4PDVA

Structure of k+ selective nak mutant in barium and potassium
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdvA00
2WLIA 4I9WA 5KUMA 1ORQC 1QLEC 3ABLC 3E8BA 3LNMB 4JTAB 3SYQA 4UUJC 3E89A 4MSWC 2WLLA 3BEHA 2WLJA 3OUSA 4R7CA 4X88A 4PA4A 3UKMA 3F5WC 4G28B 4MW8A 4P9OA 2IH3C 3JYCA 1OCCC 4MVZA 1V54C 2WLKA 4R50A 2K1EA 4F4LA 3ABMC 5EBWC 3E83A 4ZBMA 1JVMA 3AG3C 3F7VC 2A9HA 3VOUA 1LNQA 3K0DA 3SYOA 4GX1A 4WFFA 1OCZC 4QNHB 4TWKA 3OUFA 3SPJA 4PDRA 5EBLC 2A0LA 3SYPA 1OCRC 3TCUA 3LDEA 3SYCA 1M57C 1XL6A 2WLHA 4J9ZB 3SYAA 4PDLA 4RAIA 3FB7C 2X6AA 4MVRA 3STZC 1M56C 1G4YB 2ITDC 3RVYA 3FB6C 3SPCA 3PJSK 4PDVA 2NLJC 4P9PA 1K4DC 2AHYA 3ASNC 3ZRSA 2Y69C 4GX2A 3E8HA 4MS2A 4MVSA 4PDMA 3SPIA 3ZJZA 2WLMA 4GX0A 4QE9A 3HPLC 1S5HC 2A79B 2Q69A 3GB7C 3RBZA 3T1CA 2R9RB 2ITCC 4MW3A 4R8CA 3K06A 3T4ZA 2P7TC 5CBHA 3SPGA 2EILC 2OCCC 4JTDB 1R3KC 2HVJC 4QE7A 5B1BC 2Q6AA 2W0FC 4H33A 4HZ3A 4J9YB 4MVUA 2YEVA 4PA7A 2DWDC 4LP8A 4R6ZA 1BL8A 2X6CA 5B3SC 4P2ZA 1V55C 3AG2C 4X89A 3T2MA 5KUKA 3RW0A 2HFEC 3ABKC 5EC2C 3K08A 4MVQA 2WLIB 5EBMC 4WFGA 3OR6C 2AHZA 3AG1C 2ZXWC 3OR7C 2DYSC 4RO2A 1K4CC 3K03A 2WLNA 2X6BA 3UM7A 2BOCC 4XDKA 5J9PC 3TETA 2EIMC 1OCOC 2WLLB 2DWEC 4X8AA 4DXWA 3T4DA 2HG5C 3E86A 4MVOA 4RUFA 3ASOC 3R65A 3F7YC 2EIKC 2BOBC 4XDJA 3OGCC 3K04A 3LUTB 4PA6A 4MTGA 4BW5A 4HYOA 4MTOA 2Q68A 2ATKC 5E1AC 2HVKC 1ZWIC 4KFMA 4PA3A 3EFFK 5EK0A 3STLC 2ZD9A 3IGAC 3WG7C 2DYRC 1R3LC 4PA9A 3X2QC 2EIJC 5EC1C 4OXSA 3RVZA 2Q67A 5B1AC 3LDCA 4H37A 3SJQC 5CBFA 4CBCA 5IY5C 4MTFA 2IH1C 2QTOA 5BZBA 3E8FA 4G27B 2HJFC 3LDDA 4LBEC 2EINC 4RUEA 4EKWA 1P7BA 3AG4C 2H8PC 2QKSA 3FB5C 3FB8C 4WFHA 4GX5A 4P30A 2KB1A 3K0GA 1KKDA 3KG2A 1J95A 5CBGA 3IFXA 3SPHA 1R3JC 4LCUC 4WFEA 1XL4A 3E8GA 4JTCB 4XDLA 2JK5C 4MVMA 1R3IC
chains in the Genus database with same CATH superfamily
2GDSA 3ETEA 1TUEB 5DN6G 2JRIA 1HNZO 3OT7A 2F95B 2PYLA 1SQGA 3ETGA 5CB4A 4DV1B 1W59A 4O4HB 1VQ8V 2MW2B 3LNNA 4RQEA 3JASA 3K0DA 2V7QG 1P4RA 2FB5A 4O4JB 5KMGB 2DN9A 2JS3A 2QKAA 2RDCA 1ZAUA 1BHAA 1MZEA 2QDOA 5KHHA 2WLHA 3SYCA 5ITZB 2JDIG 5CA1B 2JGDB 5B1AB 1G4YB 4X1YA 3JAKA 1P49A 3CSXA 1NR7A 3PJSK 4PDVA 4P9PA 4DR3B 4DV0B 3F5TA 1COWG 1Q82W 4MS2A 4PDMA 2JVDA 1HP8A 1FFXB 1VF6C 1FXHA 4CH6A 1XREA 2YIAA 3A0RA 3CRCA 4DR7O 5CA3A 3P32A 2ZE8A 4AQYB 1NZ6A 4LP8A 4BR6A 5B3SC 4DR1B 3A2FA 1VP7A 2BSKA 4JI1B 1I7FA 3I5DA 1I08A 2ADQB 3TETA 1OCOC 1SF9A 3RYFB 5IYBO 4F6RB 4QPJA 5CN0A 2FTKA 3ZMSA 1MSDA 2WPDG 1XMQB 3MD0A 4MTGA 1EN4A 3FD9A 4DV3B 1N32O 2ATKC 4KUMA 2CGNA 4LNUB 3IC7A 1H2GA 4GT1A 4JYAB 5IDJA 3TXSA 5IY5C 2IJJA 1SA0B 1N33B 3L70H 1MSWD 3BHPA 4G27B 3L75H 1I94B 5LP6C 1GN4A 4I55B 1S5JA 1J95A 1WP8A 1AVMA 2QM4A 1MZFA 2IU0A 5B1OA 1IURA 1N8RW 3QF7A 1KU9A 4R7CA 1V55B 2P6JA 4FM2A 3HKEB 2R9IA 3JASB 5IWAB 5DECA 3P3NA 1WB8A 3ZRVA 5E79Z 4JI0B 2EIKB 2N04A 3MAQA 3DXRA 2UXDO 3JAKB 3O65A 4PDRA 5H2FZ 4LH6A 1NVPD 3E22B 1XMOB 2EJ7A 2DYRB 4RAIA 5HFLA 4B3TO 3FB6C 3AK1A 3EVKA 4DV2B 4LF7B 1HNWO 4X1KA 1P7GA 3OEHG 4GX2A 3OE7G 1H38A 2CTWA 1RM1C 3U10A 5LL6Y 3RYCB 4FLXA 5IJ9B 2Y0IA 1Q6IA 1XILA 3SGIA 3A8TA 3K9SA 3CS5A 3HB3B 5JJJB 1ENVA 3VQXA 1JFFB 5JCOC 4GKJO 5L3CA 3JAWA 2BOBC 5LP6A 2XAHA 5B1NA 1LUWA 4B7KA 2UXBB 2LW1A 3JCZA 4DV4O 1VQNV 2OTJV 1AJPA 1BCCH 4DUYB 1SRYA 3G80A 2Y4UA 4JTAB 3I56V 4UUJC 4MSWC 2BTQA 2JJ1G 2PYJA 1O9GA 2P90A 1M90W 2AZ0A 1SZTA 2UUAO 5L3BA 5BMVB 3OTOB 2XAGA 5J2TA 3DXRB 1QR9A 3DC5A 4LF8B 3ZMVA 3E83A 4I4TB 5KX5B 2JEXA 2A9HA 4YY3B 1VQ6V 1S77D 3CMEV 2DE0X 3TK1A 3OUFA 1IBMO 1XNQO 5EBLC 2A0LA 3G6BA 2XTAA 4X1KB 2CH7A 4TOIA 2EZOA 4U3JA 4JI8O 4UFZA 4BW9A 1GRJA 3CXHF 2X7RB 4BIOA 2Z0AA 2B5UA 1ZLZA 1YI2V 2R9RB 1VQ9V 3CEIA 2QTSA 1R3KC 4YJ3A 3K5LA 2ZIMA 1SERA 1WP7A 2RMKB 5JCOA 3H1KH 2YI8A 3W7TA 4MVUA 2D3OW 4X64B 1Y6XA 1KP3A 3T2MA 3G67A 5JH7B 3ABMB 5KHKA 5LP6B 1SQPH 2ZNIA 3BABA 5J9PC 2WLNA 2WLLB 2Q9LA 4B08A 2H3OA 2PI4A 2BCCH 2FMLA 4FK5C 1IVSA 5FNVB 3JD3A 2KKWA 3CX5F 4JYCA 3B09A 2HLDG 1AR4A 1BQZA 1K8AW 1AILA 3ZEDA 1BHBA 5K1PA 4FLWA 3I55V 1AI4A 3CCLV 1P7BA 2QM8A 4J7ZA 1FJGO 1DF5A 4GKKO 1JA8A 2P4VA 5B1BB 1GK9A 3CCRV 4UXNA 2FYUH 3FAVB 1EBOA 1FXVA 3RWRD 1R1BA 3N2KA 3JD1A 4LC1A 1Q90D 4IHJB 4W4KA 4E4EA 4I50A 3VQYA 3F5WC 1S3JA 4JI4O 3G4SV 3TXQA 1PPJH 5IE9A 5LGUA 2CH7B 5LOVB 3JATA 1IXBA 4WFFA 4EB6A 4DUZB 4LFCB 3HR0A 1KP2A 3ZBHA 4LF6O 1SQQH 4O4LB 4GLXA 4LR3A 1M57C 3K58A 1JX9A 4FJCC 2X0LA 3GVMA 2LP7A 1AJNA 3AK3A 1YZBA 4QE9A 3RYHB 2A79B 2JJ2G 1TGOA 1WA8B 2EILC 3CRMA 4N21A 3JD0A 1Q6UA 2YEVA 1BL8A 4Q20A 1CXZB 4YIPA 2HFEC 1IBLB 4JI2O 4NTXA 4MVQA 3UM7A 2DYSC 3J81N 1BSMA 3W7XA 3WB0A 2OIGA 4PA6A 4B3MB 1FAFA 5E1AC 5LMNB 1ZWIC 3M99B 4X20A 4LF9B 3OAAG 2CTRA 5B1AC 1KD1W 4NXNO 1K9MW 1EFRG 4MTFA 5JQGA 2HJFC 3LDDA 4RUEA 3EXAA 3BCCH 3N2KB 1AR5A 1ZL8A 1AJQA 4I50B 1VQMV 2Z3YA 3OMAB 2IJHA 1W0KG 2EBOA 3QO5A 1M9NA 1AB3A 4JYBA 3AG7A 4MVZA 4KP4A 3VQVA 4FVMA 4ZBMA 1JVMA 1HWYA 2WAMA 1OZ0A 1R6TA 5GW7A 3WG7B 4GUNA 2ZKOA 4JZGA 4MVRA 4DV7B 2VQFB 2UUBO 5LA6A 1E1RG 4KHPO 1XHZA 2NLJC 4KL1A 4EEQA 2ILMA 4MVSA 4JAVA 1GN2A 4NYKA 2E75B 1FS0G 5EZYB 4DR2O 1K73W 2P7TC 4B3RO 1QVGU 2HKOA 4JF3A 4O4HA 3ZHUA 4D6TH 4HZ3A 2ZINA 1RFYA 1PKXA 3K5OA 1EM1A 4G2KA 4O4JA 5KMGA 3JARA 1V55C 1JCHA 1KUQA 2Q8VA 1HNZB 3T1HO 4FIPC 4PELA 1L8DA 5ITZA 5CA1A 5FL7G 2JGDA 4XDKA 4OPAA 4IL6Z 4BAYA 5AG2A 4E2LA 4X20B 3OW2U 2EIKC 3ICXA 4J41A 4BW5A 2Q68A 1FFXA 3STLC 3IGAC 2NR5A 4YHHO 2DYRC 3LDCA 1K3EA 2Y69B 1WB7A 3ZHTA 2H94A 1N4CA 4LF4B 2QGNA 3BFRA 1QLEC 2ODMA 4F6RA 2N05A 5L3GA 1K5SA 2AXTZ 4FMTA 1YDXA 4B7EA 3J80N 4J11A 5H6QA 4EFBA 4WFAV 2K1EA 1AROP 2F23A 4FLTA 4LNUA 1YITV 1LNQA 1U96A 4NR1A 5KLVH 4K8ZA 4QNHB 5H6RA 1QCEA 2F93B 5BY1A 1XHXA 2HHHO 3P30A 3CRQA 4OX9B 4I55A 4JI5B 4UVCA 3T1YB 4FM0A 1NS1A 1KQSU 2AW9A 5IYCO 2XASA 1Y4MA 2DYSB 4GX0A 4EFEA 3HKEA 2PY5A 3RBZA 1IBKO 4JZ2A 3L71H 2WA3A 3JARB 1GM8A 1QVFU 4JAAA 1PNKA 1K34A 1WAZA 3ZHVA 3RW0A 3E22A 3E2EA 3ABKC 1QBZA 5BR8O 2AHZA 2JIZG 4X66O 1N34B 1GN3A 4MTXA 4PD4F 2GUZB 1JOYA 2LGQA 1OCRB 1OHHG 1UFIA 4KFMA 3L73H 2UXDB 1MOFA 3N2GB 4OXSA 2YICA 3RYCA 1ROPA 4B3SO 5IJ9A 2IH1C 5C8YB 1NH2B 2NN4A 1AI6A 3E8FA 5J2UB 4UCSA 2VS0A 5LGTA 4B3TB 3KG2A 1SKVA 1YIJV 1IX9A 2AGAA 1Z2GA 5C93A 1TVKA 1XUQA 1B3QA 1N0JA 1R73A 1KB9F 3E89A 1YVWA 1JFFA 3H9VA 1XOUA 1R6NA 3RFRA 1YJNV 3DSQA 1SESA 4UCOA 1THZA 1RPOA 3JYCA 1AP5A 4HBNA 1O9HA 2ZE7A 4F4LA 1NTZH 3ABMC 1PNLA 3BVOA 4OGQB 3K9AA 3QO7A 5LBQA 1IDSA 1JQ0A 2QR4A 4JASA 2DQ3A 1RPRA 1M4UA 2RJZA 3KZIZ 1FD9A 1PM9A 4LF5B 1YXBA 2P22C 2X6AA 1D5NA 4J10A 4WFBV 1YF2A 3M8AA 3B2EE 1K7DA 5LMUO 4Z2WA 2YIBD 2Q69A 2YUAA 3N27A 3ZN1A 4W4LA 5BMVA 3QNEA 1NTMH 4JV5B 4DV4B 5B1BC 3CMAV 1LUVA 5JWPA 2QWPB 4PI2A 3CYOA 1V9PA 3P3PA 1VF6A 4DR3O 4I4TA 3QO8A 5KX5A 1Q3EA 2E5LO 3ZHSA 2G38A 3AG2C 1L0NH 1FFTB 3K08A 2Q73A 4WFGA 4UCRA 1BT8A 1QLEB 1VF5B 3SDLA 4NTWA 2UU9B 4UVAA 2EJRA 3ABUA 5EK0A 4JI1O 3CJHB 1QHTA 3CE2A 3M7MX 3ZMZA 1IBMB 5CBFA 4X62O 1K97A 2QTOA 5BZBA 1RSOB 1TVKB 2MK3A 2QKCA 1SC5B 5KAFZ 5L3FA 3K0GA 4JI8B 1R3JC 2V4DA 1HR0B 2VQEO 2JK5C 5JH7A 1AR1B 3JAMN 4IYIA 3LNMB 2WLLA 2LGWA 4CS2A 4FLYA 3UKMA 5FNVA 1OCCC 1S5LZ 4C7UA 1K92A 1Q86W 3MDSA 3CC4V 3ZRWB 2HR3A 2QJ1A 5IWAO 3OM3B 4U7NA 1JMKC 4JI7B 3H01A 3X2QB 3FAVA 3ABKB 3CWBH 1VARA 1XI1A 3CC7V 2GHYA 3E8HA 4IHJA 2XT9A 1Q8IA 2GTAA 2IW5A 3GB7C 3QTCA 1Y76B 2EULA 4KXRA 3DTUB 1MABG 4QE7A 1Q5OA 2XUMA 2Q6AA 4X9QA 3SJAC 4J9YB 4GKKB 2CDYA 4J80A 2L35A 5LOVA 4ZOLB 3CP1A 2E76B 1FXKC 2JEUA 4O4LA 1GN6A 2GV9A 4ZKIA 2ZCEA 3ZS8C 3AG1C 1XNRO 1GM9A 4IGGA 1XEQA 5CA0B 1K33A 2V1DA 3K04A 3MHSC 1Q81W 3JCUZ 2LFRA 3CC2V 3RYHA 3WG7C 3LSSA 1WA8A 3LSUA 4ICGA 2YS8A 2ZM6O 3RN4A 2UXBO 3FB8C 5CMUA 4ZIBA 2QKSA 1G8MA 1WPXA 4ASUG 2DMXA 5CBGA 1G1XB 1WN7A 1XL4A 5GTIZ 4AHCA 2DW4A 1YTFB 3ABLC 2YIBA 3SYQA 4FLZA 5KHGA 4LWSB 4G28B 4MW8A 5D5QA 1VQPV 4IIJB 2ZDIC 3ETDA 3U11A 3WB1A 4JI2B 1D5AA 4TWKA 4F6EA 3SYPA 2R70A 2PUSA 4J9ZB 1NQTA 3AG2B 4YY3O 2F43G 4FZ0A 3RVYA 3B40A 2Y69C 1N0NA 2M7WA 2WLMA 5TISZ 3H1LH 1WPBA 1FXKA 2L6LA 1VQ7V 4DV6O 4QGPA 2F1MA 3QVNA 2UUCO 1XDCA 1KC8W 3C3TA 1E1QG 1DK1A 2IU3A 5A9GA 1ZUQA 3APOA 2LFSA 5EBMC 2WLIB 3ZRXA 1Z5WA 4LFAO 1NH2D 4DW0A 2Q7GA 4DR6O 2X6BA 4XBFA 5LGNA 2UXCB 2BE3A 1YSCA 5JVDB 4X64O 3OGCC 1Y66A 1H2SB 1M5IA 1B6QA 4FLUA 5EZYA 3ZX6A 1GH6A 1KECA 4PA9A 4GYCB 2EIJC 1OCCB 2E3CA 5KA6A 4LFBB 1GO3F 2EINC 2XAFA 2UUBB 2WWWA 1Q7YW 2HP8A 4KHPB 2HEPA 4DR4B 3SR2C 2ZDIA 1J5EO 2GBOA 1R3IC 4AILC 3ZHQA 4X65B 2BTOA 1SQVH 3ZMTA 1CPYA 3RYIB 1DLBA 2WLJA 3UO3A 3C90A 4B3RB 4NB5A 1EN5A 3HKBA 4CH4A 3KKYA 2ZXWB 1Y74B 2HJDA 4IT5A 3VBBA 3VOUA 3W7WA 1IXMA 4L8JA 3T1HB 4DRXB 1OCRC 1TUBB 3SYAA 3JD4A 3ZCCA 2P06A 2A06H 2OIEA 4DV5B 2ITDC 1FXKB 2OT5A 4LFCO 4FFBB 1K4DC 4GZRB 3G71V 3B8MA 3AG1B 4YHHB 1GMGA 1VQ5V 1VQLV 1YHQV 1NU1H 3BY6A 2EX3A 4O2AB 4A5UB 1RP3B 3UT5B 1Q43A 1PP9H 2VWKA 4OPHA 1XQ8A 1ZTEA 1W2BU 1NI8A 4Z1VA 1IZ3A 1V54B 3PN1A 4X89A 5JJEB 4AI8A 5EC2C 1A32A 3HKDA 3OR6C 1S72V 2QWRB 4DXWA 2RNBA 3F7YC 1YJWV 4QJFB 1KMIZ 1JJOA 2RN9A 3ABLB 2F4VO 5H5NA 2QWQB 5LHHA 2HVKC 4PA3A 1DF4A 4PV1B 3OGIB 1SZXA 3CCSV 4DR5O 2ZR3A 4BIUA 1BMFG 2HHHB 3D3IA 1AI7A 3W7UA 4B3MO 1BE3H 2IJIA 2H8PC 4U7OA 4P30A 2Q7EA 1U97A 4JTCB 1VMGA 1D2DA 3CCQV 3HKBB 5KUMA 3RT3C 3VQWA 2P67A 4J7KA 1IBKB 4TV9A 1HW7A 3BEHA 4FPPA 2GUZA 1QNMA 5GTHZ 4YIOA 1MMMA 3CCUV 3H1JH 1Z5VA 4H0LB 3N2GA 1N36O 3GWKC 4K35A 2ZQMA 2N74A 2AZ2A 2CK3G 1HDJA 3TJTA 5BR8B 5C8YA 2JGUA 5J2UA 5KAIZ 3TCUA 3OEEG 4Z1MG 4NXMO 3S3WA 4DR7B 4TUYB 3ZRSA 3C3SA 1KBHA 4ZI7B 4CH3A 3T1CA 4DV7O 4R8CA 2YIDA 2PGGA 1QR8A 1F4MA 4PJ0Z 4H33A 3K79A 3R66A 3HKDB 5EIBC 1FKAO 2EIJB 2DWDC 3JALB 5KUKA 3CCMV 3NXSA 1N32B 1W0JG 2EINB 1F51A 4K0KO 1YEWA 2OCHA 1NTKH 5DEDA 2A3QA 2CTPA 4MT8A 1DGSA 2DJVA 1BS3A 1YTFD 4UVBA 2IJKA 5IJ0B 5L3DA 2Y0PA 1HNXO 3RGBA 3X2QC 5GONA 3SJBC 2Q67A 4NVPA 4ZHQB 4I9QA 3CRRA 3ML0A 3D36C 3FB5C 4WFHA 4TV9B 3THOA 4YJ2B 4LCUC 2FKXA 5LMUB 2DQ0A 4JI6O 3OUSA 4ABMA 4FLVA 1BZKA 4DO2A 4JI3O 4LF4O 2WLKA 4R50A 3WB2A 4I5SA 3IJ4A 2E5LB 1NKDA 3CJHA 5EBWC 4HNAA 3F7VC 3AG3C 3ASOB 1BGYH 1HNWB 3SPJA 3B8NA 3W7SA 1RSOA 4K8XA 4CH5A 1GKFA 1X59A 2YSUB 4O4IB 2XAQA 3FKSG 3D8CA 5IT9N 3B77A 4DYLA 2AHYA 4CS3A 3AG4B 2PI5A 3AK2A 2CTQA 2XOKG 1S5HC 4OX9O 4JI5O 3ZIAG 4X62B 4MW3A 3T1YO 3IC9A 5D5PA 3T4ZA 5EYPA 4JTDB 4H44B 4I7ZB 2B1IA 3UQ8A 2XAJA 2ETNA 4DV1O 1I5YA 5IYZA 2A7WA 3Q4HA 4GKJB 2VQEB 4PA7A 4UCVA 3MHHC 2ZIOA 3NR7A 3ZRWA 2ZE6A 2LO1A 4J7JA 4JPRA 4J42A 2RQ6A 4RO2A 3GWOA 3K03A 1WJZA 2EZPA 4WBNA 2BOCC 1OCZB 2DWEC 4JYYA 4MVOA 5FPRA 1GTOA 5GONB 3D36A 5CB4B 1URFA 2P5OA 3U0ZA 4CBCA 4DV0O 2CE4A 3BA8A 3EFFK 2W6IG 4CC6A 1AP6A 1Y76A 1N34O 1R3LC 4CZZA 1KYOF 2WA4A 1PL4A 2XHBA 1M1KW 1VQOV 3G6EV 4ZOLA 2KB1A 2B9ZA 2UUAB 3SPHA 4X1YB 2OCCB 4AQYO 4TQFA 3FB7C 3APQA 5LHGA 4DR1O 2Y4TA 1JJ2U 1H2KA 1ORQC 2LQTA 1PD3A 4RWUA 3K59A 5CA0A 3H1HH 1L0LH 4UCUA 3EHBB 4PA4A 1AI5A 4HNAB 4P9OA 1I0HA 5HFMA 1XNQB 2IH3C 3B4SA 2JS5A 1XMQO 2EIMB 3ZN0A 2UXXA 4DV3O 1M93A 3SYOA 4GX1A 4DK1A 4D7TA 3WU2Z 5IYDO 3CCVV 1WLEA 3FYEB 1XNRB 4JAUA 4JYAO 5B66Z 2BSKB 1SS3A 1XL6A 3HKCA 1NJIW 1N33O 4PDLA 1YJ9V 4H13B 1I94O 2QA4V 2KG7A 2Z5UA 4TQDA 2CAZC 5EYPB 1VIBA 4N23A 3QG5A 3DC6A 4LF5O 1MNGA 4LWSA 1H2MA 3O9OA 5IYZB 3Q4HB 1UPGA 4UCTA 5CBHA 2ZM6B 4IIJA 3L74H 1PV0A 4CS4A 2W0FC 2K9PA 1EN6A 1US6A 4WBNB 2YXLA 1Q6HA 4JI0O 1MA1A 1T5EA 1VEWA 4JV5O 2GSMB 1MG1A 2ZXWC 3OR7C 1XMOO 5KA5A 3J7AU 3CB2A 3JSLA 2HG5C 3L72H 4XDJA 1GAXA 2R9AA 3H1IH 3KCYA 4HYOA 4DV2O 4LF7O 1FJGB 1SETA 2E74B 1PL0A 5F2VO 2R72A 3OTFA 3FFQA 4H37A 3CXCU 5L3EA 4LH7A 4PI0A 3AG3B 4QPKA 2WSSG 2UU9O 2RCVA 4JI4B 3JSNA 2WLIA 1Y67A 3IAYA 1VF7A 3E8BA 3ZHRA 2Y48A 1PNMA 3BAAA 5B3SB 5FLXN 2YXYA 4DV6B 2OWOA 5JVDA 2QE7G 4LF6B 3OMNB 2W6JG 4FZ1A 1HR0O 1V54C 1FPOA 2UUCB 3ZMUA 1OCOB 1FYJA 4DW1A 3HKCB 5B5EZ 1EZJA 1WNSA 2DOSA 2PZSA 2F66C 4L87A 3CPWU 2QWOB 2KG7B 4LFAB 4DR6B 1EZVH 5LXTA 3LDEA 4UV8A 1YCIA 2P4KA 1LR1A 3STZC 3OD4A 1M56C 5IY5B 1SQBH 1JPXA 1H2NA 3SPCA 3JAWB 4DUYO 3ASNC 3RYIA 1QU7A 4JI7O 1F4NA 3HPLC 4X1IA 3OMIB 3FYIB 2HVJC 3L9DA 4O2BA 1Y74A 2M6YA 3OTOO 4D7SA 4RQFA 1H2LA 1J5EB 1SQXH 4LF8O 3DGEA 4DRXA 1TUBA 3AEIA 2YDEA 5LYJA 1X4TA 4IYHA 2BTQB 4NXNB 3T4DA 4BWAA 3R65A 4FFBA 3CHXA 3JD2A 4YXWG 4UB8Z 3LUTB 3K5NA 5J2TB 2LJ2A 1TAEA 3LSQA 1ZX3A 4O2AA 3UO2A 2YC0A 3UT5A 2ZR2A 5H9CA 1S76D 3A0BZ 3TGUH 1RM1B 1KKDA 1DTOA 4U3JB 1S0VA 3E8GA 4XDLA 4I9WA 2QM7A 2PTMA 2IM9A 2FL4A 4YJ3B 2UXNA 4GCZA 5LXTB 2D2CB 1QLNA 3D3QA 1ZSPA 1UJWB 2ZE5A 4TV8A 4DR2B 2IBZH 1K5QA 4X1IB 2ADPA 2F4VB 3S3XA 5KHIA 1H8HG 4O2BB 3BA9A 4WCEV 2ARHA 1L1FA 4DR5B 4DK0A 2ITCC 5DM6V 2Q0OC 3SPGA 1NVPB 3CCEV 1R6KA 1H8EG 1JR9A 1F23A 5JJNB 1NR1A 5LYJB 2Q5ZA 2QSAA 3CCJV 4WF9V 1XBLA 4FFKA 4R6ZA 2X6CA 4PHZA 4DUZO 1CEZA 2XNDG 1TA8A 1VQ4V 2PF4E 1K4CC 4TT3G 2YXHA 4RUFA 3K5MA 3ASOC 4TUYA 2QWNB 2C2AA 4MTOA 1N36B 3KCXA 4CC5A 4ZI7A 4K3AA 2ZD9A 3WFVA 1I5XA 2NNUA 5A2QN 3CD6V 3ETQA 2YI9A 3JATB 4EB6B 3SJQC 2O57A 3A0HZ 2QEXV 2UXCO 3E35A 4NXMB 3AG4C 3JALA 4I0XA 4WFEA 2KQXA 4MVMA 1CP9A 2W0XA 4LFBO 2LW7A 1IBLO 5FPOA 5LHIA 3SJCC 3K3WA 1M56B 3K57A 4X88A 5EIBD 2Q0AA 1SQFA 2ZNJA 3ABTA 4DR4O 1E79G 3ASNB 4X65O 2OTLV 5IJ0A 1B04A 3UCSC 4TSFG 4NTYA 5K1XA 4JGSA 4UB6Z 2OYQA 1G6UA 4TV8B 5LMNO 2YEVB 3OFNG 4ZHQA 1OCZC 2CUGA 4LF9O 2B1GA 4K0KB 1KKCA 4FM1A 2Q7HA 4YJ2A 4UV9A 1HNXB 1VQKV 3SPIA 3ZJZA 2CGOA 3BPZA 4DV5O 4BIZA 2OCCC 4U3FH 4NKGB 1OJHA 4X66B 2VWJA 5JQGB 4HAMA 1ZL8B 4JI6B 4P2ZA 1F7YA 1NBMG 4O4IA 2Q4PA 1NT2B 2EIMC 4X8AA 4JI3B 3E86A 5BXZA 5KHJA 4B3SB 2VQFO 1B06A 2GTSA 1M57B 4QIWF 3RYFA 1BQ0A 1QQCA 4Q6GA 2ZT9B 5EC1C 3RVZA 4I0XB 2VRZA 1GM7A 1P84F 2KSDA 4LBEC 4EKWA 3CRAA 4GX5A 3BRCA 1OV9A 3IFXA 2EILB 1SA0A 5LA6B 3K06A 3FX7A
chains in the Genus database with same CATH topology
5LHGA 2Z3YA 2DW4A 3OMAB 1JJ2U 1YTFB 2IJHA 1ORQC 3ABLC 1W0KG 3ETEA 1TUEB 2EBOA 3SYQA 5DN6G 1PD3A 3QO5A 1M9NA 3EHBB 4PA4A 4JYBA 4G28B 1AI5A 4MW8A 4P9OA 5HFMA 2IH3C 3ETGA 4MVZA 1VQPV 4KP4A 2ZDIC 3ETDA 1VQ8V 2EIMB 3ZN0A 2UXXA 4RQEA 4ZBMA 1JVMA 1HWYA 3K0DA 2V7QG 4GX1A 3SYOA 1P4RA 2WAMA 5IYDO 3CCVV 1OZ0A 4TWKA 1WLEA 3FYEB 4JAUA 3SYPA 5GW7A 1BHAA 3SYCA 2WLHA 1XL6A 4J9ZB 3WG7B 1NJIW 4PDLA 2JDIG 1NQTA 1YJ9V 4MVRA 5B1AB 1G4YB 2QA4V 3AG2B 1E1RG 2F43G 3RVYA 2Z5UA 1NR7A 3PJSK 4PDVA 2NLJC 4P9PA 2Y69C 4N23A 1COWG 1Q82W 2M7WA 4JAVA 4MS2A 4MVSA 4PDMA 2WLMA 1FS0G 1FXKA 1K73W 1FXHA 2P7TC 5CBHA 1VQ7V 1QVGU 2HKOA 3A0RA 4JF3A 2W0FC 4HZ3A 5CA3A 3P32A 1KC8W 1PKXA 4G2KA 1E1QG 4LP8A 5B3SC 2IU3A 1V55C 1JCHA 2LFSA 5EBMC 2WLIB 2GSMB 3ZRXA 4FIPC 1MG1A 4PELA 1NH2D 2ZXWC 3OR7C 5FL7G 2X6BA 4XBFA 4XDKA 5KA5A 3TETA 1OCOC 4BAYA 5LGNA 5IYBO 2HG5C 4E2LA 4QPJA 5CN0A 2FTKA 2EIKC 3ZMSA 3OW2U 1YSCA 4XDJA 3OGCC 2WPDG 3MD0A 1Y66A 4MTGA 4BW5A 4HYOA 2Q68A 2ATKC 1B6QA 1SETA 4KUMA 1PL0A 3IGAC 3STLC 2DYRC 1KECA 4PA9A 3IC7A 2EIJC 1H2GA 4GT1A 3LDCA 1K3EA 1OCCB 4H37A 5IDJA 5IY5C 2Y69B 2IJJA 5KA6A 3CXCU 1GO3F 5L3EA 1MSWD 4G27B 2EINC 2XAFA 2H94A 2WWWA 3AG3B 1Q7YW 4QPKA 2WSSG 1J95A 2IU0A 2ZDIA 5B1OA 1R3IC 2WLIA 1QLEC 3E8BA 3ZMTA 1N8RW 1CPYA 2Y48A 1DLBA 1PNMA 2WLJA 5B3SB 4R7CA 1V55B 2P6JA 5L3GA 1K5SA 2R9IA 4FMTA 2QE7G 3OMNB 2W6JG 1V54C 2ZXWB 3ZMUA 5H6QA 4WFAV 2K1EA 3ZRVA 1AROP 1OCOB 3VBBA 3VOUA 3W7WA 1YITV 1LNQA 1EZJA 2EIKB 1IXMA 4QNHB 4L87A 3CPWU 5H6RA 4PDRA 1QCEA 1NVPD 1OCRC 3LDEA 3P30A 4UV8A 3JD4A 3SYAA 2DYRB 3ZCCA 4RAIA 4UVCA 3STZC 1M56C 5IY5B 1JPXA 2ITDC 5HFLA 1KQSU 3FB6C 1FXKB 3SPCA 2OT5A 5IYCO 2XASA 1K4DC 3ASNC 3G71V 3B8MA 3OEHG 4GX2A 3OE7G 3AG1B 1Y4MA 1H38A 2DYSB 1GMGA 1VQ5V 1F4NA 1VQLV 4GX0A 1YHQV 3HPLC 1RM1C 3RBZA 3BY6A 3OMIB 3FYIB 2HVJC 1GM8A 1QVFU 1W2BU 1PNKA 4RQFA 1K34A 1V54B 4X89A 3DGEA 3RW0A 3E2EA 5EC2C 3ABKC 1QBZA 3HB3B 3AEIA 3OR6C 1S72V 2AHZA 2JIZG 1ENVA 4DXWA 4MTXA 3T4DA 1JOYA 5L3CA 3R65A 3F7YC 2BOBC 1YJWV 4QJFB 3JD2A 1OCRB 4YXWG 1OHHG 3LUTB 2XAHA 5B1NA 3ABLB 5LHHA 2HVKC 4KFMA 4PA3A 1DF4A 3LSQA 1MOFA 4OXSA 1ROPA 2ZR2A 3JCZA 2ZR3A 5H9CA 4BIUA 1BMFG 3CCSV 1S76D 3D3IA 1AI7A 2IH1C 1NH2B 1AI6A 3E8FA 3W7UA 1VQNV 2IJIA 1RM1B 2H8PC 4U7OA 5LGTA 4P30A 1KKDA 2OTJV 1DTOA 3KG2A 1AJPA 1S0VA 1YIJV 1SRYA 3E8GA 4JTCB 4XDLA 5C93A 4I9WA 3CCQV 5KUMA 1R73A 2P67A 4JTAB 3I56V 4UUJC 3E89A 4MSWC 3BEHA 1R6NA 2JJ1G 2QM7A 1YJNV 4FPPA 2P90A 1M90W 1SESA 1SZTA 1THZA 1RPOA 3JYCA 5L3BA 3CCUV 2XAGA 1QR9A 2UXNA 4F4LA 4GCZA 3ABMC 3ZMVA 1PNLA 3E83A 3K9AA 2JEXA 3QO7A 2A9HA 5LBQA 1JQ0A 2ZQMA 1VQ6V 1QLNA 4JASA 1S77D 3CMEV 2CK3G 3TK1A 2DQ3A 3OUFA 1RPRA 5EBLC 2A0LA 3TCUA 1UJWB 3OEEG 2X6AA 4Z1MG 2EZOA 1K5QA 4WFBV 3ZRSA 1K7DA 2X7RB 1H8HG 2B5UA 4WCEV 1YI2V 2Q69A 1L1FA 3T1CA 2R9RB 3ZN1A 2ITCC 4R8CA 5DM6V 1VQ9V 3QNEA 3SPGA 1QR8A 1NVPB 1F4MA 1R3KC 5B1BC 3CMAV 3CCEV 1R6KA 3CYOA 1SERA 4H33A 1H8EG 3K79A 3QO8A 1F23A 3W7TA 1NR1A 4MVUA 3CCJV 4WF9V 2EIJB 2DWDC 4R6ZA 5KUKA 2X6CA 2D3OW 1KP3A 3AG2C 3T2MA 3CCMV 1CEZA 1FFTB 2XNDG 3NXSA 3K08A 3ABMB 1W0JG 4WFGA 2EINB 1F51A 1VQ4V 1K4CC 5J9PC 2WLNA 4TT3G 2WLLB 4RUFA 2PI4A 3ASOC 4MT8A 4FK5C 2C2AA 3JD3A 1QLEB 4MTOA 1YTFD 4UVBA 2IJKA 4UVAA 2EJRA 3ABUA 5EK0A 5L3DA 2ZD9A 4JYCA 3WFVA 1I5XA 2NNUA 3ZMZA 3CD6V 2HLDG 3X2QC 2Q67A 3SJQC 5CBFA 1K8AW 2QEXV 3E35A 1K97A 1BHBA 2QTOA 3I55V 5BZBA 1AI4A 3ML0A 2MK3A 3CCLV 1P7BA 2QM8A 3AG4C 3FB5C 4WFHA 5L3FA 1DF5A 3K0GA 1R3JC 4LCUC 4WFEA 5B1BB 2JK5C 1GK9A 2DQ0A 4MVMA 1AR1B 3CCRV 4UXNA 1CP9A 1EBOA 1FXVA 3LNMB 3JD1A 4LC1A 5LHIA 2WLLA 3K3WA 1M56B 3OUSA 4X88A 3UKMA 3F5WC 4DO2A 3ABTA 1S3JA 1E79G 1OCCC 3ASNB 2WLKA 4R50A 1K92A 3G4SV 4I5SA 2OTLV 1Q86W 1NKDA 4TSFG 5EBWC 3F7VC 3AG3C 4JGSA 5LGUA 3ASOB 4WFFA 2YEVB 3OFNG 3CC4V 1OCZC 3ZRWB 2HR3A 3SPJA 3B8NA 1KP2A 2B1GA 3W7SA 3OM3B 4U7NA 1M57C 1GKFA 1JX9A 3H01A 4FJCC 2YSUB 2X0LA 2XAQA 3FKSG 3X2QB 4UV9A 3ABKB 3B77A 2AHYA 3CC7V 2LP7A 3AG4B 1AJNA 2GHYA 3E8HA 1VQKV 2PI5A 3SPIA 3ZJZA 4QE9A 2XOKG 1S5HC 2IW5A 2A79B 3GB7C 2JJ2G 3ZIAG 4MW3A 3T4ZA 3DTUB 4BIZA 2EILC 1MABG 2OCCC 4JTDB 4QE7A 2Q6AA 4N21A 2B1IA 2XAJA 4J9YB 3JD0A 1I5YA 2YEVA 4PA7A 3MHHC 1BL8A 3CP1A 4HAMA 4P2ZA 4Q20A 3ZRWA 1FXKC 2JEUA 2HFEC 4MVQA 4JPRA 1NBMG 4ZKIA 3AG1C 4RO2A 3UM7A 2DYSC 3GWOA 3K03A 1GM9A 2EZPA 2BOCC 2EIMC 1OCZB 2DWEC 4X8AA 3E86A 4MVOA 1K33A 3W7XA 1GTOA 2V1DA 3K04A 4PA6A 3D36A 3MHSC 1Q81W 1M57B 4QIWF 2LFRA 3CC2V 5E1AC 4CBCA 1ZWIC 3EFFK 2W6IG 3M99B 3WG7C 1R3LC 4CZZA 3OAAG 3LSSA 5EC1C 3RVZA 5B1AC 1KD1W 1K9MW 1EFRG 1GM7A 4MTFA 1M1KW 1VQOV 2HJFC 3LDDA 4LBEC 4RUEA 4EKWA 3G6EV 3FB8C 5CMUA 2QKSA 1G8MA 4GX5A 1WPXA 2KB1A 4ASUG 5CBGA 3IFXA 2EILB 1AJQA 3SPHA 2OCCB 1XL4A 1VQMV 3FB7C 3K06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLI A;  4I9W A;  5KUM A;  1ORQ C;  1QLE C;  3ABL C;  3E8B A;  3LNM B;  4JTA B;  3SYQ A;  4UUJ C;  3E89 A;  4MSW C;  2WLL A;  3BEH A;  2WLJ A;  3OUS A;  4R7C A;  4X88 A;  4PA4 A;  3UKM A;  3F5W C;  4G28 B;  4MW8 A;  4P9O A;  2IH3 C;  3JYC A;  1OCC C;  4MVZ A;  1V54 C;  2WLK A;  4R50 A;  2K1E A;  4F4L A;  3ABM C;  5EBW C;  3E83 A;  4ZBM A;  1JVM A;  3AG3 C;  3F7V C;  2A9H A;  3VOU A;  1LNQ A;  3K0D A;  3SYO A;  4GX1 A;  4WFF A;  1OCZ C;  4QNH B;  4TWK A;  3OUF A;  3SPJ A;  4PDR A;  5EBL C;  2A0L A;  3SYP A;  1OCR C;  3TCU A;  3LDE A;  3SYC A;  1M57 C;  1XL6 A;  2WLH A;  4J9Z B;  3SYA A;  4PDL A;  4RAI A;  3FB7 C;  2X6A A;  4MVR A;  3STZ C;  1M56 C;  1G4Y B;  2ITD C;  3RVY A;  3FB6 C;  3SPC A;  3PJS K;  4PDV A;  2NLJ C;  4P9P A;  1K4D C;  2AHY A;  3ASN C;  3ZRS A;  2Y69 C;  4GX2 A;  3E8H A;  4MS2 A;  4MVS A;  4PDM A;  3SPI A;  3ZJZ A;  2WLM A;  4GX0 A;  4QE9 A;  3HPL C;  1S5H C;  2A79 B;  2Q69 A;  3GB7 C;  3RBZ A;  3T1C A;  2R9R B;  2ITC C;  4MW3 A;  4R8C A;  3K06 A;  3T4Z A;  2P7T C;  5CBH A;  3SPG A;  2EIL C;  2OCC C;  4JTD B;  1R3K C;  2HVJ C;  4QE7 A;  5B1B C;  2Q6A A;  2W0F C;  4H33 A;  4HZ3 A;  4J9Y B;  4MVU A;  2YEV A;  4PA7 A;  2DWD C;  4LP8 A;  4R6Z A;  1BL8 A;  2X6C A;  5B3S C;  4P2Z A;  1V55 C;  3AG2 C;  4X89 A;  3T2M A;  5KUK A;  3RW0 A;  2HFE C;  3ABK C;  5EC2 C;  3K08 A;  4MVQ A;  2WLI B;  5EBM C;  4WFG A;  3OR6 C;  2AHZ A;  3AG1 C;  2ZXW C;  3OR7 C;  2DYS C;  4RO2 A;  1K4C C;  3K03 A;  2WLN A;  2X6B A;  3UM7 A;  2BOC C;  4XDK A;  5J9P C;  3TET A;  2EIM C;  1OCO C;  2WLL B;  2DWE C;  4X8A A;  4DXW A;  3T4D A;  2HG5 C;  3E86 A;  4MVO A;  4RUF A;  3ASO C;  3R65 A;  3F7Y C;  2EIK C;  2BOB C;  4XDJ A;  3OGC C;  3K04 A;  3LUT B;  4PA6 A;  4MTG A;  4BW5 A;  4HYO A;  4MTO A;  2Q68 A;  2ATK C;  5E1A C;  2HVK C;  1ZWI C;  4KFM A;  4PA3 A;  3EFF K;  5EK0 A;  3STL C;  2ZD9 A;  3IGA C;  3WG7 C;  2DYR C;  1R3L C;  4PA9 A;  3X2Q C;  2EIJ C;  5EC1 C;  4OXS A;  3RVZ A;  2Q67 A;  5B1A C;  3LDC A;  4H37 A;  3SJQ C;  5CBF A;  4CBC A;  5IY5 C;  4MTF A;  2IH1 C;  2QTO A;  5BZB A;  3E8F A;  4G27 B;  2HJF C;  3LDD A;  4LBE C;  2EIN C;  4RUE A;  4EKW A;  1P7B A;  3AG4 C;  2H8P C;  2QKS A;  3FB5 C;  3FB8 C;  4WFH A;  4GX5 A;  4P30 A;  2KB1 A;  3K0G A;  1KKD A;  3KG2 A;  1J95 A;  5CBG A;  3IFX A;  3SPH A;  1R3J C;  4LCU C;  4WFE A;  1XL4 A;  3E8G A;  4JTC B;  4XDL A;  2JK5 C;  4MVM A;  1R3I C; 
#chains in the Genus database with same CATH topology
 2GDS A;  3ETE A;  1TUE B;  5DN6 G;  2JRI A;  1HNZ O;  3OT7 A;  2F95 B;  2PYL A;  1SQG A;  3ETG A;  5CB4 A;  4DV1 B;  1W59 A;  4O4H B;  1VQ8 V;  2MW2 B;  3LNN A;  4RQE A;  3JAS A;  3K0D A;  2V7Q G;  1P4R A;  2FB5 A;  4O4J B;  5KMG B;  2DN9 A;  2JS3 A;  2QKA A;  2RDC A;  1ZAU A;  1BHA A;  1MZE A;  2QDO A;  5KHH A;  2WLH A;  3SYC A;  5ITZ B;  2JDI G;  5CA1 B;  2JGD B;  5B1A B;  1G4Y B;  4X1Y A;  3JAK A;  1P49 A;  3CSX A;  1NR7 A;  3PJS K;  4PDV A;  4P9P A;  4DR3 B;  4DV0 B;  3F5T A;  1COW G;  1Q82 W;  4MS2 A;  4PDM A;  2JVD A;  1HP8 A;  1FFX B;  1VF6 C;  1FXH A;  4CH6 A;  1XRE A;  2YIA A;  3A0R A;  3CRC A;  4DR7 O;  5CA3 A;  3P32 A;  2ZE8 A;  4AQY B;  1NZ6 A;  4LP8 A;  4BR6 A;  5B3S C;  4DR1 B;  3A2F A;  1VP7 A;  2BSK A;  4JI1 B;  1I7F A;  3I5D A;  1I08 A;  2ADQ B;  3TET A;  1OCO C;  1SF9 A;  3RYF B;  5IYB O;  4F6R B;  4QPJ A;  5CN0 A;  2FTK A;  3ZMS A;  1MSD A;  2WPD G;  1XMQ B;  3MD0 A;  4MTG A;  1EN4 A;  3FD9 A;  4DV3 B;  1N32 O;  2ATK C;  4KUM A;  2CGN A;  4LNU B;  3IC7 A;  1H2G A;  4GT1 A;  4JYA B;  5IDJ A;  3TXS A;  5IY5 C;  2IJJ A;  1SA0 B;  1N33 B;  3L70 H;  1MSW D;  3BHP A;  4G27 B;  3L75 H;  1I94 B;  5LP6 C;  1GN4 A;  4I55 B;  1S5J A;  1J95 A;  1WP8 A;  1AVM A;  2QM4 A;  1MZF A;  2IU0 A;  5B1O A;  1IUR A;  1N8R W;  3QF7 A;  1KU9 A;  4R7C A;  1V55 B;  2P6J A;  4FM2 A;  3HKE B;  2R9I A;  3JAS B;  5IWA B;  5DEC A;  3P3N A;  1WB8 A;  3ZRV A;  5E79 Z;  4JI0 B;  2EIK B;  2N04 A;  3MAQ A;  3DXR A;  2UXD O;  3JAK B;  3O65 A;  4PDR A;  5H2F Z;  4LH6 A;  1NVP D;  3E22 B;  1XMO B;  2EJ7 A;  2DYR B;  4RAI A;  5HFL A;  4B3T O;  3FB6 C;  3AK1 A;  3EVK A;  4DV2 B;  4LF7 B;  1HNW O;  4X1K A;  1P7G A;  3OEH G;  4GX2 A;  3OE7 G;  1H38 A;  2CTW A;  1RM1 C;  3U10 A;  5LL6 Y;  3RYC B;  4FLX A;  5IJ9 B;  2Y0I A;  1Q6I A;  1XIL A;  3SGI A;  3A8T A;  3K9S A;  3CS5 A;  3HB3 B;  5JJJ B;  1ENV A;  3VQX A;  1JFF B;  5JCO C;  4GKJ O;  5L3C A;  3JAW A;  2BOB C;  5LP6 A;  2XAH A;  5B1N A;  1LUW A;  4B7K A;  2UXB B;  2LW1 A;  3JCZ A;  4DV4 O;  1VQN V;  2OTJ V;  1AJP A;  1BCC H;  4DUY B;  1SRY A;  3G80 A;  2Y4U A;  4JTA B;  3I56 V;  4UUJ C;  4MSW C;  2BTQ A;  2JJ1 G;  2PYJ A;  1O9G A;  2P90 A;  1M90 W;  2AZ0 A;  1SZT A;  2UUA O;  5L3B A;  5BMV B;  3OTO B;  2XAG A;  5J2T A;  3DXR B;  1QR9 A;  3DC5 A;  4LF8 B;  3ZMV A;  3E83 A;  4I4T B;  5KX5 B;  2JEX A;  2A9H A;  4YY3 B;  1VQ6 V;  1S77 D;  3CME V;  2DE0 X;  3TK1 A;  3OUF A;  1IBM O;  1XNQ O;  5EBL C;  2A0L A;  3G6B A;  2XTA A;  4X1K B;  2CH7 A;  4TOI A;  2EZO A;  4U3J A;  4JI8 O;  4UFZ A;  4BW9 A;  1GRJ A;  3CXH F;  2X7R B;  4BIO A;  2Z0A A;  2B5U A;  1ZLZ A;  1YI2 V;  2R9R B;  1VQ9 V;  3CEI A;  2QTS A;  1R3K C;  4YJ3 A;  3K5L A;  2ZIM A;  1SER A;  1WP7 A;  2RMK B;  5JCO A;  3H1K H;  2YI8 A;  3W7T A;  4MVU A;  2D3O W;  4X64 B;  1Y6X A;  1KP3 A;  3T2M A;  3G67 A;  5JH7 B;  3ABM B;  5KHK A;  5LP6 B;  1SQP H;  2ZNI A;  3BAB A;  5J9P C;  2WLN A;  2WLL B;  2Q9L A;  4B08 A;  2H3O A;  2PI4 A;  2BCC H;  2FML A;  4FK5 C;  1IVS A;  5FNV B;  3JD3 A;  2KKW A;  3CX5 F;  4JYC A;  3B09 A;  2HLD G;  1AR4 A;  1BQZ A;  1K8A W;  1AIL A;  3ZED A;  1BHB A;  5K1P A;  4FLW A;  3I55 V;  1AI4 A;  3CCL V;  1P7B A;  2QM8 A;  4J7Z A;  1FJG O;  1DF5 A;  4GKK O;  1JA8 A;  2P4V A;  5B1B B;  1GK9 A;  3CCR V;  4UXN A;  2FYU H;  3FAV B;  1EBO A;  1FXV A;  3RWR D;  1R1B A;  3N2K A;  3JD1 A;  4LC1 A;  1Q90 D;  4IHJ B;  4W4K A;  4E4E A;  4I50 A;  3VQY A;  3F5W C;  1S3J A;  4JI4 O;  3G4S V;  3TXQ A;  1PPJ H;  5IE9 A;  5LGU A;  2CH7 B;  5LOV B;  3JAT A;  1IXB A;  4WFF A;  4EB6 A;  4DUZ B;  4LFC B;  3HR0 A;  1KP2 A;  3ZBH A;  4LF6 O;  1SQQ H;  4O4L B;  4GLX A;  4LR3 A;  1M57 C;  3K58 A;  1JX9 A;  4FJC C;  2X0L A;  3GVM A;  2LP7 A;  1AJN A;  3AK3 A;  1YZB A;  4QE9 A;  3RYH B;  2A79 B;  2JJ2 G;  1TGO A;  1WA8 B;  2EIL C;  3CRM A;  4N21 A;  3JD0 A;  1Q6U A;  2YEV A;  1BL8 A;  4Q20 A;  1CXZ B;  4YIP A;  2HFE C;  1IBL B;  4JI2 O;  4NTX A;  4MVQ A;  3UM7 A;  2DYS C;  3J81 N;  1BSM A;  3W7X A;  3WB0 A;  2OIG A;  4PA6 A;  4B3M B;  1FAF A;  5E1A C;  5LMN B;  1ZWI C;  3M99 B;  4X20 A;  4LF9 B;  3OAA G;  2CTR A;  5B1A C;  1KD1 W;  4NXN O;  1K9M W;  1EFR G;  4MTF A;  5JQG A;  2HJF C;  3LDD A;  4RUE A;  3EXA A;  3BCC H;  3N2K B;  1AR5 A;  1ZL8 A;  1AJQ A;  4I50 B;  1VQM V;  2Z3Y A;  3OMA B;  2IJH A;  1W0K G;  2EBO A;  3QO5 A;  1M9N A;  1AB3 A;  4JYB A;  3AG7 A;  4MVZ A;  4KP4 A;  3VQV A;  4FVM A;  4ZBM A;  1JVM A;  1HWY A;  2WAM A;  1OZ0 A;  1R6T A;  5GW7 A;  3WG7 B;  4GUN A;  2ZKO A;  4JZG A;  4MVR A;  4DV7 B;  2VQF B;  2UUB O;  5LA6 A;  1E1R G;  4KHP O;  1XHZ A;  2NLJ C;  4KL1 A;  4EEQ A;  2ILM A;  4MVS A;  4JAV A;  1GN2 A;  4NYK A;  2E75 B;  1FS0 G;  5EZY B;  4DR2 O;  1K73 W;  2P7T C;  4B3R O;  1QVG U;  2HKO A;  4JF3 A;  4O4H A;  3ZHU A;  4D6T H;  4HZ3 A;  2ZIN A;  1RFY A;  1PKX A;  3K5O A;  1EM1 A;  4G2K A;  4O4J A;  5KMG A;  3JAR A;  1V55 C;  1JCH A;  1KUQ A;  2Q8V A;  1HNZ B;  3T1H O;  4FIP C;  4PEL A;  1L8D A;  5ITZ A;  5CA1 A;  5FL7 G;  2JGD A;  4XDK A;  4OPA A;  4IL6 Z;  4BAY A;  5AG2 A;  4E2L A;  4X20 B;  3OW2 U;  2EIK C;  3ICX A;  4J41 A;  4BW5 A;  2Q68 A;  1FFX A;  3STL C;  3IGA C;  2NR5 A;  4YHH O;  2DYR C;  3LDC A;  1K3E A;  2Y69 B;  1WB7 A;  3ZHT A;  2H94 A;  1N4C A;  4LF4 B;  2QGN A;  3BFR A;  1QLE C;  2ODM A;  4F6R A;  2N05 A;  5L3G A;  1K5S A;  2AXT Z;  4FMT A;  1YDX A;  4B7E A;  3J80 N;  4J11 A;  5H6Q A;  4EFB A;  4WFA V;  2K1E A;  1ARO P;  2F23 A;  4FLT A;  4LNU A;  1YIT V;  1LNQ A;  1U96 A;  4NR1 A;  5KLV H;  4K8Z A;  4QNH B;  5H6R A;  1QCE A;  2F93 B;  5BY1 A;  1XHX A;  2HHH O;  3P30 A;  3CRQ A;  4OX9 B;  4I55 A;  4JI5 B;  4UVC A;  3T1Y B;  4FM0 A;  1NS1 A;  1KQS U;  2AW9 A;  5IYC O;  2XAS A;  1Y4M A;  2DYS B;  4GX0 A;  4EFE A;  3HKE A;  2PY5 A;  3RBZ A;  1IBK O;  4JZ2 A;  3L71 H;  2WA3 A;  3JAR B;  1GM8 A;  1QVF U;  4JAA A;  1PNK A;  1K34 A;  1WAZ A;  3ZHV A;  3RW0 A;  3E22 A;  3E2E A;  3ABK C;  1QBZ A;  5BR8 O;  2AHZ A;  2JIZ G;  4X66 O;  1N34 B;  1GN3 A;  4MTX A;  4PD4 F;  2GUZ B;  1JOY A;  2LGQ A;  1OCR B;  1OHH G;  1UFI A;  4KFM A;  3L73 H;  2UXD B;  1MOF A;  3N2G B;  4OXS A;  2YIC A;  3RYC A;  1ROP A;  4B3S O;  5IJ9 A;  2IH1 C;  5C8Y B;  1NH2 B;  2NN4 A;  1AI6 A;  3E8F A;  5J2U B;  4UCS A;  2VS0 A;  5LGT A;  4B3T B;  3KG2 A;  1SKV A;  1YIJ V;  1IX9 A;  2AGA A;  1Z2G A;  5C93 A;  1TVK A;  1XUQ A;  1B3Q A;  1N0J A;  1R73 A;  1KB9 F;  3E89 A;  1YVW A;  1JFF A;  3H9V A;  1XOU A;  1R6N A;  3RFR A;  1YJN V;  3DSQ A;  1SES A;  4UCO A;  1THZ A;  1RPO A;  3JYC A;  1AP5 A;  4HBN A;  1O9H A;  2ZE7 A;  4F4L A;  1NTZ H;  3ABM C;  1PNL A;  3BVO A;  4OGQ B;  3K9A A;  3QO7 A;  5LBQ A;  1IDS A;  1JQ0 A;  2QR4 A;  4JAS A;  2DQ3 A;  1RPR A;  1M4U A;  2RJZ A;  3KZI Z;  1FD9 A;  1PM9 A;  4LF5 B;  1YXB A;  2P22 C;  2X6A A;  1D5N A;  4J10 A;  4WFB V;  1YF2 A;  3M8A A;  3B2E E;  1K7D A;  5LMU O;  4Z2W A;  2YIB D;  2Q69 A;  2YUA A;  3N27 A;  3ZN1 A;  4W4L A;  5BMV A;  3QNE A;  1NTM H;  4JV5 B;  4DV4 B;  5B1B C;  3CMA V;  1LUV A;  5JWP A;  2QWP B;  4PI2 A;  3CYO A;  1V9P A;  3P3P A;  1VF6 A;  4DR3 O;  4I4T A;  3QO8 A;  5KX5 A;  1Q3E A;  2E5L O;  3ZHS A;  2G38 A;  3AG2 C;  1L0N H;  1FFT B;  3K08 A;  2Q73 A;  4WFG A;  4UCR A;  1BT8 A;  1QLE B;  1VF5 B;  3SDL A;  4NTW A;  2UU9 B;  4UVA A;  2EJR A;  3ABU A;  5EK0 A;  4JI1 O;  3CJH B;  1QHT A;  3CE2 A;  3M7M X;  3ZMZ A;  1IBM B;  5CBF A;  4X62 O;  1K97 A;  2QTO A;  5BZB A;  1RSO B;  1TVK B;  2MK3 A;  2QKC A;  1SC5 B;  5KAF Z;  5L3F A;  3K0G A;  4JI8 B;  1R3J C;  2V4D A;  1HR0 B;  2VQE O;  2JK5 C;  5JH7 A;  1AR1 B;  3JAM N;  4IYI A;  3LNM B;  2WLL A;  2LGW A;  4CS2 A;  4FLY A;  3UKM A;  5FNV A;  1OCC C;  1S5L Z;  4C7U A;  1K92 A;  1Q86 W;  3MDS A;  3CC4 V;  3ZRW B;  2HR3 A;  2QJ1 A;  5IWA O;  3OM3 B;  4U7N A;  1JMK C;  4JI7 B;  3H01 A;  3X2Q B;  3FAV A;  3ABK B;  3CWB H;  1VAR A;  1XI1 A;  3CC7 V;  2GHY A;  3E8H A;  4IHJ A;  2XT9 A;  1Q8I A;  2GTA A;  2IW5 A;  3GB7 C;  3QTC A;  1Y76 B;  2EUL A;  4KXR A;  3DTU B;  1MAB G;  4QE7 A;  1Q5O A;  2XUM A;  2Q6A A;  4X9Q A;  3SJA C;  4J9Y B;  4GKK B;  2CDY A;  4J80 A;  2L35 A;  5LOV A;  4ZOL B;  3CP1 A;  2E76 B;  1FXK C;  2JEU A;  4O4L A;  1GN6 A;  2GV9 A;  4ZKI A;  2ZCE A;  3ZS8 C;  3AG1 C;  1XNR O;  1GM9 A;  4IGG A;  1XEQ A;  5CA0 B;  1K33 A;  2V1D A;  3K04 A;  3MHS C;  1Q81 W;  3JCU Z;  2LFR A;  3CC2 V;  3RYH A;  3WG7 C;  3LSS A;  1WA8 A;  3LSU A;  4ICG A;  2YS8 A;  2ZM6 O;  3RN4 A;  2UXB O;  3FB8 C;  5CMU A;  4ZIB A;  2QKS A;  1G8M A;  1WPX A;  4ASU G;  2DMX A;  5CBG A;  1G1X B;  1WN7 A;  1XL4 A;  5GTI Z;  4AHC A;  2DW4 A;  1YTF B;  3ABL C;  2YIB A;  3SYQ A;  4FLZ A;  5KHG A;  4LWS B;  4G28 B;  4MW8 A;  5D5Q A;  1VQP V;  4IIJ B;  2ZDI C;  3ETD A;  3U11 A;  3WB1 A;  4JI2 B;  1D5A A;  4TWK A;  4F6E A;  3SYP A;  2R70 A;  2PUS A;  4J9Z B;  1NQT A;  3AG2 B;  4YY3 O;  2F43 G;  4FZ0 A;  3RVY A;  3B40 A;  2Y69 C;  1N0N A;  2M7W A;  2WLM A;  5TIS Z;  3H1L H;  1WPB A;  1FXK A;  2L6L A;  1VQ7 V;  4DV6 O;  4QGP A;  2F1M A;  3QVN A;  2UUC O;  1XDC A;  1KC8 W;  3C3T A;  1E1Q G;  1DK1 A;  2IU3 A;  5A9G A;  1ZUQ A;  3APO A;  2LFS A;  5EBM C;  2WLI B;  3ZRX A;  1Z5W A;  4LFA O;  1NH2 D;  4DW0 A;  2Q7G A;  4DR6 O;  2X6B A;  4XBF A;  5LGN A;  2UXC B;  2BE3 A;  1YSC A;  5JVD B;  4X64 O;  3OGC C;  1Y66 A;  1H2S B;  1M5I A;  1B6Q A;  4FLU A;  5EZY A;  3ZX6 A;  1GH6 A;  1KEC A;  4PA9 A;  4GYC B;  2EIJ C;  1OCC B;  2E3C A;  5KA6 A;  4LFB B;  1GO3 F;  2EIN C;  2XAF A;  2UUB B;  2WWW A;  1Q7Y W;  2HP8 A;  4KHP B;  2HEP A;  4DR4 B;  3SR2 C;  2ZDI A;  1J5E O;  2GBO A;  1R3I C;  4AIL C;  3ZHQ A;  4X65 B;  2BTO A;  1SQV H;  3ZMT A;  1CPY A;  3RYI B;  1DLB A;  2WLJ A;  3UO3 A;  3C90 A;  4B3R B;  4NB5 A;  1EN5 A;  3HKB A;  4CH4 A;  3KKY A;  2ZXW B;  1Y74 B;  2HJD A;  4IT5 A;  3VBB A;  3VOU A;  3W7W A;  1IXM A;  4L8J A;  3T1H B;  4DRX B;  1OCR C;  1TUB B;  3SYA A;  3JD4 A;  3ZCC A;  2P06 A;  2A06 H;  2OIE A;  4DV5 B;  2ITD C;  1FXK B;  2OT5 A;  4LFC O;  4FFB B;  1K4D C;  4GZR B;  3G71 V;  3B8M A;  3AG1 B;  4YHH B;  1GMG A;  1VQ5 V;  1VQL V;  1YHQ V;  1NU1 H;  3BY6 A;  2EX3 A;  4O2A B;  4A5U B;  1RP3 B;  3UT5 B;  1Q43 A;  1PP9 H;  2VWK A;  4OPH A;  1XQ8 A;  1ZTE A;  1W2B U;  1NI8 A;  4Z1V A;  1IZ3 A;  1V54 B;  3PN1 A;  4X89 A;  5JJE B;  4AI8 A;  5EC2 C;  1A32 A;  3HKD A;  3OR6 C;  1S72 V;  2QWR B;  4DXW A;  2RNB A;  3F7Y C;  1YJW V;  4QJF B;  1KMI Z;  1JJO A;  2RN9 A;  3ABL B;  2F4V O;  5H5N A;  2QWQ B;  5LHH A;  2HVK C;  4PA3 A;  1DF4 A;  4PV1 B;  3OGI B;  1SZX A;  3CCS V;  4DR5 O;  2ZR3 A;  4BIU A;  1BMF G;  2HHH B;  3D3I A;  1AI7 A;  3W7U A;  4B3M O;  1BE3 H;  2IJI A;  2H8P C;  4U7O A;  4P30 A;  2Q7E A;  1U97 A;  4JTC B;  1VMG A;  1D2D A;  3CCQ V;  3HKB B;  5KUM A;  3RT3 C;  3VQW A;  2P67 A;  4J7K A;  1IBK B;  4TV9 A;  1HW7 A;  3BEH A;  4FPP A;  2GUZ A;  1QNM A;  5GTH Z;  4YIO A;  1MMM A;  3CCU V;  3H1J H;  1Z5V A;  4H0L B;  3N2G A;  1N36 O;  3GWK C;  4K35 A;  2ZQM A;  2N74 A;  2AZ2 A;  2CK3 G;  1HDJ A;  3TJT A;  5BR8 B;  5C8Y A;  2JGU A;  5J2U A;  5KAI Z;  3TCU A;  3OEE G;  4Z1M G;  4NXM O;  3S3W A;  4DR7 B;  4TUY B;  3ZRS A;  3C3S A;  1KBH A;  4ZI7 B;  4CH3 A;  3T1C A;  4DV7 O;  4R8C A;  2YID A;  2PGG A;  1QR8 A;  1F4M A;  4PJ0 Z;  4H33 A;  3K79 A;  3R66 A;  3HKD B;  5EIB C;  1FKA O;  2EIJ B;  2DWD C;  3JAL B;  5KUK A;  3CCM V;  3NXS A;  1N32 B;  1W0J G;  2EIN B;  1F51 A;  4K0K O;  1YEW A;  2OCH A;  1NTK H;  5DED A;  2A3Q A;  2CTP A;  4MT8 A;  1DGS A;  2DJV A;  1BS3 A;  1YTF D;  4UVB A;  2IJK A;  5IJ0 B;  5L3D A;  2Y0P A;  1HNX O;  3RGB A;  3X2Q C;  5GON A;  3SJB C;  2Q67 A;  4NVP A;  4ZHQ B;  4I9Q A;  3CRR A;  3ML0 A;  3D36 C;  3FB5 C;  4WFH A;  4TV9 B;  3THO A;  4YJ2 B;  4LCU C;  2FKX A;  5LMU B;  2DQ0 A;  4JI6 O;  3OUS A;  4ABM A;  4FLV A;  1BZK A;  4DO2 A;  4JI3 O;  4LF4 O;  2WLK A;  4R50 A;  3WB2 A;  4I5S A;  3IJ4 A;  2E5L B;  1NKD A;  3CJH A;  5EBW C;  4HNA A;  3F7V C;  3AG3 C;  3ASO B;  1BGY H;  1HNW B;  3SPJ A;  3B8N A;  3W7S A;  1RSO A;  4K8X A;  4CH5 A;  1GKF A;  1X59 A;  2YSU B;  4O4I B;  2XAQ A;  3FKS G;  3D8C A;  5IT9 N;  3B77 A;  4DYL A;  2AHY A;  4CS3 A;  3AG4 B;  2PI5 A;  3AK2 A;  2CTQ A;  2XOK G;  1S5H C;  4OX9 O;  4JI5 O;  3ZIA G;  4X62 B;  4MW3 A;  3T1Y O;  3IC9 A;  5D5P A;  3T4Z A;  5EYP A;  4JTD B;  4H44 B;  4I7Z B;  2B1I A;  3UQ8 A;  2XAJ A;  2ETN A;  4DV1 O;  1I5Y A;  5IYZ A;  2A7W A;  3Q4H A;  4GKJ B;  2VQE B;  4PA7 A;  4UCV A;  3MHH C;  2ZIO A;  3NR7 A;  3ZRW A;  2ZE6 A;  2LO1 A;  4J7J A;  4JPR A;  4J42 A;  2RQ6 A;  4RO2 A;  3GWO A;  3K03 A;  1WJZ A;  2EZP A;  4WBN A;  2BOC C;  1OCZ B;  2DWE C;  4JYY A;  4MVO A;  5FPR A;  1GTO A;  5GON B;  3D36 A;  5CB4 B;  1URF A;  2P5O A;  3U0Z A;  4CBC A;  4DV0 O;  2CE4 A;  3BA8 A;  3EFF K;  2W6I G;  4CC6 A;  1AP6 A;  1Y76 A;  1N34 O;  1R3L C;  4CZZ A;  1KYO F;  2WA4 A;  1PL4 A;  2XHB A;  1M1K W;  1VQO V;  3G6E V;  4ZOL A;  2KB1 A;  2B9Z A;  2UUA B;  3SPH A;  4X1Y B;  2OCC B;  4AQY O;  4TQF A;  3FB7 C;  3APQ A;  5LHG A;  4DR1 O;  2Y4T A;  1JJ2 U;  1H2K A;  1ORQ C;  2LQT A;  1PD3 A;  4RWU A;  3K59 A;  5CA0 A;  3H1H H;  1L0L H;  4UCU A;  3EHB B;  4PA4 A;  1AI5 A;  4HNA B;  4P9O A;  1I0H A;  5HFM A;  1XNQ B;  2IH3 C;  3B4S A;  2JS5 A;  1XMQ O;  2EIM B;  3ZN0 A;  2UXX A;  4DV3 O;  1M93 A;  3SYO A;  4GX1 A;  4DK1 A;  4D7T A;  3WU2 Z;  5IYD O;  3CCV V;  1WLE A;  3FYE B;  1XNR B;  4JAU A;  4JYA O;  5B66 Z;  2BSK B;  1SS3 A;  1XL6 A;  3HKC A;  1NJI W;  1N33 O;  4PDL A;  1YJ9 V;  4H13 B;  1I94 O;  2QA4 V;  2KG7 A;  2Z5U A;  4TQD A;  2CAZ C;  5EYP B;  1VIB A;  4N23 A;  3QG5 A;  3DC6 A;  4LF5 O;  1MNG A;  4LWS A;  1H2M A;  3O9O A;  5IYZ B;  3Q4H B;  1UPG A;  4UCT A;  5CBH A;  2ZM6 B;  4IIJ A;  3L74 H;  1PV0 A;  4CS4 A;  2W0F C;  2K9P A;  1EN6 A;  1US6 A;  4WBN B;  2YXL A;  1Q6H A;  4JI0 O;  1MA1 A;  1T5E A;  1VEW A;  4JV5 O;  2GSM B;  1MG1 A;  2ZXW C;  3OR7 C;  1XMO O;  5KA5 A;  3J7A U;  3CB2 A;  3JSL A;  2HG5 C;  3L72 H;  4XDJ A;  1GAX A;  2R9A A;  3H1I H;  3KCY A;  4HYO A;  4DV2 O;  4LF7 O;  1FJG B;  1SET A;  2E74 B;  1PL0 A;  5F2V O;  2R72 A;  3OTF A;  3FFQ A;  4H37 A;  3CXC U;  5L3E A;  4LH7 A;  4PI0 A;  3AG3 B;  4QPK A;  2WSS G;  2UU9 O;  2RCV A;  4JI4 B;  3JSN A;  2WLI A;  1Y67 A;  3IAY A;  1VF7 A;  3E8B A;  3ZHR A;  2Y48 A;  1PNM A;  3BAA A;  5B3S B;  5FLX N;  2YXY A;  4DV6 B;  2OWO A;  5JVD A;  2QE7 G;  4LF6 B;  3OMN B;  2W6J G;  4FZ1 A;  1HR0 O;  1V54 C;  1FPO A;  2UUC B;  3ZMU A;  1OCO B;  1FYJ A;  4DW1 A;  3HKC B;  5B5E Z;  1EZJ A;  1WNS A;  2DOS A;  2PZS A;  2F66 C;  4L87 A;  3CPW U;  2QWO B;  2KG7 B;  4LFA B;  4DR6 B;  1EZV H;  5LXT A;  3LDE A;  4UV8 A;  1YCI A;  2P4K A;  1LR1 A;  3STZ C;  3OD4 A;  1M56 C;  5IY5 B;  1SQB H;  1JPX A;  1H2N A;  3SPC A;  3JAW B;  4DUY O;  3ASN C;  3RYI A;  1QU7 A;  4JI7 O;  1F4N A;  3HPL C;  4X1I A;  3OMI B;  3FYI B;  2HVJ C;  3L9D A;  4O2B A;  1Y74 A;  2M6Y A;  3OTO O;  4D7S A;  4RQF A;  1H2L A;  1J5E B;  1SQX H;  4LF8 O;  3DGE A;  4DRX A;  1TUB A;  3AEI A;  2YDE A;  5LYJ A;  1X4T A;  4IYH A;  2BTQ B;  4NXN B;  3T4D A;  4BWA A;  3R65 A;  4FFB A;  3CHX A;  3JD2 A;  4YXW G;  4UB8 Z;  3LUT B;  3K5N A;  5J2T B;  2LJ2 A;  1TAE A;  3LSQ A;  1ZX3 A;  4O2A A;  3UO2 A;  2YC0 A;  3UT5 A;  2ZR2 A;  5H9C A;  1S76 D;  3A0B Z;  3TGU H;  1RM1 B;  1KKD A;  1DTO A;  4U3J B;  1S0V A;  3E8G A;  4XDL A;  4I9W A;  2QM7 A;  2PTM A;  2IM9 A;  2FL4 A;  4YJ3 B;  2UXN A;  4GCZ A;  5LXT B;  2D2C B;  1QLN A;  3D3Q A;  1ZSP A;  1UJW B;  2ZE5 A;  4TV8 A;  4DR2 B;  2IBZ H;  1K5Q A;  4X1I B;  2ADP A;  2F4V B;  3S3X A;  5KHI A;  1H8H G;  4O2B B;  3BA9 A;  4WCE V;  2ARH A;  1L1F A;  4DR5 B;  4DK0 A;  2ITC C;  5DM6 V;  2Q0O C;  3SPG A;  1NVP B;  3CCE V;  1R6K A;  1H8E G;  1JR9 A;  1F23 A;  5JJN B;  1NR1 A;  5LYJ B;  2Q5Z A;  2QSA A;  3CCJ V;  4WF9 V;  1XBL A;  4FFK A;  4R6Z A;  2X6C A;  4PHZ A;  4DUZ O;  1CEZ A;  2XND G;  1TA8 A;  1VQ4 V;  2PF4 E;  1K4C C;  4TT3 G;  2YXH A;  4RUF A;  3K5M A;  3ASO C;  4TUY A;  2QWN B;  2C2A A;  4MTO A;  1N36 B;  3KCX A;  4CC5 A;  4ZI7 A;  4K3A A;  2ZD9 A;  3WFV A;  1I5X A;  2NNU A;  5A2Q N;  3CD6 V;  3ETQ A;  2YI9 A;  3JAT B;  4EB6 B;  3SJQ C;  2O57 A;  3A0H Z;  2QEX V;  2UXC O;  3E35 A;  4NXM B;  3AG4 C;  3JAL A;  4I0X A;  4WFE A;  2KQX A;  4MVM A;  1CP9 A;  2W0X A;  4LFB O;  2LW7 A;  1IBL O;  5FPO A;  5LHI A;  3SJC C;  3K3W A;  1M56 B;  3K57 A;  4X88 A;  5EIB D;  2Q0A A;  1SQF A;  2ZNJ A;  3ABT A;  4DR4 O;  1E79 G;  3ASN B;  4X65 O;  2OTL V;  5IJ0 A;  1B04 A;  3UCS C;  4TSF G;  4NTY A;  5K1X A;  4JGS A;  4UB6 Z;  2OYQ A;  1G6U A;  4TV8 B;  5LMN O;  2YEV B;  3OFN G;  4ZHQ A;  1OCZ C;  2CUG A;  4LF9 O;  2B1G A;  4K0K B;  1KKC A;  4FM1 A;  2Q7H A;  4YJ2 A;  4UV9 A;  1HNX B;  1VQK V;  3SPI A;  3ZJZ A;  2CGO A;  3BPZ A;  4DV5 O;  4BIZ A;  2OCC C;  4U3F H;  4NKG B;  1OJH A;  4X66 B;  2VWJ A;  5JQG B;  4HAM A;  1ZL8 B;  4JI6 B;  4P2Z A;  1F7Y A;  1NBM G;  4O4I A;  2Q4P A;  1NT2 B;  2EIM C;  4X8A A;  4JI3 B;  3E86 A;  5BXZ A;  5KHJ A;  4B3S B;  2VQF O;  1B06 A;  2GTS A;  1M57 B;  4QIW F;  3RYF A;  1BQ0 A;  1QQC A;  4Q6G A;  2ZT9 B;  5EC1 C;  3RVZ A;  4I0X B;  2VRZ A;  1GM7 A;  1P84 F;  2KSD A;  4LBE C;  4EKW A;  3CRA A;  4GX5 A;  3BRC A;  1OV9 A;  3IFX A;  2EIL B;  1SA0 A;  5LA6 B;  3K06 A;  3FX7 A; 
#chains in the Genus database with same CATH homology
 5LHG A;  2Z3Y A;  2DW4 A;  3OMA B;  1JJ2 U;  1YTF B;  2IJH A;  1ORQ C;  3ABL C;  1W0K G;  3ETE A;  1TUE B;  2EBO A;  3SYQ A;  5DN6 G;  1PD3 A;  3QO5 A;  1M9N A;  3EHB B;  4PA4 A;  4JYB A;  4G28 B;  1AI5 A;  4MW8 A;  4P9O A;  5HFM A;  2IH3 C;  3ETG A;  4MVZ A;  1VQP V;  4KP4 A;  2ZDI C;  3ETD A;  1VQ8 V;  2EIM B;  3ZN0 A;  2UXX A;  4RQE A;  4ZBM A;  1JVM A;  1HWY A;  3K0D A;  2V7Q G;  4GX1 A;  3SYO A;  1P4R A;  2WAM A;  5IYD O;  3CCV V;  1OZ0 A;  4TWK A;  1WLE A;  3FYE B;  4JAU A;  3SYP A;  5GW7 A;  1BHA A;  3SYC A;  2WLH A;  1XL6 A;  4J9Z B;  3WG7 B;  1NJI W;  4PDL A;  2JDI G;  1NQT A;  1YJ9 V;  4MVR A;  5B1A B;  1G4Y B;  2QA4 V;  3AG2 B;  1E1R G;  2F43 G;  3RVY A;  2Z5U A;  1NR7 A;  3PJS K;  4PDV A;  2NLJ C;  4P9P A;  2Y69 C;  4N23 A;  1COW G;  1Q82 W;  2M7W A;  4JAV A;  4MS2 A;  4MVS A;  4PDM A;  2WLM A;  1FS0 G;  1FXK A;  1K73 W;  1FXH A;  2P7T C;  5CBH A;  1VQ7 V;  1QVG U;  2HKO A;  3A0R A;  4JF3 A;  2W0F C;  4HZ3 A;  5CA3 A;  3P32 A;  1KC8 W;  1PKX A;  4G2K A;  1E1Q G;  4LP8 A;  5B3S C;  2IU3 A;  1V55 C;  1JCH A;  2LFS A;  5EBM C;  2WLI B;  2GSM B;  3ZRX A;  4FIP C;  1MG1 A;  4PEL A;  1NH2 D;  2ZXW C;  3OR7 C;  5FL7 G;  2X6B A;  4XBF A;  4XDK A;  5KA5 A;  3TET A;  1OCO C;  4BAY A;  5LGN A;  5IYB O;  2HG5 C;  4E2L A;  4QPJ A;  5CN0 A;  2FTK A;  2EIK C;  3ZMS A;  3OW2 U;  1YSC A;  4XDJ A;  3OGC C;  2WPD G;  3MD0 A;  1Y66 A;  4MTG A;  4BW5 A;  4HYO A;  2Q68 A;  2ATK C;  1B6Q A;  1SET A;  4KUM A;  1PL0 A;  3IGA C;  3STL C;  2DYR C;  1KEC A;  4PA9 A;  3IC7 A;  2EIJ C;  1H2G A;  4GT1 A;  3LDC A;  1K3E A;  1OCC B;  4H37 A;  5IDJ A;  5IY5 C;  2Y69 B;  2IJJ A;  5KA6 A;  3CXC U;  1GO3 F;  5L3E A;  1MSW D;  4G27 B;  2EIN C;  2XAF A;  2H94 A;  2WWW A;  3AG3 B;  1Q7Y W;  4QPK A;  2WSS G;  1J95 A;  2IU0 A;  2ZDI A;  5B1O A;  1R3I C;  2WLI A;  1QLE C;  3E8B A;  3ZMT A;  1N8R W;  1CPY A;  2Y48 A;  1DLB A;  1PNM A;  2WLJ A;  5B3S B;  4R7C A;  1V55 B;  2P6J A;  5L3G A;  1K5S A;  2R9I A;  4FMT A;  2QE7 G;  3OMN B;  2W6J G;  1V54 C;  2ZXW B;  3ZMU A;  5H6Q A;  4WFA V;  2K1E A;  3ZRV A;  1ARO P;  1OCO B;  3VBB A;  3VOU A;  3W7W A;  1YIT V;  1LNQ A;  1EZJ A;  2EIK B;  1IXM A;  4QNH B;  4L87 A;  3CPW U;  5H6R A;  4PDR A;  1QCE A;  1NVP D;  1OCR C;  3LDE A;  3P30 A;  4UV8 A;  3JD4 A;  3SYA A;  2DYR B;  3ZCC A;  4RAI A;  4UVC A;  3STZ C;  1M56 C;  5IY5 B;  1JPX A;  2ITD C;  5HFL A;  1KQS U;  3FB6 C;  1FXK B;  3SPC A;  2OT5 A;  5IYC O;  2XAS A;  1K4D C;  3ASN C;  3G71 V;  3B8M A;  3OEH G;  4GX2 A;  3OE7 G;  3AG1 B;  1Y4M A;  1H38 A;  2DYS B;  1GMG A;  1VQ5 V;  1F4N A;  1VQL V;  4GX0 A;  1YHQ V;  3HPL C;  1RM1 C;  3RBZ A;  3BY6 A;  3OMI B;  3FYI B;  2HVJ C;  1GM8 A;  1QVF U;  1W2B U;  1PNK A;  4RQF A;  1K34 A;  1V54 B;  4X89 A;  3DGE A;  3RW0 A;  3E2E A;  5EC2 C;  3ABK C;  1QBZ A;  3HB3 B;  3AEI A;  3OR6 C;  1S72 V;  2AHZ A;  2JIZ G;  1ENV A;  4DXW A;  4MTX A;  3T4D A;  1JOY A;  5L3C A;  3R65 A;  3F7Y C;  2BOB C;  1YJW V;  4QJF B;  3JD2 A;  1OCR B;  4YXW G;  1OHH G;  3LUT B;  2XAH A;  5B1N A;  3ABL B;  5LHH A;  2HVK C;  4KFM A;  4PA3 A;  1DF4 A;  3LSQ A;  1MOF A;  4OXS A;  1ROP A;  2ZR2 A;  3JCZ A;  2ZR3 A;  5H9C A;  4BIU A;  1BMF G;  3CCS V;  1S76 D;  3D3I A;  1AI7 A;  2IH1 C;  1NH2 B;  1AI6 A;  3E8F A;  3W7U A;  1VQN V;  2IJI A;  1RM1 B;  2H8P C;  4U7O A;  5LGT A;  4P30 A;  1KKD A;  2OTJ V;  1DTO A;  3KG2 A;  1AJP A;  1S0V A;  1YIJ V;  1SRY A;  3E8G A;  4JTC B;  4XDL A;  5C93 A;  4I9W A;  3CCQ V;  5KUM A;  1R73 A;  2P67 A;  4JTA B;  3I56 V;  4UUJ C;  3E89 A;  4MSW C;  3BEH A;  1R6N A;  2JJ1 G;  2QM7 A;  1YJN V;  4FPP A;  2P90 A;  1M90 W;  1SES A;  1SZT A;  1THZ A;  1RPO A;  3JYC A;  5L3B A;  3CCU V;  2XAG A;  1QR9 A;  2UXN A;  4F4L A;  4GCZ A;  3ABM C;  3ZMV A;  1PNL A;  3E83 A;  3K9A A;  2JEX A;  3QO7 A;  2A9H A;  5LBQ A;  1JQ0 A;  2ZQM A;  1VQ6 V;  1QLN A;  4JAS A;  1S77 D;  3CME V;  2CK3 G;  3TK1 A;  2DQ3 A;  3OUF A;  1RPR A;  5EBL C;  2A0L A;  3TCU A;  1UJW B;  3OEE G;  2X6A A;  4Z1M G;  2EZO A;  1K5Q A;  4WFB V;  3ZRS A;  1K7D A;  2X7R B;  1H8H G;  2B5U A;  4WCE V;  1YI2 V;  2Q69 A;  1L1F A;  3T1C A;  2R9R B;  3ZN1 A;  2ITC C;  4R8C A;  5DM6 V;  1VQ9 V;  3QNE A;  3SPG A;  1QR8 A;  1NVP B;  1F4M A;  1R3K C;  5B1B C;  3CMA V;  3CCE V;  1R6K A;  3CYO A;  1SER A;  4H33 A;  1H8E G;  3K79 A;  3QO8 A;  1F23 A;  3W7T A;  1NR1 A;  4MVU A;  3CCJ V;  4WF9 V;  2EIJ B;  2DWD C;  4R6Z A;  5KUK A;  2X6C A;  2D3O W;  1KP3 A;  3AG2 C;  3T2M A;  3CCM V;  1CEZ A;  1FFT B;  2XND G;  3NXS A;  3K08 A;  3ABM B;  1W0J G;  4WFG A;  2EIN B;  1F51 A;  1VQ4 V;  1K4C C;  5J9P C;  2WLN A;  4TT3 G;  2WLL B;  4RUF A;  2PI4 A;  3ASO C;  4MT8 A;  4FK5 C;  2C2A A;  3JD3 A;  1QLE B;  4MTO A;  1YTF D;  4UVB A;  2IJK A;  4UVA A;  2EJR A;  3ABU A;  5EK0 A;  5L3D A;  2ZD9 A;  4JYC A;  3WFV A;  1I5X A;  2NNU A;  3ZMZ A;  3CD6 V;  2HLD G;  3X2Q C;  2Q67 A;  3SJQ C;  5CBF A;  1K8A W;  2QEX V;  3E35 A;  1K97 A;  1BHB A;  2QTO A;  3I55 V;  5BZB A;  1AI4 A;  3ML0 A;  2MK3 A;  3CCL V;  1P7B A;  2QM8 A;  3AG4 C;  3FB5 C;  4WFH A;  5L3F A;  1DF5 A;  3K0G A;  1R3J C;  4LCU C;  4WFE A;  5B1B B;  2JK5 C;  1GK9 A;  2DQ0 A;  4MVM A;  1AR1 B;  3CCR V;  4UXN A;  1CP9 A;  1EBO A;  1FXV A;  3LNM B;  3JD1 A;  4LC1 A;  5LHI A;  2WLL A;  3K3W A;  1M56 B;  3OUS A;  4X88 A;  3UKM A;  3F5W C;  4DO2 A;  3ABT A;  1S3J A;  1E79 G;  1OCC C;  3ASN B;  2WLK A;  4R50 A;  1K92 A;  3G4S V;  4I5S A;  2OTL V;  1Q86 W;  1NKD A;  4TSF G;  5EBW C;  3F7V C;  3AG3 C;  4JGS A;  5LGU A;  3ASO B;  4WFF A;  2YEV B;  3OFN G;  3CC4 V;  1OCZ C;  3ZRW B;  2HR3 A;  3SPJ A;  3B8N A;  1KP2 A;  2B1G A;  3W7S A;  3OM3 B;  4U7N A;  1M57 C;  1GKF A;  1JX9 A;  3H01 A;  4FJC C;  2YSU B;  2X0L A;  2XAQ A;  3FKS G;  3X2Q B;  4UV9 A;  3ABK B;  3B77 A;  2AHY A;  3CC7 V;  2LP7 A;  3AG4 B;  1AJN A;  2GHY A;  3E8H A;  1VQK V;  2PI5 A;  3SPI A;  3ZJZ A;  4QE9 A;  2XOK G;  1S5H C;  2IW5 A;  2A79 B;  3GB7 C;  2JJ2 G;  3ZIA G;  4MW3 A;  3T4Z A;  3DTU B;  4BIZ A;  2EIL C;  1MAB G;  2OCC C;  4JTD B;  4QE7 A;  2Q6A A;  4N21 A;  2B1I A;  2XAJ A;  4J9Y B;  3JD0 A;  1I5Y A;  2YEV A;  4PA7 A;  3MHH C;  1BL8 A;  3CP1 A;  4HAM A;  4P2Z A;  4Q20 A;  3ZRW A;  1FXK C;  2JEU A;  2HFE C;  4MVQ A;  4JPR A;  1NBM G;  4ZKI A;  3AG1 C;  4RO2 A;  3UM7 A;  2DYS C;  3GWO A;  3K03 A;  1GM9 A;  2EZP A;  2BOC C;  2EIM C;  1OCZ B;  2DWE C;  4X8A A;  3E86 A;  4MVO A;  1K33 A;  3W7X A;  1GTO A;  2V1D A;  3K04 A;  4PA6 A;  3D36 A;  3MHS C;  1Q81 W;  1M57 B;  4QIW F;  2LFR A;  3CC2 V;  5E1A C;  4CBC A;  1ZWI C;  3EFF K;  2W6I G;  3M99 B;  3WG7 C;  1R3L C;  4CZZ A;  3OAA G;  3LSS A;  5EC1 C;  3RVZ A;  5B1A C;  1KD1 W;  1K9M W;  1EFR G;  1GM7 A;  4MTF A;  1M1K W;  1VQO V;  2HJF C;  3LDD A;  4LBE C;  4RUE A;  4EKW A;  3G6E V;  3FB8 C;  5CMU A;  2QKS A;  1G8M A;  4GX5 A;  1WPX A;  2KB1 A;  4ASU G;  5CBG A;  3IFX A;  2EIL B;  1AJQ A;  3SPH A;  2OCC B;  1XL4 A;  1VQM V;  3FB7 C;  3K06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...