4PCLA

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sam and a manganese ion.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
b'LSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
molecule tags Transferase
source organism Anaplasma phagocytophilum str. hge1
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
total genus 79
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pclA00
5LQJA 1JSXA 4X1OA 3FUVA 3EGVA 3M4XA 1QAOA 1XXLA 5H02A 5LQNA 5EC8A 4R6WA 3VSEA 3KU1A 2YXEA 3DP7A 4ER0A 3HA7A 1L1EA 2VDUE 2VZ9A 4RTKA 2I9KA 1VL5A 5LQCA 5FQNA 5D1HA 4C08A 5EVJA 2B2CA 2GH1A 2PXXA 3LGAA 2P1DA 2PT6A 1XJ5A 1XVAA 2OYRA 3KQYA 3TFWA 5KQSA 4DKJA 3JWJA 1RI1A 5DXAA 4EK9A 5BXYA 3EVFA 4H0NA 4Y30A 3TMAA 3UJ6A 3UA3A 5LR6A 3A7DA 3HCFA 3GRRA 1X1AA 3ANXA 4C03A 3R9XB 2PLWA 3B5IA 2NXJA 2YXDA 3B3FA 2JHCA 1L9KA 3EGEA 4WVLA 3PX3A 3DLCA 4GEKA 3EEOA 3CKKA 2VP3A 1X1CA 4FZVA 4QDKA 4X63A 1RJDA 5G02A 4BLUA 2C7RA 3F4KA 2EJTA 1SUSA 4ISCA 4HH4A 1YFJA 3DLIA 2ZCJA 3PS9A 2ESRA 4ZTBA 4C4AA 2FK7A 1B42A 2PKWA 3VC1A 3HVHA 5HIIA 1P1BA 2PJDA 5E1DA 4GOND 2UYHA 4YV1A 2IBSA 5EPEA 1DCTA 2PY6A 5K0BA 1L3BA 3P2IA 3TKAA 2FYTA 1NE2A 2V7EA 2FCAA 2B78A 1R00A 2P35A 4QQKA 3D2LA 2QRVA 2IGTA 3R0QA 2P8JA 3PB3A 2H1RA 1ZKDA 1XCJA 3DUWA 2NP6A 4BP1A 4OQDA 5E9JA 3OU6A 1SVUA 1PJZA 2ZBRA 4KDRA 2HNKA 1G8AA 2P7IA 3CJQA 3E7PA 3I9FA 3LX6A 2IFTA 4XUDA 2Y1WA 5FCDA 2PBFA 2NYUA 3UBTA 5EIWA 1SG9A 4FSDA 2HTEA 3G8BA 2AOWA 5BP7A 2OO3A 4CKCA 3IYLW 4WXHA 4KDCA 3T7SA 4EQZA 3BXOA 2ZIFA 1MJFA 3AWIA 3ELDA 5EEHA 3CBGA 1Z3CA 2VDWA 4PONA 5FHRA 5GM2A 3PFGA 4RTOA 1IM8A 1D2HA 1YB2A 2IDJA 5CCXA 3EEYA 3BZBA 3UJAA 3LHDA 1JG1A 4PIMA 4RTJA 1Y8CA 4OBXA 1RJFA 4K6MA 5DLYA 4FS8A 3IEIA 1ZGJA 3OZTA 5K05A 4ER6A 5E9WA 3TRKA 2PX8A 4E32A 2PT9A 2AS0A 2AR0A 1AQIA 1L3IA 1VP3A 2ORED 2IP2A 3G2PA 2O05A 2BR4A 3M6XA 4LG1A 4X41A 2GAFA 4KIGA 5FHQA 4E70A 3ME5A 2PXCA 4EKGA 2IH5A 3T7RA 2ZVJA 1T43A 2PSSA 1JG2A 3A26A 5KYGA 3V97A 3X0DA 4MHTA 3G88A 5E8RA 5HEKA 4OBWA 4QDJA 2NXNA 1VIDA 5K09A 1EAMA 2LD4A 2ERCA 2NXEA 2PV0A 5BW4A 5F2NA 4ER5A 3P9CA 2YQZA 4PYLA 1NW8A 5FQOA 1QAQA 1NW6A 5CVUA 3EMBA 3MB5A 3GO4A 3FPHA 3SXJA 3FUTA 4RYLA 1F3LA 1R8YA 1KYWA 2P3LA 4KWCA 5HILA 5K0EA 4X61A 5DRYA 3TKYA 1G6Q1 2ZULA 5EHGA 1RJGA 1ZGAA 3CCFA 3LCUA 3JWHA 3GCZA 4MTLA 2F8LA 4FGZA 2GPYA 2BM9A 3KPJA 3M6UA 4GUAA 4PWYA 2I7CA 3LDFA 2QE6A 1KHHA 4C04A 2OPBA 2FPOA 5GIPE 3I64A 5CD1A 3SGLA 5FA5A 1WG8A 4C05A 4DZRA 1ZG3A 2G8NA 5DWQA 3PT9A 2C7QA 3CGGA 3JWGA 1JQEA 4QVGA 4E2WA 4PCAA 4HTFA 4FR0A 1WXXA 1KP9A 3DMFA 3KPYA 4R6XA 3NVMB 2IH4A 1N7IA 3HP7A 4G56A 1KPIA 2OBFA 3OU7A 3A4TA 1RI4A 3OE4A 5DXJA 2C7PA 5FWAA 2HV9A 4U7PB 5CCBA 2YR0A 3BGDA 1SKMA 2Y1XA 1PRYA 4DM3A 2EFJA 2WA2A 3NVKI 2JHPA 3KR1A 1DUSA 3EVBA 3EVZA 9MHTA 2I62A 2G1PA 4RV9A 5FADA 2OXTA 3SSMA 2ZIEA 3AY0A 5HIMA 5K0JA 4RTNA 1XDUA 5EGSA 4P7FA 2PWYA 3ID6C 5ERGB 1EQAA 5DRTA 2WK1A 3MTIA 3K6RA 4R05A 10MHA 4C06A 4DCMA 2ZWVA 1SQGA 4E2ZA 5DM2A 1G55A 1YUBA 4BLVA 3EVDA 2KW5A 5LQAA 2YUIA 1P1CA 3DXYA 3FYCA 4RTQA 1O9HA 5ICEA 2NNWB 1QZZA 4HG2A 2WA1A 3DOUA 3LPMA 4IKPA 2AOTA 1DL5A 1QAMA 3HVKA 1O54A 5E2BA 2YXLA 2Q41A 2AN5A 1JTFA 3I53A 3QOXA 3GJYA 2OKCA 3LBFA 4HTFB 3NJRA 3GRYA 3SVZA 3BWMA 3KQQA 5CVJA 3HVIA 1JR4A 2H11A 4GC5A 3MQ2A 5FWDA 5T67A 3UFBA 2BZGA 1JQDA 3LDGA 2ZZKA 3KHKA 1AQJA 2A14A 3O31A 3T7TA 5HOQA 4QTTB 3K0BA 4UOEA 4AZVA 5EIFA 5EMLA 2GB4A 5DM0A 3P2EA 4V0QA 4ATNA 4EVIA 2PX5A 1AF7A 1KPGA 5DTQA 3TM5A 3PX2A 3G2MA 1V39A 3NMUF 3GIWA 2B25A 4PYMA 1VP9A 3UJDA 4KIFA 1Q0SA 1OR8A 3NW9A 3KR2A 2XYRA 1EG2A 5K0CA 1M6YA 3QV2A 3PLAE 2QY6A 3HEMA 4QVKA 2ZBPA 3PFHA 5CVDA 4GOLD 3FPGA 5K0GA 1WY7A 3G2OA 1R74A 3BGVA 5CVVA 5GM1A 1NW5A 2AN3A 2G72A 3MHTA 2BR3A 3EVEA 5EMMA 4GBED 3DXXA 1U2ZA 4DCGA 4HSGA 4Z2YA 5DPMA 3KKZA 2PX4A 1FBNA 2GS9A 3GNLA 5GINE 1BOOA 5MHTA 1FP1D 3SSNA 3EVAA 5EG5A 3THSA 1X1DA 5K01A 1MHTA 5LQKA 4DQ0A 3HA3A 5K0FA 3GWZA 5E1MA 5CIYA 3EVCA 5CUQA 3RIEA 4FP9A 1VQ1A 7MHTA 3TQSA 1UIRA 2O07A 4FT2A 1FJXA 3P9IA 4F85A 3C6KA 1NT2A 2FK8A 4E2XA 3NWBA 3DR5A 1ZHFA 1YF3A 4PCLA 4ER7A 3KPWA 1L3CA 2CL5A 4CKEA 3BKXA 3G2QA 5EOVA 3UJ9A 2ZW9A 5DTRA 4YUYA 2ZZNA 2IPXA 5K8VA 3P71T 4BY9E 3U81A 3KQVA 4KVZA 4RVDA 4YMGA 1Q0TA 3OE5A 3FRIA 2V74B 3KQPA 3M6VA 4PGGA 5C9ZA 3M6WA 3C6MA 3M33A 5FA8A 3T0IA 5EZQA 1R18A 3LDUA 4YUWA 1D2GA 3EMDA 1N7JA 4XUCA 5T64A 2XBMA 4OQEA 3FTCA 4CXMA 4NECA 4OA8A 4E31A 3MCZA 4AUKA 1NV8A 1BKYA 4IV0A 1R6AA 4HC4A 1UFKA 1UWVA 4QTUB 4E33A 4JXJA 4HGZA 2GLUA 1P91A 1QANA 3P8ZA 1TPYA 4AX8A 4F86A 3CC8A 2I6GA 2YX1A 1BC5A 1NW3A 2CMHA 2FRXA 3G5LA 1SUIA 3MAGA 4BP3A 5DX8A 4PINA 5EHIA 4RVGA 2G70A 1I1NA 3BWYA 1WXWA 5U4XA 4P7KA 2PXAA 5HFJA 2DULA 1H1DA 5LQRA 3UJ7A 3G89A 3SSOA 3MTEA 3WSTA 3GRUA 3OPNA 3BT7A 3OCJA 4RSRA 5KQRA 1AV6A 4YV2A 1KR5A 3E8SA 4DA4A 3NTVA 2XVAA 2QRVB 5JUWA 3I5UA 3DULA 4PNEA 3AJDA 1NBIA 1JQ3A 1JSZA 1VLMA 2B3TA 1EJ0A 1X19A 2N47A 2OB2A 3H2BA 1G60A 3B3JA 3FPJA 4OA5A 4AZSA 2E5WA 5IKMA 2PVCA 3E23A 3OZSA 4AZTA 3S68A 3TM4A 4PYKA 4M36A 3FZGA 3O7WA 5DT2A 3A7EA 4GOMD 4RWZA 1INLA 2EJUA 2R6ZA 3ELUA 2BH2A 3SR4A 3LL7A 1M6EX 1I4WA 3FUWA 3ER8A 1NW7A 1WZNA 2ZTHA 2FHPA 2HWKA 2XYQA 3GRVA 3IHTA 2AN4A 3KQTA 4POOA 4HGYA 3HA5A 4O29A 5LSAA 1SQFA 1KYZA 3ELYA 5DX1A 5B1SA 4F84A 4L7VA 3LSTA 5E9QA 4E2YA 5M5BA 4XUEA 1BHJA 3O4FA 4PYIA 4RTLA 3G5TA 3KQMA 4P7JA 3NDIA 1I9GA 2GA9A 2CKDA 3HCDA 2G71A 1NBHA 3AXSA 3KR9A 2IIPA 4P58A 3IV6A 3VYWA 2B9EA 5FULA 5K0NA 3FUUA 5EZSA 2UYOA 3SM3A 1F38A 5ICFA 3CJRA 3NWEA 4RTRA 5JR3A 2PGXA 1RI2A 3TLJA 2P40A 1KPHA 3LBYA 3ORHA 4PYQA 4CWAA 5D1NA 3R6TA 2UYCA 3ELWA 4BLWA 2AOTB 2IDKA 3LKDA 3C3PA 5IH3A 3UA4A 5ICCA 3P9NA 3OFJA 5T6BA 3KQOA 5EKXA 2ZBQA 4LWOA 2VS1A 5KVAA 5GP1A 1JTEA 2ADMA 1TW3A 4RTSA 2C7OA 1XDSA 3TOSA 3REOA 1X1BA 5E1BA 3BGIA 1IXKA 4IWNA 5ICGA 3V8VA 2O0LA 5C0OE 4RTPA 3B3GA 3E05A 4EKIA 3UZUA 4ER3A 2VDVE 4GF5A 2UZ4A 3A27A 3KQSA 2P41A 4GC9A 5F2OA 2R3SA 3BKWA 3FUXA 3HM2A 2HMYB 2PWPA 5HIJA 4DF3A 2OB1A 3ER9A 3MERA 3OU2A 3HVJA 1KXZA 3FPFA 4M37A 2ONYA 1ORIA 1XTPA 3KPUA 1XCLA 3Q7EA 5KS2A 2AOUB 3FYDA 1N2XA 3DXZA 2K4MA 4PYOA 4U7TB 5F2KA 3UJBA 1YZ3A 3A25A 1RJEA 3HCEA 2CMGA 3KQWA 3QOWA 4QPPA 4YUZA 5HZMA 2EX4A 4C07A 3M70A 1XDZA 2H00A 3C3YA 3FPEA 3G7UA 3LECA 3LCCA 3OFKA 2Z6QA 3NDJA 5DSXA 4GOOD 4LWPA 1G8SA 1TW2A 3R3HA 4RVFA 5E1OA 2DPMA 1P39A 2XVMA 4MWZA 3HTXA 2HR1A 3FTEA 3BWBA 3HCBA 5DSTA 4KW7A 2NXCA 2ZSUA 3B89A 3Q87B 8MHTA 2OZVA 3FTFA 2ZZMA 4V0RA 4MIKA 4A6DA 4YMHA 2AOXA 2AVDA 2UYQA 5EMJA 5P8WA 3GU3A 5GWXA 4M7RA 3JWIA 5CM2Z 5CVEA 5GOZA 5GIOE 2BR5A 2QYOA 3KR0A 2EG5A 3PVCA 4R8SA 3SMQA 4CTJA 3GGDA 2IBTA 5K03A 4R8RA 1R8XA 2JHAA 3EPPA 4E30A 2ZLBA 3UJCA 3BUSA 5FTWA 4EMSA 4P7GA 4Y2HA 1G38A 2AOVA 3C0KA 3SX0A 4PYNA 2IH2A 3L8DA 3VC2A 1QYRA 1VPTA 2AVNA 3BWCA 2JJQA 2YVLA 4PIPA 1KIAA 4QPNA 5BW5A 4DMGA 1M0EA 2AOUA 4GQBA 3EVGA 1VE3A 3AXTA 3MCTA 4M38A 5DTMA 2O06A 1NKVA 1RI3A 3DMHA 3G8AA 2Z6UA 3UWPA 2ONZA 4YUXA 3KPVA 4XCXA 3TPZA 5K0LA 1RI5A 4QQNA 1IY9A 2BM8A 4PYJA 4AZWA 3FRHA 4IV8A 4OX9Y 3GRZA 2YTZA 4FSXA 3HCAA 2NP7A 1VBFA 4FT4A 5EEGA 4YUVA 3RODA 1YZHA 5EQJB 5LQUA 2ZIGA 5E2AA 3GXOA 5EMKA 3B7PA 1ORHA 5DM4A 4YV0A 3CJTA 3I58A 4HRAA 5HIKA 2AZTA 2XYVA 4A6EA 1YFLA 1D2CA 3R24A 3MGGA 5FUBA 2JH8A 1NV9A 3P97A 5EKUA 5DM1A 5C1IA 1O9GA 3P2KA 4RTMA 3OZRA 2P3QA 3FTDA 3UJ8A 3THRA 3GDHA 3LKZA 1JG3A 4KRGA 5E8JA 1ZQ9A 2ZFUA 2O57A 3RW9A 4CKBA 3DMGA 3EGIA 2P7HA 1HNNA 4PGHA 4RX1A 1WS6A 2OY0A 4MQ4A 4X60A 5DX0A 3DH0A 4LECA 4RVHA 4B17A 1HMYA 3ERCA 2CWWA 2PX2A 1JG4A 1FPQA 3HCCA 2P3OA 4CTKA 3PTAA 2JH9A 1EIZA 3P9KA 2JG3A 2QM3A 2ZWAA 3CVOA 1EJ6A 3DTNA 1FP2A 3TR6A 2Z6AA 3LCVB 3HNRA
chains in the Genus database with same CATH superfamily
2FRDC 2AI3A 1A8HA 3Q1KA 1NDUA 2RJNA 1Z8HA 2CHEA 1LSJA 1CJVC 1K27A 4BQPA 4FINA 5EC8A 2F1KA 3NV9A 1GPNA 5KHOC 4E4TA 2ZJ3A 4O0LA 4GO1A 3B7GA 1UMCA 2WHXA 2J6CA 2WIJA 4JGIA 2FFRA 3DM9B 3WL4A 2RHHA 1XJ0A 4M1SA 2GCEA 4RNCA 1N2CE 2BLNA 5LU8A 5IT4A 3L1UA 3KQYA 1XMIA 3IAFA 4TMVA 2OV1A 4WA7A 3TFWA 4TYYA 4ZOEA 1NP6A 4Y30A 2FRVA 4IHKA 3KJIA 1HDYA 4PNPA 1DKLA 5L45A 1S5PA 4G25A 5AHXA 2XYGA 1IEXA 1TO6A 2JJMA 3ETDA 2P78A 4G85A 4IDFA 1X1AA 1SA0A 4RD3A 3DKVA 2A5JA 2CL7X 3HABA 2H5IA 1W0KA 2AMYA 3HLTA 4TKVB 3RF6A 5IAEA 4BNZA 4KQFA 1KSHA 2NO7A 3F7OA 4KI0A 4EB3A 2FUCA 1Y42X 2OWDA 2TS1A 3EDYA 5JANA 1CU1A 3O7MA 5EMHA 1C9JA 4K9LA 4KOEC 1JX6A 3QGMA 1B42A 2PKWA 4KQHA 1ZWKA 1Y7LA 1D0SA 2G63A 2KHZA 1X7WA 2REXB 4MICA 3GUCA 3TRDA 2IEZA 2FYTA 4Q9NA 3RUAA 4YRMA 3OHSX 4J16C 1SZPA 1RC0A 2D2XA 4HZGA 4UMVA 4NV0A 5CAEA 1QYWA 2OBXA 1IXRC 4N5HX 4PZ0A 5K3BA 1D2MA 2PZKA 3I9FA 4XUDA 1E92A 2YWGA 4NZOA 3TEJA 4C4YA 1YDEA 2W11A 3KVYA 3FNIA 5JSKA 1Y7HA 2HTEA 2CMKA 3WRYC 3GJ4A 4IUDS 2AOWA 3AY7A 4LY9A 1ZMXA 3T7SA 2VYVA 4Y6PA 1R88A 2BCJQ 1R27A 2DUJA 1IM8A 1CE8A 3KT0A 2JVJA 4M54A 2C9DA 3H0CA 4ZTUB 2WVHA 1QFZA 1WB4A 3WB9A 1SXJA 4D9HA 2N9UA 1E1LA 4OBXA 4YP6A 4EG4A 2PRZA 1ZGJA 2BFFB 2GZMA 2I4TA 3IDZA 3LPNA 3P5SA 1N6OA 4KFUA 3KB8A 1UFOA 4ZDWA 4A73A 2J1LA 5TMDA 3VU3A 1BDIA 4E32A 4QYIB 2PH3A 3PR1A 5TQJA 4BO1A 4RULA 5IBPA 3HUDA 2I80A 5K0FA 4E70A 2FJ0A 2JLZA 4A5OA 5BWNA 4DILA 2PSSA 4DLVA 4K6FA 3KTFA 5F35A 3U4IA 1RRCA 2DT8A 2GRAA 2QDXA 5LP6C 1Q92A 3W5AA 2VDWB 3TZLA 3VR4D 4DC0A 5MGBA 5INTA 3AM3A 4GMDA 2D7CA 2C8JA 1EX7A 1U1DA 5I9TA 2X5KO 5BOSB 1GZDA 4CLRB 2JGNA 3R5JA 1CB7A 3RRMA 1DKRA 2B5OA 5ESWA 1YXMA 2P3LA 3K0KA 1NUUA 4RCVA 1QPBA 5DHAA 3TL2A 4TLLB 2JLUA 1UBGA 1K5DA 5G41A 1TVCA 2PL9A 3TKYA 1J5EB 2CXUA 3EH1A 4MUGA 4A9AA 1UQTA 1DO8A 1EP2B 5AVVA 5K6RA 4RLQA 3KPJA 4WLUA 1TEXA 3K7EA 2QEQA 3H65A 3I92A 4G0NA 3INNA 1GPLA 5A04A 5IXSA 4CEHB 2UAGA 2FF5A 2WLSA 2FDCA 1JQ5A 4U02A 3CGGA 5GZ3A 2PL3A 5IN5A 1JPUA 1LQ2A 1QRDA 2QGNA 3C7DB 3CF4A 2JD1A 3P5BA 3VJRA 3KZKA 3MQ4A 3OJ0A 3N28A 5AVQA 1J06A 1E2UA 1XZEA 3GEEA 3GLHB 3OJXA 3H8JA 3ILSA 5JC1A 4DV3B 4ZPXA 1DAHA 3PF9A 2FUEA 4GG1A 3SYTA 1HLPA 2P69A 4RK1A 4D57A 2XXJA 4C89A 2FMTA 2HV9A 3O84A 3W0LB 5IXYA 4LTDA 1E1QD 2JDIA 4DM3A 3H16A 4EY5A 3L0SA 4G5GA 4IQFA 2X23A 3KVNA 4KUHA 4NI5A 3H9CA 1NATA 4YAFA 3NOVA 1J21A 2D5AA 5EFOA 4YONB 1FRVA 1M33A 1N1EA 5ALPA 5K0JA 1DSSG 1GNRA 1QRUA 4KGDA 4NF2A 3PDWA 3K4HA 4UREA 2XITA 4KUGA 2PR7A 4J7CA 4L0QA 4XASA 4Y3UA 2XZTA 4LOKA 3B20A 3TW4A 4C06A 5LOVA 3JQBC 3L7BA 1UPBA 1PWXA 3KHUA 4EG5A 1CZNA 1QNLA 2WC1A 4P53A 1FE8A 1T25A 2FWAA 2ZG6A 3OT1A 3WKDA 4IJ5A 3NC1C 3QWHA 3HVKA 4MVJE 4TV9B 1CDDA 3UXEA 3A1NA 3ZS8A 2ZYAA 5KBYA 5K99A 1WBJB 4DLXA 5E4TA 1O87A 2HO5A 3GRYA 4PLVA 4Y1RB 4RLSA 1TJYA 3NWPA 3RTEA 3NHWA 4H0CA 2SNIE 4AQ7A 1T34A 3DHNA 1QH0A 3JD3A 3U6KA 3DLHA 2ZU0C 3BSWA 3C97A 2PQ0A 3K0BA 4NBSA 3W6PA 5DNEA 2XNKA 4GLOA 1P5JA 3I76A 1RJ9A 3R2JA 2VYCA 3MWEA 4Q3NA 2AWNA 4B7ZA 4EVIA 3GP8A 4NHEA 1DLJA 4I1YA 2EFHB 5JYBA 5KWVA 3T9EA 5F3RA 4BX3A 2ZSFA 1XNQB 5KVVA 2G09A 1PIWA 3JQ8B 4N0EA 4DY4A 5KYXB 1W44A 3PKJA 4D8XA 3ZWVA 4YACA 4URVR 2WTNA 2RGYA 2QRJA 4UBNA 3I72A 2ZBPA 4YY3B 2YIMA 5ER9A 5I5GA 3NG1A 1DU4A 1L5MA 2C5HA 3OLYA 3TDMA 4UVDA 3TBKA 2HWYA 3TEFA 1EG7A 4IJKA 3TNYA 1PX0A 1SBYA 4OG2A 3E2PA 2RBEA 1X77A 1U2ZA 3AI7A 1I3MA 2Z0MA 4WOCA 5DPMA 2XSZA 1MFPA 2UUOA 4AZ3B 1W7AA 4GX0A 3SBDA 2XWPA 3LFTA 5P21A 1VIMA 1MAUA 3UUFA 2QE7A 2OCAA 1NRWA 4ZDKA 4WLOA 4AWXA 3E5RA 1I4LD 3ZGYA 3DOFA 4IDEA 1Y7TA 3WNDA 1F2UB 4L6IA 4C6SA 1SB9A 5HUQA 5JSUA 1YVEI 3E7DA 4YJDA 2BJVA 1GDHA 2FP4B 3MTGA 3WB0A 2AQHA 2F3QA 1O03A 3CSSA 1E7QA 5LLDA 3AP2A 3OY7A 4FYYA 1H0RA 1CUXA 1JF8A 1LFDB 4GMHA 3RSQA 3COSA 5JAMA 1WIWA 4FFPA 1P73A 3NHZA 2HGSA 5JD3A 2IDZA 3REQB 1PR3A 1BMQA 3FRIA 5C8XA 4PGGA 1N7HA 2GN1A 1G41A 4LTNA 1KFJB 2VAPA 2F9LA 3N7UA 1QGUB 4U0JA 3GCXA 1D2GA 1KK0A 1WX1A 3JASB 2R6R1 3UV6A 1Y0BA 2A35A 3I37X 5DVZA 3R3JA 1M2EA 4QT0A 4OB7A 5BR7A 1KOGA 1L1QA 2QQEA 1M8PA 1FCJA 1Y34E 3HACA 4HZUB 4P5PA 3T7CA 4KXLA 4CGYA 2C2WA 3W3AA 1RAIA 2DLDA 2GKSA 4OMUA 1I1HA 1LLDA 4ZYVA 1IPEA 1VL1A 1C50A 3FW1A 3OCCA 4MA5A 4MP6A 2NAFA 4QC2A 1JN0A 2VDJA 2Z58A 4CTNA 3H0KA 1OIXA 4F5ZA 4F86A 1W1WA 4OM7A 2YX1A 2IYLD 5KTTA 4OTZA 4BZQA 1MW9X 4HNHA 3BWYA 2C2YA 4LX8A 4C4ZA 4M4SA 2VF5X 4XX0A 1HSZA 2XD4A 1OAOC 4YRTA 4JBWA 2B2NA 5HRCA 4X1IA 5I7EA 3RCBA 3QPUA 1U3VA 1GL6A 5L51A 3L1KA 3MT0A 2B37A 2QRVB 3NTVA 1OYVA 2QYHA 3RYIB 3AJDA 1BE1A 3OZBA 2B3TA 3CU5A 1MDBA 2JHFA 3JPYA 4BWGA 1FUEA 3HGQA 2ETXA 3E23A 3F2VA 5TT1A 3T5DA 4CM4B 1CV2A 1PJTA 2JI4A 4AKGA 3G0CA 2QUJA 4GOMD 5ALKA 2A7QA 2A92A 2R6ZA 3P9ZA 3LI2A 3A58B 1KY2A 1W0CA 2QAGA 1NNI1 3LL7A 4QAQA 1RC8A 3WKAA 3ZV5A 1LPBB 4UAVA 4HGYA 2ZIXA 3HA5A 4YJ2B 3BJZA 4YP7A 5FOWA 3L49A 1KSGA 1BCRA 5E9QA 3TQTA 1X0VA 3KFVA 1HRKA 3D6TB 3QFCA 5C7LO 5M5BA 4I5IA 4DLWA 2EGGA 4DGSA 5IULC 5BWOA 2XEDA 2BSQA 3QVMA 3HCDA 1NJ8A 2AN1A 2VPWA 2IOFA 1F8XA 4IHJA 4L74A 4JQSA 4YRQA 5E95A 4DPKA 5GTDA 3VYWA 1UBMS 2O0MA 2ZJAA 2YZ7A 1KOFA 3D3KA 2GBCA 4F6CA 1LW6E 3CJRA 3NWEA 1E63A 4RTRA 5AD1A 1F12A 2WD7B 3QK7A 4Y6RA 3TI7A 3A6ZA 2OBLA 1JBEA 4TS3A 5AM1A 2QLTA 3T6KA 3EWSA 5IH3A 2XEXA 5KJCA 2HDHA 5LMNB 3OFJA 3GBVA 4N0DA 5JVDA 4BFTA 1UEIA 3RUFA 4CI9A 3HYNA 5KYUA 4DNOA 2VS1A 2GCOB 2R86A 3BD9A 1E6LA 3LQRA 4X3CA 3OLZA 5B2FA 3REOA 1X1BA 4S0XA 4D1YA 3DEHA 3IR6A 3H8VA 3B3GA 5DP1A 2Q3EA 3JQAA 2WUVA 3OUZA 1ZM2A 2DJIA 4JP2A 1IVNA 1JJBA 3LM8A 1BG6A 4G81A 3IOEA 1CG6A 4MX8A 4J3JA 4RIEA 2PWPA 5FTJA 1B7GO 2WJWA 1NWHA 2B7LA 2X9NA 4OXXA 1KOLA 1AN0A 4Z2AA 3Q88A 1TZ2A 1C9NA 1GCIA 3OJFA 2VZLA 4Z0TA 2O2HA 3UF0A 3WB1A 3STTA 4ARBA 4DKXA 4KC0A 4CKZA 5JQGF 3SVTA 2IUFA 1X8JA 4M49A 4TTAA 3ENQA 2EF0A 4MQLA 3ZN2A 1NZDA 3A25A 1QVWA 3NBAA 1UMDB 1JA9A 5EE1A 2EX4A 1HRDA 3BXPA 1RMQA 2YWHA 4JBLA 3LC1O 4CW7A 3PUJA 1W87A 4II7A 1J0XO 2GXUA 3R0ZA 3C3EA 3K9BA 2VQEB 5IDQA 2HF9A 4OP1A 1W30A 3K96A 3U2QA 1Q3KA 3CQ9A 4UQPA 1P7YA 3E84A 2AOXA 2ZAGA 2UYQA 5P8WA 1BN6A 2QTBA 1XHEA 3VO1A 4B3SB 5LU9A 3TE6A 3O26A 5KNBH 2HT1A 2ZJ1A 3JWIA 4JBGA 1CVRA 4HJXA 2Q0QA 4CQLB 2H08A 3HH8A 3VKWA 5KB3A 5DEIA 4U7GA 2Q3HA 4GXRA 4HDMA 4LA4A 5AW9A 3BUSA 2H63A 1XRMA 3ZTWA 4EMSA 1AS2A 2Y6UA 2PJRA 4CL8A 3CR8A 1U2EA 1BXGB 4YP0A 1I30A 3S0JA 3S2IA 3WGYA 1TIKA 1GRRA 2EEZA 3QPWA 1HFJA 2X4DA 4NCKA 1BGVA 3EA0A 2KWIA 5AM5A 1H23A 3N8GA 2OHJA 3LVQE 3EPHA 2QPAA 4HNGA 5A5VA 4F3TA 2OCPA 1T3LA 3F6CA 4ZQBA 3IALA 4AMBA 4LF8B 3BULA 4HK4A 4EO4A 4PE5B 3WV5A 3T1HB 1KY3A 2GESA 3NHSA 3EGOA 3RHSA 2VTBA 3NHJA 4Q4DA 1RYFA 4B31A 5CA1A 4OQFA 3B3AA 5DB4A 4XOUA 2ZTLA 5DM4A 3K70D 2UU9B 2IYFA 2WKRA 5LZ5A 1MNQA 3EC7A 3UT5A 2QBYB 1PR2A 1ZP6A 2QP4A 3KLOA 3QVJA 4M22A 4QHYA 1TJPB 4Z8XA 4JP8A 1E32A 5EJAA 5KYYB 2XMPA 4Y0AA 1LCIA 2GBLC 4XQEA 3BS4A 4UARA 3SDBA 2WD9A 3QA9A 2Q4TA 3FTDA 4PZPA 1TUBB 3WWCA 1XZIA 5IAAA 1BDBA 4H7EA 1N5JA 4PNHA 3TZEA 1XHFA 2CHUA 1S3GA 2P9TA 3E9YA 3E4CA 3STWA 1JDTA 3THRA 2HF2A 5IFLA 2FEAA 2JHGA 3V32A 2JG3A 2ZFUA 5GZ6A 4G0XA 3DMGA 4HGNA 5FBQB 2ZRAA 4CLXA 4MIYA 3UGJA 3OPYI 4A0GA 3NCTA 2NZ8A 1QB7A 4UOZA 4X60A 4TKUB 3DH0A 4HWSA 1ODFA 3B6KA 4LECA 1Y9EA 2HFJA 3ORQA 4RVHA 1KDVA 1DC4A 3M5WA 2X0FA 2CUTA 2PGJA 3FCAA 5ANRB 1D1TA 3HCCA 3IEUA 2IF2A 5AJWA 4R3UC 1U9IC 4JOQA 2QM3A 3STVA 1T4CA 3ND8A 3NIBA 3TRHA 2D2FA 5IABA 1QNFA 3D4LA 4Q4AA 3GC6A 1FNSA 1G2QA 2E49A 2WJIA 5SY4A 2JI8A 4NH0A 1UXJA 1HNZB 3V4PB 1KMHA 3G5UA 4HN4B 1T8UA 3ZV6A 3ZD6A 4XWWA 3L0BA 2JZNA 1Y37A 5HWSA 3SKYA 1A8SA 5TIIA 2RKOA 4C08A 4OP2A 3OFSA 4QUGA 3UFXB 1Y1KE 1FFEA 2CT8A 2PKQO 2JD2A 4O6VA 3M34A 1B4DA 3B82A 4D9IA 1XVAA 2VC2B 4BNDA 2H0QA 2BBOA 2BKVA 3IIJA 2PA3A 3SZOA 2BEKA 2XH8A 4I46A 4BMVA 2MCFA 3ANXA 1LX6A 2J45A 4WN3A 2K7ZA 3NBFA 4OJKA 3EGEA 3WA7A 2X8LA 1Z07A 2Y1DA 3BEOA 3DLCA 4M9CA 3RVBA 4GEKA 1QOZA 3EEOA 1AH2A 4X63A 3T1TA 1AQ6A 2O8BB 2GILA 3FB1A 3IR7A 4G0OA 3KKQA 2A9PA 3KXPA 2EWMA 3H9JA 4Z1MA 4V03A 4DLUA 1BGXT 3DD5A 5A5EA 3LUAA 3VR2D 4BP8A 2AKAB 1I5RA 1L5HA 1Q0RA 1QU3A 2ATCA 1D1SA 4JH0A 3FFXA 2OVBA 3H5VA 1L5ZA 2V3CC 4D3ZA 4LYEA 1FTSA 4BX9A 3UK1A 1DE0A 3MRXA 3HZOA 4TVKA 3S2YA 1U0OC 3ZQJA 2W4IA 4ZVSA 2HLHA 3HWSA 4DTIA 1YZNA 3K16A 4FLFA 4OM8A 4E1BA 1A71A 1Q74A 2RAPA 3GF4A 3OU6A 1BRTA 1THZA 4MVJA 5C18A 4OFXA 3DFFA 1G8AA 3T9AA 1EYZA 4Q6BA 3TLGA 2PBFA 1WZ2A 5IKPA 3ECCA 4H17A 4MRMB 1C2YA 5M29A 3ND9A 5I5EA 2Q3JA 4UAUA 4RY0A 2ID9A 1JDPA 1T5OA 2A4KA 1ONNA 1SK8A 3ICWA 3MBKA 4H1UA 4KDCA 5KDDA 5J2UA 1NVMB 2NMVA 4DA8A 3QNMA 4HYQA 3G9XA 3GN1A 3P27A 3QLUC 3AKYA 1GG2A 5CITA 4K87A 2V7GA 3DW1X 4C88A 1FFGA 5TLSA 2XDQA 4I3HA 1TKAA 2JVKA 2GJ4A 2VWHA 3RJ9A 3SYNA 1G6HA 2R62A 1G66A 5BSFA 5JRZA 3RSZA 5KSYA 4ZQHA 1FTNA 3H5AA 1ZSVA 1Y6RA 1YIAA 3RVPA 3EHEA 1ABEA 4XWTA 4FOOA 4JITA 4X41A 1IZ9A 3ME5A 4ML3A 4F60A 1MR3F 3E9EA 5IPFA 4OXQA 1L4BA 1VL6A 4EI8A 5KYGA 3F46A 3VC3A 1Q77A 2JNWA 4M0DA 1UXGA 4UXIA 5JDCC 4LZPA 5BW4A 2PV0A 2A86A 1FBTA 2X2PA 4M0PA 2JFXA 3L18A 4EYGA 3FHTA 1PSZA 3BICA 5MN5A 5C46F 5CVUA 2UZ0A 3OQMA 3CY6A 2PGDA 4FC7A 5DWVA 5KNDA 3KD3A 4KPYA 4BDSA 4EEKA 3SOZA 5DRYA 2VAVA 3AKCA 5LBIA 1RRGA 1YBMA 2CB0A 3D8TA 1J5XA 3N0WA 1VI6A 4R9VA 1XZMA 1RJGA 5CLFA 4E08A 4HDNA 3RQSA 1Z12A 4KITB 1EZ4A 4O4LF 4PWYA 5GIPE 2OPBA 4J1QA 4U8HA 5C7OO 1G64A 3ZYZA 1K63A 4OXYA 1EHYA 4OHXA 1XNJA 3RRBA 1PTKA 1RMTA 4GIBA 4ZMBA 2FSVA 5JZSA 2HTFA 2QUHA 3AHJA 3NOXA 4PCAA 1V9SA 2ZRLA 1NAIA 2OGZA 1V1RB 3F7NA 3QMVA 1L5LA 4B6PA 4CRWB 4DLBA 4IIUA 1AO0A 3CKYA 1ADJA 2Q6OA 3W5SA 5JJKA 2IQIA 4LYHA 3ZGNA 2O8NA 1YC5A 2ZCVA 2FSVC 2I99A 3AR3A 3MD0A 5C31A 3FDIA 3OTQA 5AVSA 4JXZA 1L7OA 4LOJA 4XI9A 3SIRA 4P5DA 4XJXA 1XR3A 1PJ4A 4KO3S 1QIIA 1AU9A 1H22A 1E61A 4RNDB 1KWKA 4EA9A 1QIGA 4GS5A 3PNOA 1K0UA 1KKUA 4GOXA 3HU3A 1O95A 3BTSA 1C1YA 3BRWA 1H0SA 1V4NA 5DRTA 1TM1E 3EG5A 3IA7A 3DV0A 4ZAVA 5FPQA 2P2DA 1R0CA 1Y3HA 3TVDA 1WJGA 5EXXA 2R96A 10MHA 4E2ZA 1Q12A 2Y93A 5AYVA 2G8LA 4DDMA 3JX9A 2WMYA 1KOJA 3N53A 2JLCA 1MB3A 2W2LD 4O2BB 4CMAA 4D9JA 1O9HA 1PZGA 3HNPA 1HG1A 2QD4A 3K5HA 1TF5A 4OHMA 5FR1A 5B53A 1Q91A 2RGWA 4AJPA 1I6LA 1JA0A 3JQEA 2OKCA 4DQUA 1UC9A 5DIFA 5I4BA 4LF9B 5T67A 4LK2A 1ECFA 3UFBA 3PFWO 4DLKA 3T3IA 4ARAA 1KU0A 2REBA 1FVFA 3CW9A 4K9DA 4W9NA 3CLKA 4F56A 4KYTA 1UPCA 3IRVA 3Q7TA 5GJWC 1PV1A 4HB4A 3ZXYA 4AZVA 2D0DA 3C1TA 1AHIA 1XMPA 2W4MA 1D2AA 4HFNA 3ED5A 1MEJA 4AFNA 1A3CA 1TDJA 2V7QD 4MHOA 4DJJA 1KJIA 1DHRA 1TE2A 1YC2A 4NDZA 5KX5F 5L4LA 2XKKA 2HV8A 3ANMA 3IQWA 1XQ1A 1XWFA 3AUAA 3IBGA 1QIFA 2V7WA 2GBGA 2RC5A 1E1QA 2JDID 3A1VA 3E22A 3LFUA 1U11A 3NRBA 4CCYA 4A0SA 3NHPA 4O3MA 1EFTA 3H1TA 3PLAE 1B6GA 1QG4A 4MYCA 3WC4A 4CI0B 1J2JA 4HDRA 1O8BA 1NLMA 4CM9A 4C9BA 3MHTA 4QQFA 3HADA 2POQX 2Z1DA 3EFEA 1KI1A 4G6ZA 4P31A 3T1NA 4LDZA 1WB9A 3O1JC 3A32A 2DECA 2B3DA 2F43A 3KKZA 3VFDA 3WLOA 2B34A 3A4NA 3WHIA 4B74A 1TCVA 1UPXA 5TPZA 2ZRHA 3T5GA 4MV1A 3OE7D 5BUZA 1V37A 2IXTA 3CRVA 4WOPA 2E1PA 5EG5A 1NMYA 4FQ7A 5E1MA 1Z0SA 1OE0A 3GD7A 4MMXB 2W2MA 4MW0A 3A9CA 2OM2A 1CEXA 1RXSA 1YTLA 3IJ5A 2V7UA 4BKUA 3L6RA 3OKAA 5SV2A 1WUHS 3IA2A 4RFSA 4OI4A 1NG1A 3KCQA 5DV9A 3RKSA 3Q6IA 2CNLA 4BLTA 4FFBB 1D6JA 3HE3A 4UHBA 1TO2E 4EMUA 2GZRA 4WZAE 5ENVA 4ETWA 3HGMA 3EG9A 2CFRA 2O3RA 3IVMA 2NTYC 5ILGA 2G76A 1B0PA 2YN0A 2F1HA 3QVTA 4EFKA 1ZUWA 4EY6A 1IBLB 2P2GA 4K2HA 2ATVA 4KAAA 3ZR4B 4UE6A 4BY9E 1KGDA 4JDPA 4ZZ0A 1V5WA 5FNVB 2BCEA 3WK4A 5JMTA 5JU6A 2P9QA 3L77A 4MS1B 3GH1A 3QLEA 3WGGA 2AF4C 2H2FA 3DBRA 3GRKA 1PYGA 4NXMB 4BVFA 1R16A 1J24A 4JBHA 3UEOA 1Y6FA 1RWNA 2V58A 1C1XB 4RQBA 2Q2NA 3AL2A 1OKKA 3DQQA 2VBCA 5AJYA 1W88A 2NGRA 1NYQA 4DYHA 5C5EA 1DXOA 2FUNB 4OA8A 4BNKA 2V5VA 2RGEA 4IV0A 4AJ1A 1UFKA 4U7FA 4V3BA 5KYTA 4JI0B 3A2NA 4IEIA 2PPLA 1OXSC 3BJEA 1RLUA 1QS0A 3O94A 3MAGA 3ONDA 3VKUA 4BP3A 1C29B 4PINA 5L3ZA 3SC3A 3SNKA 5EUMA 3FBGA 4ZT3A 3CUKA 3IQGX 4WTOA 3B6IA 1XZGA 3RK4A 3TECE 4RA6B 1XRNA 3BT7A 3IT0A 4ZT6A 4B76A 2XNHA 5BW6B 2JAHA 1QUFA 1CERA 1UFRA 1FTYA 9ABPA 3M4ZA 2ODBA 4OO3A 4YRCA 4DA4A 4HWRA 3ABRB 3H2HA 2QX6A 3K9CA 1QCZA 3OIYA 1TMOA 1NVKA 3ST7A 2JKYA 3E1KA 3PPVA 5DJ5A 2WWYA 4D6PA 2PX3A 1Z6PA 2EP5A 3TL6A 1NU6A 3LF1A 1VE7A 1Z88A 3EOAI 4L22A 1XFDA 2FG5A 4PYKA 2ZUSA 1VBNA 4AY4A 4B6GA 4I50F 3A7EA 4PVCA 4Q1AA 4Q93A 2XRMA 4RWZA 4AZ0B 5TF0A 2DCUA 3AVOA 5FKJA 1IN4A 2HCJB 3GRVA 4HV4A 2BY4A 4O29A 5F7JA 1REQB 1YH3A 4JGBA 1ZOSA 4BMCA 1EP9A 3JALB 1Y3IA 4R51A 5EWJB 2PIDA 1BHJA 1FIUA 4PYIA 4G0WA 4P7JA 4JHXA 4KLAA 1VCOA 5FL3A 4D81A 4CM1A 3AXSA 1KETA 1X38A 4HB0A 4YDSA 4LMAA 1G6OA 1TCAA 3HRHA 1GGNA 3KZOA 4GYJA 16PKA 2J4FA 2JGRA 3NRJA 4S1TA 2YS7A 2I7VA 2IEIA 3F7MA 3FMPB 4KQIA 4QHTA 4UBJA 5DYYA 4DIBA 5JNLA 4ES6A 1A5ZA 3D6NB 2JGLA 5T8KC 2F55A 5L7YA 1F1JA 1T1EA 2FLWA 1K9SA 3R6TA 1HDEA 4YRRA 3ELWA 1EK5A 3D6JA 4JLUA 2PQ2A 4EKNB 4DLYA 1F4PA 3A28A 2BW0A 3N6XA 5BYJA 3TZBA 3P9NA 4NENB 4H18A 5L95A 4I55A 4EGAA 2AFHB 5MGNA 1U7OA 1J39A 1FFAA 1GRQA 1QHFA 2Q3LA 4BP9A 4B3FX 1FMTA 4KXNA 5GP1A 3JYQA 4CQMD 2BJHA 2HWUA 2ZRBA 1AM4D 1RPTA 3GJ7A 3RG8A 1YQGA 5BT8A 4FM9A 4FIZA 3SC6A 3WK6A 1GV1A 1N25A 3NIWA 3FUXA 4IIDA 3ER9A 4MQ5A 4V38A 4B3MB 2OB1A 1L5KA 1Z2DA 2BMFA 1SZCA 1NF9A 3HCRA 4LXXA 5LYYA 3RFUA 4C29A 1U9YA 3RKRA 3NU1A 5F3DA 2CSXA 1LRKA 2W93A 3AF4A 1KIMA 2AOUB 2BTQB 1XZQA 2C4MA 5F2KA 4D4GA 4DJ5X 5LPNA 1ZHOA 1YZ3A 2BFBA 4CIVA 1OUMA 2HJHA 1B1AA 3WICA 2PUEA 4C07A 2OHGA 4G4JA 5EKTA 3TNFA 1WM1A 5KREA 4G36A 5AKKA 4IF4A 5B64A 1ZI8A 5A62A 2AHOA 4XA8A 4JP3A 5J4KA 1JR2A 4OHFA 2I3ZA 2GAAA 3HTXA 3H2SA 1WRBA 2IV2X 5BNZA 3EZXA 2G80A 4B35A 3AOEC 2BEWB 5AWFC 1P7VA 1W25A 1Z8FA 4XM2A 3ETLA 2FWNA 4A6DA 4ZV7A 4CL0A 5H16A 1HQYE 2AVDA 4UPDA 4YJFA 3TZHA 1OX5A 3IP5A 1NY5A 5CM2Z 1ECBA 3LBNA 2RHCA 3FVTA 4J75A 2FSUA 1CUEA 4X84A 4PFQA 1SU6A 3DE1X 3MRVA 4I50B 1R8XA 1LBEA 3F5DA 2HA2A 3IHWA 4W9NC 5AK0A 4F3CA 2X42A 2ZTMA 1GYPA 1WKBA 4U2FA 2GARA 2ZIZA 3SX0A 1ZH6A 3G85A 2H31A 2Q2VA 3WY9A 1S1CA 4ENWA 4XPIA 5HDQA 2CVQA 1Y3AA 1ZWLA 4L0DA 4KXYA 5EXEA 5PGMA 1E7MA 4DDWA 1AO3A 5IWAB 2NUPB 1ONBA 2DH6A 4JT9A 4XVUA 4GRDA 1EBFA 1T35A 2ZQYA 3L5KA 2Z6UA 2E0IA 4Q4HB 1VYHA 4GPIB 5FTMA 5FBRB 3GFRA 3U4CA 1N5KA 3HB1A 3RGGA 5JFTA 5I4KA 3SYRA 5KX5B 3CH6A 3TX6A 1GTMA 2IYUA 1LVHA 5L3QA 5KTNA 4I4TA 1KEPA 3W9SA 3D8NA 2Z2IA 1P77A 3JW8A 4PQGA 5BY2A 1FNMA 3B6JA 5EJGA 3I58A 5CLJA 4NONA 2XT0A 1FX0A 1GPWB 1GGMA 1LDNA 3IPAA 4BJ6A 2NVBA 1G21B 2XT6A 3ZE7A 4EHKA 1NVXQ 3E6AA 4O4JA 2IHKA 3MSCA 2XMBA 1N2CB 3OKPA 1CUYA 3UKDA 4R71A 5LUAA 5B4VA 3GPLA 2HJSA 3UKJA 3HO1A 3RK1A 3GHYA 1P0CA 3NONA 2TMYA 2I9PA 4IO0A 2YW2A 4BLPA 4BNGA 1HORA 7GPBA 2VP9A 1SRQA 5AJXA 1C0PA 1EM8B 5LBUA 5DTEA 4LYJA 4DEYA 3U3XA 1H5UA 4O1HA 1OI7A 2ACKA 2LIPA 3F9RA 3DWIA 2Y92A 2X5OA 5MFZA 4U39A 4ZT5A 1ZGZA 2BGJA 5IW8A 3TRFA 2PWAA 1OAAA 3B3QA 5JSFA 4WECA 2FW1A 3BE5A 3W8FA 4CKWB 2IHJA 1CRWG 4WI1A 4KK3A 3TQRA 3ZZUA 5A5GA 3IDFA 1PQPA 3LCVB 2VLIA 3I4FA 3WP0A 4KOAA 1CSEE 3D7NA 3FUVA 4MVJP 4B3XA 4DIDA 1U63A 4AI6A 3ZBTA 2NVWA 5BN3B 3LRXA 4D4JA 2YXEA 3QYAA 3ROQA 4ER0A 3W78A 1KEUA 1YRWA 4MO9A 4CIYA 1N3IA 3BA6A 5EWMB 2XXBA 3W5BA 2F67A 4YIKA 4J0EA 1EUYA 3PD7A 4IRUB 2K6GA 2B2CA 4LUCA 4YAGA 4AN1A 3LZ6A 4OYHA 2PT6A 2PBLA 3SJAA 1PEAA 3ULKA 1XCOA 1KAEA 2MIIA 3OJCA 3ZWMA 2QHXA 1KMMA 1JTVA 1SCKA 3B1FA 1DJPA 1L5YA 4QM7A 5JBIA 4LC9A 2Q3CA 3LYAA 3OOHA 4X8HA 1AB5A 4V0SA 2OHIA 3HXQA 4HX9A 3JQAD 3NGLA 3CVXA 5LZ2A 4Z0PA 1EWRA 1AT1A 2JIMA 3L04A 3LUPA 2D1RA 4HHEA 5A3QA 4DRYA 3CKKA 4KQ9A 5I7AA 3FYHA 4GGMX 1O5TA 5JSHA 1CCWA 2C96A 4HGRA 3SFTA 4ZVUA 1H2YA 3DLIA 1Z08A 2HD4A 3D6VA 5DGIA 3UGKA 1ESDA 1NFFA 2HH9A 2PXHA 2ZJ0A 3BXXA 4QJ5A 1UDCA 1J0BA 1T9GS 1P1BA 2GPTA 4LNUB 4TUYA 4LJ6A 3V55A 2H9IA 4WXYB 2IBSA 2I2DA 4FC6A 4PM4A 1NYRA 2LPMA 1EGQA 3IOBA 4WA8A 5DYTA 5B2EA 5G1OA 1KH2A 4E3WA 5J1SB 1M8KA 1EESA 4RZHA 2V7EA 3AONB 3GW8A 3JYOA 1JPJA 2B78A 3VHQA 1Z0UA 1EJ2A 4Y2UA 5D6OA 4UTXA 4DCTA 2H7XA 2Z09A 1ZKDA 5DGTA 1X7ZB 3DUWA 3QMPA 3GARA 3ZOKA 5FLYA 4P98A 2LCQA 2G67A 3E7PA 3II6X 1XZJA 4LJYA 2DCMA 1KBZA 3JQ9A 4G8CA 1LC0A 2NYUA 4XQ9A 2O3QA 2WZDA 1TVKA 1V45E 4LFBB 5EWLA 2ADFA 2P8SA 5FLEX 2WNSA 3R7FA 1KO7A 2J9GA 3LC2O 4MP3A 4GOJA 4TV8B 4E11A 2FMHA 2FPMA 2ZIFA 1HT0A 4XKJA 5ENDA 3QJGA 1Z3CA 5DT9A 1SUDA 1ENYA 1PKXA 1IN8A 1QIKA 3BF7A 4FDMA 5FA6A 1TQ8A 5BYBA 4WN9B 4REMA 4L50A 3FZEA 1NN0A 4NH4A 4E94A 2XWJI 4NCNA 1MGPA 3IPLA 5K8CA 3ILVA 1U6JA 4RMGA 1RXIA 1SC1A 2FPLA 5CYFA 4ECAA 1AQIA 1VP3A 5DGCA 3HN7A 1PJCA 3I04M 2ZRNA 2HF7A 4MS4B 4PSVA 4WZBA 1YS7A 3I9MA 1W76A 2Q4DA 4QNRA 2RARA 2LCIA 1FUUA 3N0VA 2PZGA 1A5TA 1ND5A 4KH1A 4TT3D 1MB2A 1PYOA 4EHFA 1C9EA 2I2XB 3RUDA 2IPNA 3ISTA 4ER5A 4LOAA 4ZO6A 4BFWA 5JRDS 1WUTA 5EMNA 1JU4A 1Q19A 4OQPA 1NW6A 3I0MA 4FEAA 2J7PD 1J09A 4Q1FA 2UYYA 2HK9A 1QHGA 2VJOA 4P4NA 1EUQA 1KYWA 2NM0A 2JIZA 1UJ5A 3COYA 3IAM1 4FMPA 2NUAA 4PQYA 4PSAA 1BOFA 4YMWA 2WG1A 1OBHA 4MYSA 5KVSA 2XT9A 3WAJA 4B33A 2PS1A 4A82A 4X6XA 4Q4JB 4HLUA 1OFHA 2CL6X 4LXUA 1RCTE 1TTQB 1TM3E 4UUOA 2I7CA 2LZ0A 2ZSBA 3WKBA 5BV7A 4OIMA 5ALFA 4ZC1A 3ZHZA 2WU3A 3CX4A 2G9QA 2CB9A 3BXFA 3EIQA 4XTCS 4YAEA 4UUQA 1P2DA 4F45A 5I3ZA 2V6IA 2AFIB 3I9NA 4DIEA 4LK3A 3PT9A 5F1PA 3JWGA 4MW5A 1W94A 2DKNA 3CW8X 3OOJA 4C0SA 1WETA 5HR5A 2H0AA 2Q1TA 3EEQA 1NVVR 4JLVA 1IIBA 3OM8A 2HHCA 1KBQA 3WK7A 5BVHB 5KYKA 4WIAA 4ZCPA 4CG2A 1GKYA 1YKGA 3KPYA 1YJ8A 4C0HA 1XZDA 3PD1A 4R9RA 4TS1A 4E4YA 1RI4A 3FCCA 2CUZA 1NFRA 2BM0A 4CKBB 2H07A 3ONWA 5AUOB 3DCNA 4PYRA 4L9SA 4CEIA 2GR9A 4OHWA 4K9MA 1BHSA 5BWCA 5BSEA 1J2EA 2ZJFA 3HY4A 2PUAA 5C4IA 3IILA 2PLFA 4P7FA 5DGDA 1N3YA 4H35A 4J03A 2Y9PB 1V11B 2FMIA 5A0TA 1LLFA 4JYPA 1PT9A 5KNCH 1YUNA 1GA1A 2BRUA 2ZANA 2BZSA 3L93A 4ZT7A 2NIPA 2JL1A 4EGQA 2PL5A 2WICA 3FYCA 2HWWA 4P4GA 4B34A 4DEVA 1XPRA 1RCFA 1RHMA 4N5NA 1U0GA 4RM2A 1E9BA 2GF0A 1QLHA 3VM6A 2XCTB 4HCJA 4O4HF 1I7NA 4QYWA 1V26A 3QM1A 5G2OA 2XB2A 3BOSA 3U7FB 1NLZA 3WLPA 2VBGA 3K05A 4Q7KA 3SVZA 2A9OA 4NBTA 3UK6A 3R7LA 1KJJA 1T5IA 4TGLA 1G19A 5ITZA 4ODIA 3DCJA 4LDPA 1AZTA 1OI2A 1B0ZA 1ZI6A 4JVNA 5E0KB 1EWYA 3U4AA 2J6IA 3U0BA 2PFKA 3PSHA 4P2BA 4QTTB 5BNIA 5HOQA 3JQGA 2ONCA 4R1UA 3ZY2A 3SYLA 2CF5A 3L84A 1LWOA 2TSYB 5LNK1 2VJLA 4IIJB 2DAPA 2HC9A 2PUFA 4LXGA 3GDWA 4OPMA 2R1VA 2E4YA 2CNDA 4FYKA 3NDRA 4QXMA 2WTXA 2B25A 2VOEA 3DPIA 1OMOA 4UHDA 1Z68A 1X7XA 1JIKA 2XYRA 2YV4A 3GLTA 3MVEA 4Y67A 2X2FA 1U94A 2PUGA 5FPYA 3DOJA 1ZD5A 4G4SO 3OSUA 3OOSA 5BNWA 2AR9A 5JXWA 3VDMA 1HQCA 4OLJA 3MINA 4WL0A 1K9VF 2G72A 3AU8A 1QO9A 3OZXA 1UQUA 2G0AA 3HKEB 4R2KA 1Y98A 1VHTA 1YZTA 4WCFB 1AUXA 1E9CA 3H18A 3M0EA 3HN2A 4NYMQ 6REQA 1LTQA 2QA5A 1U3UA 1ISIA 1KQNA 4ZZ3A 3F6EX 2EHDA 2YJGA 2WF9A 1KJYA 5AKHA 3DE7X 2OEPA 1JILA 2QMHA 3ELBA 1BCSB 1HDZA 3S8EA 4PFSA 3LQ4A 2OLEA 3DE3X 4F21A 1ISSA 2FV8A 3DZ8A 1RPAA 3PUVA 2Y1KA 4QGHA 5TPZD 5EJ2A 3IQXA 4AF7A 1I2DA 1PD1A 4IGEA 3DR5A 1B8UA 3M6FA 3NKFA 4NC9A 2GBIA 1YWGO 3AERB 2A84A 4CM3A 1TMYA 5ADVA 3BMNA 2CJXA 3EOZA 3OP1A 4FSHA 5ALZA 3BJMA 3W5VA 3FPBA 3UMBA 4C2UA 4G84A 2ILTA 1RJWA 4LN1A 2PLNA 3FMVA 3BFKA 3OE5A 3KQPA 3AHEA 1DWOA 3C6MA 4G1VA 3T0IA 4XB2A 1JECA 5EZQA 2FPGB 3HRIA 3OETA 4ZXPA 3RWOA 3ACCA 3WHKA 4BEBA 4L5CA 4EI2A 1HM5A 4CM6A 5I8PA 4XUCA 2GKGA 1OI4A 1JH9A 4N5DA 3U3OA 3Q41A 3R3XA 3FTCA 2YYYA 2VAMA 5F9MA 2PLRA 4HWPA 4YHBA 1KO4A 3UWSA 3LX4A 1GHTA 5BYAA 4GLBA 1P2BA 1Y8QB 2NYAA 4HNAB 1QGAA 4UBMA 1FRZA 2VP2A 1D0VA 1VCHA 1P9OA 4W5QA 2BF7A 1WF3A 4BC0A 5CEEA 4ND7A 1M1NA 1DBIA 1SC3A 3RSLA 1K2VN 3G5LA 4F1JA 3Q0EA 3BTOA 3QITA 2G70A 2VQDA 2W6NA 3HYLA 2XCSB 3L4KA 4URZR 4NCBA 2PT7A 2AMVA 4AN4A 5LQRA 4XVCA 1EHIA 4FE4A 4Q0MA 5A1JA 1QC5B 4AIRA 2XHZA 2FG6C 5CYGA 1DI0A 3K9FC 4MR8A 3WDKA 4I8IA 5B7QA 1M76A 4LW8A 4B4VA 2R7NA 2BISA 5DYGA 3PV0A 3TR0A 3OTGA 2WJ6A 1QB8A 2EDCA 3AIKA 5F73A 4FGJA 1Y5MA 2W2KB 3H2BA 3QEMA 2XQVA 4JK3A 3RKUA 2YWJA 4HAXA 2IYRA 2BFEB 5BQPA 3B85A 3WGTA 1KVTA 2G07A 4HNUA 2OECA 3DW3X 2H85A 1U7XA 3NKLA 3OTHA 4EHLA 4WADA 1E6MA 1LPPA 4MQFA 3TTXA 4MYDA 2SBTA 4M0EA 4UM9D 4POOA 2A9VA 3HDHA 3CSUA 3K92A 1EX6A 3SC2B 5IDVA 4ZOLA 4Q3OA 5IX8A 1WW8A 5EXSA 5EY5B 1KY5A 3DQPA 5AQ1A 1EK2A 3T3NA 3ED1A 2FEWB 4UDYX 4YXFA 2WWWA 3NDIA 4M89A 3G7NA 5L4SA 2O59A 4IYRA 2MR5A 1CY1A 4V0NA 4LWQA 2CXTA 2HRDA 5K8UA 5DO9A 1SGWA 3HL4A 1X2EA 3A9VA 2GNOA 4ALJA 3A0RB 3KZ1E 1ECJA 2GJKA 4IS3A 3WP1B 1NOKA 3WAKA 4AKHA 1M7BA 3TLKA 1B0AA 1RRMA 1SCAA 3CEMA 4BPRA 1PGJA 2FEOA 2ZJ8A 1TK2A 4LBZA 1VYUA 3E9ZA 2O8EA 2CVHA 1RD4A 2VHUA 4LHYA 2QTGA 1QPZA 1EB9A 2FPIB 1R6BX 4B45A 4ZCMA 3QA3E 1E4OA 1DKQA 1XWWA 4X95A 1OBFO 5L9AA 4BNXA 4E1AA 3TOSA 2DP4E 4IWNA 3JZIA 4YWJA 5LUBA 5D84A 5EIBD 2QP9X 1T0IA 4F92B 5CCDA 2IV7A 4TL6A 4ND2A 4GC9A 2PFGA 2R8BA 5JS8A 3HM2A 3R6LA 5FORA 2HMYB 3CINA 3EAGA 1ZCAA 2B8WA 1F8FA 3E1GA 4UAGA 1MOQA 1S6YA 4L02A 2D6FA 4DDUA 4G2TA 3FPCA 4GI3A 5KS2A 3FYTA 4HYYA 3EQ7A 4QPPA 1VLJA 4KN6A 3W2FA 4GKJB 1ZJ5A 3G9QA 4RY2A 1Z33A 1XQXA 4Q9HA 3IAHA 3LCCA 3MJRA 3DEKA 4WZAB 4EABA 3RUCA 3PG5A 1A9TA 1QFSA 5TV2A 1DWQA 3CW2A 4I36A 4IG9A 1O58A 3UH1A 5JZMA 4UNSA 4IKEA 2ZR8A 1B76A 2OP0A 2WYHA 3T3PB 1RAFA 3INYA 4MIKA 2FHSA 2QMYA 4X92A 1TAHA 3JARB 4F97A 4Y8VA 4ARZB 4LZJA 1DXQA 1QWOA 3U7IA 3BERA 2ZYRA 3BMOB 5BRJA 1CY4A 2HU7A 3I12A 4ZVMA 1OHHD 2WSSA 5EP4A 4ZGBA 2IUSA 1JLLB 4IGAA 2Z30A 1ZD8A 3ZWOA 2X9QA 1SURA 3U3JA 3QH4A 4JCOA 3D0KA 3HSSA 1F0YA 1Q14A 2CLDX 4Y2HA 3STYA 1G38A 1G1MA 1JYFA 2G6BA 2HWXA 3HR4A 4FYJA 4UZFA 4WJKB 5CT8A 3TD9A 1NW4A 3IJRA 5AVOA 3UW3A 4D0LB 5JCOC 2WTBA 1BE8A 4FCVA 4LJ9A 3T9BA 4EBFA 2VH5R 3GLGB 2ZB4A 1MP0A 1ZFNA 2NUTB 3ISJA 2YQ4A 3PZRA 4IDHA 3DMHA 4D4IA 1JALA 4G23A 1EA7A 1T2VA 3A36A 5C32A 4N9QA 1BNCA 4PX5A 4JXKA 2A1IA 4URYR 4HDQB 1HEYA 2QAJA 4L7QA 1TCBA 4PYJA 1RNLA 3OPQA 1TT5B 3CRZA 1E7YA 1TQHA 3PQ7A 2C3MA 1YASA 3CO5A 3L4BA 3KKPA 4JJAA 2X9LA 2FH5B 2H29A 4CMGA 3Q72A 4BFSA 2ATIA 1RHJA 3KCNA 2NU9A 1TAUA 1Y48E 3L7IA 3OA0A 4FX5A 3M3DA 2J7KA 1LJUA 1T3TA 1T0UA 1UDRA 2H7CA 1LSOA 1OLSB 2XBLA 4UEKA 2D2VA 3D4BA 4HAOA 2A59A 2ASVA 2I54A 2NV0A 3DVAB 3URMA 4KP7A 4QA9A 3U3ZA 5FUYA 2QMZA 4O4HA 4RTMA 1LLCA 3LS2A 2J3LA 3SFVA 2DSNA 3PI6A 4IOLA 1WXHA 4UNNA 3ZX5A 1QZ3A 4CZ2A 3IP9A 3ZDBA 1Q7EA 3PC8A 4WCVA 1YJ5A 4G1BA 3GLFE 1Z8NA 1M10A 1ZN9A 1WS6A 1FL9A 2PD4A 3K5IA 2PWZA 2HEGA 3GBPA 4QOSA 5EZ5A 1NPYA 5FAKA 3PGMA 2Y0DA 2EYUA 1JHOA 2LWIA 5IEJA 1EFVB 3DVQX 1QH8A 1FTWA 2FR8A 4M9UA 5DI9A 3D54D 4YRSA 3WBFA 3CVOA 4ESOA 1D8TA 3G5AA 4BLUA 3RAFC 3PGLA 1WHTB 2J85A 3F78A 3FDFA 2Z56A 3TQCA 1K75A 3KUKA 1DPGA 3K9HA 2XDYA 3X1ZA 2G88A 3K20A 4E13A 3QKSA 1VPWA 1U7DA 2OXIA 3VC7A 4EVQA 1A82A 4G3XA 2W8BB 1DT5A 3AG5A 2BTEA 3GLVA 5CBKA 2DWCA 4FBMA 5IC4A 1I1OA 1JFFA 3LC0A 4LRTB 4C76A 3AL0C 1Q15A 1CUZA 3SYMA 4TZ0A 4HDCA 1WBDA 5HFNA 1N5MA 2BFPA 3T5MA 2JIZD 4PSUA 3L4JA 3RVOA 4FX2A 1L4YA 4G8BA 4H0NA 5HGJA 1EQ2A 4D9BA 5M3BA 5I7RA 3A7DA 2HDWA 2C9YA 1K6EA 2HJVA 1F0KA 1Z25A 2Y27A 4FHDA 4NS4A 5DCWA 3ZKWA 1MKYA 1S2GA 1CY6A 2RK3A 2YZNA 1L9KA 1SUFA 1E89A 1SRRA 2MTBA 3JQCA 5A6VA 5K0SA 4FZVA 4Q3LA 4RW0A 2X6RA 2C7RA 2OGWA 3F4KA 5CEJA 4CLHA 4P92A 1LW7A 2CFSA 2WM9B 4G26A 4LVOA 3R5KA 5SICE 3W6NA 5AW6A 4R4JA 1Y3CE 4FGSA 4JU9A 2CLSA 1N8SA 1P60A 4G89A 4GEGA 5IKOA 1KFBB 3WLIA 2XTJA 1LFAA 3AMVA 4M0LA 2ZVDA 1RXCA 4TOIA 5A06A 2IITA 1M75A 1IN7A 1FRFS 3QBJA 4QARA 1AUPA 1AGRA 4D4KA 4PTLA 3EODA 1N6IA 1QG2A 3RABA 2P35A 1I7PA 3B1ZA 2O7NA 2LKCA 1KP2A 2G25A 2H17A 1NDHA 3ZH2A 3H11A 1E0SA 1K8XB 1U3FA 3JSAA 3QSYA 1E9FA 5HS4A 4HP8A 5M2QA 2NO1A 4BZZA 4QYSA 4ZQGA 5FCDA 4DV2B 4Z4FA 3SXPA 1KQPA 2GPBA 2Q2OA 3BJRA 5J23A 1R0LA 2IUYA 3NTLA 4LEIA 1KJNA 2Q5HA 4BB9A 3KEMA 2BHNA 3IELA 1JB1A 4FDVA 4MIEA 3QU7A 4F9EA 3MFYA 1U9CA 4L07A 4C6TB 5L4NA 4JMPA 1OLXA 2YZ2A 1SXJB 5EE9A 4DBVO 2HPZA 3MJFA 1PN3A 2ZI7A 1A2BA 1F6WA 3P4XA 4YP1A 1ESMA 4IF6A 1Y8CA 1U2SA 4L1KA 5M7EA 4RTJA 3DLAA 1XAIA 1ZGCA 2AKEA 1AGYA 1X3LA 3NT2A 5ULLA 1E3EA 3GZNB 3OCXA 4P38A 3ABIA 4XDGA 3ZBPA 5GZ1A 1KAGA 4TXNA 3RYCA 2VA9A 3WB2A 2QXTA 1F2DA 5K8TA 1JFRA 2PXCA 3T7RA 2W71A 1N75A 1T43A 1ZL2A 4ND3A 3B6ZA 3UT0A 3W04A 1ULUA 4XLLA 5K4AA 2ACVA 2NVOA 1FOEB 3QXXA 1XTRA 1Z4IA 2BEVB 3NX4A 3HB4X 1NBMA 2HFKA 5K3SA 1XA4A 2OCYC 4PYLA 1J8FA 3Q10A 1ZMBA 3PL5A 3LKVA 1I0LA 1M7GA 4MJXA 3GO4A 1Z37A 3L8ZA 1EEHA 3LDAA 3N86A 3CZ4A 1T0PA 2BFCA 4QFCA 1T5SA 5KHAA 1JDBC 4X61A 3VAZA 5FUMA 5G40A 3DHWC 5TMEA 2ZULA 5IAOA 3VNQA 1W5BA 2BFAA 2EV9A 5T3YA 2F8LA 1KAQA 2JFYA 2ZJ6A 2A3NA 4Z4EA 3S1LA 2VT7A 4EI9A 3UAVA 3GJTA 4PPGA 5ICMA 3DS8A 3SGLA 4L3WA 5FFFA 1WZEA 3DEIA 5HCIA 3V1LA 4GR4A 2FW6A 1HG0A 4KPUB 4G1CA 3RT9A 1CQWA 1GM5A 1ZSYA 2PMKA 1SC6A 3S8MA 1XJWA 1GL3A 4B0OA 1VMAA 4OQ4A 2FQWA 1OFIA 2WAMA 1EAYA 2VFAA 4LGVA 3A6PC 1DC5A 3M6LA 1DIGA 2OBFA 4B87A 4HB3A 3MWGA 4YAOA 3NUQA 1PK7A 3PXGA 3TI9A 4PX3A 3RG2A 2DR0A 1UF9A 3T3MB 4EB6A 4EF5A 2JARA 4JI8B 1TZBA 2WA2A 3FRJA 3GNQA 3KOXA 3WGKA 1H3EA 4JUFA 1HLGA 4AB1A 3EVBA 1M2HA 1Z5NA 3VTAA 5C51B 2ICAA 4RCZA 5FI3A 721PA 3QELA 1GPYA 2AFRA 2P4SA 3NIDB 4A10A 4U8GA 1XDUA 3N7TA 4Q9JA 5EGSA 1YV9A 2FEXA 5JD4A 5TGDA 1DIAA 2IYWA 4EQ6A 1CS0A 3MWLA 4PQFA 4R05A 3RHZA 3ACDA 2WMNB 1CHNA 5JJIA 1SQGA 1WCYA 1G55A 2VJCA 5JCJA 4J0IA 3OT1B 2CD7A 2O1SA 4UD2A 3F6YA 1XT6A 4HQFA 4BKPA 2A9RA 1G3UA 4HG2A 4JT2A 4GR9A 1HEUA 2ORVA 2X41A 1MZVA 3DBVO 4B4KA 1Z2OX 4Y1GA 1OT3A 4G0ZA 4AG3A 4BO6A 1SHLA 3A1WA 3UW1A 3WJ7A 3PEVA 4G5SA 3IC5A 4KXXA 3BRCA 2GM3A 4F6LA 3G9ZA 3KQQA 2BGKA 4J90A 4L76A 2ZP1A 5EPUA 2V59A 4MW1A 1W5FA 2VDMB 4P4TA 3ZHYA 2BZGA 1I6KA 5KWJA 4CHGA 3LBAA 1HDRA 4KQWA 1GCAA 4XVRA 4LE1A 2DQYA 3TXXA 1F8UA 3TZ6A 4GKVA 4JI5B 1CQJB 4UOEA 5LQSA 3OQNA 3OJWA 3TDKA 2UVQA 5G4KA 5EMLA 2NU7B 3H1EA 4JS0A 4GZ3A 2JLYA 1XQVA 1YZFA 3OPYB 4XB1A 4BPBA 4OREX 4JB0A 2XMDA 1LSUA 5KQMA 4YJGA 1ZU5A 1PVOA 2WVJA 1DINA 4LCEA 1N9GA 1EZZA 5JI2E 1G20E 2O2GA 1GU1A 1FPMA 1M2OA 2H4ZA 3KR2A 2A9KA 4MYHA 1RXYA 1VMIA 4QASA 3VDNB 4KFCA 1B93A 4P54A 1EXNA 5T4EA 1Z6GA 5CVVA 4NQRA 5CDFE 3UMVA 4BU1A 4XWGA 3JVVA 2IYSA 2V6JA 5FJJA 1VKNA 4B3TB 3OP4A 1IBCA 3PXDA 4YR7A 1G59A 2FOXA 2XA2A 3GYBA 3KL4A 1JZSA 1IIRA 1KYYA 1U3GA 2WI8A 3BGOS 2Q5OA 1JDSA 2DE0X 4P3YA 2BI8A 2VUSA 4Y2SA 5JC8A 1FUKA 5K01A 3A8TA 4DEXA 1J7KA 1SELA 5JS6A 2AFHE 2CMFA 5C1DA 1EFKA 1JYSA 1I9CA 2H48A 1Z6YA 3E9NA 3RSCA 1FRNA 4JSYA 3FFWA 3CVVA 3I2IA 4QTXA 3GLKA 3JQ7A 3PQFA 5ALXA 4RZQA 2PIAA 2YH2A 1E1KA 1YBFA 3EISA 5GONB 3C8HA 3JQFA 1CUDA 1Z45A 3ENWA 1YACA 3KPWA 3Q8XB 1UJMA 1YR9A 4B5KA 4FMDF 3G9UA 4US0R 1Y1RA 2X0EA 5EJ5A 1PGOA 1FYFA 1LVUA 3Q2IA 4MR7A 2IYQA 1W46A 1N36B 1EWKA 1Z0JA 1R0YA 4Q18A 3TOVA 4N03A 1GTRA 1CJTC 2Q4EA 4KXMA 1ICIA 3ZG6A 3O4RA 2RI1A 3OCUA 3OX4A 3R5HA 3SR3A 4UHJA 4D41A 5A9RA 4BUJA 3MCVA 2E4AA 4HQLA 1FFCA 3BD8A 1M1YB 1WBBA 4ZAFA 1GR0A 4K1XA 1CJCA 2GEJA 4E12A 1C81A 5HA5A 3KYCB 5IBQA 1VECA 3RDPA 3WJ1A 1VG1A 4WH0A 3DL4A 3LZCA 2M1ZA 4MWBA 3OC6A 5BN5B 4EZBA 4Q9AA 4RXMA 4YP5A 3FJOA 3AR2A 3GP5A 4IIJF 2CDNA 2Z3VA 1UWVA 3LO8A 2AC7A 1NNUA 4HB2A 5K3DA 1RBZA 3ICEA 1Y1TA 1XD2A 4OFZA 1VYTA 1P91A 4OMFG 5AI5A 3D3WB 4G1EB 4UM8B 1IHOA 1KMQA 4B48A 3UYKA 1P4AA 2HF8A 3U4QB 5KUTA 4ZQIA 5L7TA 1K2WA 2OZLB 3TFOA 2PXAA 2XGOA 3O8QB 1XTQA 4E5NA 4BQRA 1XD8A 4HX2A 3V8NA 4B73A 1ZA2A 1L7VC 1OFVA 1R66A 3LX8A 5CBPB 5IBCA 1HYBA 4JC0A 1KJWA 4OCZA 3UAXA 3OY2A 5LMUB 1QK3A 4D4LA 2C0QA 3ROFA 1DX6A 1ZVQA 1R6XA 3BX1A 3BYZA 4LY3A 3UO8B 4A1OA 4BGUA 2O8CA 3IBFA 3TQQA 2N47A 4M8NE 3H19A 1J9EA 1OIWA 3D2BA 4LX0A 3P9RA 2VYND 4W5HA 1YB5A 2PVCA 3GMSA 2Q5IA 2AT1A 4C0KA 4KIJA 4M8KA 3TM4A 2HCRA 1FDTA 4DBLC 1GZ3A 1XEAA 3A2LA 3RRXA 5DT2A 3QF4B 5JE8A 3WO1A 1CP2A 4PLGA 1U8YA 2J9FA 3DZHA 3UUGA 1I4WA 1QM5A 3U26A 3UVEA 3V7NA 4B6SA 2QTVA 3LUDA 1DNPA 4MWEA 4KGXA 2IBMA 4WZ6A 4U3JA 3L6CA 2ZDHA 3CVUA 5KTOA 3GJQA 1J49A 3KL2A 3LSTA 4N7JA 2Q3BA 2OCXA 2WFMA 1D2NA 1T8YA 5CT9A 1S4QA 4C5CA 5JAHA 4KR0A 4ZJPA 1YQDA 2F7SA 3IQIX 1G21E 4MROA 4GR5A 4ASUD 2Q0SA 4MV7A 1TMKA 5CW1A 4UCQA 4MGYR 2AW5A 2Z2KA 2ZTSA 1NVAA 5ICFA 2W2NA 5EJ9A 2NVUA 3EXFB 1TGYA 1OFUX 3OEED 1GCGA 2OP1A 1JFLA 4QSMA 3V7UA 1YUMA 3TLJA 5J2TF 3L7DA 4Y2VA 3DJFA 4FW8A 4UUMA 1I4DD 4L4UA 4AK9A 2WUEA 4RLFA 2WJ3A 4MR9A 5DHTA 3LKDA 3MSXA 1ESNA 2HQBA 3K0FB 5WRFA 1CFJA 3HBNA 3W2TA 5AI9A 2I4IA 2PNFA 3FF1A 5EKXA 3ZY3A 1OTYA 4KNVA 5HJ7A 3THYB 1UK9A 5SYAA 2VP6A 4DQDA 1WA5A 2OYSA 5EA2A 4DUZB 3ADKA 2DBRA 1LBQA 3IUSA 2Y8EA 4U9IS 4BIIA 2FW7A 1YVRA 4EKIA 3UPDA 3PHBE 1RDFA 4M60A 4P5EA 2P0EA 4YO8A 4TYWA 2IS4A 1NLYA 2UZ4A 2L18A 5C5CA 2V96A 1T6ZA 4XAQA 3FKJA 4EJ6A 4L9RA 3HVJA 3ZNNA 2R84A 5J5VA 5TNXA 1GUDA 5J4VA 1F06A 4BVJA 3WYGA 3LGSA 4ZU3A 5M34A 4PYOA 1Y4DE 1VMKA 1ZN7A 1S01A 2K4MA 3CZMA 3FYUB 4MV4A 4O08A 5ALDA 3HCEA 3MTAA 2WWXA 4X65B 2CLIB 3P0FA 3C3YA 1TYCA 2RAUA 1U5AA 3NETA 1WUKS 4GP7A 3LPLA 4YREA 3R74A 4AUEA 4J29A 4GT1A 1ODTC 5C34B 4HQ0A 2H1SA 3E5MA 3PGJA 5AH0A 4L95C 4AW9A 2WTUA 1M6WA 1NRIA 1ZM3A 4ZXFA 2WG2A 4QEDA 4YRAA 3TGWA 5EMJA 3KDSE 4LJKA 1TKBA 4UBIA 3RIGA 3VR6A 4OV6B 4DPLA 3KYIB 3D2CA 3KR0A 4E07A 3S70A 2W90A 1Z4LA 5ALYA 3Q0IA 4OLFA 4S1NA 3D4OA 2NQTA 3R5TA 2AK3A 2I6QA 2HXSA 3FR7A 3RT1A 1QLWA 1DUVG 1RADA 2IKQA 2QVBA 3RC9A 4UM5A 1JRLA 2NPIA 2YHIB 5LD2C 4D8WA 3P45A 4Q00A 1NF3A 1VPTA 2FN9A 3BBLA 3C1UA 3FHOA 4M8IA 4OJMX 4TS9A 4Y2RA 3KAQA 4NNOA 5CT6A 5AKLA 5H68A 1L1FA 2R97A 3MUFA 4DMGA 1D2RA 3IUBA 3RC7A 3WMWA 3KSRA 3H6KA 4GQBA 4BFLA 2CDCA 5BR4A 5AJVB 4R0NA 5L6LB 3UWDA 1CNEA 3GHHA 4P4SA 2JW5A 1T29A 3TX2A 1OILA 3O74A 4QQNA 2BM8A 3R09A 3R3VA 1T0BA 4ND6A 3TW8A 2N0SA 3H5IA 3SZUA 4O4LA 2OHXA 3S99A 3LIIA 3U1BA 5T4FA 1C3EA 4OGLA 5LQUA 1ZIDA 5A4DA 3ORYA 3IT2A 4BN4A 4B2LA 4G0YA 2H2IA 3KAKA 1FZQA 3HMKA 2GPSA 3N9IA 2ABWA 1E5VA 2VP4A 5K45A 4WY2A 2XQFA 4ILKA 1IUNA 1HFKA 4UNRA 1ZN8A 2QTMA 3DZCA 4GECA 2W2LA 13PKA 1E5DA 3GBSA 3GB9A 1TTTA 1UJ4A 1BMTA 1CWUA 2NNLD 3OLXA 2YBEA 4BRWA 2YWFA 2H5EA 3AB7A 3F47A 1KI8A 1LVGA 3GDHA 2QTTA 4J0DA 4LI0A 4ZOAA 3DF9A 2VHXA 2D4AA 4LDNA 3B13B 4K81B 5DNDA 3J81k 1NNLA 2IIVA 1IE3A 4URHA 5DHRA 3EC2A 4UHKA 5THQA 1H8EA 5DX0A 4EVRA 1YE8A 1BKDR 4GQIA 1T6BY 4AXBA 4AAYA 2DR2A 4I5DA 2JPDA 1ORWA 3I0ZA 2QT0A 3RBAA 3N2EA 2PZ8A 1G16A 3PUIA 4NATA 5BV1A 3IBYA 3AP1A 4JBXA 2CV0A 2LUOA 4IKOA 2OFXA 2OD7A 4KHPB 2PS3A 1I5OA 3ZQ6A 1L4HA 4CQJA 3L0CA 4FMDB 2OENG 3BMQB 1SCUB 4HS9A 4MMYB 3FOBA 1OTXA 5EYPA 4H6PA 4WLEA 3MPOA 4R6WA 4R2LA 5EZYA 3CRMA 1FNDA 4OHYA 3K9WA 3CLSC 1ZIOA 2WTMA 3O91A 4FKBA 2ALJA 2RIRA 4Y2JA 4FGLA 1OH8A 3CPEA 4AJJA 1E1MA 4L4XA 1CLEA 2EW1A 2ZXEA 3RV3A 1QONA 3CN7A 1SAYA 3GRFA 3ZDXB 3NHKA 3IEKA 4YJ3A 1OX6A 3EXEA 3HMQA 3EBLA 1PLKA 1RI1A 3CLSD 4BYGA 4DKJA 1M2GA 5C37A 3FF4A 1Z4KA 2RH4A 3DDWA 3IP3A 4U2GA 2ZUFA 1X6VA 4Q37A 3UJ6A 2QR2A 1KQGA 3FSRA 4ENSA 1LB1B 2H1LA 2SICE 4GM0A 2ZIUB 4X20B 3A14A 3E1SA 2NXJA 1UKCA 5BR1A 1R4NB 2CLHB 2YXDA 3EWNA 3VISA 3ZTTA 5AVTA 2YVQA 3PX3A 5E3HA 4DRXA 3S28A 5E6UA 5JNVA 1X1CA 3AESB 4OATA 1M5UA 1GU7A 4LNAA 2CE2X 2V6FA 3UQZA 4BCBA 4C4AA 1OFGA 3RIXA 1RKVA 2CLLB 3OEHA 1M6VB 2VUUA 1KMNA 2GXAA 4ARIA 1PGNA 2NT4A 2PY6A 3QXJA 2ZBUA 3VSBA 1Q95A 1T9DA 1VHJA 3ZIUA 3C3XA 3LKBA 4JL6A 4ZV4A 1XVTA 5F51A 4PQRA 1NE2A 2DPXA 3HV2A 3WJ2A 1RZRD 1RXUA 2WJHA 3L02A 1KU6A 1K3TA 1BHQ1 1QGOA 2OILA 3C74A 1PJQA 2XX3A 1ZONA 3G17A 3HJHA 4BXOB 5E7JA 1VYVA 3V4ZA 3INTA 5AI4A 1GZ6A 4TWRA 4FYHA 2GBLA 1NY6A 3FTQA 3MOSA 3KG2A 5AHKA 4BNTA 5JYDA 4IFBA 1L9XA 1Y8RA 5A05A 2FWIA 2HM7A 5EIWA 4RWEA 3CUUA 2G08A 4G2NA 1CZOA 3FMGA 1U7HA 1I8TA 3NHUA 3NI2A 1GUFA 1ABFA 1ZI9A 2W9XA 1VKRA 4PZZA 1X2BA 2KPOA 1SFRA 2IK8A 1KFCB 3GJ0A 4FK8A 4MKXA 5BSVA 4OHUA 2XDQB 2A9FA 3R3WA 2EZ8A 5B3KA 1NIPA 1ZDMA 4CVNA 4DR1B 3TPCA 2EZTA 1IHPA 4Q48A 4WUVA 2V6GA 2E6UX 1M2NA 4Z86A 3KYDB 4IIGA 3NVAA 3I61A 1PD0A 1WQ1R 4EY4A 4DUYB 2CE7A 3C16C 3NBZC 5HFJA 5C8VA 1GUBA 1UFVA 1UDBA 3C1OA 2D5IA 3EZ6A 4OYRA 1XZHA 3DFIA 1ST3A 2Z5GA 2EC5A 2X8JB 1WCIB 3FDZA 4MHSA 1NJ2A 3QTBA 3PVSA 4TKVA 4QDJA 4TYPA 2D2EA 2NXNA 3KV3O 2NXEA 3M6MD 1WOMA 4OHKA 4DCVA 4A2PA 2PZAA 4ABYA 3DM5A 3B5JA 5TQ2B 4HMQA 5FQOA 1A1SA 1C7RA 1V3VA 2BD0A 2R8RA 3PHCA 3SXJA 1R0WA 5ISMA 5NULA 2Q62A 1YZLA 1WE2A 3JRNA 4ZU6X 1IMJA 1AS3A 4A6XA 2C9BA 2GNPA 3RS3A 1FFYA 5MN6A 1RWMA 3P9SA 1U7ZA 2FGKA 4LGMA 1WSDA 4P36A 3UAYA 4DV4B 1CX9B 1O5OA 1RRVA 2YZMA 1HLDA 3DAFA 1AXGA 4GSYA 1E1CB 3EDMA 2QRUA 4UU8A 1GNVA 4W63A 2QN9A 2IX9A 1QF6A 3MJTA 4G1UC 1HDIA 2AQKA 3KUDA 1KDRA 1HI9A 2OV2A 3GN2A 2OQ2A 3L05A 5FA5A 1CNMA 1HOTA 2D74A 4IFEA 3DVRX 4B3HA 1WKVA 2QJFA 1NXTA 2I22A 4BZPA 4ZEVA 5F23A 1E2HA 5AJUA 2D2IA 3GFGA 4WMLA 3WLJA 1DAOA 4YMSA 4KO2S 4IV5A 5CG1A 2HCBA 4CCWA 1QIMA 1JEQB 4M1EA 4B2IA 2ZR9A 4NZPA 1M66A 1Q7CA 4IJQA 1VPDA 2FOLA 3THWB 5TGZA 4P4UA 3I04A 4B7UA 1FFXB 2O4CA 1G7TA 1KVQA 2YINC 2YVKA 2J3QA 5YASA 1JE1A 1M8FA 3BB3A 4PRLA 3RYFA 5JISA 1XQ9A 2G0NA 1S4MA 2HIGA 2VHTA 2X1HA 1DC7A 4FOPA 3DDSA 4U7PB 5ALSA 5BSMA 2YHAA 5IZCA 3EXAA 3NVKI 1L5RA 5CFNA 2ZWMA 4XPZA 1OYYA 1W29A 3MF4A 4EL0A 4PSKA 2DMRA 2C83A 3ZUGA 5I7FA 1U1GA 4NBLA 4AKSA 3NEPX 2ZIEA 1U0LA 2HSEA 3IPRA 4I3FA 1ZHHA 1OZ0A 4LBVA 2BGRA 4F06A 1EUCA 1DX9A 4BV9A 4L9WA 4D9FA 3IAXA 3OOEA 3MEQA 2QG6A 4O2BA 1CLUA 5DM2A 3HEAA 1YUBA 3D5EA 3O75A 4QRHA 4B4WA 3PRJA 4BBPA 3IVXA 121PA 1J23A 1DAMA 3O3OB 1Q20A 5KOJA 4KLRA 4KZPA 3KVOA 3A6LA 4IKPA 1GDTA 4QOGA 5ALTA 1ECPA 1MOSA 4GRIA 4YHHB 3TLMA 3V1TC 3M1AA 1UAAA 3L8CA 1J2YA 1U99A 2B98A 2X77A 1ZC4A 4KVFA 3ROTA 2PCJA 2OAGA 2XZDA 3MQ2A 4WNCA 2BGNA 1ZS9A 3ZJUA 3ER6A 3OF3A 1JQDA 2VNAA 4MB2A 4R41A 1HL7A 3PWZA 4CT5A 2B21A 3O8CA 1QZXA 2XUJA 1SXJE 4C0LA 1ICEA 5AUNB 3O2QB 4D92A 2PX0A 4BFVA 2P9JA 2WJZB 4I6EA 2PMWB 4B5LA 4BO8A 3G2HA 3UT6A 2PN1A 3GT7A 1Y6ZA 2WKPA 3KB2A 2X4GA 2J59A 4LZWA 1XPJA 2YIVX 5LYJA 1J6UA 1D6MA 4EA8A 1W73A 4HDRB 4MVJD 4C7MA 2CXPA 4C0QC 2A0KA </