4PD4F

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4pd4F00
1SQVH 5KLVH 1NTZH 3CWBH 4D6TH 1BCCH 3H1JH 3L72H 1L0NH 4U3FH 1KYOF 3H1LH 2BCCH 1SQPH 1NTKH 3H1IH 2FYUH 1L0LH 2A06H 1BGYH 1P84F 3L73H 3H1KH 1PP9H 1SQXH 3H1HH 1BE3H 1EZVH 1SQQH 3L71H 2IBZH 1NTMH 1KB9F 3BCCH 1NU1H 3L70H 1SQBH 1PPJH 4PD4F 3CXHF 3L75H 3L74H 3TGUH 3CX5F
chains in the Genus database with same CATH superfamily
4MS2A 1UPGA 4QJFB 4XDLA 1M93A 1W0JG 4BW9A 4H0LB 1BGYH 5J2TA 1CPYA 5KAFZ 3C3SA 3HKEB 2GBOA 1EZVH 4EFBA 1YITV 3JSLA 1OCOB 3JATB 5B1AC 1W0KG 5H5NA 3RWRD 2OT5A 2ZKOA 3J80N 2ZCEA 4ZHQB 2V7QG 3RYCA 4R50A 5CBHA 2UXXA 3RYFA 5JWPA 1G4YB 2N05A 2F4VO 4N23A 4O2AA 4RO2A 1BHAA 5J9PC 5LGUA 2DW4A 4B3TB 1YDXA 1EN4A 3T4ZA 1K92A 1YCIA 3EHBB 4WBNB 1QLNA 4ZOLA 1ENVA 4J10A 3ABKC 2QKSA 2HEPA 2DQ3A 1OHHG 1FJGO 1SERA 2A9HA 1MSDA 1PKXA 2LW7A 2QM8A 3AK3A 2OIGA 4BIZA 2OCCB 1R6KA 5CMUA 1HR0O 1VQ4V 1QR9A 3K03A 1NS1A 3LSQA 3FYIB 2YS8A 3LDCA 3MHSC 4PA9A 1DK1A 1KP3A 1R1BA 2AHZA 2JGDA 2IBZH 5B1OA 3K5OA 2HJFC 4UCUA 3M7MX 4JAAA 1Q43A 1FXKC 3U0ZA 3K58A 1K97A 1LNQA 1F51A 4MTXA 1SKVA 5EK0A 4JASA 4FIPC 5ITZA 2JIZG 5JVDB 3HKBA 3F5WC 2BSKA 1FAFA 1KBHA 1D2DA 1KP2A 1Z5WA 4TOIA 2XAJA 4TUYA 3F7YC 2DYSB 3OEEG 2E5LB 4R7CA 4GX0A 3JAMN 1N33O 5DECA 4F6EA 1H38A 2W6JG 1MSWD 3CMAV 1MG1A 5KA6A 2Y4UA 5EYPA 4JI2B 1M57B 3LDDA 2JRIA 2QWQB 2Q69A 3K06A 4YJ2B 4X1YB 3JD3A 1YTFB 5BR8B 4J7KA 2P5OA 4TQDA 2R72A 4TV8A 2PY5A 3ASNC 5LMUB 1TAEA 5FPRA 2UUBB 3QTCA 4X66B 1O9HA 1WAZA 3A8TA 4DR3O 4TQFA 1OCZB 2XTAA 4LF9O 2CUGA 2Z3YA 3OR7C 1KECA 2F43G 4UVCA 1YIJV 2K9PA 5JQGA 1WN7A 3LNMB 3AG2B 1WPBA 2DYSC 2UXDB 3WB2A 3JD1A 2YXYA 4JV5O 4RUEA 3OW2U 3R65A 2L35A 3IAYA 4KFMA 1DGSA 3ABUA 4L8JA 2BCCH 3CRRA 1XNQB 2QM4A 3B8NA 3TCUA 3ICXA 3SYOA 2Y0PA 3H1KH 3CCUV 4LNUB 2WLLA 5EBLC 1VARA 2DMXA 1GM9A 1Q90D 3DC6A 4BWAA 5B1AB 1G1XB 2Q7GA 1NTKH 2IJKA 4DV0B 3FX7A 4R8CA 3H1HH 1N36O 1AR1B 5LHGA 1H2NA 4ZOLB 4FMTA 2UU9O 5L3FA 3CHXA 3ABTA 3KKYA 3B2EE 2LJ2A 3CWBH 4J42A 4PA7A 1AILA 4J7JA 5LXTB 1XMOB 4LWSA 5B1BB 3R66A 1AI4A 2PF4E 4JTDB 1NR7A 3RYHB 2XHBA 4GKJO 4JYAB 1WLEA 3WFVA 4O2BB 4N21A 1E79G 1MABG 1WPXA 4JI7B 2GDSA 3ZRXA 1AR5A 3CYOA 3ZJZA 1VIBA 1K7DA 4DR3B 2A0LA 3ZN1A 2Q67A 3E83A 1HW7A 1NT2B 1BQ0A 1Q6UA 5JCOA 2AZ0A 1MZFA 1NJIW 3DXRA 4DUYO 2DN9A 4IIJB 2Q9LA 3N2KB 5KX5B 5J2UB 1JJ2U 4KUMA 2VQEB 1PNMA 1UFIA 4JTAB 2ZDIA 1K5SA 3JASB 4J11A 2LW1A 1OCRB 3JAWA 4DRXA 4JI3B 1ZAUA 3GWOA 4X1YA 4Z1VA 4UCOA 3SYCA 4JI2O 2BTQA 4WFBV 4DV2O 4LR3A 4MVMA 3FB6C 3P32A 3ZHUA 2DWDC 5FL7G 3OD4A 4RWUA 3EXAA 3H1LH 3WB0A 3RN4A 3OTFA 1S5HC 3K0DA 2HLDG 4GKKB 2VQFB 4JYCA 1HWYA 5IWAO 1I5YA 3F7VC 3BY6A 4PI2A 2RCVA 3SJBC 1H2LA 4FM0A 3N2GB 1XUQA 4BR6A 4ABMA 2IH1C 2C2AA 3ETDA 4PJ0Z 1OZ0A 2CTPA 3W7WA 3GWKC 4NXMO 1MNGA 1DTOA 1TVKA 1IZ3A 4GLXA 1BQZA 4B7EA 2WA3A 5IDJA 2XNDG 2EJ7A 5LMNB 5FPOA 3NR7A 1RP3B 1Y67A 2P4KA 4I7ZB 4IL6Z 1VQOV 4B3MO 4DO2A 4NB5A 1N8RW 5CA0B 2RNBA 4G2KA 4EKWA 3IFXA 3DTUB 5JVDA 4LC1A 4HYOA 4H33A 2H8PC 3H9VA 4P30A 1VQ9V 1AI6A 2K1EA 3B4SA 3JALB 2X6AA 5JH7B 4O4IA 4TUYB 4JI4B 1AROP 2IU0A 5GTHZ 2ADPA 2CDYA 3M8AA 2R9AA 3D36A 2FL4A 4MSWC 3RFRA 4DV0O 1AP6A 3D3IA 1ZTEA 4G28B 4LCUC 4X88A 1JMKC 4UB6Z 3A0HZ 3D36C 5BXZA 1VQ6V 1SF9A 4QPKA 1QVFU 4CC5A 1S3JA 4TV9B 2H94A 4DV1B 5CN0A 3RT3C 5CA1A 1L0NH 2FTKA 2QWRB 1I5XA 2X7RB 1M4UA 1YF2A 2R9IA 2Y69B 3ETQA 4JI5O 1S5LZ 3X2QC 3K5NA 5CA3A 3HPLC 4RQFA 2QKAA 2IU3A 2W6IG 2LFRA 4IIJA 1RSOA 2P4VA 4KP4A 2ATKC 3RYIB 2QWPB 3L9DA 3A0RA 1VQ8V 2IJJA 3SPHA 4P9PA 2B9ZA 1NI8A 4EEQA 2IH3C 3T1HO 4PHZA 3JAKB 4LFBO 5CB4A 3WG7B 2WLLB 1N4CA 1M56B 3BA8A 1HNWB 1SS3A 2CK3G 4LWSB 4AILC 3OTOB 1BSMA 3FAVA 2UUAO 3E8GA 3P3PA 4O4JB 5B1BC 4LFBB 5D5PA 1XMOO 4OX9B 3ZRSA 3TJTA 2A79B 4PDRA 1K8AW 3OMIB 1PV0A 4H37A 3TETA 1WB8A 4X8AA 5K1XA 3JD2A 3T1HB 5H2FZ 2NNUA 1I08A 3APOA 4YJ3B 2WLNA 2Q5ZA 3TXSA 3SJCC 3CEIA 5LXTA 4RQEA 4FLXA 2PYLA 3CCRV 2FYUH 4DR2O 5KX5A 5GW7A 1AJPA 2ZR2A 1I0HA 1THZA 1B6QA 2KKWA 3ABLB 2JVDA 1XMQB 4UV9A 2E3CA 1P7BA 3STLC 1AI5A 5IYBO 3N27A 4RAIA 3K5LA 3JAWB 1YVWA 3SYPA 1RM1B 1QCEA 1G8MA 3S3WA 1K4CC 4U3JA 3UKMA 2HVJC 1UJWB 3S3XA 5LMNO 1K5QA 3ZHRA 2GV9A 3TGUH 3GB7C 4DK1A 2VWJA 3G6EV 2Z0AA 5LBQA 2R9RB 2XUMA 4W4LA 2KQXA 4LF9B 3K5MA 2HKOA 3LDEA 4I9QA 3E89A 3NXSA 1SQQH 2AXTZ 1Y76B 4DR6B 4CS3A 1Q6HA 2CGNA 1DF4A 1PPJH 1VF5B 4DUZO 2HHHO 1H2MA 1SA0A 1Q6IA 3ZRWA 1HP8A 2KB1A 1IXMA 1GRJA 1LR1A 1ZWIC 4UUJC 4LF6B 2PZSA 1VQMV 1L1FA 2XAQA 1MOFA 4FLYA 1AI7A 2Q0OC 4O4IB 2DJVA 1BL8A 2B1GA 2NR5A 2OIEA 4JI7O 5HFMA 5CA0A 5LOVA 4I5SA 4J80A 4WFGA 4WFAV 2EIJB 3I5DA 1Y66A 5LHIA 3CCMV 1GM7A 3ABMC 4I55B 3D3QA 4FFBA 1ZSPA 3FYEB 2OTJV 4X1KB 4I4TA 1GMGA 4PDMA 2YC0A 4OPAA 1N0NA 3CCEV 1XHXA 4JI8O 2XASA 4WFFA 3BVOA 3E8FA 4F6RA 1XILA 5LHHA 2EBOA 1OCCB 5L3DA 4E4EA 1Q3EA 1FFXA 3CRMA 1EM1A 4GX5A 1GN3A 3G71V 3WG7C 5LGNA 1X59A 5FNVB 1VF6A 3LNNA 5KHIA 2YDEA 3JALA 1P4RA 2WLIA 3ZHTA 3ABMB 4L87A 1S5JA 2GHYA 3MD0A 3VBBA 5LP6B 3W7SA 1KUQA 3CPWU 5GTIZ 1JPXA 2YIAA 1GN4A 1WA8B 1O9GA 2VQFO 2D3OW 1YZBA 1HDJA 2QTSA 5JCOC 1MMMA 1EN5A 4CH5A 2HG5C 4O4JA 3JARA 4LH6A 1F7YA 3UT5A 1XL4A 4TV9A 4O4LA 4YXWG 1M1KW 5CBFA 4JI1O 4A5UB 2OYQA 3ZCCA 4YHHO 3L73H 4DXWA 1SQXH 3PJSK 1ZLZA 4U3JB 2PI4A 1JA8A 1V9PA 3ZHVA 3OEHG 4QGPA 2ZM6O 1TUBA 3RYIA 1NBMG 2E75B 1GAXA 4MTOA 4MW8A 1FD9A 1WNSA 3JAKA 1N33B 2JS5A 4LF4O 3HKEA 2VS0A 4AHCA 3L71H 2WLHA 2A3QA 1NU1H 1XEQA 4UCSA 1N0JA 2EJRA 4ZHQA 4UV8A 1N34O 3AG1C 2JGDB 2QR4A 4DR5O 5JJEB 3ETEA 2ZE8A 3H01A 2B1IA 3IJ4A 2VWKA 1HNXB 5KAIZ 4X66O 5TISZ 4GKJB 4HZ3A 5LA6A 3ZMZA 3B09A 1KKCA 1YJWV 3QF7A 1VQNV 5ITZB 3BHPA 4DV3O 3ZMVA 5EYPB 2FKXA 1SQVH 1RPRA 2CTRA 4JI8B 1R73A 4K3AA 4JZGA 1VQLV 3OM3B 1FXKB 4TV8B 2YIDA 3K08A 1BE3H 4IHJB 3RW0A 2UUBO 4P2ZA 4PA3A 1W2BU 5EIBC 4JZ2A 5LGTA 2UXDO 4PDLA 4NTYA 3VQYA 3LUTB 4B3SO 3CD6V 3CSXA 4FM2A 4F4LA 1PL0A 3E86A 3K59A 3CCJV 4LF7O 2WWWA 2QSAA 4B3RO 1Y4MA 1IURA 1FYJA 1M57C 3OGIB 1NH2B 3CB2A 1RFYA 5LOVB 1GTOA 4NKGB 3CCSV 2MK3A 5BR8O 2ZNJA 2ZINA 4DR6O 5C93A 1K33A 2N04A 2OWOA 4F6RB 4YJ2A 4OPHA 1IBLB 2EIJC 2LQTA 5CBGA 3PN1A 2E5LO 3ZX6A 2DYRC 4LNUA 3WU2Z 3QG5A 2E74B 4ZI7B 1JJOA 4BAYA 3C3TA 1I94B 4FLWA 2YIBA 2JEXA 4X20B 4MVRA 4WCEV 1VMGA 4MVOA 3OMNB 3CCLV 3E22A 1SC5B 1FKAO 1HNZO 5KHGA 4TWKA 3K79A 1AP5A 4DV7B 3RBZA 2QA4V 3CX5F 4MTFA 4LF5O 2O57A 4Q6GA 3T1YO 4X9QA 4U3FH 1NKDA 2XT9A 4GX1A 3D8CA 2EIMC 4B7KA 4FLVA 4X1KA 4EB6B 1YTFD 2F4VB 3QO8A 3LSSA 4X62B 1GK9A 2QGNA 2EZPA 1NZ6A 4Z1MG 5GONB 2L6LA 2HR3A 1YSCA 2EIMB 4MVZA 3DSQA 3ETGA 3OT7A 4I50B 4LBEC 5EZYA 4O2BA 2OCCC 4NR1A 3G4SV 2ZIOA 1QR8A 4OX9O 4PI0A 5DEDA 4RUFA 2ZE5A 3ZIAG 3OAAG 2F23A 2V1DA 1VQPV 2QWNB 1M9NA 1WP8A 3CCVV 4AI8A 1VQ5V 3DXRB 4UCVA 3HKDB 2HFEC 1HNWO 1BZKA 4DR7O 4I0XA 2DWEC 1V55B 2ZDIC 4DV4O 3AK2A 1NTMH 1I7FA 4JI5B 4JTCB 2XOKG 2UXCO 3IC7A 2ILMA 2P90A 3KCYA 2Q4PA 2GUZB 2WSSG 5KHKA 2JEUA 2Q68A 3RVYA 4DV4B 2YSUB 2OTLV 4QIWF 2D2CB 2EIKB 3BEHA 1K34A 2IM9A 3OUFA 3TK1A 3ASOC 2CAZC 4IGGA 1HNXO 5KUKA 4E2LA 5JH7A 4HNAB 4UB8Z 1NVPD 1QLEB 2RN9A 4IHJA 4FFKA 1Z2GA 3DC5A 4UFZA 4DR7B 4JYYA 3JD4A 4X64O 2A06H 2ZXWB 1AJQA 4LF8B 3RGBA 3ZBHA 5B3SC 3ZS8C 4NXMB 1ZX3A 1M90W 4DV5O 2XAGA 3OMAB 3UQ8A 4LF4B 4K8ZA 4JGSA 1S0VA 4CH4A 4X1IA 4CS2A 2HVKC 4JI4O 4H44B 1H2SB 4K8XA 5IWAB 5F2VO 2ZXWC 4K35A 4DR1O 1US6A 4MVUA 2UUCO 5B3SB 5IY5B 3L70H 4UVBA 2A7WA 3FD9A 1YEWA 4ICGA 3A0BZ 2OCHA 4KL1A 4JI1B 3OGCC 2P6JA 2W0XA 1PNLA 2CTQA 4J9YB 5L3GA 4KHPO 2M6YA 4H13B 4IYIA 2YEVA 2Y69C 2UXBO 3BRCA 2NN4A 4JAVA 4J7ZA 2EILB 4B3RB 1Q8IA 5A2QN 4GUNA 2RMKB 3OUSA 2QWOB 4B3SB 1URFA 1JFFA 1Y74A 1HR0B 2X6CA 2ITDC 1CEZA 4IT5A 4FVMA 3HB3B 4DV1O 3E8HA 1VQ7V 2XAHA 1H2GA 4YY3B 1GO3F 4JI3O 1IX9A 5KMGA 1SRYA 4X20A 1PD3A 1ZUQA 4DYLA 3SPGA 3MAQA 4CS4A 2LGWA 4Z2WA 2P06A 4FLUA 3SYQA 5IT9N 1IBLO 2YIBD 2Y4TA 1EFRG 4QNHB 2QJ1A 3SGIA 4O2AB 1PL4A 2BOCC 1SZTA 2DQ0A 3L75H 3P30A 4CBCA 1JOYA 4UCTA 5EZYB 5J2TB 2ZE7A 1LUWA 1N32O 4GCZA 4GKKO 3K57A 5C8YA 3CE2A 5IJ0A 3JCZA 1CXZB 1B06A 3FB8C 3CXCU 2QE7G 5EBWC 1F4MA 1S72V 3SYAA 1PM9A 2QKCA 4DV2B 3T2MA 4I50A 2WA4A 2E76B 5LL6Y 3JD0A 1S76D 4LF8O 2ZNIA 1OJHA 3H1JH 3ASOB 4EFEA 1JQ0A 1OCOC 4FZ0A 4B3TO 4XDKA 1FXHA 5CB4B 4DUYB 4LFAO 1PP9H 2PI5A 2V4DA 4BIOA 5IE9A 1Y76A 2YI8A 2F1MA 5L3BA 3HKDA 2JJ1G 1W59A 2FMLA 3RYFB 3FAVB 2EULA 1XQ8A 5GONA 4NTWA 2ZIMA 4J41A 3G80A 4DW1A 5JJJB 3IGAC 3J7AU 2EZOA 4CZZA 1MZEA 4GZRB 4DR2B 5D5QA 3QVNA 2UXCB 1EZJA 2P7TC 1XDCA 3O65A 3W7UA 2LP7A 3AG4C 5KA5A 3CC4V 4JV5B 2LO1A 1SA0B 4X89A 4JI0B 4TSFG 1NQTA 1S77D 2YEVB 1N36B 2JJ2G 3G67A 3BCCH 1QVGU 5AG2A 2AW9A 2RQ6A 1R3JC 1YXBA 1YI2V 3HKCB 1IXBA 1E1RG 4BIUA 2GUZA 3T4DA 3F5TA 4FJCC 2EIKC 1XNQO 2X6BA 3MHHC 2KG7B 4JI0O 4X62O 1RPOA 2WAMA 4HAMA 3BA9A 4W4KA 2CH7A 1D5AA 4DV6O 1QLEC 2ZT9B 2WLJA 1L8DA 1U97A 1IBKB 4I55A 3CXHF 2N74A 3SJQC 1XBLA 3L74H 5EBMC 5IYZA 2XAFA 4D7TA 3VQXA 4D7SA 1N32B 5KHHA 3I56V 3VQWA 4I4TB 2BOBC 3CMEV 2QM7A 3CRAA 2X0LA 4QE7A 2BE3A 4NXNB 4JI6O 3AG2C 3LSUA 1HNZB 4LF5B 3RYHA 4DK0A 3ASNB 1KB9F 3WB1A 1D5NA 1AR4A 4LFCO 2YXLA 3RVZA 4FFBB 2AHYA 2IW5A 4U7NA 2ADQB 5H6RA 1K73W 3ZEDA 5FNVA 3G6BA 2CE4A 2PGGA 4OXSA 1TA8A 1ROPA 2PYJA 4MT8A 1V54C 5KUMA 1ZL8A 1R3KC 5BY1A 4TT3G 3N2KA 1BT8A 1WA8A 3SPJA 1JVMA 3KZIZ 1B3QA 3M99B 5H9CA 5L3CA 1AVMA 4JI6B 4LP8A 5KMGB 3JARB 1KU9A 3JASA 4WF9V 1F23A 3X2QB 4UVAA 1V54B 1EN6A 3BAAA 1JX9A 1IBMO 4WFHA 4DRXB 4GYCB 4R6ZA 1QHTA 1AB3A 3IC9A 1KD1W 2F93B 3UM7A 1J95A 4PELA 4FZ1A 4YIOA 3AG7A 1IDSA 3UO2A 4BW5A 3CRQA 5EC1C 1YJNV 4NVPA 1FFXB 3UT5B 4LF7B 2IJIA 5DM6V 1M56C 2EINB 1OCRC 3DGEA 4DR1B 2UUCB 4KXRA 4LFCB 3FB5C 3THOA 2BTOA 4DUZB 3ABLC 3K3WA 1BMFG 1MA1A 1FS0G 1IVSA 1BHBA 1TUEB 1BCCH 4G27B 2Q7HA 3CP1A 2YI9A 2VRZA 1X4TA 3E35A 1Q7YW 1JR9A 1H8EG 1I94O 1VEWA 1KQSU 3EFFK 1P49A 4O4HA 1H8HG 2F66C 4NXNO 4MVQA 3UCSC 3ZHSA 1Y6XA 1FJGB 5E79Z 3HKCA 1T5EA 2F95B 2G38A 5BZBA 1XHZA 5C8YB 3E8BA 2Y48A 1OV9A 5IJ0B 5A9GA 3ABKB 5IJ9B 1SQPH 3Q4HA 5B5EZ 4DV3B 2BTQB 1L0LH 3MDSA 1P84F 3FKSG 4ZKIA 1QU7A 1IBMB 1SQFA 5B66Z 4PA4A 5LYJB 1TUBB 1DLBA 1FXKA 2UU9B 5J2UA 4DR5B 2W0FC 4DV6B 1FXVA 1QNMA 1RM1C 5LA6B 2GSMB 1XREA 4K0KO 2Z5UA 3W7TA 2Q6AA 1GKFA 3OR6C 3H1IH 5IYCO 3HR0A 1IBKO 3A2FA 2M7WA 3N2GA 3QO5A 2Q0AA 4NTXA 2ZM6B 2KG7A 4JYBA 2P22C 1KMIZ 3JCUZ 3CJHA 4LH7A 4FK5C 1EBOA 3FB7C 3U11A 2VQEO 1NR1A 3GVMA 4ZI7A 4YHHB 2PUSA 2NLJC 2DOSA 4U7OA 4AQYB 1Q81W 2ITCC 1OCCC 1CP9A 2WLKA 2RDCA 4FM1A 3ZMTA 4X65O 2H3OA 2QDOA 1OCZC 1K3EA 4DV7O 1XNRB 3L72H 3FFQA 4AQYO 3ZHQA 2Q8VA 2JDIG 5IYZB 1GM8A 1F4NA 1FFTB 1TVKB 4JYAO 3SR2C 5LMUO 5H6QA 5CA1B 1Z5VA 5BMVB 1ORQC 4DW0A 2Y0IA 3BFRA 4FPPA 3E22B 5KLVH 1BS3A 4P9OA 2YXHA 4ASUG 1QQCA 5HFLA 3K9SA 1R6TA 2CH7B 4CC6A 4WBNA 1J5EO 1P7GA 2GTAA 3ZMUA 2P67A 4LFAB 3VQVA 4CH6A 2ZE6A 1H2KA 3K9AA 2JK5C 3KG2A 3ZMSA 3STZC 3ML0A 3ZRVA 4C7UA 4YJ3A 5KHJA 1A32A 2ETNA 1COWG 1ZL8B 1RSOB 3SDLA 2FB5A 3B40A 2QTOA 1NVPB 2UXNA 3OFNG 3C90A 5B1NA 3RYCB 4I0XB 1E1QG 4O4HB 3K0GA 5K1PA 1WJZA 3OE7G 2EINC 3AEIA 3T1CA 3O9OA 3I55V 4MW3A 3K04A 1V55C 3CS5A 4MVSA 1GN2A 3E2EA 3EVKA 3JATA 1GH6A 4DR4B 1PNKA 4J9ZB 1VQKV 1SQGA 3Q4HB 2PTMA 3HKBB 4PA6A 2BSKB 2CGOA 2HHHB 1R6NA 3B8MA 4LF6O 1NTZH 3QO7A 3CC7V 2IJHA 4FLZA 4KHPB 3AG1B 3CCQV 4B3MB 3P3NA 4QE9A 1AJNA 2UXBB 4WFEA 4EB6A 1Q5OA 2WLMA 1J5EB 1B04A 1Q86W 4YY3O 4PD4F 4JAUA 3ZRWB 1XNRO 4DR4O 2YICA 3AK1A 4B08A 4ZIBA 2AZ2A 4X65B 1WB7A 5JJNB 1KYOF 5LYJA 4UXNA 2HP8A 1K4DC 2CTWA 4XBFA 4UCRA 2MW2B 4I9WA 4Q20A 2WPDG 1U96A 5EIBD 4FLTA 2JGUA 5IJ9A 3W7XA 3CC2V 2KSDA 2YUAA 3B77A 5IY5C 1QBZA 3UO3A 4D6TH 4GX2A 4JPRA 1N34B 4ZBMA 4NYKA 4PV1B 4XDJA 3QNEA 1YHQV 5E1AC 4GT1A 1K9MW 1XI1A 2RJZA 3VOUA 1XOUA 2B5UA 5FLXN 1LUVA 3SPCA 3J81N 4X64B 4HBNA 2Q73A 1SZXA 3CRCA 1VF7A 3JSNA 3AG4B 3AG3C 3JYCA 5JQGB 2GTSA 1TGOA 2ODMA 3U10A 3OTOO 4OGQB 2R70A 1XL6A 1GN6A 4X1IB 2QEXV 4JF3A 2DE0X 2DYRB 2JS3A 2LGQA 3BABA 2UUAB 2Q7EA 1SQBH 3AG3B 2LFSA 4QPJA 4YIPA 4HNAA 1Q82W 1WP7A 1R3IC 3SJAC 1G6UA 5LP6A 2ZD9A 4CH3A 4DV5B 3KCXA 5BMVA 1YJ9V 5L3EA 1KKDA 1NH2D 3T1YB 1JCHA 2ZR3A 5LP6C 1VP7A 1VF6C 4MTGA 3SPIA 3CJHB 2AGAA 3TXQA 1SESA 1XMQO 2HJDA 4O4LB 1FPOA 1R3LC 2ZQMA 1M5IA 1SETA 4K0KB 5IYDO 5DN6G 2WLIB 3BPZA 3ZN0A 2ARHA 4IYHA 1KC8W 2EILC 1JFFB 1Y74B 5EC2C 3APQA 1DF5A 4PDVA 2EX3A
chains in the Genus database with same CATH topology
1SQVH 5KLVH 1NTZH 3CWBH 4D6TH 1BCCH 3H1JH 3L72H 1L0NH 4U3FH 1KYOF 3H1LH 2BCCH 1SQPH 1NTKH 3H1IH 2FYUH 1L0LH 2A06H 1BGYH 1P84F 3L73H 3H1KH 1PP9H 1SQXH 3H1HH 1BE3H 1EZVH 1SQQH 3L71H 2IBZH 1NTMH 1KB9F 3BCCH 1NU1H 3L70H 1SQBH 1PPJH 4PD4F 3CXHF 3L75H 3L74H 3TGUH 3CX5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV H;  5KLV H;  1NTZ H;  3CWB H;  4D6T H;  1BCC H;  3H1J H;  3L72 H;  1L0N H;  4U3F H;  1KYO F;  3H1L H;  2BCC H;  1SQP H;  1NTK H;  3H1I H;  2FYU H;  1L0L H;  2A06 H;  1BGY H;  1P84 F;  3L73 H;  3H1K H;  1PP9 H;  1SQX H;  3H1H H;  1BE3 H;  1EZV H;  1SQQ H;  3L71 H;  2IBZ H;  1NTM H;  1KB9 F;  3BCC H;  1NU1 H;  3L70 H;  1SQB H;  1PPJ H;  4PD4 F;  3CXH F;  3L75 H;  3L74 H;  3TGU H;  3CX5 F; 
#chains in the Genus database with same CATH topology
 4MS2 A;  1UPG A;  4QJF B;  4XDL A;  1M93 A;  1W0J G;  4BW9 A;  4H0L B;  1BGY H;  5J2T A;  1CPY A;  5KAF Z;  3C3S A;  3HKE B;  2GBO A;  1EZV H;  4EFB A;  1YIT V;  3JSL A;  1OCO B;  3JAT B;  5B1A C;  1W0K G;  5H5N A;  3RWR D;  2OT5 A;  2ZKO A;  3J80 N;  2ZCE A;  4ZHQ B;  2V7Q G;  3RYC A;  4R50 A;  5CBH A;  2UXX A;  3RYF A;  5JWP A;  1G4Y B;  2N05 A;  2F4V O;  4N23 A;  4O2A A;  4RO2 A;  1BHA A;  5J9P C;  5LGU A;  2DW4 A;  4B3T B;  1YDX A;  1EN4 A;  3T4Z A;  1K92 A;  1YCI A;  3EHB B;  4WBN B;  1QLN A;  4ZOL A;  1ENV A;  4J10 A;  3ABK C;  2QKS A;  2HEP A;  2DQ3 A;  1OHH G;  1FJG O;  1SER A;  2A9H A;  1MSD A;  1PKX A;  2LW7 A;  2QM8 A;  3AK3 A;  2OIG A;  4BIZ A;  2OCC B;  1R6K A;  5CMU A;  1HR0 O;  1VQ4 V;  1QR9 A;  3K03 A;  1NS1 A;  3LSQ A;  3FYI B;  2YS8 A;  3LDC A;  3MHS C;  4PA9 A;  1DK1 A;  1KP3 A;  1R1B A;  2AHZ A;  2JGD A;  2IBZ H;  5B1O A;  3K5O A;  2HJF C;  4UCU A;  3M7M X;  4JAA A;  1Q43 A;  1FXK C;  3U0Z A;  3K58 A;  1K97 A;  1LNQ A;  1F51 A;  4MTX A;  1SKV A;  5EK0 A;  4JAS A;  4FIP C;  5ITZ A;  2JIZ G;  5JVD B;  3HKB A;  3F5W C;  2BSK A;  1FAF A;  1KBH A;  1D2D A;  1KP2 A;  1Z5W A;  4TOI A;  2XAJ A;  4TUY A;  3F7Y C;  2DYS B;  3OEE G;  2E5L B;  4R7C A;  4GX0 A;  3JAM N;  1N33 O;  5DEC A;  4F6E A;  1H38 A;  2W6J G;  1MSW D;  3CMA V;  1MG1 A;  5KA6 A;  2Y4U A;  5EYP A;  4JI2 B;  1M57 B;  3LDD A;  2JRI A;  2QWQ B;  2Q69 A;  3K06 A;  4YJ2 B;  4X1Y B;  3JD3 A;  1YTF B;  5BR8 B;  4J7K A;  2P5O A;  4TQD A;  2R72 A;  4TV8 A;  2PY5 A;  3ASN C;  5LMU B;  1TAE A;  5FPR A;  2UUB B;  3QTC A;  4X66 B;  1O9H A;  1WAZ A;  3A8T A;  4DR3 O;  4TQF A;  1OCZ B;  2XTA A;  4LF9 O;  2CUG A;  2Z3Y A;  3OR7 C;  1KEC A;  2F43 G;  4UVC A;  1YIJ V;  2K9P A;  5JQG A;  1WN7 A;  3LNM B;  3AG2 B;  1WPB A;  2DYS C;  2UXD B;  3WB2 A;  3JD1 A;  2YXY A;  4JV5 O;  4RUE A;  3OW2 U;  3R65 A;  2L35 A;  3IAY A;  4KFM A;  1DGS A;  3ABU A;  4L8J A;  2BCC H;  3CRR A;  1XNQ B;  2QM4 A;  3B8N A;  3TCU A;  3ICX A;  3SYO A;  2Y0P A;  3H1K H;  3CCU V;  4LNU B;  2WLL A;  5EBL C;  1VAR A;  2DMX A;  1GM9 A;  1Q90 D;  3DC6 A;  4BWA A;  5B1A B;  1G1X B;  2Q7G A;  1NTK H;  2IJK A;  4DV0 B;  3FX7 A;  4R8C A;  3H1H H;  1N36 O;  1AR1 B;  5LHG A;  1H2N A;  4ZOL B;  4FMT A;  2UU9 O;  5L3F A;  3CHX A;  3ABT A;  3KKY A;  3B2E E;  2LJ2 A;  3CWB H;  4J42 A;  4PA7 A;  1AIL A;  4J7J A;  5LXT B;  1XMO B;  4LWS A;  5B1B B;  3R66 A;  1AI4 A;  2PF4 E;  4JTD B;  1NR7 A;  3RYH B;  2XHB A;  4GKJ O;  4JYA B;  1WLE A;  3WFV A;  4O2B B;  4N21 A;  1E79 G;  1MAB G;  1WPX A;  4JI7 B;  2GDS A;  3ZRX A;  1AR5 A;  3CYO A;  3ZJZ A;  1VIB A;  1K7D A;  4DR3 B;  2A0L A;  3ZN1 A;  2Q67 A;  3E83 A;  1HW7 A;  1NT2 B;  1BQ0 A;  1Q6U A;  5JCO A;  2AZ0 A;  1MZF A;  1NJI W;  3DXR A;  4DUY O;  2DN9 A;  4IIJ B;  2Q9L A;  3N2K B;  5KX5 B;  5J2U B;  1JJ2 U;  4KUM A;  2VQE B;  1PNM A;  1UFI A;  4JTA B;  2ZDI A;  1K5S A;  3JAS B;  4J11 A;  2LW1 A;  1OCR B;  3JAW A;  4DRX A;  4JI3 B;  1ZAU A;  3GWO A;  4X1Y A;  4Z1V A;  4UCO A;  3SYC A;  4JI2 O;  2BTQ A;  4WFB V;  4DV2 O;  4LR3 A;  4MVM A;  3FB6 C;  3P32 A;  3ZHU A;  2DWD C;  5FL7 G;  3OD4 A;  4RWU A;  3EXA A;  3H1L H;  3WB0 A;  3RN4 A;  3OTF A;  1S5H C;  3K0D A;  2HLD G;  4GKK B;  2VQF B;  4JYC A;  1HWY A;  5IWA O;  1I5Y A;  3F7V C;  3BY6 A;  4PI2 A;  2RCV A;  3SJB C;  1H2L A;  4FM0 A;  3N2G B;  1XUQ A;  4BR6 A;  4ABM A;  2IH1 C;  2C2A A;  3ETD A;  4PJ0 Z;  1OZ0 A;  2CTP A;  3W7W A;  3GWK C;  4NXM O;  1MNG A;  1DTO A;  1TVK A;  1IZ3 A;  4GLX A;  1BQZ A;  4B7E A;  2WA3 A;  5IDJ A;  2XND G;  2EJ7 A;  5LMN B;  5FPO A;  3NR7 A;  1RP3 B;  1Y67 A;  2P4K A;  4I7Z B;  4IL6 Z;  1VQO V;  4B3M O;  4DO2 A;  4NB5 A;  1N8R W;  5CA0 B;  2RNB A;  4G2K A;  4EKW A;  3IFX A;  3DTU B;  5JVD A;  4LC1 A;  4HYO A;  4H33 A;  2H8P C;  3H9V A;  4P30 A;  1VQ9 V;  1AI6 A;  2K1E A;  3B4S A;  3JAL B;  2X6A A;  5JH7 B;  4O4I A;  4TUY B;  4JI4 B;  1ARO P;  2IU0 A;  5GTH Z;  2ADP A;  2CDY A;  3M8A A;  2R9A A;  3D36 A;  2FL4 A;  4MSW C;  3RFR A;  4DV0 O;  1AP6 A;  3D3I A;  1ZTE A;  4G28 B;  4LCU C;  4X88 A;  1JMK C;  4UB6 Z;  3A0H Z;  3D36 C;  5BXZ A;  1VQ6 V;  1SF9 A;  4QPK A;  1QVF U;  4CC5 A;  1S3J A;  4TV9 B;  2H94 A;  4DV1 B;  5CN0 A;  3RT3 C;  5CA1 A;  1L0N H;  2FTK A;  2QWR B;  1I5X A;  2X7R B;  1M4U A;  1YF2 A;  2R9I A;  2Y69 B;  3ETQ A;  4JI5 O;  1S5L Z;  3X2Q C;  3K5N A;  5CA3 A;  3HPL C;  4RQF A;  2QKA A;  2IU3 A;  2W6I G;  2LFR A;  4IIJ A;  1RSO A;  2P4V A;  4KP4 A;  2ATK C;  3RYI B;  2QWP B;  3L9D A;  3A0R A;  1VQ8 V;  2IJJ A;  3SPH A;  4P9P A;  2B9Z A;  1NI8 A;  4EEQ A;  2IH3 C;  3T1H O;  4PHZ A;  3JAK B;  4LFB O;  5CB4 A;  3WG7 B;  2WLL B;  1N4C A;  1M56 B;  3BA8 A;  1HNW B;  1SS3 A;  2CK3 G;  4LWS B;  4AIL C;  3OTO B;  1BSM A;  3FAV A;  2UUA O;  3E8G A;  3P3P A;  4O4J B;  5B1B C;  4LFB B;  5D5P A;  1XMO O;  4OX9 B;  3ZRS A;  3TJT A;  2A79 B;  4PDR A;  1K8A W;  3OMI B;  1PV0 A;  4H37 A;  3TET A;  1WB8 A;  4X8A A;  5K1X A;  3JD2 A;  3T1H B;  5H2F Z;  2NNU A;  1I08 A;  3APO A;  4YJ3 B;  2WLN A;  2Q5Z A;  3TXS A;  3SJC C;  3CEI A;  5LXT A;  4RQE A;  4FLX A;  2PYL A;  3CCR V;  2FYU H;  4DR2 O;  5KX5 A;  5GW7 A;  1AJP A;  2ZR2 A;  1I0H A;  1THZ A;  1B6Q A;  2KKW A;  3ABL B;  2JVD A;  1XMQ B;  4UV9 A;  2E3C A;  1P7B A;  3STL C;  1AI5 A;  5IYB O;  3N27 A;  4RAI A;  3K5L A;  3JAW B;  1YVW A;  3SYP A;  1RM1 B;  1QCE A;  1G8M A;  3S3W A;  1K4C C;  4U3J A;  3UKM A;  2HVJ C;  1UJW B;  3S3X A;  5LMN O;  1K5Q A;  3ZHR A;  2GV9 A;  3TGU H;  3GB7 C;  4DK1 A;  2VWJ A;  3G6E V;  2Z0A A;  5LBQ A;  2R9R B;  2XUM A;  4W4L A;  2KQX A;  4LF9 B;  3K5M A;  2HKO A;  3LDE A;  4I9Q A;  3E89 A;  3NXS A;  1SQQ H;  2AXT Z;  1Y76 B;  4DR6 B;  4CS3 A;  1Q6H A;  2CGN A;  1DF4 A;  1PPJ H;  1VF5 B;  4DUZ O;  2HHH O;  1H2M A;  1SA0 A;  1Q6I A;  3ZRW A;  1HP8 A;  2KB1 A;  1IXM A;  1GRJ A;  1LR1 A;  1ZWI C;  4UUJ C;  4LF6 B;  2PZS A;  1VQM V;  1L1F A;  2XAQ A;  1MOF A;  4FLY A;  1AI7 A;  2Q0O C;  4O4I B;  2DJV A;  1BL8 A;  2B1G A;  2NR5 A;  2OIE A;  4JI7 O;  5HFM A;  5CA0 A;  5LOV A;  4I5S A;  4J80 A;  4WFG A;  4WFA V;  2EIJ B;  3I5D A;  1Y66 A;  5LHI A;  3CCM V;  1GM7 A;  3ABM C;  4I55 B;  3D3Q A;  4FFB A;  1ZSP A;  3FYE B;  2OTJ V;  4X1K B;  4I4T A;  1GMG A;  4PDM A;  2YC0 A;  4OPA A;  1N0N A;  3CCE V;  1XHX A;  4JI8 O;  2XAS A;  4WFF A;  3BVO A;  3E8F A;  4F6R A;  1XIL A;  5LHH A;  2EBO A;  1OCC B;  5L3D A;  4E4E A;  1Q3E A;  1FFX A;  3CRM A;  1EM1 A;  4GX5 A;  1GN3 A;  3G71 V;  3WG7 C;  5LGN A;  1X59 A;  5FNV B;  1VF6 A;  3LNN A;  5KHI A;  2YDE A;  3JAL A;  1P4R A;  2WLI A;  3ZHT A;  3ABM B;  4L87 A;  1S5J A;  2GHY A;  3MD0 A;  3VBB A;  5LP6 B;  3W7S A;  1KUQ A;  3CPW U;  5GTI Z;  1JPX A;  2YIA A;  1GN4 A;  1WA8 B;  1O9G A;  2VQF O;  2D3O W;  1YZB A;  1HDJ A;  2QTS A;  5JCO C;  1MMM A;  1EN5 A;  4CH5 A;  2HG5 C;  4O4J A;  3JAR A;  4LH6 A;  1F7Y A;  3UT5 A;  1XL4 A;  4TV9 A;  4O4L A;  4YXW G;  1M1K W;  5CBF A;  4JI1 O;  4A5U B;  2OYQ A;  3ZCC A;  4YHH O;  3L73 H;  4DXW A;  1SQX H;  3PJS K;  1ZLZ A;  4U3J B;  2PI4 A;  1JA8 A;  1V9P A;  3ZHV A;  3OEH G;  4QGP A;  2ZM6 O;  1TUB A;  3RYI A;  1NBM G;  2E75 B;  1GAX A;  4MTO A;  4MW8 A;  1FD9 A;  1WNS A;  3JAK A;  1N33 B;  2JS5 A;  4LF4 O;  3HKE A;  2VS0 A;  4AHC A;  3L71 H;  2WLH A;  2A3Q A;  1NU1 H;  1XEQ A;  4UCS A;  1N0J A;  2EJR A;  4ZHQ A;  4UV8 A;  1N34 O;  3AG1 C;  2JGD B;  2QR4 A;  4DR5 O;  5JJE B;  3ETE A;  2ZE8 A;  3H01 A;  2B1I A;  3IJ4 A;  2VWK A;  1HNX B;  5KAI Z;  4X66 O;  5TIS Z;  4GKJ B;  4HZ3 A;  5LA6 A;  3ZMZ A;  3B09 A;  1KKC A;  1YJW V;  3QF7 A;  1VQN V;  5ITZ B;  3BHP A;  4DV3 O;  3ZMV A;  5EYP B;  2FKX A;  1SQV H;  1RPR A;  2CTR A;  4JI8 B;  1R73 A;  4K3A A;  4JZG A;  1VQL V;  3OM3 B;  1FXK B;  4TV8 B;  2YID A;  3K08 A;  1BE3 H;  4IHJ B;  3RW0 A;  2UUB O;  4P2Z A;  4PA3 A;  1W2B U;  5EIB C;  4JZ2 A;  5LGT A;  2UXD O;  4PDL A;  4NTY A;  3VQY A;  3LUT B;  4B3S O;  3CD6 V;  3CSX A;  4FM2 A;  4F4L A;  1PL0 A;  3E86 A;  3K59 A;  3CCJ V;  4LF7 O;  2WWW A;  2QSA A;  4B3R O;  1Y4M A;  1IUR A;  1FYJ A;  1M57 C;  3OGI B;  1NH2 B;  3CB2 A;  1RFY A;  5LOV B;  1GTO A;  4NKG B;  3CCS V;  2MK3 A;  5BR8 O;  2ZNJ A;  2ZIN A;  4DR6 O;  5C93 A;  1K33 A;  2N04 A;  2OWO A;  4F6R B;  4YJ2 A;  4OPH A;  1IBL B;  2EIJ C;  2LQT A;  5CBG A;  3PN1 A;  2E5L O;  3ZX6 A;  2DYR C;  4LNU A;  3WU2 Z;  3QG5 A;  2E74 B;  4ZI7 B;  1JJO A;  4BAY A;  3C3T A;  1I94 B;  4FLW A;  2YIB A;  2JEX A;  4X20 B;  4MVR A;  4WCE V;  1VMG A;  4MVO A;  3OMN B;  3CCL V;  3E22 A;  1SC5 B;  1FKA O;  1HNZ O;  5KHG A;  4TWK A;  3K79 A;  1AP5 A;  4DV7 B;  3RBZ A;  2QA4 V;  3CX5 F;  4MTF A;  4LF5 O;  2O57 A;  4Q6G A;  3T1Y O;  4X9Q A;  4U3F H;  1NKD A;  2XT9 A;  4GX1 A;  3D8C A;  2EIM C;  4B7K A;  4FLV A;  4X1K A;  4EB6 B;  1YTF D;  2F4V B;  3QO8 A;  3LSS A;  4X62 B;  1GK9 A;  2QGN A;  2EZP A;  1NZ6 A;  4Z1M G;  5GON B;  2L6L A;  2HR3 A;  1YSC A;  2EIM B;  4MVZ A;  3DSQ A;  3ETG A;  3OT7 A;  4I50 B;  4LBE C;  5EZY A;  4O2B A;  2OCC C;  4NR1 A;  3G4S V;  2ZIO A;  1QR8 A;  4OX9 O;  4PI0 A;  5DED A;  4RUF A;  2ZE5 A;  3ZIA G;  3OAA G;  2F23 A;  2V1D A;  1VQP V;  2QWN B;  1M9N A;  1WP8 A;  3CCV V;  4AI8 A;  1VQ5 V;  3DXR B;  4UCV A;  3HKD B;  2HFE C;  1HNW O;  1BZK A;  4DR7 O;  4I0X A;  2DWE C;  1V55 B;  2ZDI C;  4DV4 O;  3AK2 A;  1NTM H;  1I7F A;  4JI5 B;  4JTC B;  2XOK G;  2UXC O;  3IC7 A;  2ILM A;  2P90 A;  3KCY A;  2Q4P A;  2GUZ B;  2WSS G;  5KHK A;  2JEU A;  2Q68 A;  3RVY A;  4DV4 B;  2YSU B;  2OTL V;  4QIW F;  2D2C B;  2EIK B;  3BEH A;  1K34 A;  2IM9 A;  3OUF A;  3TK1 A;  3ASO C;  2CAZ C;  4IGG A;  1HNX O;  5KUK A;  4E2L A;  5JH7 A;  4HNA B;  4UB8 Z;  1NVP D;  1QLE B;  2RN9 A;  4IHJ A;  4FFK A;  1Z2G A;  3DC5 A;  4UFZ A;  4DR7 B;  4JYY A;  3JD4 A;  4X64 O;  2A06 H;  2ZXW B;  1AJQ A;  4LF8 B;  3RGB A;  3ZBH A;  5B3S C;  3ZS8 C;  4NXM B;  1ZX3 A;  1M90 W;  4DV5 O;  2XAG A;  3OMA B;  3UQ8 A;  4LF4 B;  4K8Z A;  4JGS A;  1S0V A;  4CH4 A;  4X1I A;  4CS2 A;  2HVK C;  4JI4 O;  4H44 B;  1H2S B;  4K8X A;  5IWA B;  5F2V O;  2ZXW C;  4K35 A;  4DR1 O;  1US6 A;  4MVU A;  2UUC O;  5B3S B;  5IY5 B;  3L70 H;  4UVB A;  2A7W A;  3FD9 A;  1YEW A;  4ICG A;  3A0B Z;  2OCH A;  4KL1 A;  4JI1 B;  3OGC C;  2P6J A;  2W0X A;  1PNL A;  2CTQ A;  4J9Y B;  5L3G A;  4KHP O;  2M6Y A;  4H13 B;  4IYI A;  2YEV A;  2Y69 C;  2UXB O;  3BRC A;  2NN4 A;  4JAV A;  4J7Z A;  2EIL B;  4B3R B;  1Q8I A;  5A2Q N;  4GUN A;  2RMK B;  3OUS A;  2QWO B;  4B3S B;  1URF A;  1JFF A;  1Y74 A;  1HR0 B;  2X6C A;  2ITD C;  1CEZ A;  4IT5 A;  4FVM A;  3HB3 B;  4DV1 O;  3E8H A;  1VQ7 V;  2XAH A;  1H2G A;  4YY3 B;  1GO3 F;  4JI3 O;  1IX9 A;  5KMG A;  1SRY A;  4X20 A;  1PD3 A;  1ZUQ A;  4DYL A;  3SPG A;  3MAQ A;  4CS4 A;  2LGW A;  4Z2W A;  2P06 A;  4FLU A;  3SYQ A;  5IT9 N;  1IBL O;  2YIB D;  2Y4T A;  1EFR G;  4QNH B;  2QJ1 A;  3SGI A;  4O2A B;  1PL4 A;  2BOC C;  1SZT A;  2DQ0 A;  3L75 H;  3P30 A;  4CBC A;  1JOY A;  4UCT A;  5EZY B;  5J2T B;  2ZE7 A;  1LUW A;  1N32 O;  4GCZ A;  4GKK O;  3K57 A;  5C8Y A;  3CE2 A;  5IJ0 A;  3JCZ A;  1CXZ B;  1B06 A;  3FB8 C;  3CXC U;  2QE7 G;  5EBW C;  1F4M A;  1S72 V;  3SYA A;  1PM9 A;  2QKC A;  4DV2 B;  3T2M A;  4I50 A;  2WA4 A;  2E76 B;  5LL6 Y;  3JD0 A;  1S76 D;  4LF8 O;  2ZNI A;  1OJH A;  3H1J H;  3ASO B;  4EFE A;  1JQ0 A;  1OCO C;  4FZ0 A;  4B3T O;  4XDK A;  1FXH A;  5CB4 B;  4DUY B;  4LFA O;  1PP9 H;  2PI5 A;  2V4D A;  4BIO A;  5IE9 A;  1Y76 A;  2YI8 A;  2F1M A;  5L3B A;  3HKD A;  2JJ1 G;  1W59 A;  2FML A;  3RYF B;  3FAV B;  2EUL A;  1XQ8 A;  5GON A;  4NTW A;  2ZIM A;  4J41 A;  3G80 A;  4DW1 A;  5JJJ B;  3IGA C;  3J7A U;  2EZO A;  4CZZ A;  1MZE A;  4GZR B;  4DR2 B;  5D5Q A;  3QVN A;  2UXC B;  1EZJ A;  2P7T C;  1XDC A;  3O65 A;  3W7U A;  2LP7 A;  3AG4 C;  5KA5 A;  3CC4 V;  4JV5 B;  2LO1 A;  1SA0 B;  4X89 A;  4JI0 B;  4TSF G;  1NQT A;  1S77 D;  2YEV B;  1N36 B;  2JJ2 G;  3G67 A;  3BCC H;  1QVG U;  5AG2 A;  2AW9 A;  2RQ6 A;  1R3J C;  1YXB A;  1YI2 V;  3HKC B;  1IXB A;  1E1R G;  4BIU A;  2GUZ A;  3T4D A;  3F5T A;  4FJC C;  2EIK C;  1XNQ O;  2X6B A;  3MHH C;  2KG7 B;  4JI0 O;  4X62 O;  1RPO A;  2WAM A;  4HAM A;  3BA9 A;  4W4K A;  2CH7 A;  1D5A A;  4DV6 O;  1QLE C;  2ZT9 B;  2WLJ A;  1L8D A;  1U97 A;  1IBK B;  4I55 A;  3CXH F;  2N74 A;  3SJQ C;  1XBL A;  3L74 H;  5EBM C;  5IYZ A;  2XAF A;  4D7T A;  3VQX A;  4D7S A;  1N32 B;  5KHH A;  3I56 V;  3VQW A;  4I4T B;  2BOB C;  3CME V;  2QM7 A;  3CRA A;  2X0L A;  4QE7 A;  2BE3 A;  4NXN B;  4JI6 O;  3AG2 C;  3LSU A;  1HNZ B;  4LF5 B;  3RYH A;  4DK0 A;  3ASN B;  1KB9 F;  3WB1 A;  1D5N A;  1AR4 A;  4LFC O;  2YXL A;  3RVZ A;  4FFB B;  2AHY A;  2IW5 A;  4U7N A;  2ADQ B;  5H6R A;  1K73 W;  3ZED A;  5FNV A;  3G6B A;  2CE4 A;  2PGG A;  4OXS A;  1TA8 A;  1ROP A;  2PYJ A;  4MT8 A;  1V54 C;  5KUM A;  1ZL8 A;  1R3K C;  5BY1 A;  4TT3 G;  3N2K A;  1BT8 A;  1WA8 A;  3SPJ A;  1JVM A;  3KZI Z;  1B3Q A;  3M99 B;  5H9C A;  5L3C A;  1AVM A;  4JI6 B;  4LP8 A;  5KMG B;  3JAR B;  1KU9 A;  3JAS A;  4WF9 V;  1F23 A;  3X2Q B;  4UVA A;  1V54 B;  1EN6 A;  3BAA A;  1JX9 A;  1IBM O;  4WFH A;  4DRX B;  4GYC B;  4R6Z A;  1QHT A;  1AB3 A;  3IC9 A;  1KD1 W;  2F93 B;  3UM7 A;  1J95 A;  4PEL A;  4FZ1 A;  4YIO A;  3AG7 A;  1IDS A;  3UO2 A;  4BW5 A;  3CRQ A;  5EC1 C;  1YJN V;  4NVP A;  1FFX B;  3UT5 B;  4LF7 B;  2IJI A;  5DM6 V;  1M56 C;  2EIN B;  1OCR C;  3DGE A;  4DR1 B;  2UUC B;  4KXR A;  4LFC B;  3FB5 C;  3THO A;  2BTO A;  4DUZ B;  3ABL C;  3K3W A;  1BMF G;  1MA1 A;  1FS0 G;  1IVS A;  1BHB A;  1TUE B;  1BCC H;  4G27 B;  2Q7H A;  3CP1 A;  2YI9 A;  2VRZ A;  1X4T A;  3E35 A;  1Q7Y W;  1JR9 A;  1H8E G;  1I94 O;  1VEW A;  1KQS U;  3EFF K;  1P49 A;  4O4H A;  1H8H G;  2F66 C;  4NXN O;  4MVQ A;  3UCS C;  3ZHS A;  1Y6X A;  1FJG B;  5E79 Z;  3HKC A;  1T5E A;  2F95 B;  2G38 A;  5BZB A;  1XHZ A;  5C8Y B;  3E8B A;  2Y48 A;  1OV9 A;  5IJ0 B;  5A9G A;  3ABK B;  5IJ9 B;  1SQP H;  3Q4H A;  5B5E Z;  4DV3 B;  2BTQ B;  1L0L H;  3MDS A;  1P84 F;  3FKS G;  4ZKI A;  1QU7 A;  1IBM B;  1SQF A;  5B66 Z;  4PA4 A;  5LYJ B;  1TUB B;  1DLB A;  1FXK A;  2UU9 B;  5J2U A;  4DR5 B;  2W0F C;  4DV6 B;  1FXV A;  1QNM A;  1RM1 C;  5LA6 B;  2GSM B;  1XRE A;  4K0K O;  2Z5U A;  3W7T A;  2Q6A A;  1GKF A;  3OR6 C;  3H1I H;  5IYC O;  3HR0 A;  1IBK O;  3A2F A;  2M7W A;  3N2G A;  3QO5 A;  2Q0A A;  4NTX A;  2ZM6 B;  2KG7 A;  4JYB A;  2P22 C;  1KMI Z;  3JCU Z;  3CJH A;  4LH7 A;  4FK5 C;  1EBO A;  3FB7 C;  3U11 A;  2VQE O;  1NR1 A;  3GVM A;  4ZI7 A;  4YHH B;  2PUS A;  2NLJ C;  2DOS A;  4U7O A;  4AQY B;  1Q81 W;  2ITC C;  1OCC C;  1CP9 A;  2WLK A;  2RDC A;  4FM1 A;  3ZMT A;  4X65 O;  2H3O A;  2QDO A;  1OCZ C;  1K3E A;  4DV7 O;  1XNR B;  3L72 H;  3FFQ A;  4AQY O;  3ZHQ A;  2Q8V A;  2JDI G;  5IYZ B;  1GM8 A;  1F4N A;  1FFT B;  1TVK B;  4JYA O;  3SR2 C;  5LMU O;  5H6Q A;  5CA1 B;  1Z5V A;  5BMV B;  1ORQ C;  4DW0 A;  2Y0I A;  3BFR A;  4FPP A;  3E22 B;  5KLV H;  1BS3 A;  4P9O A;  2YXH A;  4ASU G;  1QQC A;  5HFL A;  3K9S A;  1R6T A;  2CH7 B;  4CC6 A;  4WBN A;  1J5E O;  1P7G A;  2GTA A;  3ZMU A;  2P67 A;  4LFA B;  3VQV A;  4CH6 A;  2ZE6 A;  1H2K A;  3K9A A;  2JK5 C;  3KG2 A;  3ZMS A;  3STZ C;  3ML0 A;  3ZRV A;  4C7U A;  4YJ3 A;  5KHJ A;  1A32 A;  2ETN A;  1COW G;  1ZL8 B;  1RSO B;  3SDL A;  2FB5 A;  3B40 A;  2QTO A;  1NVP B;  2UXN A;  3OFN G;  3C90 A;  5B1N A;  3RYC B;  4I0X B;  1E1Q G;  4O4H B;  3K0G A;  5K1P A;  1WJZ A;  3OE7 G;  2EIN C;  3AEI A;  3T1C A;  3O9O A;  3I55 V;  4MW3 A;  3K04 A;  1V55 C;  3CS5 A;  4MVS A;  1GN2 A;  3E2E A;  3EVK A;  3JAT A;  1GH6 A;  4DR4 B;  1PNK A;  4J9Z B;  1VQK V;  1SQG A;  3Q4H B;  2PTM A;  3HKB B;  4PA6 A;  2BSK B;  2CGO A;  2HHH B;  1R6N A;  3B8M A;  4LF6 O;  1NTZ H;  3QO7 A;  3CC7 V;  2IJH A;  4FLZ A;  4KHP B;  3AG1 B;  3CCQ V;  4B3M B;  3P3N A;  4QE9 A;  1AJN A;  2UXB B;  4WFE A;  4EB6 A;  1Q5O A;  2WLM A;  1J5E B;  1B04 A;  1Q86 W;  4YY3 O;  4PD4 F;  4JAU A;  3ZRW B;  1XNR O;  4DR4 O;  2YIC A;  3AK1 A;  4B08 A;  4ZIB A;  2AZ2 A;  4X65 B;  1WB7 A;  5JJN B;  1KYO F;  5LYJ A;  4UXN A;  2HP8 A;  1K4D C;  2CTW A;  4XBF A;  4UCR A;  2MW2 B;  4I9W A;  4Q20 A;  2WPD G;  1U96 A;  5EIB D;  4FLT A;  2JGU A;  5IJ9 A;  3W7X A;  3CC2 V;  2KSD A;  2YUA A;  3B77 A;  5IY5 C;  1QBZ A;  3UO3 A;  4D6T H;  4GX2 A;  4JPR A;  1N34 B;  4ZBM A;  4NYK A;  4PV1 B;  4XDJ A;  3QNE A;  1YHQ V;  5E1A C;  4GT1 A;  1K9M W;  1XI1 A;  2RJZ A;  3VOU A;  1XOU A;  2B5U A;  5FLX N;  1LUV A;  3SPC A;  3J81 N;  4X64 B;  4HBN A;  2Q73 A;  1SZX A;  3CRC A;  1VF7 A;  3JSN A;  3AG4 B;  3AG3 C;  3JYC A;  5JQG B;  2GTS A;  1TGO A;  2ODM A;  3U10 A;  3OTO O;  4OGQ B;  2R70 A;  1XL6 A;  1GN6 A;  4X1I B;  2QEX V;  4JF3 A;  2DE0 X;  2DYR B;  2JS3 A;  2LGQ A;  3BAB A;  2UUA B;  2Q7E A;  1SQB H;  3AG3 B;  2LFS A;  4QPJ A;  4YIP A;  4HNA A;  1Q82 W;  1WP7 A;  1R3I C;  3SJA C;  1G6U A;  5LP6 A;  2ZD9 A;  4CH3 A;  4DV5 B;  3KCX A;  5BMV A;  1YJ9 V;  5L3E A;  1KKD A;  1NH2 D;  3T1Y B;  1JCH A;  2ZR3 A;  5LP6 C;  1VP7 A;  1VF6 C;  4MTG A;  3SPI A;  3CJH B;  2AGA A;  3TXQ A;  1SES A;  1XMQ O;  2HJD A;  4O4L B;  1FPO A;  1R3L C;  2ZQM A;  1M5I A;  1SET A;  4K0K B;  5IYD O;  5DN6 G;  2WLI B;  3BPZ A;  3ZN0 A;  2ARH A;  4IYH A;  1KC8 W;  2EIL C;  1JFF B;  1Y74 B;  5EC2 C;  3APQ A;  1DF5 A;  4PDV A;  2EX3 A; 
#chains in the Genus database with same CATH homology
 1SQV H;  5KLV H;  1NTZ H;  3CWB H;  4D6T H;  1BCC H;  3H1J H;  3L72 H;  1L0N H;  4U3F H;  1KYO F;  3H1L H;  2BCC H;  1SQP H;  1NTK H;  3H1I H;  2FYU H;  1L0L H;  2A06 H;  1BGY H;  1P84 F;  3L73 H;  3H1K H;  1PP9 H;  1SQX H;  3H1H H;  1BE3 H;  1EZV H;  1SQQ H;  3L71 H;  2IBZ H;  1NTM H;  1KB9 F;  3BCC H;  1NU1 H;  3L70 H;  1SQB H;  1PPJ H;  4PD4 F;  3CXH F;  3L75 H;  3L74 H;  3TGU H;  3CX5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...