4PD4F

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4pd4F00
1L0LH 1SQBH 3L71H 3CXHF 5KLVH 1KYOF 1L0NH 1SQXH 3TGUH 1PP9H 3H1HH 2FYUH 1NTMH 3H1LH 4U3FH 1BGYH 4PD4F 3BCCH 1SQPH 1BCCH 2BCCH 3CX5F 3L73H 3H1IH 1EZVH 2A06H 3H1KH 3L74H 3H1JH 1NTKH 1NTZH 3L75H 2IBZH 1KB9F 1BE3H 1NU1H 1SQQH 3L70H 3CWBH 1SQVH 1PPJH 3L72H 1P84F 4D6TH
chains in the Genus database with same CATH superfamily
1EN4A 2E76B 5B1BC 3EHBB 2QA4V 4Z1MG 4O2BA 2LFSA 4WF9V 5KUMA 3LSSA 1Z2GA 1QBZA 3K57A 4DR4O 1YCIA 1SERA 3WU2Z 1N0JA 3ZHRA 5L3EA 5B1OA 4GX5A 2Y69B 1K7DA 4FFBB 3CXHF 5FPOA 3CCLV 4X1KA 1XL6A 1G4YB 4DUZB 3O9OA 1URFA 3B40A 5LYJB 3KG2A 4TT3G 4W4KA 2P7TC 3H1JH 2OTJV 1R3LC 1OHHG 1H2KA 3CCQV 5IY5B 5JJEB 4UV9A 1OCZB 2F93B 1VF5B 5L3FA 1Q86W 3ASOB 5LMUB 4JZGA 4TSFG 3K79A 4X65O 2OT5A 3H9VA 1XMQB 5C8YA 3G71V 1ENVA 1B06A 2QKSA 4DV6B 2Q7HA 4FM0A 4O2AB 1NR1A 3HKBA 4IL6Z 5IE9A 1FFTB 2DQ0A 1Y76B 4FIPC 1VQ9V 1YF2A 3PJSK 3CEIA 4D6TH 4B3MB 1OCOB 3JYCA 4DV2O 4GKKB 1BGYH 1XNQB 1Y74A 1S5JA 2KQXA 1FXKC 4X9QA 3N2GB 3OGIB 5LGNA 4LFAB 4DR1B 2E5LO 4UVAA 1FJGB 5IJ0B 3AEIA 3U10A 3ZEDA 1PPJH 2OCCC 3ZMUA 4EFEA 2F43G 1AJQA 3MHSC 4U3FH 4LFAO 2EBOA 4AHCA 2HKOA 4DV1O 3D36C 4JI8O 4DV2B 2GUZA 3MD0A 3KCYA 5LOVA 3LSQA 5EYPB 2Y0PA 1SQBH 4X62B 4KHPO 1VQ7V 4LWSB 3A0HZ 1EBOA 4TUYB 1H2SB 3GB7C 4OPHA 3FB5C 4JYYA 2E75B 2PTMA 2EINB 2QKAA 2X0LA 3OMIB 3R65A 3ZMTA 3CCSV 4UCRA 3JD2A 5IYBO 2UUAB 5JH7B 4O4HB 2A3QA 4PA4A 3GVMA 3CPWU 1N36B 3UO3A 1Q82W 2Q5ZA 1MOFA 3E83A 3ICXA 3OM3B 2X6BA 2F66C 4GKJO 4Q20A 3G4SV 2UUCB 3WFVA 4YY3O 3CMAV 2KG7B 4JI0O 3SPGA 3CCMV 5FNVA 4DR2O 1E79G 1BE3H 4DUYO 5L3GA 4ZKIA 3LDEA 2ZINA 2ILMA 3CXCU 5EYPA 4DR2B 4DV3O 4LF6O 5A9GA 1AJNA 3M8AA 4U3JB 2XAQA 5C8YB 4I7ZB 1I94O 2YS8A 4DR4B 5FPRA 4A5UB 1R6TA 5JJJB 2Q67A 3ZMVA 2HEPA 4NTYA 3EFFK 3ABLB 2HHHO 1F4MA 2AHZA 3SJQC 5H5NA 4FFKA 3SPIA 4N23A 3J80N 4X1YB 2LW1A 1EFRG 1BHBA 3D36A 4NR1A 4PA3A 3BHPA 3IC9A 1DF5A 2JDIG 2AZ0A 5BZBA 4CC5A 1SKVA 1TUEB 5B3SC 4CS3A 2WLLA 1H2MA 2XAGA 4NTXA 2RQ6A 3UO2A 3LUTB 1KECA 5IYZB 5KAFZ 3UM7A 3ML0A 1NKDA 3ZCCA 2KKWA 1GM9A 4RUFA 5KX5A 4G27B 2FL4A 4ZOLA 3RN4A 1K97A 1YVWA 1ZAUA 1HR0O 4GX2A 3H1LH 3K5MA 2WLHA 5DN6G 1H2GA 1CP9A 3G67A 2IJKA 3H1IH 1FPOA 3VQWA 4DXWA 3DXRA 4HNAB 3L75H 2Z3YA 3OW2U 4DV7O 2PY5A 1K92A 1OCCC 5LXTA 1WN7A 3RYCB 3RVZA 3UQ8A 3AG2B 2Q4PA 4DR1O 2JS5A 4X1IA 5F2VO 2CTQA 2VS0A 4K0KB 4D7SA 2P6JA 4J11A 4O4IA 4AI8A 4E4EA 1YDXA 1EM1A 2A79B 4UCUA 5FLXN 1WA8B 1I94B 3FFQA 1H2NA 3AK2A 1JMKC 4DV4B 1HW7A 3JD1A 4FLWA 4I55A 2DW4A 1S3JA 4MT8A 4DK0A 3G6BA 1QLEC 1P84F 4WFFA 2UUCO 2ZE6A 4JI5B 3CCEV 4O4IB 3T2MA 3ZHVA 4RO2A 5GONB 2GTSA 4J42A 2VQEB 4DV1B 4JYCA 4X1IB 4WFGA 1K3EA 3QO5A 4GUNA 5J9PC 4DR5B 1YSCA 4QGPA 3JASB 4CH4A 1R3IC 1UPGA 4OXSA 5JCOC 4QNHB 3KCXA 5LA6B 2Y69C 2CTWA 1Q8IA 2VWKA 3B8NA 1NTMH 1AR1B 5CBHA 3AG7A 5GONA 4LH6A 2FB5A 3OUFA 4B7EA 3CHXA 2WLIB 3ZRVA 2B1IA 1BL8A 1VF6A 2QM4A 2WLLB 2V1DA 3SDLA 4I55B 5DECA 2WLNA 3E2EA 4R6ZA 3EVKA 3KZIZ 1GH6A 5IYCO 3SJCC 4UCOA 4K35A 2QSAA 4UXNA 3T4ZA 3L73H 1PL4A 2Y4UA 4OPAA 3ETDA 4TV9B 1Q90D 2GBOA 1F4NA 4JI1B 4X88A 4QPJA 4DR3B 1FAFA 4MVSA 2ZXWB 3U11A 4PD4F 4CZZA 1XNQO 2Q7EA 5H9CA 4WBNA 4EEQA 2HJFC 2CGNA 2AHYA 4JYBA 2IJIA 4LFCB 5LHIA 4FM2A 5KHGA 4FLZA 4ZOLB 2QJ1A 2XUMA 4QPKA 5FNVB 4NXMB 2A9HA 5IYZA 1V55B 1YJ9V 3OTFA 4DV6O 4CC6A 2QM8A 4FK5C 4H33A 5KHJA 1K34A 2EIKB 2YXYA 4PJ0Z 3SYQA 1US6A 4E2LA 1GRJA 3RFRA 2DJVA 1GM8A 4JAAA 2CUGA 4B3TO 4P9PA 5KLVH 1FXVA 4LNUB 2PF4E 3AG3C 3ZHSA 4JI4O 4K3AA 3D3IA 1XNRB 2GHYA 4LF8O 1JA8A 4CS4A 1IBKB 2WA3A 4YIPA 4FLYA 4LP8A 1I7FA 4J41A 1EZVH 4MTOA 1E1QG 2AW9A 4JI5O 4TQFA 5CBGA 3TXSA 1M1KW 4LF5O 2JJ2G 2Z0AA 2O57A 4PA7A 1BZKA 4FPPA 1HNXO 2CTRA 2YICA 1WB8A 1IBLO 4LFBO 1NH2D 2BSKA 5L3BA 4X66B 4JI2O 1BQ0A 3JAWB 2ITDC 5KMGB 4LNUA 1JR9A 4UCVA 3NR7A 1JFFB 3ETEA 4B3SB 4I5SA 2YSUB 2UXBO 3AK1A 4NB5A 4R7CA 1WAZA 3ZN0A 1VQ4V 2P4KA 4ZI7A 4MTGA 4UB8Z 4B3SO 1Q6UA 3EXAA 3C3TA 3JAMN 4P2ZA 1KBHA 1ZLZA 1Q3EA 2PI5A 1F51A 1J95A 3B77A 4TUYA 4X66O 4JI2B 4DYLA 1CEZA 5JVDA 4LFBB 4ASUG 2WLKA 3OR7C 3OTOB 4GX1A 3CJHB 1NR7A 4BIUA 1W59A 3HKBB 5LOVB 2AZ2A 5B3SB 4JI7O 4QE7A 5LHHA 3O65A 3F5TA 1SQFA 2Q8VA 4GCZA 1N36O 3RYFA 3ASNC 1IVSA 5LHGA 1KB9F 1OV9A 1CPYA 1OCOC 1YITV 3OGCC 3HKCA 5JWPA 2D2CB 2UU9B 3ABLC 1W0JG 1K4CC 1ZL8B 3VQXA 4N21A 2YIDA 5KHKA 3OEHG 1M4UA 4Z1VA 2XT9A 1PNMA 3AG4B 5LL6Y 4UV8A 2X6AA 1VQ5V 1NU1H 4YIOA 5BY1A 1Q7YW 2M6YA 1MZEA 1ZWIC 2UXDO 2OIEA 3C3SA 1IXBA 1Z5VA 3JD3A 5IY5C 2CK3G 5KHIA 2YIAA 5LP6C 2OYQA 1EN5A 4X89A 4YY3B 1R73A 1OJHA 2ADQB 1LUVA 4R50A 4WFHA 3ZN1A 4JAUA 1XDCA 4MVRA 3SR2C 1FD9A 4PA6A 1NVPB 1XHZA 3L72H 2UUBO 5EC2C 5J2UA 1GKFA 1VQ8V 2DYSC 1GM7A 1G8MA 3WG7C 3IC7A 3S3WA 3FX7A 4X1KB 4NXMO 2Q73A 3L9DA 2W6JG 4LF4O 3ZHTA 1Y6XA 1G6UA 3M99B 2PGGA 1XI1A 4LF5B 2JVDA 1KMIZ 1SZXA 2UXXA 5DM6V 4Q6GA 4DV5O 1QQCA 2AGAA 5HFMA 4DV0B 1XMOO 1IBKO 4H37A 3FAVB 2B1GA 2XAHA 5E1AC 1NTKH 2P4VA 5ITZB 5H2FZ 1N34O 2Z5UA 3K0DA 5CA3A 3BA8A 1GTOA 4AQYB 3KKYA 3SPCA 4KXRA 1JQ0A 1O9HA 2CAZC 3UT5A 3VBBA 1YTFD 1FJGO 2DN9A 2NNUA 2QM7A 1JPXA 1DK1A 1Q81W 3CC2V 3M7MX 3Q4HB 1FXHA 3OEEG 3MAQA 3THOA 1N33O 5J2TB 2Y4TA 1COWG 2IW5A 3SJAC 5CB4B 1ZSPA 1KKCA 4BW5A 4FLTA 1UJWB 3JALB 1M93A 3ASOC 4LF7B 2ZKOA 3S3XA 3K59A 2UXCB 1R3JC 2XAFA 2UU9O 3FD9A 3FB7C 1DLBA 4IHJA 2RMKB 2IH1C 1QVGU 2G38A 5AG2A 1K4DC 4Z2WA 1CXZB 3T1YO 3JD4A 1PP9H 3ZMZA 5LGTA 1XHXA 4F4LA 2V4DA 4PDVA 1R6NA 5K1PA 4DUZO 4B3RB 5B66Z 4K8ZA 3JALA 3R66A 2YIBA 3JATA 1XREA 5CB4A 2XNDG 2KG7A 3SPJA 5IJ9A 1MA1A 2JEUA 5KUKA 4L8JA 1JCHA 3Q4HA 4I0XA 2NR5A 3CRMA 1P7BA 3RWRD 1T5EA 4BW9A 1YZBA 3ABMB 5JH7A 2CH7B 2QWRB 1SESA 1SQQH 2JEXA 1KC8W 2W6IG 4DR5O 5H6QA 1RM1B 3FAVA 4I50A 4JTAB 2Q6AA 4LWSA 4DRXB 2HG5C 3P3PA 2DYRC 4B7KA 4PHZA 3CRRA 3SPHA 1TVKB 1HNZB 1AROP 3J7AU 4BIZA 1XBLA 2BE3A 3IJ4A 1SZTA 1N8RW 2R9AA 3L70H 2GUZB 1HNZO 3TETA 2JK5C 2ZDIA 3ABKB 1Q5OA 3JCUZ 4JPRA 3W7SA 3AG1B 1XNRO 3J81N 1RP3B 1GMGA 3QO8A 2A06H 1V54C 4KUMA 2BTQB 4TV8A 3TCUA 5EZYA 3K03A 3CE2A 4YJ2A 4MVUA 1KD1W 2LW7A 3MDSA 3N2GA 3ABMC 1XQ8A 5BMVB 1M57C 4O4JA 3K5OA 4CH5A 4DR7O 1I5YA 1NI8A 3D3QA 2QEXV 1YJNV 4UB6Z 3SYOA 3IAYA 1NTZH 4X62O 5EIBD 4J9YB 1Y76A 5JJNB 1BSMA 5CA0A 4UFZA 4LFCO 4RQEA 2OCHA 2YUAA 4U7NA 1IXMA 1FXKA 1PNLA 1EN6A 5FL7G 2QDOA 2AXTZ 4X20B 2QWQB 2Y0IA 2A0LA 1RSOB 2LQTA 4NXNB 4JI3B 1NQTA 1AI6A 1QNMA 2XHBA 5EZYB 1ZL8A 2P90A 5EBMC 3TXQA 4TQDA 1VIBA 3HKCB 2EINC 3AG3B 1Q6IA 1H38A 1SQXH 4LF7O 3MHHC 2E5LB 2DE0X 3RYFB 3E8HA 1RSOA 1N4CA 2K1EA 1OCRC 2EJRA 2LO1A 1IBLB 4J10A 4KHPB 4BIOA 1LR1A 5CMUA 1G1XB 2R9IA 4FFBA 5TISZ 4GKKO 2MW2B 1B3QA 1PM9A 2K9PA 2ZDIC 4B3MO 2ITCC 1YXBA 2GDSA 2YXLA 3BPZA 3RYIA 4JTDB 1VQMV 2NN4A 1M5IA 3BVOA 3CJHA 4GYCB 4HZ3A 1K8AW 2W0XA 5KHHA 5H6RA 1NBMG 2D3OW 4OX9B 4DR6O 1SA0A 4MW8A 1XMQO 3BFRA 3E22A 2BCCH 2H94A 2WLJA 3D8CA 3ABKC 1HP8A 5LMUO 2LFRA 2IJHA 3A0BZ 1K9MW 4B3TB 4DR3O 1YIJV 3B09A 4ZHQB 2ADPA 3FYIB 2UXNA 2DYRB 5IWAO 3CRCA 1XMOB 4I0XB 3H1HH 2VQEO 2ZD9A 3G6EV 4F6RA 1BCCH 2RCVA 5EIBC 5LP6A 3JARB 2BSKB 5GTHZ 1YEWA 4UVCA 3SYCA 1HDJA 1K5QA 3WB0A 3CCVV 3RVYA 1AI4A 2PZSA 4DV4O 5JQGB 1TAEA 2GTAA 1I08A 1MNGA 1TUBA 2WAMA 3E8FA 3DC6A 4K0KO 2QGNA 4RUEA 3K3WA 2RJZA 5HFLA 4MW3A 5CA1A 1P7GA 4FLXA 4JI1O 4FJCC 1VQ6V 4EKWA 3JAKB 2P06A 3GWOA 2CH7A 3HKDA 4FLVA 2PYLA 4I4TB 2HLDG 1LUWA 1YHQV 5JCOA 1EZJA 4IGGA 2QWOB 1NT2B 1FFXA 4QIWF 2WSSG 4P30A 1KKDA 4BWAA 2HR3A 4EB6A 1VQKV 4YHHO 3T1HB 2XOKG 2ZT9B 1NS1A 1P4RA 3SYAA 1Y67A 4YJ3B 4H44B 1S5HC 5B1BB 1I5XA 5D5PA 5LGUA 2L6LA 3AG4C 2XAJA 2ZR2A 3T4DA 3W7UA 1WJZA 1BMFG 4MTFA 2P67A 4GT1A 3I56V 3ETQA 4PA9A 3WB1A 1ROPA 3JAKA 2X6CA 5CA1B 1Q43A 4JI6B 1L0NH 2YDEA 1BHAA 1XOUA 1BS3A 3BCCH 3CCJV 1TUBB 2M7WA 4OX9O 4U7OA 1HR0B 2BOBC 5CBFA 2DMXA 3K04A 3OUSA 3TJTA 4GX0A 1IBMO 5B1NA 1S72V 3CMEV 4PDMA 3ZRWA 5C93A 1R3KC 5E79Z 5J2UB 5CN0A 1LNQA 4I4TA 3CC7V 5B1AB 5LA6A 4PI0A 3WB2A 2UUAO 4TWKA 2Q0AA 3G80A 1M9NA 2P22C 1KU9A 5ITZA 2YI8A 2Q0OC 2HHHB 5L3CA 3E86A 3RYHB 1PKXA 4MVMA 1AP5A 2IU0A 4IYIA 4DV3B 4LF6B 2ETNA 2EIJB 1M56C 1AJPA 3L71H 3OAAG 4QE9A 1AR4A 1KYOF 3VOUA 2F23A 4DO2A 3JD0A 2N04A 5LP6B 3DGEA 1WP8A 1A32A 4F6RB 4RQFA 1S5LZ 1GN4A 3CRAA 3X2QC 2JGDA 4G2KA 2EILC 3B4SA 1MG1A 5EK0A 2UXBB 2QWPB 1M57B 3F5WC 3FKSG 4HNAA 4NYKA 1TGOA 1BT8A 3LSUA 4J7JA 4PELA 2UXCO 3BRCA 3E22B 5DEDA 3A8TA 2EIMB 4FZ1A 3CX5F 2LJ2A 3BABA 3E35A 2LP7A 1V54B 3RW0A 4K8XA 4YHHB 1V55C 1WLEA 2W0FC 2Y48A 3SYPA 4IIJA 4TOIA 1JVMA 5JVDB 1N33B 3P32A 3K06A 3APQA 3I55V 1SQGA 4OGQB 4PDLA 1XUQA 4JI4B 2EZPA 1HNWB 2ZE5A 2ZXWC 1VMGA 1QVFU 1GO3F 3CRQA 2EULA 3OMNB 4JV5O 4X1YA 1AI7A 1Y66A 3ZJZA 2OCCB 3ZMSA 1RPRA 5KMGA 3JAWA 1RM1C 3ZRXA 4LH7A 1Y4MA 2ARHA 2EIMC 2YXHA 1PL0A 4LF9B 1FXKB 1S77D 3T1HO 1IX9A 1OCRB 4ICGA 3IGAC 3SJBC 3CB2A 4CBCA 1TVKA 2EILB 4LF9O 1L1FA 1F7YA 1GN3A 1D5NA 1KUQA 3RT3C 3E8GA 4UUJC 4G28B 2ZM6B 1S76D 4O4JB 2FMLA 3DTUB 4ABMA 1OZ0A 2F1MA 2RN9A 4AQYO 3F7VC 3A2FA 1ORQC 4YJ2B 5LMNB 1R1BA 1M90W 2Q68A 2QE7G 4JYAO 2BTQA 3ABTA 5EBLC 1JFFA 2ZIOA 4DV0O 1W2BU 4LC1A 4FZ0A 4X64B 3LNNA 2VQFB 3NXSA 5IYDO 3H01A 4PDRA 2E74B 1PV0A 4BAYA 3N2KB 4DR6B 1VQNV 1GN2A 1P49A 2B9ZA 1YI2V 5LBQA 2ZIMA 1QLEB 3QF7A 5IT9N 2MK3A 3BEHA 4DW1A 1RPOA 4PV1B 2BOCC 3E89A 5B1AC 4X65B 2FYUH 1QU7A 4ZIBA 4HBNA 4NTWA 2KSDA 1SQPH 1GK9A 5IWAB 2HP8A 4IT5A 1QR9A 1NVPD 1UFIA 3AG1C 2NLJC 1R6KA 1VP7A 2LGWA 4H0LB 4DV7B 4RAIA 4JV5B 2R9RB 2F4VB 1FYJA 3LNMB 4NVPA 1N0NA 1SRYA 3VQVA 3PN1A 5A2QN 2R72A 3QO7A 3W7XA 2VRZA 1MSWD 5KAIZ 3SGIA 1B04A 1JX9A 2WLMA 4DV5B 3P3NA 4HAMA 2JS3A 4KP4A 3K58A 2WLIA 5IJ9B 2JRIA 2N74A 4BR6A 4EB6B 4JI7B 1VEWA 1WPXA 3A0RA 1XILA 3OTOO 2WA4A 2XASA 3VQYA 2LGQA 1AVMA 3JATB 5BR8O 3ABUA 2PI4A 4C7UA 2OIGA 2ZCEA 1N32B 4J80A 4WBNB 1U96A 1PNKA 2CTPA 1S0VA 5K1XA 3APOA 1AI5A 3JASA 2H3OA 2EZOA 2UUBB 1MABG 3CS5A 3W7TA 1QR8A 4QJFB 4JI3O 2Q7GA 5IDJA 1PD3A 1NZ6A 3W7WA 2QTSA 2E3CA 1XL4A 3OFNG 2P5OA 2HJDA 1IBMB 2XTAA 2VWJA 3B2EE 4CH6A 5JQGA 1XEQA 1H2LA 2EIJC 4WFEA 4JAVA 2ZNJA 4JF3A 2QTOA 3UKMA 5EBWC 4D7TA 3STZC 1IURA 3OE7G 2ZE7A 3N2KA 3F7YC 3TGUH 2WWWA 1WA8A 2N05A 1YJWV 2IJJA 1TA8A 5BXZA 4JI6O 1RFYA 4L87A 4ZHQA 4UCTA 5GTIZ 2FKXA 3ZIAG 2KB1A 3QNEA 3DXRB 1E1RG 4MSWC 1JOYA 1JJOA 1SA0B 1X4TA 2YI9A 1AP6A 1N32O 4IYHA 1WB7A 3RBZA 3U0ZA 2YEVB 2DOSA 3H1KH 2GV9A 3HR0A 1W0KG 2IBZH 2A7WA 2RNBA 3RYIB 3ASNB 2PUSA 2ZE8A 3ZHUA 4KFMA 3CYOA 1MMMA 4DUYB 1WP7A 1IDSA 1J5EB 4WFAV 4B3RO 4LF8B 1ZTEA 3HKEA 3K0GA 3BA9A 2JGUA 5B5EZ 2HFEC 3HB3B 4LCUC 1ZX3A 4B08A 3T1YB 2C2AA 4JGSA 5KA6A 1Z5WA 1WNSA 2RDCA 1O9GA 3RYCA 2HVKC 4R8CA 1N34B 2X7RB 5GW7A 2Q69A 1THZA 4UVBA 4JZ2A 4X20A 2ZM6O 4O4LB 3WG7B 4J7KA 2CGOA 4IIJB 3RGBA 2YIBD 4DK1A 2EJ7A 4HYOA 1HNXB 5KX5B 2DYSB 4ZBMA 1AILA 2JJ1G 3K5LA 1SQVH 2BTOA 2QR4A 5L3DA 1SF9A 1H8HG 1DF4A 3FYEB 2OWOA 3BAAA 4MVOA 4X64O 4GZRB 5EC1C 2F95B 4UCSA 5BMVA 1K73W 2H8PC 3K08A 1SETA 4O4HA 3CCUV 5LMNO 2JGDB 1U97A 3QVNA 2PYJA 1OCZC 2QWNB 4J9ZB 1YTFB 2FTKA 3CD6V 1HNWO 3E8BA 3TK1A 1SC5B 2DQ3A 1D5AA 3DSQA 2JIZG 3AK3A 4WCEV 4JTCB 1FKAO 4JASA 4U3JA 2DWEC 5CA0B 2ZNIA 4LBEC 3QG5A 4CH3A 2IU3A 3RYHA 3I5DA 4DRXA 1DTOA 4FMTA 3IFXA 4YXWG 2VQFO 3C90A 2ATKC 5KA5A 4W4LA 4P9OA 3JCZA 3P30A 4MVQA 3QTCA 4ZI7B 3OR6C 4X8AA 3ETGA 5IJ0A 4TV8B 1QHTA 1ZUQA 1L0LH 4RWUA 3STLC 3UCSC 4I9QA 4CS2A 1H8EG 3ZRWB 3CCRV 2EX3A 4XDLA 1Y74B 1F23A 1MSDA 2L35A 4GLXA 1Q6HA 1K5SA 1IZ3A 4WFBV 3ZRSA 1FS0G 1J5EO 4LF4B 1X59A 4FM1A 3N27A 1HWYA 1SS3A 1QLNA 4AILC 1VQOV 3OMAB 3JSLA 4FLUA 1V9PA 4I50B 1B6QA 3ZHQA 3X2QB 1GAXA 2CDYA 3BY6A 2Q9LA 3HPLC 1VQPV 2OTLV 5LYJA 1MZFA 4MS2A 4NXNO 3CP1A 2WPDG 1QCEA 4YJ3A 1M56B 1GN6A 5BR8B 3ZX6A 1VQLV 3FB8C 4KL1A 4I9WA 2UXDB 2ZQMA 1NJIW 1KP2A 5D5QA 1I0HA 2GSMB 1BQZA 5J2TA 2ZR3A 2V7QG 4LR3A 1D2DA 1FFXB 4O2AA 4JI0B 4F6EA 1VF6C 4O4LA 2R70A 4DR7B 1NH2B 3HKDB 3OT7A 1VF7A 4XDJA 1K33A 3UT5B 2F4VO 4PI2A 2EIKC 3ZS8C 2DWDC 4EFBA 2YC0A 3GWKC 3CWBH 2B5UA 2IM9A 1VARA 4IHJB 4DW0A 4TV9A 3B8MA 2QKCA 4J7ZA 1L8DA 3DC5A 3T1CA 4MVZA 3JSNA 3AG2C 1KP3A 3HKEB 4FVMA 4XBFA 1DGSA 1OCCB 3K5NA 4MTXA 3L74H 2ODMA 3K9SA 4H13B 1KQSU 1JJ2U 3ZBHA 3JARA 2CE4A 1WPBA 4XDKA 4JI8B 3LDCA 4GKJB 2YEVA 3FB6C 3CSXA 3CC4V 2HVJC 3LDDA 4JYAB 4NKGB 4O2BB 2IH3C 1AR5A 5LXTB 3OD4A 3K9AA 1AB3A
chains in the Genus database with same CATH topology
1L0LH 1SQBH 3L71H 3CXHF 5KLVH 1KYOF 1L0NH 1SQXH 3TGUH 1PP9H 3H1HH 2FYUH 1NTMH 3H1LH 4U3FH 1BGYH 4PD4F 3BCCH 1SQPH 1BCCH 2BCCH 3CX5F 3L73H 3H1IH 1EZVH 2A06H 3H1KH 3L74H 3H1JH 1NTKH 1NTZH 3L75H 2IBZH 1KB9F 1BE3H 1NU1H 1SQQH 3L70H 3CWBH 1SQVH 1PPJH 3L72H 1P84F 4D6TH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L H;  1SQB H;  3L71 H;  3CXH F;  5KLV H;  1KYO F;  1L0N H;  1SQX H;  3TGU H;  1PP9 H;  3H1H H;  2FYU H;  1NTM H;  3H1L H;  4U3F H;  1BGY H;  4PD4 F;  3BCC H;  1SQP H;  1BCC H;  2BCC H;  3CX5 F;  3L73 H;  3H1I H;  1EZV H;  2A06 H;  3H1K H;  3L74 H;  3H1J H;  1NTK H;  1NTZ H;  3L75 H;  2IBZ H;  1KB9 F;  1BE3 H;  1NU1 H;  1SQQ H;  3L70 H;  3CWB H;  1SQV H;  1PPJ H;  3L72 H;  1P84 F;  4D6T H; 
#chains in the Genus database with same CATH topology
 1EN4 A;  2E76 B;  5B1B C;  3EHB B;  2QA4 V;  4Z1M G;  4O2B A;  2LFS A;  4WF9 V;  5KUM A;  3LSS A;  1Z2G A;  1QBZ A;  3K57 A;  4DR4 O;  1YCI A;  1SER A;  3WU2 Z;  1N0J A;  3ZHR A;  5L3E A;  5B1O A;  4GX5 A;  2Y69 B;  1K7D A;  4FFB B;  3CXH F;  5FPO A;  3CCL V;  4X1K A;  1XL6 A;  1G4Y B;  4DUZ B;  3O9O A;  1URF A;  3B40 A;  5LYJ B;  3KG2 A;  4TT3 G;  4W4K A;  2P7T C;  3H1J H;  2OTJ V;  1R3L C;  1OHH G;  1H2K A;  3CCQ V;  5IY5 B;  5JJE B;  4UV9 A;  1OCZ B;  2F93 B;  1VF5 B;  5L3F A;  1Q86 W;  3ASO B;  5LMU B;  4JZG A;  4TSF G;  3K79 A;  4X65 O;  2OT5 A;  3H9V A;  1XMQ B;  5C8Y A;  3G71 V;  1ENV A;  1B06 A;  2QKS A;  4DV6 B;  2Q7H A;  4FM0 A;  4O2A B;  1NR1 A;  3HKB A;  4IL6 Z;  5IE9 A;  1FFT B;  2DQ0 A;  1Y76 B;  4FIP C;  1VQ9 V;  1YF2 A;  3PJS K;  3CEI A;  4D6T H;  4B3M B;  1OCO B;  3JYC A;  4DV2 O;  4GKK B;  1BGY H;  1XNQ B;  1Y74 A;  1S5J A;  2KQX A;  1FXK C;  4X9Q A;  3N2G B;  3OGI B;  5LGN A;  4LFA B;  4DR1 B;  2E5L O;  4UVA A;  1FJG B;  5IJ0 B;  3AEI A;  3U10 A;  3ZED A;  1PPJ H;  2OCC C;  3ZMU A;  4EFE A;  2F43 G;  1AJQ A;  3MHS C;  4U3F H;  4LFA O;  2EBO A;  4AHC A;  2HKO A;  4DV1 O;  3D36 C;  4JI8 O;  4DV2 B;  2GUZ A;  3MD0 A;  3KCY A;  5LOV A;  3LSQ A;  5EYP B;  2Y0P A;  1SQB H;  4X62 B;  4KHP O;  1VQ7 V;  4LWS B;  3A0H Z;  1EBO A;  4TUY B;  1H2S B;  3GB7 C;  4OPH A;  3FB5 C;  4JYY A;  2E75 B;  2PTM A;  2EIN B;  2QKA A;  2X0L A;  3OMI B;  3R65 A;  3ZMT A;  3CCS V;  4UCR A;  3JD2 A;  5IYB O;  2UUA B;  5JH7 B;  4O4H B;  2A3Q A;  4PA4 A;  3GVM A;  3CPW U;  1N36 B;  3UO3 A;  1Q82 W;  2Q5Z A;  1MOF A;  3E83 A;  3ICX A;  3OM3 B;  2X6B A;  2F66 C;  4GKJ O;  4Q20 A;  3G4S V;  2UUC B;  3WFV A;  4YY3 O;  3CMA V;  2KG7 B;  4JI0 O;  3SPG A;  3CCM V;  5FNV A;  4DR2 O;  1E79 G;  1BE3 H;  4DUY O;  5L3G A;  4ZKI A;  3LDE A;  2ZIN A;  2ILM A;  3CXC U;  5EYP A;  4DR2 B;  4DV3 O;  4LF6 O;  5A9G A;  1AJN A;  3M8A A;  4U3J B;  2XAQ A;  5C8Y B;  4I7Z B;  1I94 O;  2YS8 A;  4DR4 B;  5FPR A;  4A5U B;  1R6T A;  5JJJ B;  2Q67 A;  3ZMV A;  2HEP A;  4NTY A;  3EFF K;  3ABL B;  2HHH O;  1F4M A;  2AHZ A;  3SJQ C;  5H5N A;  4FFK A;  3SPI A;  4N23 A;  3J80 N;  4X1Y B;  2LW1 A;  1EFR G;  1BHB A;  3D36 A;  4NR1 A;  4PA3 A;  3BHP A;  3IC9 A;  1DF5 A;  2JDI G;  2AZ0 A;  5BZB A;  4CC5 A;  1SKV A;  1TUE B;  5B3S C;  4CS3 A;  2WLL A;  1H2M A;  2XAG A;  4NTX A;  2RQ6 A;  3UO2 A;  3LUT B;  1KEC A;  5IYZ B;  5KAF Z;  3UM7 A;  3ML0 A;  1NKD A;  3ZCC A;  2KKW A;  1GM9 A;  4RUF A;  5KX5 A;  4G27 B;  2FL4 A;  4ZOL A;  3RN4 A;  1K97 A;  1YVW A;  1ZAU A;  1HR0 O;  4GX2 A;  3H1L H;  3K5M A;  2WLH A;  5DN6 G;  1H2G A;  1CP9 A;  3G67 A;  2IJK A;  3H1I H;  1FPO A;  3VQW A;  4DXW A;  3DXR A;  4HNA B;  3L75 H;  2Z3Y A;  3OW2 U;  4DV7 O;  2PY5 A;  1K92 A;  1OCC C;  5LXT A;  1WN7 A;  3RYC B;  3RVZ A;  3UQ8 A;  3AG2 B;  2Q4P A;  4DR1 O;  2JS5 A;  4X1I A;  5F2V O;  2CTQ A;  2VS0 A;  4K0K B;  4D7S A;  2P6J A;  4J11 A;  4O4I A;  4AI8 A;  4E4E A;  1YDX A;  1EM1 A;  2A79 B;  4UCU A;  5FLX N;  1WA8 B;  1I94 B;  3FFQ A;  1H2N A;  3AK2 A;  1JMK C;  4DV4 B;  1HW7 A;  3JD1 A;  4FLW A;  4I55 A;  2DW4 A;  1S3J A;  4MT8 A;  4DK0 A;  3G6B A;  1QLE C;  1P84 F;  4WFF A;  2UUC O;  2ZE6 A;  4JI5 B;  3CCE V;  4O4I B;  3T2M A;  3ZHV A;  4RO2 A;  5GON B;  2GTS A;  4J42 A;  2VQE B;  4DV1 B;  4JYC A;  4X1I B;  4WFG A;  1K3E A;  3QO5 A;  4GUN A;  5J9P C;  4DR5 B;  1YSC A;  4QGP A;  3JAS B;  4CH4 A;  1R3I C;  1UPG A;  4OXS A;  5JCO C;  4QNH B;  3KCX A;  5LA6 B;  2Y69 C;  2CTW A;  1Q8I A;  2VWK A;  3B8N A;  1NTM H;  1AR1 B;  5CBH A;  3AG7 A;  5GON A;  4LH6 A;  2FB5 A;  3OUF A;  4B7E A;  3CHX A;  2WLI B;  3ZRV A;  2B1I A;  1BL8 A;  1VF6 A;  2QM4 A;  2WLL B;  2V1D A;  3SDL A;  4I55 B;  5DEC A;  2WLN A;  3E2E A;  4R6Z A;  3EVK A;  3KZI Z;  1GH6 A;  5IYC O;  3SJC C;  4UCO A;  4K35 A;  2QSA A;  4UXN A;  3T4Z A;  3L73 H;  1PL4 A;  2Y4U A;  4OPA A;  3ETD A;  4TV9 B;  1Q90 D;  2GBO A;  1F4N A;  4JI1 B;  4X88 A;  4QPJ A;  4DR3 B;  1FAF A;  4MVS A;  2ZXW B;  3U11 A;  4PD4 F;  4CZZ A;  1XNQ O;  2Q7E A;  5H9C A;  4WBN A;  4EEQ A;  2HJF C;  2CGN A;  2AHY A;  4JYB A;  2IJI A;  4LFC B;  5LHI A;  4FM2 A;  5KHG A;  4FLZ A;  4ZOL B;  2QJ1 A;  2XUM A;  4QPK A;  5FNV B;  4NXM B;  2A9H A;  5IYZ A;  1V55 B;  1YJ9 V;  3OTF A;  4DV6 O;  4CC6 A;  2QM8 A;  4FK5 C;  4H33 A;  5KHJ A;  1K34 A;  2EIK B;  2YXY A;  4PJ0 Z;  3SYQ A;  1US6 A;  4E2L A;  1GRJ A;  3RFR A;  2DJV A;  1GM8 A;  4JAA A;  2CUG A;  4B3T O;  4P9P A;  5KLV H;  1FXV A;  4LNU B;  2PF4 E;  3AG3 C;  3ZHS A;  4JI4 O;  4K3A A;  3D3I A;  1XNR B;  2GHY A;  4LF8 O;  1JA8 A;  4CS4 A;  1IBK B;  2WA3 A;  4YIP A;  4FLY A;  4LP8 A;  1I7F A;  4J41 A;  1EZV H;  4MTO A;  1E1Q G;  2AW9 A;  4JI5 O;  4TQF A;  5CBG A;  3TXS A;  1M1K W;  4LF5 O;  2JJ2 G;  2Z0A A;  2O57 A;  4PA7 A;  1BZK A;  4FPP A;  1HNX O;  2CTR A;  2YIC A;  1WB8 A;  1IBL O;  4LFB O;  1NH2 D;  2BSK A;  5L3B A;  4X66 B;  4JI2 O;  1BQ0 A;  3JAW B;  2ITD C;  5KMG B;  4LNU A;  1JR9 A;  4UCV A;  3NR7 A;  1JFF B;  3ETE A;  4B3S B;  4I5S A;  2YSU B;  2UXB O;  3AK1 A;  4NB5 A;  4R7C A;  1WAZ A;  3ZN0 A;  1VQ4 V;  2P4K A;  4ZI7 A;  4MTG A;  4UB8 Z;  4B3S O;  1Q6U A;  3EXA A;  3C3T A;  3JAM N;  4P2Z A;  1KBH A;  1ZLZ A;  1Q3E A;  2PI5 A;  1F51 A;  1J95 A;  3B77 A;  4TUY A;  4X66 O;  4JI2 B;  4DYL A;  1CEZ A;  5JVD A;  4LFB B;  4ASU G;  2WLK A;  3OR7 C;  3OTO B;  4GX1 A;  3CJH B;  1NR7 A;  4BIU A;  1W59 A;  3HKB B;  5LOV B;  2AZ2 A;  5B3S B;  4JI7 O;  4QE7 A;  5LHH A;  3O65 A;  3F5T A;  1SQF A;  2Q8V A;  4GCZ A;  1N36 O;  3RYF A;  3ASN C;  1IVS A;  5LHG A;  1KB9 F;  1OV9 A;  1CPY A;  1OCO C;  1YIT V;  3OGC C;  3HKC A;  5JWP A;  2D2C B;  2UU9 B;  3ABL C;  1W0J G;  1K4C C;  1ZL8 B;  3VQX A;  4N21 A;  2YID A;  5KHK A;  3OEH G;  1M4U A;  4Z1V A;  2XT9 A;  1PNM A;  3AG4 B;  5LL6 Y;  4UV8 A;  2X6A A;  1VQ5 V;  1NU1 H;  4YIO A;  5BY1 A;  1Q7Y W;  2M6Y A;  1MZE A;  1ZWI C;  2UXD O;  2OIE A;  3C3S A;  1IXB A;  1Z5V A;  3JD3 A;  5IY5 C;  2CK3 G;  5KHI A;  2YIA A;  5LP6 C;  2OYQ A;  1EN5 A;  4X89 A;  4YY3 B;  1R73 A;  1OJH A;  2ADQ B;  1LUV A;  4R50 A;  4WFH A;  3ZN1 A;  4JAU A;  1XDC A;  4MVR A;  3SR2 C;  1FD9 A;  4PA6 A;  1NVP B;  1XHZ A;  3L72 H;  2UUB O;  5EC2 C;  5J2U A;  1GKF A;  1VQ8 V;  2DYS C;  1GM7 A;  1G8M A;  3WG7 C;  3IC7 A;  3S3W A;  3FX7 A;  4X1K B;  4NXM O;  2Q73 A;  3L9D A;  2W6J G;  4LF4 O;  3ZHT A;  1Y6X A;  1G6U A;  3M99 B;  2PGG A;  1XI1 A;  4LF5 B;  2JVD A;  1KMI Z;  1SZX A;  2UXX A;  5DM6 V;  4Q6G A;  4DV5 O;  1QQC A;  2AGA A;  5HFM A;  4DV0 B;  1XMO O;  1IBK O;  4H37 A;  3FAV B;  2B1G A;  2XAH A;  5E1A C;  1NTK H;  2P4V A;  5ITZ B;  5H2F Z;  1N34 O;  2Z5U A;  3K0D A;  5CA3 A;  3BA8 A;  1GTO A;  4AQY B;  3KKY A;  3SPC A;  4KXR A;  1JQ0 A;  1O9H A;  2CAZ C;  3UT5 A;  3VBB A;  1YTF D;  1FJG O;  2DN9 A;  2NNU A;  2QM7 A;  1JPX A;  1DK1 A;  1Q81 W;  3CC2 V;  3M7M X;  3Q4H B;  1FXH A;  3OEE G;  3MAQ A;  3THO A;  1N33 O;  5J2T B;  2Y4T A;  1COW G;  2IW5 A;  3SJA C;  5CB4 B;  1ZSP A;  1KKC A;  4BW5 A;  4FLT A;  1UJW B;  3JAL B;  1M93 A;  3ASO C;  4LF7 B;  2ZKO A;  3S3X A;  3K59 A;  2UXC B;  1R3J C;  2XAF A;  2UU9 O;  3FD9 A;  3FB7 C;  1DLB A;  4IHJ A;  2RMK B;  2IH1 C;  1QVG U;  2G38 A;  5AG2 A;  1K4D C;  4Z2W A;  1CXZ B;  3T1Y O;  3JD4 A;  1PP9 H;  3ZMZ A;  5LGT A;  1XHX A;  4F4L A;  2V4D A;  4PDV A;  1R6N A;  5K1P A;  4DUZ O;  4B3R B;  5B66 Z;  4K8Z A;  3JAL A;  3R66 A;  2YIB A;  3JAT A;  1XRE A;  5CB4 A;  2XND G;  2KG7 A;  3SPJ A;  5IJ9 A;  1MA1 A;  2JEU A;  5KUK A;  4L8J A;  1JCH A;  3Q4H A;  4I0X A;  2NR5 A;  3CRM A;  1P7B A;  3RWR D;  1T5E A;  4BW9 A;  1YZB A;  3ABM B;  5JH7 A;  2CH7 B;  2QWR B;  1SES A;  1SQQ H;  2JEX A;  1KC8 W;  2W6I G;  4DR5 O;  5H6Q A;  1RM1 B;  3FAV A;  4I50 A;  4JTA B;  2Q6A A;  4LWS A;  4DRX B;  2HG5 C;  3P3P A;  2DYR C;  4B7K A;  4PHZ A;  3CRR A;  3SPH A;  1TVK B;  1HNZ B;  1ARO P;  3J7A U;  4BIZ A;  1XBL A;  2BE3 A;  3IJ4 A;  1SZT A;  1N8R W;  2R9A A;  3L70 H;  2GUZ B;  1HNZ O;  3TET A;  2JK5 C;  2ZDI A;  3ABK B;  1Q5O A;  3JCU Z;  4JPR A;  3W7S A;  3AG1 B;  1XNR O;  3J81 N;  1RP3 B;  1GMG A;  3QO8 A;  2A06 H;  1V54 C;  4KUM A;  2BTQ B;  4TV8 A;  3TCU A;  5EZY A;  3K03 A;  3CE2 A;  4YJ2 A;  4MVU A;  1KD1 W;  2LW7 A;  3MDS A;  3N2G A;  3ABM C;  1XQ8 A;  5BMV B;  1M57 C;  4O4J A;  3K5O A;  4CH5 A;  4DR7 O;  1I5Y A;  1NI8 A;  3D3Q A;  2QEX V;  1YJN V;  4UB6 Z;  3SYO A;  3IAY A;  1NTZ H;  4X62 O;  5EIB D;  4J9Y B;  1Y76 A;  5JJN B;  1BSM A;  5CA0 A;  4UFZ A;  4LFC O;  4RQE A;  2OCH A;  2YUA A;  4U7N A;  1IXM A;  1FXK A;  1PNL A;  1EN6 A;  5FL7 G;  2QDO A;  2AXT Z;  4X20 B;  2QWQ B;  2Y0I A;  2A0L A;  1RSO B;  2LQT A;  4NXN B;  4JI3 B;  1NQT A;  1AI6 A;  1QNM A;  2XHB A;  5EZY B;  1ZL8 A;  2P90 A;  5EBM C;  3TXQ A;  4TQD A;  1VIB A;  3HKC B;  2EIN C;  3AG3 B;  1Q6I A;  1H38 A;  1SQX H;  4LF7 O;  3MHH C;  2E5L B;  2DE0 X;  3RYF B;  3E8H A;  1RSO A;  1N4C A;  2K1E A;  1OCR C;  2EJR A;  2LO1 A;  1IBL B;  4J10 A;  4KHP B;  4BIO A;  1LR1 A;  5CMU A;  1G1X B;  2R9I A;  4FFB A;  5TIS Z;  4GKK O;  2MW2 B;  1B3Q A;  1PM9 A;  2K9P A;  2ZDI C;  4B3M O;  2ITC C;  1YXB A;  2GDS A;  2YXL A;  3BPZ A;  3RYI A;  4JTD B;  1VQM V;  2NN4 A;  1M5I A;  3BVO A;  3CJH A;  4GYC B;  4HZ3 A;  1K8A W;  2W0X A;  5KHH A;  5H6R A;  1NBM G;  2D3O W;  4OX9 B;  4DR6 O;  1SA0 A;  4MW8 A;  1XMQ O;  3BFR A;  3E22 A;  2BCC H;  2H94 A;  2WLJ A;  3D8C A;  3ABK C;  1HP8 A;  5LMU O;  2LFR A;  2IJH A;  3A0B Z;  1K9M W;  4B3T B;  4DR3 O;  1YIJ V;  3B09 A;  4ZHQ B;  2ADP A;  3FYI B;  2UXN A;  2DYR B;  5IWA O;  3CRC A;  1XMO B;  4I0X B;  3H1H H;  2VQE O;  2ZD9 A;  3G6E V;  4F6R A;  1BCC H;  2RCV A;  5EIB C;  5LP6 A;  3JAR B;  2BSK B;  5GTH Z;  1YEW A;  4UVC A;  3SYC A;  1HDJ A;  1K5Q A;  3WB0 A;  3CCV V;  3RVY A;  1AI4 A;  2PZS A;  4DV4 O;  5JQG B;  1TAE A;  2GTA A;  1I08 A;  1MNG A;  1TUB A;  2WAM A;  3E8F A;  3DC6 A;  4K0K O;  2QGN A;  4RUE A;  3K3W A;  2RJZ A;  5HFL A;  4MW3 A;  5CA1 A;  1P7G A;  4FLX A;  4JI1 O;  4FJC C;  1VQ6 V;  4EKW A;  3JAK B;  2P06 A;  3GWO A;  2CH7 A;  3HKD A;  4FLV A;  2PYL A;  4I4T B;  2HLD G;  1LUW A;  1YHQ V;  5JCO A;  1EZJ A;  4IGG A;  2QWO B;  1NT2 B;  1FFX A;  4QIW F;  2WSS G;  4P30 A;  1KKD A;  4BWA A;  2HR3 A;  4EB6 A;  1VQK V;  4YHH O;  3T1H B;  2XOK G;  2ZT9 B;  1NS1 A;  1P4R A;  3SYA A;  1Y67 A;  4YJ3 B;  4H44 B;  1S5H C;  5B1B B;  1I5X A;  5D5P A;  5LGU A;  2L6L A;  3AG4 C;  2XAJ A;  2ZR2 A;  3T4D A;  3W7U A;  1WJZ A;  1BMF G;  4MTF A;  2P67 A;  4GT1 A;  3I56 V;  3ETQ A;  4PA9 A;  3WB1 A;  1ROP A;  3JAK A;  2X6C A;  5CA1 B;  1Q43 A;  4JI6 B;  1L0N H;  2YDE A;  1BHA A;  1XOU A;  1BS3 A;  3BCC H;  3CCJ V;  1TUB B;  2M7W A;  4OX9 O;  4U7O A;  1HR0 B;  2BOB C;  5CBF A;  2DMX A;  3K04 A;  3OUS A;  3TJT A;  4GX0 A;  1IBM O;  5B1N A;  1S72 V;  3CME V;  4PDM A;  3ZRW A;  5C93 A;  1R3K C;  5E79 Z;  5J2U B;  5CN0 A;  1LNQ A;  4I4T A;  3CC7 V;  5B1A B;  5LA6 A;  4PI0 A;  3WB2 A;  2UUA O;  4TWK A;  2Q0A A;  3G80 A;  1M9N A;  2P22 C;  1KU9 A;  5ITZ A;  2YI8 A;  2Q0O C;  2HHH B;  5L3C A;  3E86 A;  3RYH B;  1PKX A;  4MVM A;  1AP5 A;  2IU0 A;  4IYI A;  4DV3 B;  4LF6 B;  2ETN A;  2EIJ B;  1M56 C;  1AJP A;  3L71 H;  3OAA G;  4QE9 A;  1AR4 A;  1KYO F;  3VOU A;  2F23 A;  4DO2 A;  3JD0 A;  2N04 A;  5LP6 B;  3DGE A;  1WP8 A;  1A32 A;  4F6R B;  4RQF A;  1S5L Z;  1GN4 A;  3CRA A;  3X2Q C;  2JGD A;  4G2K A;  2EIL C;  3B4S A;  1MG1 A;  5EK0 A;  2UXB B;  2QWP B;  1M57 B;  3F5W C;  3FKS G;  4HNA A;  4NYK A;  1TGO A;  1BT8 A;  3LSU A;  4J7J A;  4PEL A;  2UXC O;  3BRC A;  3E22 B;  5DED A;  3A8T A;  2EIM B;  4FZ1 A;  3CX5 F;  2LJ2 A;  3BAB A;  3E35 A;  2LP7 A;  1V54 B;  3RW0 A;  4K8X A;  4YHH B;  1V55 C;  1WLE A;  2W0F C;  2Y48 A;  3SYP A;  4IIJ A;  4TOI A;  1JVM A;  5JVD B;  1N33 B;  3P32 A;  3K06 A;  3APQ A;  3I55 V;  1SQG A;  4OGQ B;  4PDL A;  1XUQ A;  4JI4 B;  2EZP A;  1HNW B;  2ZE5 A;  2ZXW C;  1VMG A;  1QVF U;  1GO3 F;  3CRQ A;  2EUL A;  3OMN B;  4JV5 O;  4X1Y A;  1AI7 A;  1Y66 A;  3ZJZ A;  2OCC B;  3ZMS A;  1RPR A;  5KMG A;  3JAW A;  1RM1 C;  3ZRX A;  4LH7 A;  1Y4M A;  2ARH A;  2EIM C;  2YXH A;  1PL0 A;  4LF9 B;  1FXK B;  1S77 D;  3T1H O;  1IX9 A;  1OCR B;  4ICG A;  3IGA C;  3SJB C;  3CB2 A;  4CBC A;  1TVK A;  2EIL B;  4LF9 O;  1L1F A;  1F7Y A;  1GN3 A;  1D5N A;  1KUQ A;  3RT3 C;  3E8G A;  4UUJ C;  4G28 B;  2ZM6 B;  1S76 D;  4O4J B;  2FML A;  3DTU B;  4ABM A;  1OZ0 A;  2F1M A;  2RN9 A;  4AQY O;  3F7V C;  3A2F A;  1ORQ C;  4YJ2 B;  5LMN B;  1R1B A;  1M90 W;  2Q68 A;  2QE7 G;  4JYA O;  2BTQ A;  3ABT A;  5EBL C;  1JFF A;  2ZIO A;  4DV0 O;  1W2B U;  4LC1 A;  4FZ0 A;  4X64 B;  3LNN A;  2VQF B;  3NXS A;  5IYD O;  3H01 A;  4PDR A;  2E74 B;  1PV0 A;  4BAY A;  3N2K B;  4DR6 B;  1VQN V;  1GN2 A;  1P49 A;  2B9Z A;  1YI2 V;  5LBQ A;  2ZIM A;  1QLE B;  3QF7 A;  5IT9 N;  2MK3 A;  3BEH A;  4DW1 A;  1RPO A;  4PV1 B;  2BOC C;  3E89 A;  5B1A C;  4X65 B;  2FYU H;  1QU7 A;  4ZIB A;  4HBN A;  4NTW A;  2KSD A;  1SQP H;  1GK9 A;  5IWA B;  2HP8 A;  4IT5 A;  1QR9 A;  1NVP D;  1UFI A;  3AG1 C;  2NLJ C;  1R6K A;  1VP7 A;  2LGW A;  4H0L B;  4DV7 B;  4RAI A;  4JV5 B;  2R9R B;  2F4V B;  1FYJ A;  3LNM B;  4NVP A;  1N0N A;  1SRY A;  3VQV A;  3PN1 A;  5A2Q N;  2R72 A;  3QO7 A;  3W7X A;  2VRZ A;  1MSW D;  5KAI Z;  3SGI A;  1B04 A;  1JX9 A;  2WLM A;  4DV5 B;  3P3N A;  4HAM A;  2JS3 A;  4KP4 A;  3K58 A;  2WLI A;  5IJ9 B;  2JRI A;  2N74 A;  4BR6 A;  4EB6 B;  4JI7 B;  1VEW A;  1WPX A;  3A0R A;  1XIL A;  3OTO O;  2WA4 A;  2XAS A;  3VQY A;  2LGQ A;  1AVM A;  3JAT B;  5BR8 O;  3ABU A;  2PI4 A;  4C7U A;  2OIG A;  2ZCE A;  1N32 B;  4J80 A;  4WBN B;  1U96 A;  1PNK A;  2CTP A;  1S0V A;  5K1X A;  3APO A;  1AI5 A;  3JAS A;  2H3O A;  2EZO A;  2UUB B;  1MAB G;  3CS5 A;  3W7T A;  1QR8 A;  4QJF B;  4JI3 O;  2Q7G A;  5IDJ A;  1PD3 A;  1NZ6 A;  3W7W A;  2QTS A;  2E3C A;  1XL4 A;  3OFN G;  2P5O A;  2HJD A;  1IBM B;  2XTA A;  2VWJ A;  3B2E E;  4CH6 A;  5JQG A;  1XEQ A;  1H2L A;  2EIJ C;  4WFE A;  4JAV A;  2ZNJ A;  4JF3 A;  2QTO A;  3UKM A;  5EBW C;  4D7T A;  3STZ C;  1IUR A;  3OE7 G;  2ZE7 A;  3N2K A;  3F7Y C;  3TGU H;  2WWW A;  1WA8 A;  2N05 A;  1YJW V;  2IJJ A;  1TA8 A;  5BXZ A;  4JI6 O;  1RFY A;  4L87 A;  4ZHQ A;  4UCT A;  5GTI Z;  2FKX A;  3ZIA G;  2KB1 A;  3QNE A;  3DXR B;  1E1R G;  4MSW C;  1JOY A;  1JJO A;  1SA0 B;  1X4T A;  2YI9 A;  1AP6 A;  1N32 O;  4IYH A;  1WB7 A;  3RBZ A;  3U0Z A;  2YEV B;  2DOS A;  3H1K H;  2GV9 A;  3HR0 A;  1W0K G;  2IBZ H;  2A7W A;  2RNB A;  3RYI B;  3ASN B;  2PUS A;  2ZE8 A;  3ZHU A;  4KFM A;  3CYO A;  1MMM A;  4DUY B;  1WP7 A;  1IDS A;  1J5E B;  4WFA V;  4B3R O;  4LF8 B;  1ZTE A;  3HKE A;  3K0G A;  3BA9 A;  2JGU A;  5B5E Z;  2HFE C;  3HB3 B;  4LCU C;  1ZX3 A;  4B08 A;  3T1Y B;  2C2A A;  4JGS A;  5KA6 A;  1Z5W A;  1WNS A;  2RDC A;  1O9G A;  3RYC A;  2HVK C;  4R8C A;  1N34 B;  2X7R B;  5GW7 A;  2Q69 A;  1THZ A;  4UVB A;  4JZ2 A;  4X20 A;  2ZM6 O;  4O4L B;  3WG7 B;  4J7K A;  2CGO A;  4IIJ B;  3RGB A;  2YIB D;  4DK1 A;  2EJ7 A;  4HYO A;  1HNX B;  5KX5 B;  2DYS B;  4ZBM A;  1AIL A;  2JJ1 G;  3K5L A;  1SQV H;  2BTO A;  2QR4 A;  5L3D A;  1SF9 A;  1H8H G;  1DF4 A;  3FYE B;  2OWO A;  3BAA A;  4MVO A;  4X64 O;  4GZR B;  5EC1 C;  2F95 B;  4UCS A;  5BMV A;  1K73 W;  2H8P C;  3K08 A;  1SET A;  4O4H A;  3CCU V;  5LMN O;  2JGD B;  1U97 A;  3QVN A;  2PYJ A;  1OCZ C;  2QWN B;  4J9Z B;  1YTF B;  2FTK A;  3CD6 V;  1HNW O;  3E8B A;  3TK1 A;  1SC5 B;  2DQ3 A;  1D5A A;  3DSQ A;  2JIZ G;  3AK3 A;  4WCE V;  4JTC B;  1FKA O;  4JAS A;  4U3J A;  2DWE C;  5CA0 B;  2ZNI A;  4LBE C;  3QG5 A;  4CH3 A;  2IU3 A;  3RYH A;  3I5D A;  4DRX A;  1DTO A;  4FMT A;  3IFX A;  4YXW G;  2VQF O;  3C90 A;  2ATK C;  5KA5 A;  4W4L A;  4P9O A;  3JCZ A;  3P30 A;  4MVQ A;  3QTC A;  4ZI7 B;  3OR6 C;  4X8A A;  3ETG A;  5IJ0 A;  4TV8 B;  1QHT A;  1ZUQ A;  1L0L H;  4RWU A;  3STL C;  3UCS C;  4I9Q A;  4CS2 A;  1H8E G;  3ZRW B;  3CCR V;  2EX3 A;  4XDL A;  1Y74 B;  1F23 A;  1MSD A;  2L35 A;  4GLX A;  1Q6H A;  1K5S A;  1IZ3 A;  4WFB V;  3ZRS A;  1FS0 G;  1J5E O;  4LF4 B;  1X59 A;  4FM1 A;  3N27 A;  1HWY A;  1SS3 A;  1QLN A;  4AIL C;  1VQO V;  3OMA B;  3JSL A;  4FLU A;  1V9P A;  4I50 B;  1B6Q A;  3ZHQ A;  3X2Q B;  1GAX A;  2CDY A;  3BY6 A;  2Q9L A;  3HPL C;  1VQP V;  2OTL V;  5LYJ A;  1MZF A;  4MS2 A;  4NXN O;  3CP1 A;  2WPD G;  1QCE A;  4YJ3 A;  1M56 B;  1GN6 A;  5BR8 B;  3ZX6 A;  1VQL V;  3FB8 C;  4KL1 A;  4I9W A;  2UXD B;  2ZQM A;  1NJI W;  1KP2 A;  5D5Q A;  1I0H A;  2GSM B;  1BQZ A;  5J2T A;  2ZR3 A;  2V7Q G;  4LR3 A;  1D2D A;  1FFX B;  4O2A A;  4JI0 B;  4F6E A;  1VF6 C;  4O4L A;  2R70 A;  4DR7 B;  1NH2 B;  3HKD B;  3OT7 A;  1VF7 A;  4XDJ A;  1K33 A;  3UT5 B;  2F4V O;  4PI2 A;  2EIK C;  3ZS8 C;  2DWD C;  4EFB A;  2YC0 A;  3GWK C;  3CWB H;  2B5U A;  2IM9 A;  1VAR A;  4IHJ B;  4DW0 A;  4TV9 A;  3B8M A;  2QKC A;  4J7Z A;  1L8D A;  3DC5 A;  3T1C A;  4MVZ A;  3JSN A;  3AG2 C;  1KP3 A;  3HKE B;  4FVM A;  4XBF A;  1DGS A;  1OCC B;  3K5N A;  4MTX A;  3L74 H;  2ODM A;  3K9S A;  4H13 B;  1KQS U;  1JJ2 U;  3ZBH A;  3JAR A;  2CE4 A;  1WPB A;  4XDK A;  4JI8 B;  3LDC A;  4GKJ B;  2YEV A;  3FB6 C;  3CSX A;  3CC4 V;  2HVJ C;  3LDD A;  4JYA B;  4NKG B;  4O2B B;  2IH3 C;  1AR5 A;  5LXT B;  3OD4 A;  3K9A A;  1AB3 A; 
#chains in the Genus database with same CATH homology
 1L0L H;  1SQB H;  3L71 H;  3CXH F;  5KLV H;  1KYO F;  1L0N H;  1SQX H;  3TGU H;  1PP9 H;  3H1H H;  2FYU H;  1NTM H;  3H1L H;  4U3F H;  1BGY H;  4PD4 F;  3BCC H;  1SQP H;  1BCC H;  2BCC H;  3CX5 F;  3L73 H;  3H1I H;  1EZV H;  2A06 H;  3H1K H;  3L74 H;  3H1J H;  1NTK H;  1NTZ H;  3L75 H;  2IBZ H;  1KB9 F;  1BE3 H;  1NU1 H;  1SQQ H;  3L70 H;  3CWB H;  1SQV H;  1PPJ H;  3L72 H;  1P84 F;  4D6T H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...