4PD4F

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4pd4F00
1BGYH 3CXHF 1KYOF 3L75H 3L74H 1SQBH 1P84F 1SQVH 3H1HH 3H1LH 4D6TH 4U3FH 3L70H 1NTZH 3H1KH 3BCCH 1EZVH 1PP9H 1PPJH 2IBZH 4PD4F 1BE3H 3L71H 2A06H 3CX5F 1L0LH 2BCCH 2FYUH 1NTMH 1L0NH 5KLVH 1SQQH 1NU1H 1SQXH 1BCCH 3CWBH 3L72H 1SQPH 3TGUH 3H1JH 3L73H 3H1IH 1KB9F 1NTKH
chains in the Genus database with same CATH superfamily
3OUFA 4CZZA 1YHQV 3RW0A 4MVQA 1SF9A 3K04A 2Y48A 1HR0O 4LFAO 3T1HO 3LNMB 5AG2A 2KKWA 3VQYA 1WNSA 2GV9A 2QWQB 1W0JG 4F4LA 1JOYA 1AJQA 1Q81W 1V55B 1XI1A 1FXHA 2HJDA 3ZN0A 4BW9A 2ZNIA 2ZR2A 3K9SA 3DGEA 3L73H 1IBKO 1GM7A 4TQDA 5L3DA 1VEWA 1Y74A 2EIKB 3L75H 2QJ1A 3R66A 4UCSA 1DF5A 1H2SB 5CBGA 4KUMA 3G80A 1QU7A 3SYOA 3IC7A 4JYBA 4B3MB 4LNUB 2QE7G 2QEXV 1KP3A 1GH6A 1WN7A 3MHHC 3B8MA 2OCHA 4GKJB 1R3KC 1B6QA 4PV1B 3EXAA 2NN4A 1F51A 2ZE8A 2MK3A 4OGQB 5LYJB 2CGOA 1IDSA 4MVMA 4IT5A 5KX5B 1NJIW 2YS8A 4NXMB 1NTZH 4CC5A 1QR9A 3K08A 1OZ0A 4XBFA 3D36A 4NR1A 4IIJB 4X65O 1NT2B 5JH7B 1AJNA 1JMKC 3DC6A 5A2QN 4ZKIA 2F43G 5J2UB 2QGNA 3IAYA 1WA8B 1Q6HA 1AILA 3EVKA 1EBOA 5B1NA 1JX9A 3EHBB 3OMNB 1UPGA 4ZOLB 4LFAB 2QM8A 3ASOC 3T1HB 4DR1O 3ZHVA 2ZXWC 1QHTA 2LFRA 1MA1A 1KBHA 4BWAA 3RYHA 2P5OA 4IYHA 3KKYA 1QVGU 3SPGA 1SETA 3E8BA 3LSSA 1IBKB 3X2QC 5CA3A 3GVMA 3BRCA 3B77A 3ZHSA 1ORQC 3CXCU 3HKDA 1LNQA 1AP5A 1H2LA 1BL8A 3FB7C 4DV1O 2E76B 1AI5A 1ZL8B 3ZIAG 1MG1A 4UFZA 2ZT9B 3OD4A 5J2TA 1FS0G 4GX1A 4ZI7A 3CC4V 1EZVH 2P22C 1PPJH 1DK1A 2JJ1G 3APQA 2JGDA 1RM1C 3PJSK 2CK3G 1EN6A 3SPHA 5H5NA 3C3TA 1VF6C 3JASB 3E8GA 2LQTA 1Y76A 3UQ8A 3CEIA 4XDLA 4D7SA 1IX9A 2P4KA 3UT5A 4KFMA 2HLDG 4WFFA 1XMQO 2IW5A 3N2GA 4X65B 4C7UA 1FJGO 1K3EA 5GW7A 5KLVH 4Q6GA 3VQXA 1N0NA 2Q68A 3AG3C 3ABTA 5EK0A 4JI5B 1BGYH 3ZRVA 1FD9A 4ZIBA 3D36C 4YIOA 3FD9A 1PKXA 4DR2O 4AI8A 2QWRB 1MZFA 2A79B 4JASA 4LF5O 2P7TC 4YY3O 1SZTA 4DR1B 3OR6C 1GM9A 3JD0A 3BPZA 1GKFA 3KCXA 4G28B 2RMKB 3MHSC 2RJZA 2ZCEA 1W59A 1Q3EA 3E8FA 1P4RA 1TAEA 4NB5A 1MOFA 3CRRA 4PDMA 4B7KA 2KG7A 3F7YC 2DQ3A 5TISZ 3WFVA 2QM4A 3SJBC 4LP8A 5CA1B 4DV6O 2DMXA 2OCCB 3I56V 4DV1B 3RT3C 2UXBO 2QKCA 2CTPA 5IYBO 5LXTA 3G67A 1FFTB 1N32O 4YJ3A 2YUAA 1J5EO 4MVRA 4QGPA 1S5JA 2WLHA 4DRXA 1OCZC 2PYJA 5E79Z 1N34O 2WLJA 1GM8A 2JVDA 2UXDO 4DUZO 1CPYA 1OCCC 4AHCA 4WF9V 1Z5WA 3AK3A 4O4LA 2XT9A 5L3GA 5B3SB 3H1LH 1AI4A 4MVOA 5E1AC 2IBZH 1R1BA 1I94O 4RUFA 1QQCA 4FFBA 1GAXA 3AG7A 4PJ0Z 4X62B 4FLZA 1I0HA 3RN4A 1SQPH 4H37A 2CH7B 2QSAA 4LR3A 3HKCA 3ASNC 4DR2B 2JEUA 1Q7YW 2R9RB 1M9NA 4LF5B 3CCSV 2ITDC 4YY3B 4MS2A 4LF9O 1FFXA 3UCSC 3TXQA 4I50A 1E1QG 1G1XB 5ITZA 3B40A 2XOKG 3RBZA 2HVKC 3RYIA 3IGAC 3ASOB 5BY1A 1MMMA 5IY5C 3SPJA 1GK9A 1SA0B 5C8YA 5JWPA 2ZXWB 1H2NA 1LUWA 4DV6B 4EEQA 1MSDA 2UXBB 2IH3C 1MABG 2P90A 2Y0PA 5D5PA 3ZHTA 1N32B 3K06A 1YITV 4JI0B 2AXTZ 1J5EB 2ZKOA 3LUTB 2QA4V 3A0HZ 3QNEA 4MTGA 1BSMA 1N34B 3P30A 4LF8O 1JR9A 2E75B 4DYLA 2GDSA 1KP2A 4GCZA 2UXDB 1KD1W 4LF6O 1TUBA 2QTOA 3K0DA 4DUZB 1R3IC 1VQ6V 1K73W 5CB4A 1H8HG 4UVCA 1Q6IA 4O2BA 3CXHF 4Z2WA 4FJCC 1P84F 1VF5B 1ZLZA 2UUBO 4UB8Z 4B08A 1I94B 5IYZA 2RNBA 2XUMA 3ZMVA 4FM1A 5IJ0A 4R8CA 1RSOB 5BXZA 4WFGA 5KMGA 2EJ7A 1VQ4V 4H33A 3CYOA 3CCVV 4K8ZA 1M57C 4Q20A 1SQBH 5GONB 3A2FA 4LF9B 1YVWA 1KKCA 3DXRA 2OTJV 4NTWA 3CRMA 1XMOB 2ADPA 2YXYA 3K03A 4JI1O 1NVPB 2UUAO 3OT7A 1H38A 1SC5B 3AG1C 1OV9A 4B3SO 4I55B 1U96A 3GWOA 1PV0A 4MT8A 5C93A 4YJ2A 4WBNA 1YF2A 2E74B 3A0BZ 3AG2C 1H2MA 4GZRB 1K92A 4UUJC 1Y66A 2QWOB 4DUYO 4O4JB 1P7GA 5B1BB 3MD0A 2YIDA 4CC6A 1NH2D 4FM0A 2ODMA 2DWEC 4ZBMA 1HP8A 5FLXN 1K33A 2R72A 2HHHB 1QLNA 1F7YA 1VMGA 4LF8B 3M7MX 1XL4A 5L3FA 2A9HA 5IJ9A 2YICA 4LF6B 1VQ9V 3ZEDA 4HBNA 3N27A 1M93A 3G4SV 4FFKA 2LJ2A 3TJTA 2A06H 3CPWU 3HKDB 1MSWD 2B1IA 5EBWC 3J7AU 1BCCH 2FMLA 1WPBA 2UUBB 5KA5A 4HAMA 2PGGA 3G6BA 3WG7C 4W4KA 1JCHA 1TVKA 3FYIB 4IHJB 1OHHG 1OCRB 2HJFC 4JI7O 2VS0A 1O9HA 2B1GA 5K1XA 3RVZA 4RUEA 4KP4A 1H8EG 4K3AA 1R73A 3ZJZA 3RYFB 5IE9A 3UT5B 2A3QA 4JI1B 2UUAB 3JD2A 4B3SB 4LBEC 5LMNO 3ML0A 4RQFA 4KHPO 4PI2A 1H2KA 1NR7A 2NNUA 1P49A 5DM6V 5LHIA 5FNVA 2ZIOA 3ZMSA 4FZ1A 4TUYB 2WLLB 4DK1A 4DUYB 5B1AB 4GX2A 4YIPA 3ABLB 5CA0A 4W4LA 1Y6XA 1RP3B 5IY5B 2ZIMA 2P67A 4JI3O 1XL6A 1YIJV 3BHPA 1E79G 4FK5C 3TXSA 4DXWA 1AR4A 4X1YA 1GN3A 3FB6C 1V9PA 3CSXA 2H3OA 3CRQA 1EFRG 3LDEA 2EIJB 3NXSA 3VBBA 1GRJA 4GLXA 4CH6A 1M4UA 4U3FH 4CH4A 2HKOA 2RDCA 3F5WC 3NR7A 5EC1C 3JAWB 1NH2B 1J95A 2YIAA 2M6YA 2PY5A 1PD3A 2OTLV 1PNKA 4YJ3B 1AVMA 1YI2V 2DYSC 4YHHB 4JI7B 2PF4E 4DRXB 4I4TB 5FL7G 4X1KA 1O9GA 4I9WA 1VF6A 1PNLA 3BEHA 3ETDA 2EIMB 1B04A 2EZPA 4QJFB 2OT5A 3BVOA 3JATA 1URFA 1CXZB 4X9QA 2VWJA 3IFXA 1N0JA 3IJ4A 1BHAA 2X6CA 5LMNB 4LF4O 2WLIA 2XAJA 4UV8A 2Q7EA 1XILA 2DJVA 1M57B 3K3WA 4DR6O 4KHPB 4FFBB 3CHXA 3CCJV 5IDJA 1RPRA 3SDLA 5LOVB 4J9ZB 2XAHA 3OW2U 2JGUA 3C90A 3HKCB 4JI8O 3AG1B 3CP1A 1N33O 2BOCC 1R6TA 2F95B 5LGNA 3CJHA 3OUSA 4N21A 4Z1MG 4JI5O 4O4IA 1FFXB 4JI3B 1JJOA 4DV2O 4DV5O 2QR4A 2LGWA 2JEXA 1VQMV 5A9GA 3UO3A 4TV9A 3RYIB 2DYRC 4X1IA 3QTCA 2LFSA 3J81N 3QF7A 1KYOF 2EILC 3IC9A 5DN6G 2FTKA 1Q90D 4NYKA 4FMTA 1Y67A 3JCUZ 2P06A 3SYCA 1W2BU 3LDDA 1BE3H 2K9PA 3E35A 3ABKB 2N05A 2Q0AA 1AP6A 4MSWC 1YJ9V 1YTFD 1G6UA 4P9OA 1I7FA 3FYEB 1FPOA 3ZMTA 1TGOA 5IWAO 3H01A 1BS3A 3P3PA 4B3TO 4U3JB 1XREA 5L3BA 3SJCC 1JJ2U 2YEVA 2XAGA 4X20A 4OX9B 4CH5A 3PN1A 4CS4A 4O2BB 2EX3A 4TV8A 1VF7A 2F93B 1NTKH 4LF4B 2IJIA 2G38A 5IYZB 4DR6B 3OM3B 1GN2A 1WB7A 1EN5A 1OCOC 3K5MA 5JJNB 5IJ0B 2ARHA 4GT1A 2IM9A 2QM7A 4PA6A 3OEEG 5CN0A 5KMGB 4JI8B 1K5QA 1N33B 3N2KA 4X88A 4O4HA 2MW2B 3QO8A 1M56C 4G27B 2XTAA 3D8CA 4FPPA 2ZM6O 4OPHA 2XASA 2UXCO 2OIEA 4DV2B 3DXRB 4X62O 4DV5B 2WAMA 3W7WA 1OJHA 2Q69A 1WP7A 3F7VC 2B5UA 3ZRWA 2X7RB 4K8XA 2ZE7A 2ZE6A 4YJ2B 3WB0A 4WBNB 2W6JG 5HFMA 3M99B 1NZ6A 2EINC 2Q67A 1AR1B 4H0LB 5JVDA 5BMVA 1UJWB 4P2ZA 5B5EZ 1XHXA 1K97A 4TT3G 5EYPA 2Y69B 2ZDIC 3DSQA 3JYCA 3E89A 1LR1A 4JTAB 1AR5A 4DW1A 2WLNA 1KU9A 4PD4F 1QVFU 3CRCA 4CH3A 1JVMA 1KQSU 1K4DC 5KHIA 1ZTEA 1YDXA 4HNAA 4EKWA 5BR8O 4UXNA 3LSUA 5IWAB 4B3TB 3B8NA 3K5OA 3VQVA 1M5IA 1Q86W 5L3EA 4BAYA 3DC5A 5JJEB 3E22A 4JI0O 1VP7A 5LA6B 2B9ZA 4UCRA 2ATKC 3ZRXA 1NU1H 2CGNA 1N8RW 2E3CA 5DECA 4LF7O 2WA3A 1IVSA 1AB3A 4NKGB 2YXLA 1TVKB 1HNZO 2YI8A 3JALA 3CD6V 4JYCA 1GO3F 2LW7A 3OMAB 4JAAA 1FXKA 2BTQA 4CBCA 5F2VO 4F6RB 2ZM6B 2IJKA 1B06A 4QE9A 2UXCB 5FPRA 1K8AW 4K0KO 2IH1C 1TUEB 4UB6Z 3JD3A 3HPLC 1HNXO 2N74A 3TK1A 2UXNA 2A0LA 3OE7G 3S3WA 5KX5A 3ZBHA 4DV4O 3D3QA 4R7CA 4G2KA 3JARA 5EBLC 1V54C 2FYUH 5FNVB 3BAAA 1XMOO 1SQQH 1YXBA 1WPXA 3ZX6A 4JV5B 4IIJA 1M1KW 1DGSA 2Z0AA 4QPKA 2JS5A 3U0ZA 1HW7A 2ZQMA 1IBMO 3SJQC 3KCYA 1K5SA 3FFQA 4DO2A 3RGBA 1R3JC 4PELA 3SYAA 4AQYB 4X1YB 4I9QA 3HR0A 4IL6Z 3K9AA 5BR8B 4J10A 3WB1A 1B3QA 1BQ0A 4JYYA 3FKSG 3X2QB 1JPXA 4ZOLA 1I08A 3CCQV 1RFYA 3T1CA 1YEWA 3U11A 1R3LC 1X4TA 2HHHO 5KHHA 4UCVA 5KHJA 3WU2Z 4LF7B 4H44B 5B1OA 1HNWO 1PM9A 1Y4MA 5GTIZ 1Y74B 1HNZB 2RCVA 3Q4HA 1RM1B 3T1YB 2UU9B 4E4EA 3QO7A 2HR3A 1KMIZ 4X1KB 3APOA 4JTDB 1V55C 4NTXA 2KSDA 2Q9LA 3ZHRA 3I5DA 4K0KB 1Z2GA 2IU3A 2BSKA 2CAZC 4U7OA 3G71V 2Q5ZA 2EIKC 1HNXB 1FXKC 3E2EA 2WLIB 1E1RG 3AG3B 1S76D 1K7DA 4DV4B 2GUZA 1F23A 2UUCB 2GSMB 2HP8A 3SGIA 2AW9A 4FLYA 3CCRV 3UKMA 2DN9A 2V4DA 4GX5A 2GTSA 4BR6A 4GYCB 1DTOA 4FLWA 3CJHB 3L72H 1IBMB 4R6ZA 1FYJA 1NBMG 2WSSG 4U7NA 4DV7O 4FM2A 1K34A 3E8HA 3U10A 1ZAUA 3CE2A 4QNHB 3ETEA 5KHGA 4AILC 1FXVA 3LNNA 2PUSA 1WJZA 2IU0A 2M7WA 5LBQA 4J7JA 3RYHB 3MAQA 2WA4A 2L35A 5DEDA 3J80N 2QKAA 1S5HC 3ZMZA 3W7XA 1YJNV 2OYQA 2HEPA 1HNWB 3A8TA 2F4VO 4JI2O 2DE0X 1YZBA 5LP6A 4JGSA 1OCZB 4WFBV 4HZ3A 2YIBD 3CCEV 4PDVA 2CTWA 5JQGA 5J2TB 4ZI7B 2L6LA 2Y0IA 1OCCB 4JF3A 1X59A 4YHHO 2JGDB 4DV3O 3L9DA 2ZR3A 4NXNO 1R6KA 3GB7C 5LHHA 3THOA 2XNDG 1Y76B 4LH7A 4LCUC 1SRYA 5B66Z 1FAFA 1W0KG 4N23A 3W7UA 2VQFO 4J9YB 3RVYA 3RYCA 3ASNB 3JAMN 1G8MA 1AJPA 2JK5C 3N2GB 4NTYA 3CB2A 4O4HB 2YSUB 2BTOA 2CTQA 5KHKA 4LFBO 4ICGA 5H9CA 3FAVA 4DV7B 3UM7A 1AROP 2CH7A 2HFEC 3A0RA 3UO2A 3ZRWB 5JCOC 1SERA 5KUKA 3OGIB 4OXSA 1ZUQA 2ZINA 4LWSA 3CCLV 5EZYA 1NR1A 2W6IG 1IZ3A 2F1MA 5EYPB 2C2AA 2LGQA 2JDIG 2WLKA 2VQEO 2F4VB 2KG7B 4X64O 4JI2B 4I0XA 3SPCA 2F23A 4B3RO 2V7QG 5LXTB 4P30A 2KQXA 5H2FZ 3AK2A 4JYAB 3M8AA 1GTOA 3CC2V 3E22B 2X0LA 4DV3B 4IYIA 4JAVA 4D6TH 1VARA 4NXNB 5LP6C 3AK1A 5KUMA 4D7TA 4MTXA 2OCCC 1S0VA 5BZBA 4BIZA 3ZHUA 1VQ8V 1VQKV 2VQFB 3JALB 2Q0OC 4O4LB 4OX9O 2ILMA 3O9OA 1F4NA 4MW8A 3K79A 2HVJC 1FXKB 1PNMA 2BTQB 2GHYA 3HKBA 1S77D 2YDEA 3H1KH 1WB8A 4LFBB 3CRAA 4RAIA 3CC7V 1SZXA 4ZHQA 4TOIA 1L0LH 3OEHG 1ZWIC 1MNGA 3BA9A 1GMGA 3JD1A 4CS3A 4JI4O 2RQ6A 1RSOA 3SYQA 5B3SC 4J41A 1EN4A 4O2AA 4MTFA 4FLTA 3AG4C 3ZS8C 3L74H 3BFRA 3E83A 2K1EA 3AG2B 4MVSA 4J42A 5GONA 3JARB 2QKSA 1CP9A 4I50B 1XBLA 5ITZB 1N36O 3ETGA 4JI6B 4QIWF 1Z5VA 2ZDIA 4K35A 2XHBA 4DV0B 4I55A 2Z5UA 4TQFA 1KKDA 5C8YB 2VQEB 4UVBA 4X64B 2NR5A 2FL4A 2EJRA 3HKEA 4QE7A 3ABUA 5EC2C 5IYDO 4EB6A 3BCCH 2Q7GA 3C3SA 4O4JA 4B3RB 1JFFA 3JAKA 4FIPC 2BOBC 1T5EA 3CX5F 3K5NA 1AI7A 3D3IA 5FPOA 1HR0B 3ETQA 2V1DA 1Q6UA 1NI8A 1XNRO 1NS1A 1XUQA 1GN4A 2WLMA 4JTCB 1TUBB 4RWUA 4NVPA 1D5NA 5LMUO 1I5YA 3WG7B 3FB5C 1G4YB 1P7BA 3Q4HB 5CB4B 1QR8A 1QLEC 2PI4A 4FLVA 2Y4TA 2VRZA 3BABA 4BIOA 2FB5A 2QWPB 1LUVA 2AZ2A 2O57A 2QWNB 2Q6AA 4J11A 3TCUA 2EULA 3L70H 4J80A 3E86A 2BSKB 4ASUG 4H13B 4JI4B 4IHJA 3L71H 2Z3YA 5EIBC 1Q82W 3ZCCA 3P32A 5CMUA 1AI6A 3QG5A 2YXHA 2ZE5A 5IYCO 1A32A 5JJJB 4RO2A 5J9PC 1VQ7V 2GUZB 3RYFA 2LP7A 5IT9N 1K4CC 1N36B 4B7EA 3K57A 1PP9H 2DW4A 1DF4A 2GTAA 2CUGA 1L8DA 4GUNA 2R9AA 2WWWA 4WFAV 2HG5C 3H1JH 2D3OW 3SYPA 2WPDG 2LW1A 3CMAV 4DR4O 4TUYA 4JV5O 4P9PA 2WLLA 1ZX3A 2EBOA 2X6BA 2XAFA 1VQ5V 4DK0A 2Q7HA 3ZMUA 3LDCA 4JPRA 4UCTA 4AQYO 1PL0A 1XNRB 4IGGA 5K1PA 1S72V 4PA9A 2ADQB 5IJ9B 5B1BC 3VOUA 5LMUB 2E5LO 1RPOA 4X89A 2AHYA 4J7ZA 2DYSB 2BE3A 4JZGA 3G6EV 5LP6B 1PL4A 1S3JA 4DW0A 5EIBD 4L8JA 3B2EE 5JQGB 3JAWA 3ABMC 3JSNA 3MDSA 1YTFB 2Q4PA 1ZSPA 3LSQA 1VQPV 3T1YO 2UU9O 2YIBA 2X6AA 4DR5O 4PDLA 4MVZA 3HB3B 5LGUA 4I4TA 1SKVA 3STLC 2QDOA 2CDYA 1BT8A 1SQXH 4LH6A 3OAAG 2W0FC 4LNUA 1KB9F 2GBOA 3K5LA 4DR7O 3RYCB 1U97A 1VQNV 1FKAO 1OCRC 1XMQB 1VQOV 1FJGB 5LYJA 4FLXA 3AG4B 1NVPD 2ITCC 4J7KA 1EM1A 2UUCO 1SESA 1VIBA 3FAVB 5CBFA 2D2CB 4FVMA 5LOVA 4DR4B 1VQLV 3OMIB 4MW3A 3R65A 4TWKA 3OFNG 4UV9A 5CA0B 5JH7A 2H94A 5LHGA 1R6NA 2R9IA 1WLEA 2DYRB 3ZRSA 4JAUA 4LWSB 3WB2A 3BY6A 3H1HH 4XDKA 2Q8VA 5J2UA 5EZYB 3BA8A 3K59A 3SPIA 2EILB 2YC0A 5KAIZ 5H6RA 1US6A 2PZSA 1WA8A 3QVNA 4LFCO 5B1AC 4TSFG 3ABLC 3EFFK 2E5LB 1ROPA 4GKKO 4JZ2A 1XDCA 5GTHZ 1Q43A 5EBMC 3F5TA 2PI5A 2JS3A 1EZJA 2UXXA 2RN9A 5HFLA 1I5XA 4I0XB 3KG2A 4KXRA 1YSCA 2CTRA 4FLUA 4YXWG 4E2LA 2PYLA 3KZIZ 4F6EA 1COWG 2EIJC 2JIZG 1QLEB 5D5QA 1D5AA 4DR5B 2ZD9A 3FB8C 2R70A 1SQVH 3B09A 3OTFA 4CS2A 4EFBA 1ZL8A 2EZOA 2H8PC 3JATB 4PHZA 4U3JA 1OCOB 2DOSA 4PDRA 2IJJA 1WP8A 4EFEA 2NLJC 4DR7B 4PA3A 3CCUV 1BQZA 3CWBH 1XEQA 3K58A 1M56B 3HKBB 4LC1A 3O65A 3JASA 2XAQA 2EIMC 1NQTA 2JRIA 4HYOA 4ZHQB 2VWKA 1YJWV 4OPAA 1KUQA 1UFIA 2BCCH 3STZC 5JCOA 2F66C 4O2AB 1BZKA 3T4DA 1SQFA 1THZA 5H6QA 1IXBA 3JD4A 2EINB 2OIGA 2QTSA 3K0GA 4O4IB 3CCMV 3JCZA 4WFHA 1K9MW 1NKDA 2ETNA 2P4VA 4LFCB 2KB1A 3ZHQA 4KL1A 4UCOA 4TV9B 4R50A 1KECA 4FZ0A 3OR7C 5KA6A 4GKKB 1WAZA 4X1IB 2Q73A 3CMEV 2P6JA 2YI9A 1GN6A 1SS3A 3OTOO 3HKEB 4DR3O 2AHZA 4EB6B 1S5LZ 1JFFB 3JAKB 4WFEA 2LO1A 2FKXA 1XNQO 3S3XA 5KAFZ 1D2DA 2CE4A 4X66O 4WCEV 3ICXA 4PA4A 5CA1A 1YCIA 1IURA 1IBLO 3ABMB 1JQ0A 4JYAO 4MVUA 2A7WA 3W7TA 3ABKC 3FX7A 2YEVB 4XDJA 4ABMA 4X20B 3CS5A 2OWOA 1XHZA 1Q8IA 4I5SA 5LA6A 4BIUA 4TV8B 1L0NH 1QNMA 3OGCC 4L87A 1TA8A 1H2GA 1XOUA 4X8AA 2W0XA 1XQ8A 4PA7A 5L3CA 3RFRA 1N4CA 4BW5A 2PTMA 2DWDC 4QPJA 3RWRD 3N2KB 5LGTA 1ENVA 1Q5OA 1QBZA 1BMFG 1QCEA 4MTOA 3W7SA 5LL6Y 1NTMH 4F6RA 4B3MO 1DLBA 1JA8A 1V54B 3B4SA 1F4MA 4A5UB 4GKJO 4I7ZB 2JJ2G 3I55V 3DTUB 3GWKC 1IXMA 4UVAA 3P3NA 1HWYA 1HDJA 1BHBA 2Y4UA 5JVDB 2N04A 4NXMO 2IJHA 5BMVB 2ZNJA 1L1FA 3QO5A 1MZEA 3OTOB 3T4ZA 3TGUH 3TETA 4DR3B 4Z1VA 3H1IH 4UCUA 5CBHA 4JI6O 2AZ0A 3AEIA 1M90W 4DV0O 3SR2C 3ZN1A 2AGAA 4RQEA 1XNQB 2DQ0A 3SJAC 4PI0A 3T2MA 1SA0A 1KC8W 1CEZA 3H9VA 1SQGA 4X66B 3JSLA 4HNAB 1IBLB 2Y69C 3VQWA 4GX0A
chains in the Genus database with same CATH topology
1BGYH 3CXHF 1KYOF 3L75H 3L74H 1SQBH 1P84F 1SQVH 3H1HH 3H1LH 4D6TH 4U3FH 3L70H 1NTZH 3H1KH 3BCCH 1EZVH 1PP9H 1PPJH 2IBZH 4PD4F 1BE3H 3L71H 2A06H 3CX5F 1L0LH 2BCCH 2FYUH 1NTMH 1L0NH 5KLVH 1SQQH 1NU1H 1SQXH 1BCCH 3CWBH 3L72H 1SQPH 3TGUH 3H1JH 3L73H 3H1IH 1KB9F 1NTKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY H;  3CXH F;  1KYO F;  3L75 H;  3L74 H;  1SQB H;  1P84 F;  1SQV H;  3H1H H;  3H1L H;  4D6T H;  4U3F H;  3L70 H;  1NTZ H;  3H1K H;  3BCC H;  1EZV H;  1PP9 H;  1PPJ H;  2IBZ H;  4PD4 F;  1BE3 H;  3L71 H;  2A06 H;  3CX5 F;  1L0L H;  2BCC H;  2FYU H;  1NTM H;  1L0N H;  5KLV H;  1SQQ H;  1NU1 H;  1SQX H;  1BCC H;  3CWB H;  3L72 H;  1SQP H;  3TGU H;  3H1J H;  3L73 H;  3H1I H;  1KB9 F;  1NTK H; 
#chains in the Genus database with same CATH topology
 3OUF A;  4CZZ A;  1YHQ V;  3RW0 A;  4MVQ A;  1SF9 A;  3K04 A;  2Y48 A;  1HR0 O;  4LFA O;  3T1H O;  3LNM B;  5AG2 A;  2KKW A;  3VQY A;  1WNS A;  2GV9 A;  2QWQ B;  1W0J G;  4F4L A;  1JOY A;  1AJQ A;  1Q81 W;  1V55 B;  1XI1 A;  1FXH A;  2HJD A;  3ZN0 A;  4BW9 A;  2ZNI A;  2ZR2 A;  3K9S A;  3DGE A;  3L73 H;  1IBK O;  1GM7 A;  4TQD A;  5L3D A;  1VEW A;  1Y74 A;  2EIK B;  3L75 H;  2QJ1 A;  3R66 A;  4UCS A;  1DF5 A;  1H2S B;  5CBG A;  4KUM A;  3G80 A;  1QU7 A;  3SYO A;  3IC7 A;  4JYB A;  4B3M B;  4LNU B;  2QE7 G;  2QEX V;  1KP3 A;  1GH6 A;  1WN7 A;  3MHH C;  3B8M A;  2OCH A;  4GKJ B;  1R3K C;  1B6Q A;  4PV1 B;  3EXA A;  2NN4 A;  1F51 A;  2ZE8 A;  2MK3 A;  4OGQ B;  5LYJ B;  2CGO A;  1IDS A;  4MVM A;  4IT5 A;  5KX5 B;  1NJI W;  2YS8 A;  4NXM B;  1NTZ H;  4CC5 A;  1QR9 A;  3K08 A;  1OZ0 A;  4XBF A;  3D36 A;  4NR1 A;  4IIJ B;  4X65 O;  1NT2 B;  5JH7 B;  1AJN A;  1JMK C;  3DC6 A;  5A2Q N;  4ZKI A;  2F43 G;  5J2U B;  2QGN A;  3IAY A;  1WA8 B;  1Q6H A;  1AIL A;  3EVK A;  1EBO A;  5B1N A;  1JX9 A;  3EHB B;  3OMN B;  1UPG A;  4ZOL B;  4LFA B;  2QM8 A;  3ASO C;  3T1H B;  4DR1 O;  3ZHV A;  2ZXW C;  1QHT A;  2LFR A;  1MA1 A;  1KBH A;  4BWA A;  3RYH A;  2P5O A;  4IYH A;  3KKY A;  1QVG U;  3SPG A;  1SET A;  3E8B A;  3LSS A;  1IBK B;  3X2Q C;  5CA3 A;  3GVM A;  3BRC A;  3B77 A;  3ZHS A;  1ORQ C;  3CXC U;  3HKD A;  1LNQ A;  1AP5 A;  1H2L A;  1BL8 A;  3FB7 C;  4DV1 O;  2E76 B;  1AI5 A;  1ZL8 B;  3ZIA G;  1MG1 A;  4UFZ A;  2ZT9 B;  3OD4 A;  5J2T A;  1FS0 G;  4GX1 A;  4ZI7 A;  3CC4 V;  1EZV H;  2P22 C;  1PPJ H;  1DK1 A;  2JJ1 G;  3APQ A;  2JGD A;  1RM1 C;  3PJS K;  2CK3 G;  1EN6 A;  3SPH A;  5H5N A;  3C3T A;  1VF6 C;  3JAS B;  3E8G A;  2LQT A;  1Y76 A;  3UQ8 A;  3CEI A;  4XDL A;  4D7S A;  1IX9 A;  2P4K A;  3UT5 A;  4KFM A;  2HLD G;  4WFF A;  1XMQ O;  2IW5 A;  3N2G A;  4X65 B;  4C7U A;  1FJG O;  1K3E A;  5GW7 A;  5KLV H;  4Q6G A;  3VQX A;  1N0N A;  2Q68 A;  3AG3 C;  3ABT A;  5EK0 A;  4JI5 B;  1BGY H;  3ZRV A;  1FD9 A;  4ZIB A;  3D36 C;  4YIO A;  3FD9 A;  1PKX A;  4DR2 O;  4AI8 A;  2QWR B;  1MZF A;  2A79 B;  4JAS A;  4LF5 O;  2P7T C;  4YY3 O;  1SZT A;  4DR1 B;  3OR6 C;  1GM9 A;  3JD0 A;  3BPZ A;  1GKF A;  3KCX A;  4G28 B;  2RMK B;  3MHS C;  2RJZ A;  2ZCE A;  1W59 A;  1Q3E A;  3E8F A;  1P4R A;  1TAE A;  4NB5 A;  1MOF A;  3CRR A;  4PDM A;  4B7K A;  2KG7 A;  3F7Y C;  2DQ3 A;  5TIS Z;  3WFV A;  2QM4 A;  3SJB C;  4LP8 A;  5CA1 B;  4DV6 O;  2DMX A;  2OCC B;  3I56 V;  4DV1 B;  3RT3 C;  2UXB O;  2QKC A;  2CTP A;  5IYB O;  5LXT A;  3G67 A;  1FFT B;  1N32 O;  4YJ3 A;  2YUA A;  1J5E O;  4MVR A;  4QGP A;  1S5J A;  2WLH A;  4DRX A;  1OCZ C;  2PYJ A;  5E79 Z;  1N34 O;  2WLJ A;  1GM8 A;  2JVD A;  2UXD O;  4DUZ O;  1CPY A;  1OCC C;  4AHC A;  4WF9 V;  1Z5W A;  3AK3 A;  4O4L A;  2XT9 A;  5L3G A;  5B3S B;  3H1L H;  1AI4 A;  4MVO A;  5E1A C;  2IBZ H;  1R1B A;  1I94 O;  4RUF A;  1QQC A;  4FFB A;  1GAX A;  3AG7 A;  4PJ0 Z;  4X62 B;  4FLZ A;  1I0H A;  3RN4 A;  1SQP H;  4H37 A;  2CH7 B;  2QSA A;  4LR3 A;  3HKC A;  3ASN C;  4DR2 B;  2JEU A;  1Q7Y W;  2R9R B;  1M9N A;  4LF5 B;  3CCS V;  2ITD C;  4YY3 B;  4MS2 A;  4LF9 O;  1FFX A;  3UCS C;  3TXQ A;  4I50 A;  1E1Q G;  1G1X B;  5ITZ A;  3B40 A;  2XOK G;  3RBZ A;  2HVK C;  3RYI A;  3IGA C;  3ASO B;  5BY1 A;  1MMM A;  5IY5 C;  3SPJ A;  1GK9 A;  1SA0 B;  5C8Y A;  5JWP A;  2ZXW B;  1H2N A;  1LUW A;  4DV6 B;  4EEQ A;  1MSD A;  2UXB B;  2IH3 C;  1MAB G;  2P90 A;  2Y0P A;  5D5P A;  3ZHT A;  1N32 B;  3K06 A;  1YIT V;  4JI0 B;  2AXT Z;  1J5E B;  2ZKO A;  3LUT B;  2QA4 V;  3A0H Z;  3QNE A;  4MTG A;  1BSM A;  1N34 B;  3P30 A;  4LF8 O;  1JR9 A;  2E75 B;  4DYL A;  2GDS A;  1KP2 A;  4GCZ A;  2UXD B;  1KD1 W;  4LF6 O;  1TUB A;  2QTO A;  3K0D A;  4DUZ B;  1R3I C;  1VQ6 V;  1K73 W;  5CB4 A;  1H8H G;  4UVC A;  1Q6I A;  4O2B A;  3CXH F;  4Z2W A;  4FJC C;  1P84 F;  1VF5 B;  1ZLZ A;  2UUB O;  4UB8 Z;  4B08 A;  1I94 B;  5IYZ A;  2RNB A;  2XUM A;  3ZMV A;  4FM1 A;  5IJ0 A;  4R8C A;  1RSO B;  5BXZ A;  4WFG A;  5KMG A;  2EJ7 A;  1VQ4 V;  4H33 A;  3CYO A;  3CCV V;  4K8Z A;  1M57 C;  4Q20 A;  1SQB H;  5GON B;  3A2F A;  4LF9 B;  1YVW A;  1KKC A;  3DXR A;  2OTJ V;  4NTW A;  3CRM A;  1XMO B;  2ADP A;  2YXY A;  3K03 A;  4JI1 O;  1NVP B;  2UUA O;  3OT7 A;  1H38 A;  1SC5 B;  3AG1 C;  1OV9 A;  4B3S O;  4I55 B;  1U96 A;  3GWO A;  1PV0 A;  4MT8 A;  5C93 A;  4YJ2 A;  4WBN A;  1YF2 A;  2E74 B;  3A0B Z;  3AG2 C;  1H2M A;  4GZR B;  1K92 A;  4UUJ C;  1Y66 A;  2QWO B;  4DUY O;  4O4J B;  1P7G A;  5B1B B;  3MD0 A;  2YID A;  4CC6 A;  1NH2 D;  4FM0 A;  2ODM A;  2DWE C;  4ZBM A;  1HP8 A;  5FLX N;  1K33 A;  2R72 A;  2HHH B;  1QLN A;  1F7Y A;  1VMG A;  4LF8 B;  3M7M X;  1XL4 A;  5L3F A;  2A9H A;  5IJ9 A;  2YIC A;  4LF6 B;  1VQ9 V;  3ZED A;  4HBN A;  3N27 A;  1M93 A;  3G4S V;  4FFK A;  2LJ2 A;  3TJT A;  2A06 H;  3CPW U;  3HKD B;  1MSW D;  2B1I A;  5EBW C;  3J7A U;  1BCC H;  2FML A;  1WPB A;  2UUB B;  5KA5 A;  4HAM A;  2PGG A;  3G6B A;  3WG7 C;  4W4K A;  1JCH A;  1TVK A;  3FYI B;  4IHJ B;  1OHH G;  1OCR B;  2HJF C;  4JI7 O;  2VS0 A;  1O9H A;  2B1G A;  5K1X A;  3RVZ A;  4RUE A;  4KP4 A;  1H8E G;  4K3A A;  1R73 A;  3ZJZ A;  3RYF B;  5IE9 A;  3UT5 B;  2A3Q A;  4JI1 B;  2UUA B;  3JD2 A;  4B3S B;  4LBE C;  5LMN O;  3ML0 A;  4RQF A;  4KHP O;  4PI2 A;  1H2K A;  1NR7 A;  2NNU A;  1P49 A;  5DM6 V;  5LHI A;  5FNV A;  2ZIO A;  3ZMS A;  4FZ1 A;  4TUY B;  2WLL B;  4DK1 A;  4DUY B;  5B1A B;  4GX2 A;  4YIP A;  3ABL B;  5CA0 A;  4W4L A;  1Y6X A;  1RP3 B;  5IY5 B;  2ZIM A;  2P67 A;  4JI3 O;  1XL6 A;  1YIJ V;  3BHP A;  1E79 G;  4FK5 C;  3TXS A;  4DXW A;  1AR4 A;  4X1Y A;  1GN3 A;  3FB6 C;  1V9P A;  3CSX A;  2H3O A;  3CRQ A;  1EFR G;  3LDE A;  2EIJ B;  3NXS A;  3VBB A;  1GRJ A;  4GLX A;  4CH6 A;  1M4U A;  4U3F H;  4CH4 A;  2HKO A;  2RDC A;  3F5W C;  3NR7 A;  5EC1 C;  3JAW B;  1NH2 B;  1J95 A;  2YIA A;  2M6Y A;  2PY5 A;  1PD3 A;  2OTL V;  1PNK A;  4YJ3 B;  1AVM A;  1YI2 V;  2DYS C;  4YHH B;  4JI7 B;  2PF4 E;  4DRX B;  4I4T B;  5FL7 G;  4X1K A;  1O9G A;  4I9W A;  1VF6 A;  1PNL A;  3BEH A;  3ETD A;  2EIM B;  1B04 A;  2EZP A;  4QJF B;  2OT5 A;  3BVO A;  3JAT A;  1URF A;  1CXZ B;  4X9Q A;  2VWJ A;  3IFX A;  1N0J A;  3IJ4 A;  1BHA A;  2X6C A;  5LMN B;  4LF4 O;  2WLI A;  2XAJ A;  4UV8 A;  2Q7E A;  1XIL A;  2DJV A;  1M57 B;  3K3W A;  4DR6 O;  4KHP B;  4FFB B;  3CHX A;  3CCJ V;  5IDJ A;  1RPR A;  3SDL A;  5LOV B;  4J9Z B;  2XAH A;  3OW2 U;  2JGU A;  3C90 A;  3HKC B;  4JI8 O;  3AG1 B;  3CP1 A;  1N33 O;  2BOC C;  1R6T A;  2F95 B;  5LGN A;  3CJH A;  3OUS A;  4N21 A;  4Z1M G;  4JI5 O;  4O4I A;  1FFX B;  4JI3 B;  1JJO A;  4DV2 O;  4DV5 O;  2QR4 A;  2LGW A;  2JEX A;  1VQM V;  5A9G A;  3UO3 A;  4TV9 A;  3RYI B;  2DYR C;  4X1I A;  3QTC A;  2LFS A;  3J81 N;  3QF7 A;  1KYO F;  2EIL C;  3IC9 A;  5DN6 G;  2FTK A;  1Q90 D;  4NYK A;  4FMT A;  1Y67 A;  3JCU Z;  2P06 A;  3SYC A;  1W2B U;  3LDD A;  1BE3 H;  2K9P A;  3E35 A;  3ABK B;  2N05 A;  2Q0A A;  1AP6 A;  4MSW C;  1YJ9 V;  1YTF D;  1G6U A;  4P9O A;  1I7F A;  3FYE B;  1FPO A;  3ZMT A;  1TGO A;  5IWA O;  3H01 A;  1BS3 A;  3P3P A;  4B3T O;  4U3J B;  1XRE A;  5L3B A;  3SJC C;  1JJ2 U;  2YEV A;  2XAG A;  4X20 A;  4OX9 B;  4CH5 A;  3PN1 A;  4CS4 A;  4O2B B;  2EX3 A;  4TV8 A;  1VF7 A;  2F93 B;  1NTK H;  4LF4 B;  2IJI A;  2G38 A;  5IYZ B;  4DR6 B;  3OM3 B;  1GN2 A;  1WB7 A;  1EN5 A;  1OCO C;  3K5M A;  5JJN B;  5IJ0 B;  2ARH A;  4GT1 A;  2IM9 A;  2QM7 A;  4PA6 A;  3OEE G;  5CN0 A;  5KMG B;  4JI8 B;  1K5Q A;  1N33 B;  3N2K A;  4X88 A;  4O4H A;  2MW2 B;  3QO8 A;  1M56 C;  4G27 B;  2XTA A;  3D8C A;  4FPP A;  2ZM6 O;  4OPH A;  2XAS A;  2UXC O;  2OIE A;  4DV2 B;  3DXR B;  4X62 O;  4DV5 B;  2WAM A;  3W7W A;  1OJH A;  2Q69 A;  1WP7 A;  3F7V C;  2B5U A;  3ZRW A;  2X7R B;  4K8X A;  2ZE7 A;  2ZE6 A;  4YJ2 B;  3WB0 A;  4WBN B;  2W6J G;  5HFM A;  3M99 B;  1NZ6 A;  2EIN C;  2Q67 A;  1AR1 B;  4H0L B;  5JVD A;  5BMV A;  1UJW B;  4P2Z A;  5B5E Z;  1XHX A;  1K97 A;  4TT3 G;  5EYP A;  2Y69 B;  2ZDI C;  3DSQ A;  3JYC A;  3E89 A;  1LR1 A;  4JTA B;  1AR5 A;  4DW1 A;  2WLN A;  1KU9 A;  4PD4 F;  1QVF U;  3CRC A;  4CH3 A;  1JVM A;  1KQS U;  1K4D C;  5KHI A;  1ZTE A;  1YDX A;  4HNA A;  4EKW A;  5BR8 O;  4UXN A;  3LSU A;  5IWA B;  4B3T B;  3B8N A;  3K5O A;  3VQV A;  1M5I A;  1Q86 W;  5L3E A;  4BAY A;  3DC5 A;  5JJE B;  3E22 A;  4JI0 O;  1VP7 A;  5LA6 B;  2B9Z A;  4UCR A;  2ATK C;  3ZRX A;  1NU1 H;  2CGN A;  1N8R W;  2E3C A;  5DEC A;  4LF7 O;  2WA3 A;  1IVS A;  1AB3 A;  4NKG B;  2YXL A;  1TVK B;  1HNZ O;  2YI8 A;  3JAL A;  3CD6 V;  4JYC A;  1GO3 F;  2LW7 A;  3OMA B;  4JAA A;  1FXK A;  2BTQ A;  4CBC A;  5F2V O;  4F6R B;  2ZM6 B;  2IJK A;  1B06 A;  4QE9 A;  2UXC B;  5FPR A;  1K8A W;  4K0K O;  2IH1 C;  1TUE B;  4UB6 Z;  3JD3 A;  3HPL C;  1HNX O;  2N74 A;  3TK1 A;  2UXN A;  2A0L A;  3OE7 G;  3S3W A;  5KX5 A;  3ZBH A;  4DV4 O;  3D3Q A;  4R7C A;  4G2K A;  3JAR A;  5EBL C;  1V54 C;  2FYU H;  5FNV B;  3BAA A;  1XMO O;  1SQQ H;  1YXB A;  1WPX A;  3ZX6 A;  4JV5 B;  4IIJ A;  1M1K W;  1DGS A;  2Z0A A;  4QPK A;  2JS5 A;  3U0Z A;  1HW7 A;  2ZQM A;  1IBM O;  3SJQ C;  3KCY A;  1K5S A;  3FFQ A;  4DO2 A;  3RGB A;  1R3J C;  4PEL A;  3SYA A;  4AQY B;  4X1Y B;  4I9Q A;  3HR0 A;  4IL6 Z;  3K9A A;  5BR8 B;  4J10 A;  3WB1 A;  1B3Q A;  1BQ0 A;  4JYY A;  3FKS G;  3X2Q B;  1JPX A;  4ZOL A;  1I08 A;  3CCQ V;  1RFY A;  3T1C A;  1YEW A;  3U11 A;  1R3L C;  1X4T A;  2HHH O;  5KHH A;  4UCV A;  5KHJ A;  3WU2 Z;  4LF7 B;  4H44 B;  5B1O A;  1HNW O;  1PM9 A;  1Y4M A;  5GTI Z;  1Y74 B;  1HNZ B;  2RCV A;  3Q4H A;  1RM1 B;  3T1Y B;  2UU9 B;  4E4E A;  3QO7 A;  2HR3 A;  1KMI Z;  4X1K B;  3APO A;  4JTD B;  1V55 C;  4NTX A;  2KSD A;  2Q9L A;  3ZHR A;  3I5D A;  4K0K B;  1Z2G A;  2IU3 A;  2BSK A;  2CAZ C;  4U7O A;  3G71 V;  2Q5Z A;  2EIK C;  1HNX B;  1FXK C;  3E2E A;  2WLI B;  1E1R G;  3AG3 B;  1S76 D;  1K7D A;  4DV4 B;  2GUZ A;  1F23 A;  2UUC B;  2GSM B;  2HP8 A;  3SGI A;  2AW9 A;  4FLY A;  3CCR V;  3UKM A;  2DN9 A;  2V4D A;  4GX5 A;  2GTS A;  4BR6 A;  4GYC B;  1DTO A;  4FLW A;  3CJH B;  3L72 H;  1IBM B;  4R6Z A;  1FYJ A;  1NBM G;  2WSS G;  4U7N A;  4DV7 O;  4FM2 A;  1K34 A;  3E8H A;  3U10 A;  1ZAU A;  3CE2 A;  4QNH B;  3ETE A;  5KHG A;  4AIL C;  1FXV A;  3LNN A;  2PUS A;  1WJZ A;  2IU0 A;  2M7W A;  5LBQ A;  4J7J A;  3RYH B;  3MAQ A;  2WA4 A;  2L35 A;  5DED A;  3J80 N;  2QKA A;  1S5H C;  3ZMZ A;  3W7X A;  1YJN V;  2OYQ A;  2HEP A;  1HNW B;  3A8T A;  2F4V O;  4JI2 O;  2DE0 X;  1YZB A;  5LP6 A;  4JGS A;  1OCZ B;  4WFB V;  4HZ3 A;  2YIB D;  3CCE V;  4PDV A;  2CTW A;  5JQG A;  5J2T B;  4ZI7 B;  2L6L A;  2Y0I A;  1OCC B;  4JF3 A;  1X59 A;  4YHH O;  2JGD B;  4DV3 O;  3L9D A;  2ZR3 A;  4NXN O;  1R6K A;  3GB7 C;  5LHH A;  3THO A;  2XND G;  1Y76 B;  4LH7 A;  4LCU C;  1SRY A;  5B66 Z;  1FAF A;  1W0K G;  4N23 A;  3W7U A;  2VQF O;  4J9Y B;  3RVY A;  3RYC A;  3ASN B;  3JAM N;  1G8M A;  1AJP A;  2JK5 C;  3N2G B;  4NTY A;  3CB2 A;  4O4H B;  2YSU B;  2BTO A;  2CTQ A;  5KHK A;  4LFB O;  4ICG A;  5H9C A;  3FAV A;  4DV7 B;  3UM7 A;  1ARO P;  2CH7 A;  2HFE C;  3A0R A;  3UO2 A;  3ZRW B;  5JCO C;  1SER A;  5KUK A;  3OGI B;  4OXS A;  1ZUQ A;  2ZIN A;  4LWS A;  3CCL V;  5EZY A;  1NR1 A;  2W6I G;  1IZ3 A;  2F1M A;  5EYP B;  2C2A A;  2LGQ A;  2JDI G;  2WLK A;  2VQE O;  2F4V B;  2KG7 B;  4X64 O;  4JI2 B;  4I0X A;  3SPC A;  2F23 A;  4B3R O;  2V7Q G;  5LXT B;  4P30 A;  2KQX A;  5H2F Z;  3AK2 A;  4JYA B;  3M8A A;  1GTO A;  3CC2 V;  3E22 B;  2X0L A;  4DV3 B;  4IYI A;  4JAV A;  4D6T H;  1VAR A;  4NXN B;  5LP6 C;  3AK1 A;  5KUM A;  4D7T A;  4MTX A;  2OCC C;  1S0V A;  5BZB A;  4BIZ A;  3ZHU A;  1VQ8 V;  1VQK V;  2VQF B;  3JAL B;  2Q0O C;  4O4L B;  4OX9 O;  2ILM A;  3O9O A;  1F4N A;  4MW8 A;  3K79 A;  2HVJ C;  1FXK B;  1PNM A;  2BTQ B;  2GHY A;  3HKB A;  1S77 D;  2YDE A;  3H1K H;  1WB8 A;  4LFB B;  3CRA A;  4RAI A;  3CC7 V;  1SZX A;  4ZHQ A;  4TOI A;  1L0L H;  3OEH G;  1ZWI C;  1MNG A;  3BA9 A;  1GMG A;  3JD1 A;  4CS3 A;  4JI4 O;  2RQ6 A;  1RSO A;  3SYQ A;  5B3S C;  4J41 A;  1EN4 A;  4O2A A;  4MTF A;  4FLT A;  3AG4 C;  3ZS8 C;  3L74 H;  3BFR A;  3E83 A;  2K1E A;  3AG2 B;  4MVS A;  4J42 A;  5GON A;  3JAR B;  2QKS A;  1CP9 A;  4I50 B;  1XBL A;  5ITZ B;  1N36 O;  3ETG A;  4JI6 B;  4QIW F;  1Z5V A;  2ZDI A;  4K35 A;  2XHB A;  4DV0 B;  4I55 A;  2Z5U A;  4TQF A;  1KKD A;  5C8Y B;  2VQE B;  4UVB A;  4X64 B;  2NR5 A;  2FL4 A;  2EJR A;  3HKE A;  4QE7 A;  3ABU A;  5EC2 C;  5IYD O;  4EB6 A;  3BCC H;  2Q7G A;  3C3S A;  4O4J A;  4B3R B;  1JFF A;  3JAK A;  4FIP C;  2BOB C;  1T5E A;  3CX5 F;  3K5N A;  1AI7 A;  3D3I A;  5FPO A;  1HR0 B;  3ETQ A;  2V1D A;  1Q6U A;  1NI8 A;  1XNR O;  1NS1 A;  1XUQ A;  1GN4 A;  2WLM A;  4JTC B;  1TUB B;  4RWU A;  4NVP A;  1D5N A;  5LMU O;  1I5Y A;  3WG7 B;  3FB5 C;  1G4Y B;  1P7B A;  3Q4H B;  5CB4 B;  1QR8 A;  1QLE C;  2PI4 A;  4FLV A;  2Y4T A;  2VRZ A;  3BAB A;  4BIO A;  2FB5 A;  2QWP B;  1LUV A;  2AZ2 A;  2O57 A;  2QWN B;  2Q6A A;  4J11 A;  3TCU A;  2EUL A;  3L70 H;  4J80 A;  3E86 A;  2BSK B;  4ASU G;  4H13 B;  4JI4 B;  4IHJ A;  3L71 H;  2Z3Y A;  5EIB C;  1Q82 W;  3ZCC A;  3P32 A;  5CMU A;  1AI6 A;  3QG5 A;  2YXH A;  2ZE5 A;  5IYC O;  1A32 A;  5JJJ B;  4RO2 A;  5J9P C;  1VQ7 V;  2GUZ B;  3RYF A;  2LP7 A;  5IT9 N;  1K4C C;  1N36 B;  4B7E A;  3K57 A;  1PP9 H;  2DW4 A;  1DF4 A;  2GTA A;  2CUG A;  1L8D A;  4GUN A;  2R9A A;  2WWW A;  4WFA V;  2HG5 C;  3H1J H;  2D3O W;  3SYP A;  2WPD G;  2LW1 A;  3CMA V;  4DR4 O;  4TUY A;  4JV5 O;  4P9P A;  2WLL A;  1ZX3 A;  2EBO A;  2X6B A;  2XAF A;  1VQ5 V;  4DK0 A;  2Q7H A;  3ZMU A;  3LDC A;  4JPR A;  4UCT A;  4AQY O;  1PL0 A;  1XNR B;  4IGG A;  5K1P A;  1S72 V;  4PA9 A;  2ADQ B;  5IJ9 B;  5B1B C;  3VOU A;  5LMU B;  2E5L O;  1RPO A;  4X89 A;  2AHY A;  4J7Z A;  2DYS B;  2BE3 A;  4JZG A;  3G6E V;  5LP6 B;  1PL4 A;  1S3J A;  4DW0 A;  5EIB D;  4L8J A;  3B2E E;  5JQG B;  3JAW A;  3ABM C;  3JSN A;  3MDS A;  1YTF B;  2Q4P A;  1ZSP A;  3LSQ A;  1VQP V;  3T1Y O;  2UU9 O;  2YIB A;  2X6A A;  4DR5 O;  4PDL A;  4MVZ A;  3HB3 B;  5LGU A;  4I4T A;  1SKV A;  3STL C;  2QDO A;  2CDY A;  1BT8 A;  1SQX H;  4LH6 A;  3OAA G;  2W0F C;  4LNU A;  1KB9 F;  2GBO A;  3K5L A;  4DR7 O;  3RYC B;  1U97 A;  1VQN V;  1FKA O;  1OCR C;  1XMQ B;  1VQO V;  1FJG B;  5LYJ A;  4FLX A;  3AG4 B;  1NVP D;  2ITC C;  4J7K A;  1EM1 A;  2UUC O;  1SES A;  1VIB A;  3FAV B;  5CBF A;  2D2C B;  4FVM A;  5LOV A;  4DR4 B;  1VQL V;  3OMI B;  4MW3 A;  3R65 A;  4TWK A;  3OFN G;  4UV9 A;  5CA0 B;  5JH7 A;  2H94 A;  5LHG A;  1R6N A;  2R9I A;  1WLE A;  2DYR B;  3ZRS A;  4JAU A;  4LWS B;  3WB2 A;  3BY6 A;  3H1H H;  4XDK A;  2Q8V A;  5J2U A;  5EZY B;  3BA8 A;  3K59 A;  3SPI A;  2EIL B;  2YC0 A;  5KAI Z;  5H6R A;  1US6 A;  2PZS A;  1WA8 A;  3QVN A;  4LFC O;  5B1A C;  4TSF G;  3ABL C;  3EFF K;  2E5L B;  1ROP A;  4GKK O;  4JZ2 A;  1XDC A;  5GTH Z;  1Q43 A;  5EBM C;  3F5T A;  2PI5 A;  2JS3 A;  1EZJ A;  2UXX A;  2RN9 A;  5HFL A;  1I5X A;  4I0X B;  3KG2 A;  4KXR A;  1YSC A;  2CTR A;  4FLU A;  4YXW G;  4E2L A;  2PYL A;  3KZI Z;  4F6E A;  1COW G;  2EIJ C;  2JIZ G;  1QLE B;  5D5Q A;  1D5A A;  4DR5 B;  2ZD9 A;  3FB8 C;  2R70 A;  1SQV H;  3B09 A;  3OTF A;  4CS2 A;  4EFB A;  1ZL8 A;  2EZO A;  2H8P C;  3JAT B;  4PHZ A;  4U3J A;  1OCO B;  2DOS A;  4PDR A;  2IJJ A;  1WP8 A;  4EFE A;  2NLJ C;  4DR7 B;  4PA3 A;  3CCU V;  1BQZ A;  3CWB H;  1XEQ A;  3K58 A;  1M56 B;  3HKB B;  4LC1 A;  3O65 A;  3JAS A;  2XAQ A;  2EIM C;  1NQT A;  2JRI A;  4HYO A;  4ZHQ B;  2VWK A;  1YJW V;  4OPA A;  1KUQ A;  1UFI A;  2BCC H;  3STZ C;  5JCO A;  2F66 C;  4O2A B;  1BZK A;  3T4D A;  1SQF A;  1THZ A;  5H6Q A;  1IXB A;  3JD4 A;  2EIN B;  2OIG A;  2QTS A;  3K0G A;  4O4I B;  3CCM V;  3JCZ A;  4WFH A;  1K9M W;  1NKD A;  2ETN A;  2P4V A;  4LFC B;  2KB1 A;  3ZHQ A;  4KL1 A;  4UCO A;  4TV9 B;  4R50 A;  1KEC A;  4FZ0 A;  3OR7 C;  5KA6 A;  4GKK B;  1WAZ A;  4X1I B;  2Q73 A;  3CME V;  2P6J A;  2YI9 A;  1GN6 A;  1SS3 A;  3OTO O;  3HKE B;  4DR3 O;  2AHZ A;  4EB6 B;  1S5L Z;  1JFF B;  3JAK B;  4WFE A;  2LO1 A;  2FKX A;  1XNQ O;  3S3X A;  5KAF Z;  1D2D A;  2CE4 A;  4X66 O;  4WCE V;  3ICX A;  4PA4 A;  5CA1 A;  1YCI A;  1IUR A;  1IBL O;  3ABM B;  1JQ0 A;  4JYA O;  4MVU A;  2A7W A;  3W7T A;  3ABK C;  3FX7 A;  2YEV B;  4XDJ A;  4ABM A;  4X20 B;  3CS5 A;  2OWO A;  1XHZ A;  1Q8I A;  4I5S A;  5LA6 A;  4BIU A;  4TV8 B;  1L0N H;  1QNM A;  3OGC C;  4L87 A;  1TA8 A;  1H2G A;  1XOU A;  4X8A A;  2W0X A;  1XQ8 A;  4PA7 A;  5L3C A;  3RFR A;  1N4C A;  4BW5 A;  2PTM A;  2DWD C;  4QPJ A;  3RWR D;  3N2K B;  5LGT A;  1ENV A;  1Q5O A;  1QBZ A;  1BMF G;  1QCE A;  4MTO A;  3W7S A;  5LL6 Y;  1NTM H;  4F6R A;  4B3M O;  1DLB A;  1JA8 A;  1V54 B;  3B4S A;  1F4M A;  4A5U B;  4GKJ O;  4I7Z B;  2JJ2 G;  3I55 V;  3DTU B;  3GWK C;  1IXM A;  4UVA A;  3P3N A;  1HWY A;  1HDJ A;  1BHB A;  2Y4U A;  5JVD B;  2N04 A;  4NXM O;  2IJH A;  5BMV B;  2ZNJ A;  1L1F A;  3QO5 A;  1MZE A;  3OTO B;  3T4Z A;  3TGU H;  3TET A;  4DR3 B;  4Z1V A;  3H1I H;  4UCU A;  5CBH A;  4JI6 O;  2AZ0 A;  3AEI A;  1M90 W;  4DV0 O;  3SR2 C;  3ZN1 A;  2AGA A;  4RQE A;  1XNQ B;  2DQ0 A;  3SJA C;  4PI0 A;  3T2M A;  1SA0 A;  1KC8 W;  1CEZ A;  3H9V A;  1SQG A;  4X66 B;  3JSL A;  4HNA B;  1IBL B;  2Y69 C;  3VQW A;  4GX0 A; 
#chains in the Genus database with same CATH homology
 1BGY H;  3CXH F;  1KYO F;  3L75 H;  3L74 H;  1SQB H;  1P84 F;  1SQV H;  3H1H H;  3H1L H;  4D6T H;  4U3F H;  3L70 H;  1NTZ H;  3H1K H;  3BCC H;  1EZV H;  1PP9 H;  1PPJ H;  2IBZ H;  4PD4 F;  1BE3 H;  3L71 H;  2A06 H;  3CX5 F;  1L0L H;  2BCC H;  2FYU H;  1NTM H;  1L0N H;  5KLV H;  1SQQ H;  1NU1 H;  1SQX H;  1BCC H;  3CWB H;  3L72 H;  1SQP H;  3TGU H;  3H1J H;  3L73 H;  3H1I H;  1KB9 F;  1NTK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...