 1MFZA 5T8KC 4I1RA 5EQFA 4MKGA 1FMLA 3DOEA 3L7BA 1CZHA 2R7LA 3F4KA 3FAKA 2JFNA 3CFYA 1RLUA 4B7UA 3HFSA 1RD4A 1Y98A 3DZDA 1O8CA 2VPPA 1SHLA 5CT6A 3SZ3A 5CEEA 4DB2A 1BN7A 2WDPA 3OZEA 3NHAA 3BC1A 3HMQA 4WLUA 3GDHA 3HI6A 4V1CB 2W6JD 1YR1A 4MV3A 2HU5A 3GEEA 3IP5A 1IXSB 1QS0B 1U0HC 2AUMA 2P41A 3BWVA 1Z0IA 3JQ9C 4B43A 5G3YA 4BCCA 4CKBA 2EWMA 2CLIB 1MIHA 1XEFA 4M8NE 1T9KA 2IOFK 4MKIA 3MWEB 5CR9A 1Q84A 3VFDA 4DDVA 3H65A 4OK6A 4OREX 3RS3A 2RIPA 2G7MC 4K9PA 4Q3NA 3UYLA 5CFMA 4YJFA 3GB9A 3R77A 4BB6A 2H2HA 5IAGA 4MV9A 1U1EA 3SR3A 2GJAA 2CB0A 1JEYB 3FPGA 1V47A 1EJ6A 1XTTA 1Z8NA 4H9GA 4D2IA 4DG9A 5HQ3A 1RQXA 3RE1A 3STTA 3H2BA 3AOGA 3U40A 5C8ZA 1US8B 3A0RB 5LBUA 3G3EA 4NZPA 2RONA 2Y2UA 3JXEA 3KYJB 3CKLA 1Z6XA 3CM0A 3WGGA 2IYQA 1R74A 2D8MA 4JMLA 4D8TA 2HZBA 1XVVA 4B84A 1RJ9B 4G67A 4C05A 1SMKA 1TTQB 1CY2A 4HAUA 4Q1VA 1Z8HA 2ZOSA 5ESXA 1WDTA 5JSHA 4YJ2A 1HTBA 5J4YA 5BO5A 1NFQA 4OP1A 4XRRA 2CV2A 1XN4A 3R0IA 4DF3A 2Q5CA