4PD4F

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
b'VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
molecule tags Oxidoreductase/inhibitor
source organism Mus musculus
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4pd4F00
1BE3H 1EZVH 2A06H 2BCCH 3L73H 1NTZH 1KYOF 1SQXH 3TGUH 1L0LH 1BGYH 3H1LH 1NTKH 4PD4F 1NTMH 1SQBH 3H1JH 2IBZH 3H1IH 4D6TH 1PP9H 5KLVH 1P84F 3H1HH 1NU1H 3L71H 3L74H 1PPJH 1SQVH 3CX5F 3L72H 3L75H 3L70H 1SQQH 2FYUH 3CWBH 1L0NH 1SQPH 1KB9F 1BCCH 3H1KH 4U3FH 3BCCH 3CXHF
chains in the Genus database with same CATH superfamily
3ZHQA 1ZTEA 3DC5A 1NVPD 5H2FZ 5LHHA 2DW4A 2DWDC 3LDEA 3OAAG 1QR8A 3RT3C 3W7XA 2BE3A 2XAJA 2H3OA 2WLHA 3MD0A 1E79G 1VQMV 4Z2WA 4B3SB 2K1EA 3RN4A 1L0LH 1J95A 4JI1B 1MZEA 2EZOA 3LNMB 1EN4A 4JAVA 4PD4F 1WN7A 3HKEA 3UKMA 4TV9B 3I56V 1M56C 4TQFA 3W7TA 1T5EA 3QTCA 2QA4V 3PN1A 4DR4O 3GWKC 4JYAO 5EZYB 2N74A 3SPIA 2Y0PA 1VQ9V 2CAZC 2OIGA 4L87A 2A06H 3FX7A 5EYPB 2VQEB 5BR8O 1W0JG 3F5WC 4FVMA 3TXQA 1NJIW 1FKAO 3ASNB 3OEHG 2WLMA 3N2GA 4PDLA 2JIZG 1PNKA 4RO2A 1HP8A 2Q7GA 1AROP 5HFMA 3UCSC 1WB8A 2X0LA 2YIBD 2B5UA 2HP8A 1Y74A 4DR4B 2UUCO 4BIOA 5IWAO 4YY3B 2EIMC 4E2LA 5C93A 2QKAA 5IYBO 1P7GA 4J7ZA 4H0LB 1OCRB 1UPGA 2X6CA 2DMXA 4JGSA 4X64B 3HKDB 1JCHA 2E74B 4B08A 3MHSC 1P49A 4CS3A 1R3JC 2UUCB 1XBLA 5LL6Y 1EZJA 1VF6A 1Y76B 3RYCB 2CE4A 2IBZH 2DYRB 3T1YB 1VQPV 1R6KA 2CGNA 5KX5B 2XAQA 4J9YB 1H38A 4QGPA 2AW9A 4JZ2A 5EC1C 3CCSV 1PL4A 4P9OA 2P7TC 3C90A 4CH5A 4DV6B 3JATA 4U7OA 2P4KA 3CPWU 3Q4HA 3N2GB 3ABUA 4QJFB 4J9ZB 3UQ8A 2JGDB 1Q5OA 2RMKB 4DV3B 1ZX3A 4B7KA 1FAFA 4DR7O 2H94A 1K8AW 2Q5ZA 2QGNA 4CH4A 2L35A 4LFAO 3SPJA 1ROPA 4GLXA 1IXMA 3LDDA 3CMEV 5KHKA 4RQEA 4LF4O 1BE3H 1IZ3A 1A32A 2QM4A 5IJ0A 4JI4O 2UU9B 5L3CA 4X8AA 1I5YA 4BW5A 2YXYA 5ITZB 4HNAA 4JAUA 5B1NA 2JEXA 4FIPC 1H2KA 4JI3B 1QLEC 2Q6AA 1SETA 1K9MW 1BHBA 2K9PA 3HKBA 1MOFA 2ITCC 1RSOB 2QKCA 5FNVB 3E89A 4P30A 5KA5A 3ZEDA 4MS2A 1ZAUA 1KU9A 4YIOA 2OCCC 1JX9A 1WNSA 3E8FA 4YJ2A 4NTWA 3ABLC 2DYSB 3TK1A 4FM1A 1XL6A 1GAXA 5LMUO 4X1KB 4CH3A 3K9SA 2QTOA 2F95B 1V9PA 2QR4A 4KXRA 1N0JA 1PV0A 4OGQB 1SF9A 4DK0A 3ASNC 1NTZH 1H8EG 2YDEA 3K3WA 2WLLB 3JD3A 5B1AC 4NTYA 3G80A 4O2AA 4PI0A 2ZM6B 5CA0B 1Y74B 1TA8A 2UUBO 5L3FA 4N21A 1IURA 1PL0A 4TWKA 3JARB 1RP3B 3QF7A 5J2TB 5KHHA 4RAIA 3JAKA 4LWSA 3H1KH 2W6JG 2RDCA 3T4DA 2NR5A 3FB8C 5KHGA 4W4KA 3H1HH 4X1IA 2QKSA 4NXMB 1HNXO 2YI9A 1QVFU 2XAHA 4JI1O 1OHHG 2UXDB 1KP2A 1B6QA 1FXVA 3CCMV 4JI2O 2P4VA 5KHJA 3A0RA 4DV7B 1W0KG 4NB5A 1R6TA 2CTWA 3K04A 2HR3A 3BEHA 3AG1B 2Y69C 3LUTB 2RN9A 4DR1B 2FL4A 5CMUA 1FXHA 2YC0A 1G6UA 4O2BB 4DXWA 5IT9N 4PA4A 2LQTA 1YDXA 4DV5O 3BY6A 3HPLC 1V55B 5CN0A 4G28B 2DQ0A 4ZIBA 2F23A 3P3PA 3M7MX 4XDKA 4HNAB 3WG7C 1JJOA 3L9DA 1N34B 1I7FA 4YJ3A 2IW5A 5CBGA 5LBQA 5TISZ 2FB5A 2HVJC 1VQ5V 4JTDB 1G8MA 3AG2B 2Z3YA 3C3SA 5LYJB 5FLXN 3CB2A 1K73W 2Q4PA 2QEXV 4TOIA 1OCZC 3K0GA 1XNRO 4LF9O 1HW7A 1EN6A 5LHGA 1NZ6A 1V54C 1AI7A 4U7NA 2B1GA 1YTFD 1GO3F 1WPBA 1MNGA 5IE9A 4QIWF 4UVAA 3RVYA 4CC6A 3U0ZA 2L6LA 1NR7A 3APQA 2ZDIC 2C2AA 3SYQA 4MVMA 4DK1A 2Y48A 4JI3O 3BA8A 4LF6O 4GKKO 2PTMA 3RYFA 1ZUQA 2ZIMA 3OMNB 1M4UA 1KYOF 4WBNB 5KMGB 3JASA 5BR8B 2YEVB 1LUVA 3VQWA 3H1JH 1IBMB 1NKDA 1MMMA 1RFYA 2FTKA 1PNMA 1IBKB 1R3KC 1H2LA 4JYYA 3WB1A 5LMNB 1VIBA 1S5JA 1FXKA 1KP3A 5B3SC 5CA1A 3JD4A 4ZHQB 4LF6B 3CHXA 2YIAA 1LUWA 5H6RA 1XUQA 4I0XA 4D7TA 1IX9A 2IM9A 2OIEA 3VOUA 1GM7A 5LXTA 2KG7B 1SQFA 4FLXA 2GUZB 1SRYA 2AHYA 4BAYA 3ZMSA 5BY1A 4I7ZB 4YHHO 1Y6XA 3T1YO 2E3CA 3CCLV 1XNQO 2JDIG 1XL4A 2BOCC 1R3IC 2VWJA 1YHQV 4J7JA 3ZIAG 5LGTA 3M8AA 1K92A 2HJDA 1K5SA 2E5LO 2QE7G 4O2BA 3E22B 3P32A 2CTRA 4R50A 1ZL8B 4DRXA 4FMTA 2VQFB 1P7BA 1JVMA 4DO2A 5IYDO 5GTHZ 4DV3O 3B77A 4KFMA 1RPRA 1OCOB 2JJ1G 3D36C 2OTLV 4NKGB 4GKJO 1IXBA 2QJ1A 1N8RW 2P6JA 4D6TH 3K58A 5D5QA 1OCCB 3ZRWA 2ZNIA 1VQKV 1SQPH 2D2CB 5JVDB 1MA1A 3JARA 5LXTB 1NI8A 3D8CA 2KKWA 4OPAA 5GTIZ 3FKSG 5JJEB 5BXZA 3E86A 3STZC 4FLYA 2LFSA 2V7QG 2F1MA 1VEWA 1QVGU 4JI7O 4JI8B 1VQ7V 3JYCA 3STLC 2EULA 3CP1A 3T1CA 4X1IB 1Z5VA 2KB1A 5FL7G 1SS3A 3ETGA 3RYIB 3THOA 5CBFA 2BTQB 4LF5O 4NR1A 1NTKH 3JD2A 1QCEA 2ADPA 2QM8A 3QO5A 2UUAO 4LFBB 4AHCA 3CJHB 4LR3A 2PGGA 1NBMG 3EFFK 1AVMA 3OGCC 5BZBA 5JWPA 2QWQB 2QWOB 1HR0O 2ZIOA 1Q86W 2ZT9B 2EINC 1F4NA 1AI5A 4X1YB 2IH1C 1G4YB 2N04A 3SJBC 4X62O 4JI5O 3D36A 1CPYA 3FD9A 2UUAB 1CXZB 1HNXB 5LP6A 1I0HA 3ABMB 5DECA 1S77D 2RQ6A 1M56B 3T4ZA 4F6RA 1F51A 3S3WA 2VRZA 1K7DA 5LYJA 3AG4B 2LW7A 4DV1B 3E22A 4QPJA 3QVNA 4RUEA 3CRQA 3K57A 5L3EA 4X20B 4JAAA 3SPGA 1IBKO 1K97A 1Q6HA 3E2EA 3ASOB 4EKWA 2EIJC 4X1KA 3L71H 4B7EA 1B04A 4O4IB 3N2KA 4MTGA 2JJ2G 4K35A 1TVKA 3B40A 3C3TA 2RNBA 1XHXA 5B66Z 3R65A 4UXNA 2XT9A 3RYFB 2CGOA 4PA9A 1Q81W 4QE9A 3RYHB 4JTAB 3CE2A 1M93A 2AHZA 4IHJA 1SZTA 2AZ0A 1KECA 2Q0OC 2QWNB 3ZHUA 4CS4A 4FJCC 2ZXWC 5E79Z 1N36B 2P5OA 2JS3A 1SC5B 2WLNA 3F5TA 3JD1A 4LF9B 4CZZA 1WB7A 2H8PC 4IT5A 3B8MA 4GKJB 4YIPA 4H37A 4I0XB 4J41A 2AXTZ 1WP7A 1AP5A 4Z1VA 3L72H 3CSXA 4NVPA 1Q7YW 4GX0A 1QR9A 3OD4A 4LBEC 2EIKC 4F4LA 5GW7A 5LP6C 1AI6A 1JR9A 1AJPA 3K08A 2ZINA 4CH6A 3ZCCA 4GUNA 3FFQA 1EM1A 2EILC 3OE7G 3RGBA 3SYPA 3ETDA 4IL6Z 1TVKB 1NU1H 4JYAB 4TUYB 4UVCA 2ETNA 4FPPA 1RM1B 4FLUA 4FFBB 1JOYA 3CXCU 3W7WA 1N33B 1KKCA 5LA6A 1U97A 1W59A 4RUFA 1BZKA 1XDCA 1CEZA 2XHBA 4DV4O 3TGUH 1YXBA 1TAEA 3FAVB 1K4CC 2Q69A 1GKFA 4F6RB 3DXRA 4X66B 3PJSK 4I5SA 1FFXA 1KQSU 2CTQA 2HKOA 4GX1A 3H1LH 3BRCA 5KAFZ 1IBLO 4P2ZA 1M5IA 1BQ0A 3D3QA 2F43G 1GM8A 2CTPA 4WCEV 2PYLA 4NXNO 1SESA 2DYSC 4UVBA 4DV7O 3T1HO 2LW1A 5EBLC 4ASUG 5IY5C 1ZWIC 5B1BC 3W7UA 4O4JA 5JCOA 4X62B 4FLZA 1XEQA 3ABMC 3JD0A 4AILC 1YTFB 3L73H 3ABKC 3K79A 1VARA 3LNNA 4GZRB 1WLEA 2JGDA 1AP6A 1AR5A 2RCVA 2E5LB 4BIUA 4TV8A 4FFBA 5B1AB 4WFBV 5KHIA 2IJKA 5JJJB 5EBMC 5LA6B 4K8XA 1R1BA 2M6YA 4KP4A 3AG4C 1KKDA 4DR5B 3ABLB 3RWRD 5J9PC 2YXHA 5DM6V 1Y66A 3BHPA 3P30A 4WFGA 3CD6V 4EFBA 2XAFA 1Z5WA 1QBZA 3HKBB 2IJIA 3OUSA 4HYOA 3ZMUA 2B1IA 1M57C 4JI7B 1QLEB 2UXNA 4JI8O 3K03A 4X1YA 1US6A 4X64O 1R3LC 2EX3A 4G27B 4MVOA 3ZMVA 5L3DA 4RQFA 3CC4V 1D2DA 1UJWB 3RVZA 2LGWA 2HHHB 1K34A 3B4SA 1OJHA 2XUMA 1H2MA 2DYRC 4I50B 1M9NA 1CP9A 2WPDG 1I94B 1GN6A 4H13B 1N36O 2A3QA 3AG7A 4EB6B 2EILB 2GV9A 4UCSA 2HEPA 1JFFA 2JVDA 2Q68A 4WBNA 1E1QG 3K9AA 5KMGA 1N32O 5JH7A 3SJQC 1RPOA 2CH7B 4UCUA 3CEIA 4ZKIA 3IAYA 4UB6Z 2GTAA 1JJ2U 3R66A 3ZMZA 1QHTA 1IBMO 4JI0B 2JS5A 3GB7C 1S76D 1R73A 3KG2A 5KUKA 2QWRB 4JTCB 4PA3A 5LOVB 1F23A 4LF4B 3AG3B 3X2QB 5HFLA 1THZA 4B3TO 1AB3A 3CRMA 1GMGA 2KG7A 4Q6GA 4BIZA 2A0LA 2PZSA 2DE0X 3I5DA 1XI1A 4UCRA 1H2SB 5GONB 3HKDA 3E8BA 2R9RB 4X88A 4CBCA 1VQOV 3I55V 1P4RA 5IY5B 1VF6C 5CA3A 4IYHA 2EJ7A 3EHBB 3QO8A 5E1AC 3OTOB 4DR6B 2BOBC 2JEUA 4X9QA 5B1BB 3CC2V 3L75H 3E83A 3WB2A 1YSCA 1ZL8A 1NH2D 4B3TB 3F7VC 4U3FH 1NR1A 4IGGA 4JV5B 2ADQB 2FKXA 2EINB 1KBHA 2GHYA 2ZD9A 3KCYA 4DV2B 2R72A 3ZRSA 3FB5C 3ZHRA 5LGUA 3JSLA 3K06A 1YCIA 1SQVH 1AI4A 3K5MA 4LFCB 4DR2O 2F66C 2V4DA 3BPZA 4MTOA 4TUYA 2PY5A 3GWOA 1D5NA 1BSMA 1S5HC 4UV8A 1L1FA 2Y0IA 3SYOA 4ICGA 1ZLZA 2W6IG 3J81N 2A9HA 4I55B 1I5XA 4B3RO 2UXXA 3AG2C 1VQ6V 2F4VB 3G6BA 5J2TA 5ITZA 1XMOO 1G1XB 3CRRA 3L70H 3TCUA 1UFIA 3K5NA 4ABMA 5IYZB 1BCCH 4PDMA 3NR7A 3OMAB 4GYCB 4MW3A 1GTOA 2Q73A 4DR2B 4LFCO 1FJGO 4AI8A 1SKVA 2UXDO 2X6AA 1BHAA 4QE7A 4O4HA 2OTJV 4YY3O 2BTOA 1EN5A 3FB7C 1SZXA 3SYCA 2F4VO 3CJHA 4X20A 1JQ0A 4RWUA 3AG1C 5H9CA 5EC2C 1Q90D 4TSFG 4J11A 3SPCA 1X4TA 4MTXA 3ZJZA 2QTSA 2EJRA 1N4CA 1VP7A 4B3SO 1V55C 2HHHO 3JAWA 5K1PA 4Q20A 1N33O 2ILMA 1I94O 4JASA 1BS3A 5DEDA 3JAKB 2VQEO 4MSWC 5LMUB 4IHJB 2M7WA 4DR1O 4WF9V 3HKCA 4DR3O 2ZCEA 2WA4A 4UCOA 4I9WA 3HKEB 2XNDG 3CX5F 4UFZA 3HR0A 4YJ3B 4X66O 1VF7A 1OCCC 3JSNA 1Q6UA 3LSQA 2ZXWB 3CYOA 1VQNV 1BMFG 2NLJC 3VQVA 3JALB 2EIJB 4JYBA 1QLNA 2R70A 2UXCO 1TUBB 4DR3B 3AK1A 3UO3A 2OT5A 4W4LA 2ZDIA 3CCRV 4MVRA 4O4LA 4X89A 4I4TA 1O9HA 2Q9LA 3CC7V 2YUAA 4ZBMA 1YIJV 4X65B 2PYJA 5LHIA 2B9ZA 4PV1B 3MDSA 2LO1A 4WFAV 2E75B 4XDJA 1PD3A 1PPJH 5BMVA 3RYHA 4PELA 4LF8O 4BWAA 4LC1A 1DF5A 4DV0B 4CC5A 3OR7C 2EBOA 1S5LZ 5H5NA 5IYZA 2ITDC 2WLKA 1W2BU 3CCJV 4AQYO 4KHPB 2IH3C 2IU0A 4JYCA 2EZPA 1MSDA 4DV6O 1SERA 1Q6IA 4H33A 4PJ0Z 4I9QA 1U96A 1QNMA 2IJJA 1OZ0A 4LF8B 4FLWA 4XDLA 1O9GA 5FPRA 1DGSA 1F7YA 4IYIA 3SYAA 4B3RB 1Q43A 5H6QA 1EFRG 3BABA 1HNWO 2QSAA 3OT7A 3KZIZ 2UXBB 1S72V 3CWBH 3OGIB 2P22C 3LSSA 1MG1A 2E76B 2P06A 3AK2A 3D3IA 4EEQA 1EZVH 5EZYA 4DV4B 3CRCA 1SQXH 3E8HA 5IYCO 2PF4E 4LFBO 2DWEC 2R9IA 1KC8W 5EYPA 4FZ0A 2XAGA 1VQLV 1PP9H 2YIBA 1AR4A 2EIKB 1FD9A 5A2QN 1HNZO 1K33A 3UT5B 5B1OA 2JGUA 3O9OA 2N05A 4WFHA 2HVKC 2IU3A 1FXKC 2W0FC 3SGIA 4ZI7A 3G4SV 3APOA 1XMQO 2QDOA 3DXRB 1NVPB 1BQZA 3A2FA 2GBOA 2ZE5A 3ZS8C 4ZHQA 1M90W 4ZOLB 4LF7O 1WP8A 1SQGA 5AG2A 3OEEG 3ZRWB 3B2EE 1S0VA 3VQXA 3MAQA 3HB3B 4K3AA 1TUBA 3K59A 4OXSA 4OX9O 3OTOO 3N27A 2LGQA 2BSKA 1R6NA 1M57B 3QO7A 1NS1A 3FYEB 4TQDA 1Y4MA 5EBWC 3N2KB 3T1HB 1IVSA 4J10A 4DYLA 4FK5C 1PNLA 2EIMB 4DW1A 3RYCA 3IFXA 1OCRC 5C8YA 1WA8B 4DUYO 1IDSA 2WWWA 4QPKA 5L3GA 4JZGA 3MHHC 3EXAA 5JH7B 3QNEA 3WB0A 1HR0B 1VF5B 4NTXA 4FLTA 4MTFA 2HLDG 4UCVA 3J7AU 3L74H 4NYKA 2DOSA 2MW2B 4PI2A 1SQQH 1AJQA 4WFFA 4IIJB 2WA3A 3CXHF 3JAWB 3VQYA 2CDYA 1VQ4V 1GN3A 2ZR2A 5KUMA 1YJWV 3DGEA 1NH2B 5IJ0B 5JJNB 2QWPB 2CK3G 4H44B 1GH6A 3EVKA 3LDCA 1XQ8A 3P3NA 2ZQMA 1L0NH 5FPOA 4DR7B 1S3JA 4DV0O 2RJZA 4DV5B 1DTOA 1Q3EA 3K5OA 4R8CA 4J7KA 4R6ZA 4R7CA 4JPRA 2HJFC 4LNUA 3KCXA 5CB4A 1RSOA 1MSWD 4BR6A 5B5EZ 1OV9A 4U3JB 5C8YB 3OR6C 2P67A 4J80A 3A0BZ 2IJHA 3OTFA 1FPOA 3LSUA 3UT5A 2KQXA 3K5LA 1HDJA 3VBBA 1RM1C 1OCZB 2O57A 3TXSA 4O4LB 3FYIB 3F7YC 1GN2A 4ZI7B 3ZN0A 1BGYH 3FAVA 1DF4A 3BA9A 1NTMH 4HAMA 4LH7A 4O4IA 4UCTA 1FXKB 4ZOLA 5KLVH 2WLLA 2OCHA 5CA0A 1ZSPA 5IWAB 1AILA 3S3XA 3UM7A 2A79B 3CS5A 5BMVB 3T2MA 5JCOC 5IDJA 4GKKB 1FFTB 3CCEV 5EIBC 1ORQC 1YJNV 2XASA 2VQFO 2XOKG 3DTUB 4AQYB 4K0KO 3RBZA 4UUJC 3JAMN 4LCUC 2ARHA 4HBNA 3AEIA 2NN4A 1WPXA 3W7SA 3ETQA 1XOUA 1KMIZ 2KSDA 3OUFA 4LNUB 4KUMA 1MZFA 1JPXA 2LP7A 1HNZB 5LMNO 2OWOA 3IC7A 3OFNG 4O4HB 5J2UA 3B09A 2ZKOA 2UXCB 3H1IH 1X59A 2FMLA 1XILA 2A7WA 2Q67A 3BVOA 1XMQB 1YJ9V 3JATB 1KB9F 3OM3B 1ENVA 4LF7B 3Q4HB 5CA1B 4QNHB 3RW0A 3DC6A 4EFEA 2ZE7A 5B3SB 4JF3A 4GT1A 3CRAA 4UB8Z 1XNQB 2UU9O 2OYQA 1QQCA 2LJ2A 4MVSA 4B3MB 4DUZB 5JQGB 4F6EA 3O65A 3FB6C 2ZR3A 1HWYA 4DW0A 4LFAB 3ZHTA 4Z1MG 2F93B 2YSUB 2DN9A 4J42A 1WAZA 2ZE8A 2AGAA 1Y67A 1VQ8V 4JI4B 3HKCB 1XMOB 2MK3A 5F2VO 2GTSA 4N23A 3WFVA 3QG5A 3E35A 1H2NA 4UV9A 1LR1A 3ZN1A 1IBLB 1I08A 4I50A 3ASOC 4OX9B 1QU7A 4U3JA 4XBFA 4FFKA 1FJGB 1SA0B 4MVZA 5CBHA 4EB6A 3U10A 5IJ9A 1AJNA 1JFFB 2WSSG 1N34O 2BCCH 2VS0A 4D7SA 2X6BA 3AK3A 1EBOA 4PA7A 3U11A 2W0XA 1J5EO 3ETEA 2PI5A 4PA6A 4GCZA 4FM0A 4I4TB 3BAAA 1Q82W 4JI6O 4FLVA 3DSQA 1PKXA 2VWKA 3K0DA 4DR5O 1WA8A 2PUSA 3ZRXA 4PHZA 1NQTA 2D3OW 2Z5UA 1J5EB 4C7UA 2UUBB 4E4EA 3WG7B 5JQGA 4L8JA 3SJCC 1B06A 3AG3C 4NXNB 1V54B 2P90A 1BT8A 2Y4UA 4GX5A 5LP6B 4LF5B 4YHHB 3G71V 2DQ3A 1K5QA 4IIJA 3SR2C 1AR1B 4NXMO 2LFRA 5FNVA 1URFA 2Y69B 2BTQA 1SA0A 1JA8A 3TJTA 4YJ2B 2XTAA 5D5PA 4FM2A 2Q0AA 4BW9A 3ABTA 3CCUV 2JK5C 1L8DA 4MVQA 2NNUA 1FYJA 1PM9A 3A0HZ 4O4JB 2YICA 1FS0G 3NXSA 1Q8IA 4KL1A 4O2AB 4JI5B 2DJVA 4X65O 3ML0A 2GSMB 3OW2U 2Q8VA 3ICXA 4TV8B 1VMGA 1DLBA 3ZHVA 5LGNA 3OMIB 2AZ2A 5K1XA 3CMAV 4JV5O 4DRXB 3H01A 4OPHA 3SPHA 4K0KB 2HG5C 4MT8A 4I55A 4LWSB 2YXLA 2PI4A 1YVWA 2CH7A 1MABG 4PDVA 2Q7EA 3IJ4A 1P84F 2CUGA 1TGOA 4CS2A 4A5UB 2R9AA 1WJZA 4KHPO 5LOVA 3CCVV 2WLJA 1Y76A 3ABKB 2YIDA 5JVDA 2V1DA 1XNRB 2ODMA 4TT3G 2Y4TA 1N0NA 4JI0O 5KX5A 1N32B 3A8TA 3G6EV 1GRJA 1K3EA 2BSKB 1HNWB 2WLIB 3ZMTA 3IGAC 2FYUH 3WU2Z 1DK1A 4P9PA 1LNQA 5DN6G 3TETA 4K8ZA 2UXBO 3B8NA 3RYIA 4LP8A 1SQBH 1Z2GA 1YI2V 4MVUA 4B3MO 4DV2O 5J2UB 5L3BA 3BFRA 3ZX6A 2OCCB 2ZE6A 5EK0A 1YEWA 2Z0AA 3RFRA 2WAMA 3JCZA 4PDRA 1XHZA 1JMKC 2YS8A 1M1KW 4DR6O 3SJAC 2ATKC 3UO2A 1FFXB 4G2KA 2X7RB 3JALA 2GDSA 1GN4A 1H2GA 5KA6A 3BCCH 3X2QC 1YF2A 1BL8A 3G67A 2GUZA 4HZ3A 5GONA 3J80N 2WLIA 1KD1W 3H9VA 5EIBD 3CCQV 1XREA 1F4MA 1K4DC 1OCOC 1D5AA 3KKYA 1H8HG 4TV9A 1YZBA 2G38A 2Q7HA 4MW8A 2ZNJA 3SDLA 3ZBHA 4YXWG 1NT2B 2HFEC 1GM9A 2JRIA 3ZHSA 1COWG 4JI2B 5A9GA 5CB4B 5IJ9B 1GK9A 3E8GA 5KAIZ 4DUYB 2YI8A 3JASB 4GX2A 3JCUZ 2YEVA 4FZ1A 2ZM6O 1TUEB 4JI6B 3M99B 1YITV 3IC9A 1E1RG 3GVMA 4WFEA 1KUQA 1B3QA 3ZRVA 4DV1O 2QM7A 4DUZO 4LH6A
chains in the Genus database with same CATH topology
1BE3H 1EZVH 2A06H 2BCCH 3L73H 1NTZH 1KYOF 1SQXH 3TGUH 1L0LH 1BGYH 3H1LH 1NTKH 4PD4F 1NTMH 1SQBH 3H1JH 2IBZH 3H1IH 4D6TH 1PP9H 5KLVH 1P84F 3H1HH 1NU1H 3L71H 3L74H 1PPJH 1SQVH 3CX5F 3L72H 3L75H 3L70H 1SQQH 2FYUH 3CWBH 1L0NH 1SQPH 1KB9F 1BCCH 3H1KH 4U3FH 3BCCH 3CXHF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 H;  1EZV H;  2A06 H;  2BCC H;  3L73 H;  1NTZ H;  1KYO F;  1SQX H;  3TGU H;  1L0L H;  1BGY H;  3H1L H;  1NTK H;  4PD4 F;  1NTM H;  1SQB H;  3H1J H;  2IBZ H;  3H1I H;  4D6T H;  1PP9 H;  5KLV H;  1P84 F;  3H1H H;  1NU1 H;  3L71 H;  3L74 H;  1PPJ H;  1SQV H;  3CX5 F;  3L72 H;  3L75 H;  3L70 H;  1SQQ H;  2FYU H;  3CWB H;  1L0N H;  1SQP H;  1KB9 F;  1BCC H;  3H1K H;  4U3F H;  3BCC H;  3CXH F; 
#chains in the Genus database with same CATH topology
 3ZHQ A;  1ZTE A;  3DC5 A;  1NVP D;  5H2F Z;  5LHH A;  2DW4 A;  2DWD C;  3LDE A;  3OAA G;  1QR8 A;  3RT3 C;  3W7X A;  2BE3 A;  2XAJ A;  2H3O A;  2WLH A;  3MD0 A;  1E79 G;  1VQM V;  4Z2W A;  4B3S B;  2K1E A;  3RN4 A;  1L0L H;  1J95 A;  4JI1 B;  1MZE A;  2EZO A;  3LNM B;  1EN4 A;  4JAV A;  4PD4 F;  1WN7 A;  3HKE A;  3UKM A;  4TV9 B;  3I56 V;  1M56 C;  4TQF A;  3W7T A;  1T5E A;  3QTC A;  2QA4 V;  3PN1 A;  4DR4 O;  3GWK C;  4JYA O;  5EZY B;  2N74 A;  3SPI A;  2Y0P A;  1VQ9 V;  2CAZ C;  2OIG A;  4L87 A;  2A06 H;  3FX7 A;  5EYP B;  2VQE B;  5BR8 O;  1W0J G;  3F5W C;  4FVM A;  3TXQ A;  1NJI W;  1FKA O;  3ASN B;  3OEH G;  2WLM A;  3N2G A;  4PDL A;  2JIZ G;  1PNK A;  4RO2 A;  1HP8 A;  2Q7G A;  1ARO P;  5HFM A;  3UCS C;  1WB8 A;  2X0L A;  2YIB D;  2B5U A;  2HP8 A;  1Y74 A;  4DR4 B;  2UUC O;  4BIO A;  5IWA O;  4YY3 B;  2EIM C;  4E2L A;  5C93 A;  2QKA A;  5IYB O;  1P7G A;  4J7Z A;  4H0L B;  1OCR B;  1UPG A;  2X6C A;  2DMX A;  4JGS A;  4X64 B;  3HKD B;  1JCH A;  2E74 B;  4B08 A;  3MHS C;  1P49 A;  4CS3 A;  1R3J C;  2UUC B;  1XBL A;  5LL6 Y;  1EZJ A;  1VF6 A;  1Y76 B;  3RYC B;  2CE4 A;  2IBZ H;  2DYR B;  3T1Y B;  1VQP V;  1R6K A;  2CGN A;  5KX5 B;  2XAQ A;  4J9Y B;  1H38 A;  4QGP A;  2AW9 A;  4JZ2 A;  5EC1 C;  3CCS V;  1PL4 A;  4P9O A;  2P7T C;  3C90 A;  4CH5 A;  4DV6 B;  3JAT A;  4U7O A;  2P4K A;  3CPW U;  3Q4H A;  3N2G B;  3ABU A;  4QJF B;  4J9Z B;  3UQ8 A;  2JGD B;  1Q5O A;  2RMK B;  4DV3 B;  1ZX3 A;  4B7K A;  1FAF A;  4DR7 O;  2H94 A;  1K8A W;  2Q5Z A;  2QGN A;  4CH4 A;  2L35 A;  4LFA O;  3SPJ A;  1ROP A;  4GLX A;  1IXM A;  3LDD A;  3CME V;  5KHK A;  4RQE A;  4LF4 O;  1BE3 H;  1IZ3 A;  1A32 A;  2QM4 A;  5IJ0 A;  4JI4 O;  2UU9 B;  5L3C A;  4X8A A;  1I5Y A;  4BW5 A;  2YXY A;  5ITZ B;  4HNA A;  4JAU A;  5B1N A;  2JEX A;  4FIP C;  1H2K A;  4JI3 B;  1QLE C;  2Q6A A;  1SET A;  1K9M W;  1BHB A;  2K9P A;  3HKB A;  1MOF A;  2ITC C;  1RSO B;  2QKC A;  5FNV B;  3E89 A;  4P30 A;  5KA5 A;  3ZED A;  4MS2 A;  1ZAU A;  1KU9 A;  4YIO A;  2OCC C;  1JX9 A;  1WNS A;  3E8F A;  4YJ2 A;  4NTW A;  3ABL C;  2DYS B;  3TK1 A;  4FM1 A;  1XL6 A;  1GAX A;  5LMU O;  4X1K B;  4CH3 A;  3K9S A;  2QTO A;  2F95 B;  1V9P A;  2QR4 A;  4KXR A;  1N0J A;  1PV0 A;  4OGQ B;  1SF9 A;  4DK0 A;  3ASN C;  1NTZ H;  1H8E G;  2YDE A;  3K3W A;  2WLL B;  3JD3 A;  5B1A C;  4NTY A;  3G80 A;  4O2A A;  4PI0 A;  2ZM6 B;  5CA0 B;  1Y74 B;  1TA8 A;  2UUB O;  5L3F A;  4N21 A;  1IUR A;  1PL0 A;  4TWK A;  3JAR B;  1RP3 B;  3QF7 A;  5J2T B;  5KHH A;  4RAI A;  3JAK A;  4LWS A;  3H1K H;  2W6J G;  2RDC A;  3T4D A;  2NR5 A;  3FB8 C;  5KHG A;  4W4K A;  3H1H H;  4X1I A;  2QKS A;  4NXM B;  1HNX O;  2YI9 A;  1QVF U;  2XAH A;  4JI1 O;  1OHH G;  2UXD B;  1KP2 A;  1B6Q A;  1FXV A;  3CCM V;  4JI2 O;  2P4V A;  5KHJ A;  3A0R A;  4DV7 B;  1W0K G;  4NB5 A;  1R6T A;  2CTW A;  3K04 A;  2HR3 A;  3BEH A;  3AG1 B;  2Y69 C;  3LUT B;  2RN9 A;  4DR1 B;  2FL4 A;  5CMU A;  1FXH A;  2YC0 A;  1G6U A;  4O2B B;  4DXW A;  5IT9 N;  4PA4 A;  2LQT A;  1YDX A;  4DV5 O;  3BY6 A;  3HPL C;  1V55 B;  5CN0 A;  4G28 B;  2DQ0 A;  4ZIB A;  2F23 A;  3P3P A;  3M7M X;  4XDK A;  4HNA B;  3WG7 C;  1JJO A;  3L9D A;  1N34 B;  1I7F A;  4YJ3 A;  2IW5 A;  5CBG A;  5LBQ A;  5TIS Z;  2FB5 A;  2HVJ C;  1VQ5 V;  4JTD B;  1G8M A;  3AG2 B;  2Z3Y A;  3C3S A;  5LYJ B;  5FLX N;  3CB2 A;  1K73 W;  2Q4P A;  2QEX V;  4TOI A;  1OCZ C;  3K0G A;  1XNR O;  4LF9 O;  1HW7 A;  1EN6 A;  5LHG A;  1NZ6 A;  1V54 C;  1AI7 A;  4U7N A;  2B1G A;  1YTF D;  1GO3 F;  1WPB A;  1MNG A;  5IE9 A;  4QIW F;  4UVA A;  3RVY A;  4CC6 A;  3U0Z A;  2L6L A;  1NR7 A;  3APQ A;  2ZDI C;  2C2A A;  3SYQ A;  4MVM A;  4DK1 A;  2Y48 A;  4JI3 O;  3BA8 A;  4LF6 O;  4GKK O;  2PTM A;  3RYF A;  1ZUQ A;  2ZIM A;  3OMN B;  1M4U A;  1KYO F;  4WBN B;  5KMG B;  3JAS A;  5BR8 B;  2YEV B;  1LUV A;  3VQW A;  3H1J H;  1IBM B;  1NKD A;  1MMM A;  1RFY A;  2FTK A;  1PNM A;  1IBK B;  1R3K C;  1H2L A;  4JYY A;  3WB1 A;  5LMN B;  1VIB A;  1S5J A;  1FXK A;  1KP3 A;  5B3S C;  5CA1 A;  3JD4 A;  4ZHQ B;  4LF6 B;  3CHX A;  2YIA A;  1LUW A;  5H6R A;  1XUQ A;  4I0X A;  4D7T A;  1IX9 A;  2IM9 A;  2OIE A;  3VOU A;  1GM7 A;  5LXT A;  2KG7 B;  1SQF A;  4FLX A;  2GUZ B;  1SRY A;  2AHY A;  4BAY A;  3ZMS A;  5BY1 A;  4I7Z B;  4YHH O;  1Y6X A;  3T1Y O;  2E3C A;  3CCL V;  1XNQ O;  2JDI G;  1XL4 A;  2BOC C;  1R3I C;  2VWJ A;  1YHQ V;  4J7J A;  3ZIA G;  5LGT A;  3M8A A;  1K92 A;  2HJD A;  1K5S A;  2E5L O;  2QE7 G;  4O2B A;  3E22 B;  3P32 A;  2CTR A;  4R50 A;  1ZL8 B;  4DRX A;  4FMT A;  2VQF B;  1P7B A;  1JVM A;  4DO2 A;  5IYD O;  5GTH Z;  4DV3 O;  3B77 A;  4KFM A;  1RPR A;  1OCO B;  2JJ1 G;  3D36 C;  2OTL V;  4NKG B;  4GKJ O;  1IXB A;  2QJ1 A;  1N8R W;  2P6J A;  4D6T H;  3K58 A;  5D5Q A;  1OCC B;  3ZRW A;  2ZNI A;  1VQK V;  1SQP H;  2D2C B;  5JVD B;  1MA1 A;  3JAR A;  5LXT B;  1NI8 A;  3D8C A;  2KKW A;  4OPA A;  5GTI Z;  3FKS G;  5JJE B;  5BXZ A;  3E86 A;  3STZ C;  4FLY A;  2LFS A;  2V7Q G;  2F1M A;  1VEW A;  1QVG U;  4JI7 O;  4JI8 B;  1VQ7 V;  3JYC A;  3STL C;  2EUL A;  3CP1 A;  3T1C A;  4X1I B;  1Z5V A;  2KB1 A;  5FL7 G;  1SS3 A;  3ETG A;  3RYI B;  3THO A;  5CBF A;  2BTQ B;  4LF5 O;  4NR1 A;  1NTK H;  3JD2 A;  1QCE A;  2ADP A;  2QM8 A;  3QO5 A;  2UUA O;  4LFB B;  4AHC A;  3CJH B;  4LR3 A;  2PGG A;  1NBM G;  3EFF K;  1AVM A;  3OGC C;  5BZB A;  5JWP A;  2QWQ B;  2QWO B;  1HR0 O;  2ZIO A;  1Q86 W;  2ZT9 B;  2EIN C;  1F4N A;  1AI5 A;  4X1Y B;  2IH1 C;  1G4Y B;  2N04 A;  3SJB C;  4X62 O;  4JI5 O;  3D36 A;  1CPY A;  3FD9 A;  2UUA B;  1CXZ B;  1HNX B;  5LP6 A;  1I0H A;  3ABM B;  5DEC A;  1S77 D;  2RQ6 A;  1M56 B;  3T4Z A;  4F6R A;  1F51 A;  3S3W A;  2VRZ A;  1K7D A;  5LYJ A;  3AG4 B;  2LW7 A;  4DV1 B;  3E22 A;  4QPJ A;  3QVN A;  4RUE A;  3CRQ A;  3K57 A;  5L3E A;  4X20 B;  4JAA A;  3SPG A;  1IBK O;  1K97 A;  1Q6H A;  3E2E A;  3ASO B;  4EKW A;  2EIJ C;  4X1K A;  3L71 H;  4B7E A;  1B04 A;  4O4I B;  3N2K A;  4MTG A;  2JJ2 G;  4K35 A;  1TVK A;  3B40 A;  3C3T A;  2RNB A;  1XHX A;  5B66 Z;  3R65 A;  4UXN A;  2XT9 A;  3RYF B;  2CGO A;  4PA9 A;  1Q81 W;  4QE9 A;  3RYH B;  4JTA B;  3CE2 A;  1M93 A;  2AHZ A;  4IHJ A;  1SZT A;  2AZ0 A;  1KEC A;  2Q0O C;  2QWN B;  3ZHU A;  4CS4 A;  4FJC C;  2ZXW C;  5E79 Z;  1N36 B;  2P5O A;  2JS3 A;  1SC5 B;  2WLN A;  3F5T A;  3JD1 A;  4LF9 B;  4CZZ A;  1WB7 A;  2H8P C;  4IT5 A;  3B8M A;  4GKJ B;  4YIP A;  4H37 A;  4I0X B;  4J41 A;  2AXT Z;  1WP7 A;  1AP5 A;  4Z1V A;  3L72 H;  3CSX A;  4NVP A;  1Q7Y W;  4GX0 A;  1QR9 A;  3OD4 A;  4LBE C;  2EIK C;  4F4L A;  5GW7 A;  5LP6 C;  1AI6 A;  1JR9 A;  1AJP A;  3K08 A;  2ZIN A;  4CH6 A;  3ZCC A;  4GUN A;  3FFQ A;  1EM1 A;  2EIL C;  3OE7 G;  3RGB A;  3SYP A;  3ETD A;  4IL6 Z;  1TVK B;  1NU1 H;  4JYA B;  4TUY B;  4UVC A;  2ETN A;  4FPP A;  1RM1 B;  4FLU A;  4FFB B;  1JOY A;  3CXC U;  3W7W A;  1N33 B;  1KKC A;  5LA6 A;  1U97 A;  1W59 A;  4RUF A;  1BZK A;  1XDC A;  1CEZ A;  2XHB A;  4DV4 O;  3TGU H;  1YXB A;  1TAE A;  3FAV B;  1K4C C;  2Q69 A;  1GKF A;  4F6R B;  3DXR A;  4X66 B;  3PJS K;  4I5S A;  1FFX A;  1KQS U;  2CTQ A;  2HKO A;  4GX1 A;  3H1L H;  3BRC A;  5KAF Z;  1IBL O;  4P2Z A;  1M5I A;  1BQ0 A;  3D3Q A;  2F43 G;  1GM8 A;  2CTP A;  4WCE V;  2PYL A;  4NXN O;  1SES A;  2DYS C;  4UVB A;  4DV7 O;  3T1H O;  2LW1 A;  5EBL C;  4ASU G;  5IY5 C;  1ZWI C;  5B1B C;  3W7U A;  4O4J A;  5JCO A;  4X62 B;  4FLZ A;  1XEQ A;  3ABM C;  3JD0 A;  4AIL C;  1YTF B;  3L73 H;  3ABK C;  3K79 A;  1VAR A;  3LNN A;  4GZR B;  1WLE A;  2JGD A;  1AP6 A;  1AR5 A;  2RCV A;  2E5L B;  4BIU A;  4TV8 A;  4FFB A;  5B1A B;  4WFB V;  5KHI A;  2IJK A;  5JJJ B;  5EBM C;  5LA6 B;  4K8X A;  1R1B A;  2M6Y A;  4KP4 A;  3AG4 C;  1KKD A;  4DR5 B;  3ABL B;  3RWR D;  5J9P C;  2YXH A;  5DM6 V;  1Y66 A;  3BHP A;  3P30 A;  4WFG A;  3CD6 V;  4EFB A;  2XAF A;  1Z5W A;  1QBZ A;  3HKB B;  2IJI A;  3OUS A;  4HYO A;  3ZMU A;  2B1I A;  1M57 C;  4JI7 B;  1QLE B;  2UXN A;  4JI8 O;  3K03 A;  4X1Y A;  1US6 A;  4X64 O;  1R3L C;  2EX3 A;  4G27 B;  4MVO A;  3ZMV A;  5L3D A;  4RQF A;  3CC4 V;  1D2D A;  1UJW B;  3RVZ A;  2LGW A;  2HHH B;  1K34 A;  3B4S A;  1OJH A;  2XUM A;  1H2M A;  2DYR C;  4I50 B;  1M9N A;  1CP9 A;  2WPD G;  1I94 B;  1GN6 A;  4H13 B;  1N36 O;  2A3Q A;  3AG7 A;  4EB6 B;  2EIL B;  2GV9 A;  4UCS A;  2HEP A;  1JFF A;  2JVD A;  2Q68 A;  4WBN A;  1E1Q G;  3K9A A;  5KMG A;  1N32 O;  5JH7 A;  3SJQ C;  1RPO A;  2CH7 B;  4UCU A;  3CEI A;  4ZKI A;  3IAY A;  4UB6 Z;  2GTA A;  1JJ2 U;  3R66 A;  3ZMZ A;  1QHT A;  1IBM O;  4JI0 B;  2JS5 A;  3GB7 C;  1S76 D;  1R73 A;  3KG2 A;  5KUK A;  2QWR B;  4JTC B;  4PA3 A;  5LOV B;  1F23 A;  4LF4 B;  3AG3 B;  3X2Q B;  5HFL A;  1THZ A;  4B3T O;  1AB3 A;  3CRM A;  1GMG A;  2KG7 A;  4Q6G A;  4BIZ A;  2A0L A;  2PZS A;  2DE0 X;  3I5D A;  1XI1 A;  4UCR A;  1H2S B;  5GON B;  3HKD A;  3E8B A;  2R9R B;  4X88 A;  4CBC A;  1VQO V;  3I55 V;  1P4R A;  5IY5 B;  1VF6 C;  5CA3 A;  4IYH A;  2EJ7 A;  3EHB B;  3QO8 A;  5E1A C;  3OTO B;  4DR6 B;  2BOB C;  2JEU A;  4X9Q A;  5B1B B;  3CC2 V;  3L75 H;  3E83 A;  3WB2 A;  1YSC A;  1ZL8 A;  1NH2 D;  4B3T B;  3F7V C;  4U3F H;  1NR1 A;  4IGG A;  4JV5 B;  2ADQ B;  2FKX A;  2EIN B;  1KBH A;  2GHY A;  2ZD9 A;  3KCY A;  4DV2 B;  2R72 A;  3ZRS A;  3FB5 C;  3ZHR A;  5LGU A;  3JSL A;  3K06 A;  1YCI A;  1SQV H;  1AI4 A;  3K5M A;  4LFC B;  4DR2 O;  2F66 C;  2V4D A;  3BPZ A;  4MTO A;  4TUY A;  2PY5 A;  3GWO A;  1D5N A;  1BSM A;  1S5H C;  4UV8 A;  1L1F A;  2Y0I A;  3SYO A;  4ICG A;  1ZLZ A;  2W6I G;  3J81 N;  2A9H A;  4I55 B;  1I5X A;  4B3R O;  2UXX A;  3AG2 C;  1VQ6 V;  2F4V B;  3G6B A;  5J2T A;  5ITZ A;  1XMO O;  1G1X B;  3CRR A;  3L70 H;  3TCU A;  1UFI A;  3K5N A;  4ABM A;  5IYZ B;  1BCC H;  4PDM A;  3NR7 A;  3OMA B;  4GYC B;  4MW3 A;  1GTO A;  2Q73 A;  4DR2 B;  4LFC O;  1FJG O;  4AI8 A;  1SKV A;  2UXD O;  2X6A A;  1BHA A;  4QE7 A;  4O4H A;  2OTJ V;  4YY3 O;  2BTO A;  1EN5 A;  3FB7 C;  1SZX A;  3SYC A;  2F4V O;  3CJH A;  4X20 A;  1JQ0 A;  4RWU A;  3AG1 C;  5H9C A;  5EC2 C;  1Q90 D;  4TSF G;  4J11 A;  3SPC A;  1X4T A;  4MTX A;  3ZJZ A;  2QTS A;  2EJR A;  1N4C A;  1VP7 A;  4B3S O;  1V55 C;  2HHH O;  3JAW A;  5K1P A;  4Q20 A;  1N33 O;  2ILM A;  1I94 O;  4JAS A;  1BS3 A;  5DED A;  3JAK B;  2VQE O;  4MSW C;  5LMU B;  4IHJ B;  2M7W A;  4DR1 O;  4WF9 V;  3HKC A;  4DR3 O;  2ZCE A;  2WA4 A;  4UCO A;  4I9W A;  3HKE B;  2XND G;  3CX5 F;  4UFZ A;  3HR0 A;  4YJ3 B;  4X66 O;  1VF7 A;  1OCC C;  3JSN A;  1Q6U A;  3LSQ A;  2ZXW B;  3CYO A;  1VQN V;  1BMF G;  2NLJ C;  3VQV A;  3JAL B;  2EIJ B;  4JYB A;  1QLN A;  2R70 A;  2UXC O;  1TUB B;  4DR3 B;  3AK1 A;  3UO3 A;  2OT5 A;  4W4L A;  2ZDI A;  3CCR V;  4MVR A;  4O4L A;  4X89 A;  4I4T A;  1O9H A;  2Q9L A;  3CC7 V;  2YUA A;  4ZBM A;  1YIJ V;  4X65 B;  2PYJ A;  5LHI A;  2B9Z A;  4PV1 B;  3MDS A;  2LO1 A;  4WFA V;  2E75 B;  4XDJ A;  1PD3 A;  1PPJ H;  5BMV A;  3RYH A;  4PEL A;  4LF8 O;  4BWA A;  4LC1 A;  1DF5 A;  4DV0 B;  4CC5 A;  3OR7 C;  2EBO A;  1S5L Z;  5H5N A;  5IYZ A;  2ITD C;  2WLK A;  1W2B U;  3CCJ V;  4AQY O;  4KHP B;  2IH3 C;  2IU0 A;  4JYC A;  2EZP A;  1MSD A;  4DV6 O;  1SER A;  1Q6I A;  4H33 A;  4PJ0 Z;  4I9Q A;  1U96 A;  1QNM A;  2IJJ A;  1OZ0 A;  4LF8 B;  4FLW A;  4XDL A;  1O9G A;  5FPR A;  1DGS A;  1F7Y A;  4IYI A;  3SYA A;  4B3R B;  1Q43 A;  5H6Q A;  1EFR G;  3BAB A;  1HNW O;  2QSA A;  3OT7 A;  3KZI Z;  2UXB B;  1S72 V;  3CWB H;  3OGI B;  2P22 C;  3LSS A;  1MG1 A;  2E76 B;  2P06 A;  3AK2 A;  3D3I A;  4EEQ A;  1EZV H;  5EZY A;  4DV4 B;  3CRC A;  1SQX H;  3E8H A;  5IYC O;  2PF4 E;  4LFB O;  2DWE C;  2R9I A;  1KC8 W;  5EYP A;  4FZ0 A;  2XAG A;  1VQL V;  1PP9 H;  2YIB A;  1AR4 A;  2EIK B;  1FD9 A;  5A2Q N;  1HNZ O;  1K33 A;  3UT5 B;  5B1O A;  2JGU A;  3O9O A;  2N05 A;  4WFH A;  2HVK C;  2IU3 A;  1FXK C;  2W0F C;  3SGI A;  4ZI7 A;  3G4S V;  3APO A;  1XMQ O;  2QDO A;  3DXR B;  1NVP B;  1BQZ A;  3A2F A;  2GBO A;  2ZE5 A;  3ZS8 C;  4ZHQ A;  1M90 W;  4ZOL B;  4LF7 O;  1WP8 A;  1SQG A;  5AG2 A;  3OEE G;  3ZRW B;  3B2E E;  1S0V A;  3VQX A;  3MAQ A;  3HB3 B;  4K3A A;  1TUB A;  3K59 A;  4OXS A;  4OX9 O;  3OTO O;  3N27 A;  2LGQ A;  2BSK A;  1R6N A;  1M57 B;  3QO7 A;  1NS1 A;  3FYE B;  4TQD A;  1Y4M A;  5EBW C;  3N2K B;  3T1H B;  1IVS A;  4J10 A;  4DYL A;  4FK5 C;  1PNL A;  2EIM B;  4DW1 A;  3RYC A;  3IFX A;  1OCR C;  5C8Y A;  1WA8 B;  4DUY O;  1IDS A;  2WWW A;  4QPK A;  5L3G A;  4JZG A;  3MHH C;  3EXA A;  5JH7 B;  3QNE A;  3WB0 A;  1HR0 B;  1VF5 B;  4NTX A;  4FLT A;  4MTF A;  2HLD G;  4UCV A;  3J7A U;  3L74 H;  4NYK A;  2DOS A;  2MW2 B;  4PI2 A;  1SQQ H;  1AJQ A;  4WFF A;  4IIJ B;  2WA3 A;  3CXH F;  3JAW B;  3VQY A;  2CDY A;  1VQ4 V;  1GN3 A;  2ZR2 A;  5KUM A;  1YJW V;  3DGE A;  1NH2 B;  5IJ0 B;  5JJN B;  2QWP B;  2CK3 G;  4H44 B;  1GH6 A;  3EVK A;  3LDC A;  1XQ8 A;  3P3N A;  2ZQM A;  1L0N H;  5FPO A;  4DR7 B;  1S3J A;  4DV0 O;  2RJZ A;  4DV5 B;  1DTO A;  1Q3E A;  3K5O A;  4R8C A;  4J7K A;  4R6Z A;  4R7C A;  4JPR A;  2HJF C;  4LNU A;  3KCX A;  5CB4 A;  1RSO A;  1MSW D;  4BR6 A;  5B5E Z;  1OV9 A;  4U3J B;  5C8Y B;  3OR6 C;  2P67 A;  4J80 A;  3A0B Z;  2IJH A;  3OTF A;  1FPO A;  3LSU A;  3UT5 A;  2KQX A;  3K5L A;  1HDJ A;  3VBB A;  1RM1 C;  1OCZ B;  2O57 A;  3TXS A;  4O4L B;  3FYI B;  3F7Y C;  1GN2 A;  4ZI7 B;  3ZN0 A;  1BGY H;  3FAV A;  1DF4 A;  3BA9 A;  1NTM H;  4HAM A;  4LH7 A;  4O4I A;  4UCT A;  1FXK B;  4ZOL A;  5KLV H;  2WLL A;  2OCH A;  5CA0 A;  1ZSP A;  5IWA B;  1AIL A;  3S3X A;  3UM7 A;  2A79 B;  3CS5 A;  5BMV B;  3T2M A;  5JCO C;  5IDJ A;  4GKK B;  1FFT B;  3CCE V;  5EIB C;  1ORQ C;  1YJN V;  2XAS A;  2VQF O;  2XOK G;  3DTU B;  4AQY B;  4K0K O;  3RBZ A;  4UUJ C;  3JAM N;  4LCU C;  2ARH A;  4HBN A;  3AEI A;  2NN4 A;  1WPX A;  3W7S A;  3ETQ A;  1XOU A;  1KMI Z;  2KSD A;  3OUF A;  4LNU B;  4KUM A;  1MZF A;  1JPX A;  2LP7 A;  1HNZ B;  5LMN O;  2OWO A;  3IC7 A;  3OFN G;  4O4H B;  5J2U A;  3B09 A;  2ZKO A;  2UXC B;  3H1I H;  1X59 A;  2FML A;  1XIL A;  2A7W A;  2Q67 A;  3BVO A;  1XMQ B;  1YJ9 V;  3JAT B;  1KB9 F;  3OM3 B;  1ENV A;  4LF7 B;  3Q4H B;  5CA1 B;  4QNH B;  3RW0 A;  3DC6 A;  4EFE A;  2ZE7 A;  5B3S B;  4JF3 A;  4GT1 A;  3CRA A;  4UB8 Z;  1XNQ B;  2UU9 O;  2OYQ A;  1QQC A;  2LJ2 A;  4MVS A;  4B3M B;  4DUZ B;  5JQG B;  4F6E A;  3O65 A;  3FB6 C;  2ZR3 A;  1HWY A;  4DW0 A;  4LFA B;  3ZHT A;  4Z1M G;  2F93 B;  2YSU B;  2DN9 A;  4J42 A;  1WAZ A;  2ZE8 A;  2AGA A;  1Y67 A;  1VQ8 V;  4JI4 B;  3HKC B;  1XMO B;  2MK3 A;  5F2V O;  2GTS A;  4N23 A;  3WFV A;  3QG5 A;  3E35 A;  1H2N A;  4UV9 A;  1LR1 A;  3ZN1 A;  1IBL B;  1I08 A;  4I50 A;  3ASO C;  4OX9 B;  1QU7 A;  4U3J A;  4XBF A;  4FFK A;  1FJG B;  1SA0 B;  4MVZ A;  5CBH A;  4EB6 A;  3U10 A;  5IJ9 A;  1AJN A;  1JFF B;  2WSS G;  1N34 O;  2BCC H;  2VS0 A;  4D7S A;  2X6B A;  3AK3 A;  1EBO A;  4PA7 A;  3U11 A;  2W0X A;  1J5E O;  3ETE A;  2PI5 A;  4PA6 A;  4GCZ A;  4FM0 A;  4I4T B;  3BAA A;  1Q82 W;  4JI6 O;  4FLV A;  3DSQ A;  1PKX A;  2VWK A;  3K0D A;  4DR5 O;  1WA8 A;  2PUS A;  3ZRX A;  4PHZ A;  1NQT A;  2D3O W;  2Z5U A;  1J5E B;  4C7U A;  2UUB B;  4E4E A;  3WG7 B;  5JQG A;  4L8J A;  3SJC C;  1B06 A;  3AG3 C;  4NXN B;  1V54 B;  2P90 A;  1BT8 A;  2Y4U A;  4GX5 A;  5LP6 B;  4LF5 B;  4YHH B;  3G71 V;  2DQ3 A;  1K5Q A;  4IIJ A;  3SR2 C;  1AR1 B;  4NXM O;  2LFR A;  5FNV A;  1URF A;  2Y69 B;  2BTQ A;  1SA0 A;  1JA8 A;  3TJT A;  4YJ2 B;  2XTA A;  5D5P A;  4FM2 A;  2Q0A A;  4BW9 A;  3ABT A;  3CCU V;  2JK5 C;  1L8D A;  4MVQ A;  2NNU A;  1FYJ A;  1PM9 A;  3A0H Z;  4O4J B;  2YIC A;  1FS0 G;  3NXS A;  1Q8I A;  4KL1 A;  4O2A B;  4JI5 B;  2DJV A;  4X65 O;  3ML0 A;  2GSM B;  3OW2 U;  2Q8V A;  3ICX A;  4TV8 B;  1VMG A;  1DLB A;  3ZHV A;  5LGN A;  3OMI B;  2AZ2 A;  5K1X A;  3CMA V;  4JV5 O;  4DRX B;  3H01 A;  4OPH A;  3SPH A;  4K0K B;  2HG5 C;  4MT8 A;  4I55 A;  4LWS B;  2YXL A;  2PI4 A;  1YVW A;  2CH7 A;  1MAB G;  4PDV A;  2Q7E A;  3IJ4 A;  1P84 F;  2CUG A;  1TGO A;  4CS2 A;  4A5U B;  2R9A A;  1WJZ A;  4KHP O;  5LOV A;  3CCV V;  2WLJ A;  1Y76 A;  3ABK B;  2YID A;  5JVD A;  2V1D A;  1XNR B;  2ODM A;  4TT3 G;  2Y4T A;  1N0N A;  4JI0 O;  5KX5 A;  1N32 B;  3A8T A;  3G6E V;  1GRJ A;  1K3E A;  2BSK B;  1HNW B;  2WLI B;  3ZMT A;  3IGA C;  2FYU H;  3WU2 Z;  1DK1 A;  4P9P A;  1LNQ A;  5DN6 G;  3TET A;  4K8Z A;  2UXB O;  3B8N A;  3RYI A;  4LP8 A;  1SQB H;  1Z2G A;  1YI2 V;  4MVU A;  4B3M O;  4DV2 O;  5J2U B;  5L3B A;  3BFR A;  3ZX6 A;  2OCC B;  2ZE6 A;  5EK0 A;  1YEW A;  2Z0A A;  3RFR A;  2WAM A;  3JCZ A;  4PDR A;  1XHZ A;  1JMK C;  2YS8 A;  1M1K W;  4DR6 O;  3SJA C;  2ATK C;  3UO2 A;  1FFX B;  4G2K A;  2X7R B;  3JAL A;  2GDS A;  1GN4 A;  1H2G A;  5KA6 A;  3BCC H;  3X2Q C;  1YF2 A;  1BL8 A;  3G67 A;  2GUZ A;  4HZ3 A;  5GON A;  3J80 N;  2WLI A;  1KD1 W;  3H9V A;  5EIB D;  3CCQ V;  1XRE A;  1F4M A;  1K4D C;  1OCO C;  1D5A A;  3KKY A;  1H8H G;  4TV9 A;  1YZB A;  2G38 A;  2Q7H A;  4MW8 A;  2ZNJ A;  3SDL A;  3ZBH A;  4YXW G;  1NT2 B;  2HFE C;  1GM9 A;  2JRI A;  3ZHS A;  1COW G;  4JI2 B;  5A9G A;  5CB4 B;  5IJ9 B;  1GK9 A;  3E8G A;  5KAI Z;  4DUY B;  2YI8 A;  3JAS B;  4GX2 A;  3JCU Z;  2YEV A;  4FZ1 A;  2ZM6 O;  1TUE B;  4JI6 B;  3M99 B;  1YIT V;  3IC9 A;  1E1R G;  3GVM A;  4WFE A;  1KUQ A;  1B3Q A;  3ZRV A;  4DV1 O;  2QM7 A;  4DUZ O;  4LH6 A; 
#chains in the Genus database with same CATH homology
 1BE3 H;  1EZV H;  2A06 H;  2BCC H;  3L73 H;  1NTZ H;  1KYO F;  1SQX H;  3TGU H;  1L0L H;  1BGY H;  3H1L H;  1NTK H;  4PD4 F;  1NTM H;  1SQB H;  3H1J H;  2IBZ H;  3H1I H;  4D6T H;  1PP9 H;  5KLV H;  1P84 F;  3H1H H;  1NU1 H;  3L71 H;  3L74 H;  1PPJ H;  1SQV H;  3CX5 F;  3L72 H;  3L75 H;  3L70 H;  1SQQ H;  2FYU H;  3CWB H;  1L0N H;  1SQP H;  1KB9 F;  1BCC H;  3H1K H;  4U3F H;  3BCC H;  3CXH F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...