4PDVA

Structure of k+ selective nak mutant in barium and potassium
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdvA00
2KB1A 2A9HA 1ORQC 1OCRC 2WLNA 2WLMA 3OR7C 1XL4A 4G27B 2Y69C 5BZBA 2X6BA 2QKSA 3ABLC 3FB8C 4PA4A 4PA7A 3F5WC 4MTOA 3E8HA 4CBCA 2DYRC 3STLC 4F4LA 3E89A 2EILC 1R3JC 4MS2A 3R65A 4PDMA 3E8GA 2IH1C 4UUJC 2A79B 3AG3C 3IGAC 4JTCB 2OCCC 2DWDC 2Q6AA 3SPIA 4HYOA 3K08A 5KUKA 1R3KC 2HG5C 4HZ3A 3AG2C 4KFMA 2P7TC 3OUFA 1OCOC 4R50A 4R6ZA 4RUEA 4EKWA 4WFEA 1R3IC 4R7CA 4WFFA 2AHYA 5CBHA 2IH3C 3F7VC 1V55C 3FB5C 4QE9A 4GX5A 1LNQA 2WLLB 5IY5C 2ZD9A 4MSWC 3TCUA 3WG7C 4XDJA 2JK5C 3SYAA 2WLLA 3TETA 3E83A 3PJSK 4J9YB 4XDLA 5E1AC 2EIJC 4JTDB 3RVZA 2NLJC 4JTAB 3RBZA 1QLEC 1ZWIC 4P2ZA 3E8BA 3VOUA 3LNMB 2WLJA 3ASNC 3SPHA 3SYOA 2WLIA 4J9ZB 3SPJA 2WLIB 3HPLC 4QE7A 4X89A 4MW3A 2YEVA 3SJQC 4P9PA 2DWEC 4GX1A 1M57C 2BOCC 4GX0A 3F7YC 3OUSA 4RUFA 2Q67A 1K4DC 2AHZA 1BL8A 4LBEC 5KUMA 3E86A 2ITDC 2WLKA 2X6AA 3ABKC 3GB7C 3K0DA 3AG1C 4PDVA 3ZRSA 3JYCA 1J95A 3LDEA 1P7BA 3E8FA 4PA3A 3SYCA 1V54C 4BW5A 3LDCA 3ZJZA 5B1AC 3BEHA 3K04A 1KKDA 4MVZA 2WLHA 4RAIA 5B3SC 3IFXA 2HVJC 4MVMA 4G28B 4H37A 3T4ZA 3UM7A 4DXWA 4PA6A 2HFEC 1K4CC 3KG2A 2DYSC 3STZC 2W0FC 2HJFC 2X6CA 4H33A 5CBFA 3FB6C 4MVRA 4R8CA 3ABMC 4PDRA 4PDLA 5EK0A 2K1EA 4ZBMA 3RVYA 2H8PC 2ATKC 2Q69A 4MVOA 2QTOA 4I9WA 5EBLC 5B1BC 3LDDA 4XDKA 2BOBC 4MVQA 4WFGA 2A0LA 2HVKC 5EBWC 4MTFA 4TWKA 4WFHA 2Q68A 2R9RB 3OR6C 4LP8A 2EIMC 3ASOC 4QNHB 5EC1C 3SPGA 4P30A 3T1CA 3SPCA 3EFFK 4OXSA 1G4YB 1OCCC 3LUTB 3T2MA 4LCUC 3UKMA 3OGCC 5CBGA 3K03A 4MVUA 3T4DA 3X2QC 3FB7C 4MW8A 4X88A 1M56C 1S5HC 4P9OA 2EINC 5EBMC 3K0GA 4GX2A 4MVSA 3SYPA 3SYQA 2ZXWC 2ITCC 5EC2C 3K06A 4PA9A 1JVMA 4X8AA 1OCZC 4RO2A 4MTGA 3RW0A 3AG4C 5J9PC 1XL6A 2EIKC 1R3LC
chains in the Genus database with same CATH superfamily
3ZHVA 5KHKA 1XL4A 4NTXA 4PA4A 4BAYA 1XNRO 2YI9A 1X59A 1MSWD 1Q6UA 4U3JB 2WSSG 4YY3O 3IJ4A 1XNRB 3AG3B 4R50A 3RN4A 1QLNA 4YJ3A 3SJAC 2ZNJA 2OCHA 1VQKV 3JALB 4ICGA 3ABKB 4K0KO 4X20B 3PJSK 5FPRA 2EIJC 4BIUA 3RVZA 3A0BZ 3VOUA 3JD3A 2EINB 2YSUB 3ASNC 3ZBHA 5HFMA 1K73W 1GKFA 4O2AA 3C3SA 2WLIB 5LGTA 4WCEV 3JATA 1AJNA 3P32A 1Q82W 3QG5A 2UUBB 1O9GA 2ZE7A 1FXHA 4LF5O 1V54C 2AGAA 1HR0B 4ZKIA 2HVJC 2GTSA 3QO5A 3T4ZA 4AILC 4UCOA 2OT5A 3B4SA 5LYJB 2K1EA 1Z2GA 4JYYA 3PN1A 1XREA 4ZHQA 4JI1O 2V7QG 1R6TA 4DYLA 3LUTB 4JI8B 4GCZA 1GN3A 4BIOA 5EYPA 5EYPB 3T1HO 4NXNB 3WB2A 1HR0O 1R3LC 2XASA 4FFBA 4AI8A 2WLNA 3FB8C 1IBMB 2UU9O 4F4LA 4OX9B 2VQEO 4K0KB 1MMMA 2ZKOA 3Q4HA 1SA0B 5JVDA 2N74A 2RJZA 2QGNA 4Z1MG 2CH7A 2YIBA 1K3EA 4OX9O 1F7YA 2QKAA 4N23A 3C3TA 3THOA 1JMKC 2BTQA 1OV9A 1JR9A 2L35A 1EFRG 1IVSA 5IY5C 1AR1B 4MSWC 2N05A 3UO2A 1VIBA 3T1HB 1J5EB 2HJDA 1OJHA 1X4TA 1W59A 4UV9A 2X0LA 4J80A 1EN6A 1Q86W 2H94A 4LF4B 4GKKB 3HPLC 2UU9B 1G1XB 1BSMA 2YEVA 3M8AA 3CC7V 3ZMTA 1HNWO 1NT2B 2BSKA 2BOCC 4B3TB 1MOFA 3H1HH 1JOYA 3CPWU 4TV9B 1OCRB 2QR4A 2QWPB 3LDCA 1TVKA 5A2QN 4H37A 2Q7HA 1F4MA 4LH6A 1K4CC 3KG2A 1XOUA 3ZHTA 3VQVA 4ZBMA 3RYFA 1AP6A 4F6RB 5EBLC 1Y76B 4LWSB 2PYJA 4I55A 4WBNA 2A0LA 5EBWC 1CXZB 5KMGB 1XMQO 1KP3A 2Q0AA 4W4KA 3HKBA 1YJNV 2EIMC 2PF4E 2XT9A 5BR8O 4JI0B 3B09A 1DK1A 1YJWV 2UXBO 2JRIA 1Y6XA 4H13B 3JD2A 4FFBB 5H6RA 2YDEA 4U3FH 5EZYA 4PA7A 1KQSU 5LGUA 4A5UB 2JGUA 2MW2B 4JI3B 4KUMA 1OCZB 1N33B 1PNMA 4J11A 4NXNO 1WN7A 1H2SB 1NBMG 2ZR3A 1MZEA 1Y74B 2ZNIA 1NS1A 1OCCB 1OCOC 1VF6A 1QR9A 4LFAO 4CH6A 3RWRD 3S3XA 5KA6A 1COWG 1HW7A 4DR6O 2XHBA 1I5XA 5IYCO 1EM1A 4OGQB 2NLJC 3D8CA 1NVPB 1K5SA 1OZ0A 1YHQV 5D5PA 4X89A 4LH7A 3EHBB 2ADPA 4GX0A 4JYCA 4JAVA 1R6KA 3ZRSA 3SYCA 2QWNB 3GWOA 4LF6O 1VF5B 1K34A 1FXKA 2AZ2A 3CC2V 1NQTA 3LSSA 2LW7A 1H2GA 1GO3F 2H8PC 3G71V 4JI8O 5L3DA 5B1BC 4DV7B 4DV5O 3CSXA 3KKYA 2F43G 3ZMZA 5TISZ 4IIJA 4DK0A 1G4YB 1YTFB 3QO7A 2YC0A 3T4DA 5CA1B 2Z0AA 2P22C 4UCTA 1BHAA 3E22B 2AZ0A 5JQGB 2CTRA 4RQEA 1KMIZ 4J7KA 5ITZA 1VF6C 1VQ8V 4DR4O 4LFCO 2KB1A 2A9HA 2WLMA 1BT8A 5EZYB 3CRMA 5KX5A 5CB4B 3STLC 3F5TA 1M4UA 4PDMA 1KUQA 4HYOA 1IXBA 4K8ZA 3ZIAG 2OCCB 4LF9B 5JCOC 3B8NA 1HP8A 2QM4A 5CBHA 1W0JG 2IH3C 1QNMA 1TUEB 4GX5A 2CE4A 1L0LH 3AG4B 1D2DA 1SESA 2ILMA 3ZRVA 5LHGA 1GTOA 1WA8A 1GM7A 4YY3B 1LUWA 1IURA 1BCCH 1D5NA 3P3NA 1ZLZA 2UXNA 1K8AW 3JAWA 2DWEC 4DR5O 3K79A 1RSOA 1EZVH 3OUSA 4FVMA 2K9PA 4ZOLA 2R9IA 4TV8A 2DQ3A 5JJNB 3CJHB 1SZXA 1FYJA 2W6JG 1GN4A 2ZDIC 3ZN0A 1NJIW 3CRQA 4KHPB 5BY1A 2DYSC 3E2EA 3FB6C 1N32B 2R72A 1KD1W 4UV8A 1AI5A 4EFBA 4DV5B 2FB5A 4JAAA 3BAAA 3AG1B 2LW1A 2XAQA 2XNDG 3RYCB 1WLEA 1BZKA 1QU7A 4Q6GA 4PELA 1NU1H 3JALA 4MVSA 3DC5A 3B2EE 1JVMA 1M56B 5IT9N 5DM6V 1K92A 3RW0A 3RYHB 5FLXN 3JARA 2YICA 1R1BA 3JCUZ 1OCRC 5LXTA 3OR7C 4UFZA 3CCUV 2F4VB 3BRCA 3E8HA 4IYIA 1VMGA 4X66O 2B1GA 2EX3A 4Z1VA 1OHHG 2F66C 3H01A 3SPIA 3MD0A 3OTOO 3CCMV 3CCLV 2HG5C 1AR4A 1JJOA 1H8HG 2KKWA 2UXCB 2PGGA 3K5LA 4RUEA 4O4JB 4WFEA 1R3IC 3CRCA 2UXDO 1EZJA 5DECA 2A06H 4I0XB 4JASA 5CMUA 3TGUH 3MAQA 1WPBA 3JD4A 4UB8Z 1FFTB 4J9YB 3SR2C 3RYIB 4UXNA 1NI8A 3D3QA 1P49A 1ZWIC 4LFCB 1D5AA 1NTKH 3ETEA 3X2QB 4JZ2A 5LOVA 4LF8O 4MTXA 4YJ2A 2GSMB 4PJ0Z 4MW3A 5GW7A 2B9ZA 4NTYA 4FM2A 1L8DA 3D36C 4DUYO 1BL8A 4LBEC 3GB7C 2QA4V 2QEXV 4LF5B 2EIKB 1GH6A 1J95A 4BW5A 3I55V 4DRXB 1MNGA 1K97A 1OCOB 4LNUA 5J2UB 3TXSA 1SF9A 5EK0A 1YEWA 3RVYA 2WA4A 2YUAA 2VWJA 4FK5C 2LQTA 3HKBB 1PP9H 4PHZA 2R9RB 1AROP 2ZT9B 5LL6Y 4DUZO 2XUMA 2BTQB 1AP5A 2MK3A 2VRZA 1Q6IA 4X8AA 1J5EO 3ZHRA 3HKCA 3IAYA 1XMOO 4TSFG 2VWKA 4XBFA 3N27A 2X6BA 5CB4A 2XAFA 5B1NA 3R65A 3H9VA 4X65B 3JAWB 1K9MW 2E74B 1N0JA 4EFEA 2XAHA 2C2AA 4K8XA 1JPXA 4K3AA 1N32O 3CEIA 2BTOA 1GAXA 1U97A 1EN4A 4O4HB 4D7SA 1EN5A 2L6LA 4I0XA 4H44B 1BGYH 1FKAO 2ZD9A 2JK5C 1WP7A 2CGOA 3E83A 2D2CB 1Y76A 5IJ0A 1JFFB 3ZHSA 5D5QA 4X1YB 1RPRA 2YI8A 1SERA 3FYEB 4U7OA 2LJ2A 3KCXA 2DOSA 1SQVH 4O2BA 1Q8IA 2DQ0A 1I0HA 4FLTA 1THZA 3KZIZ 2E5LO 3K0DA 4CZZA 1MG1A 4J7ZA 3BY6A 4FZ1A 4UCRA 1VQ9V 2ZE8A 4G28B 1LUVA 3K5MA 5LXTB 2W0FC 2Z5UA 1Y67A 3ZX6A 3UT5A 4PDLA 1UPGA 1SRYA 5H6QA 2IJKA 5IYZB 2E75B 2HLDG 1H2NA 3VBBA 1NVPD 3BVOA 3BCCH 3T1CA 2EBOA 4AQYB 1IBLO 1I5YA 1SQBH 5CA1A 3IC7A 5L3BA 3A8TA 4MW8A 1FFXA 4OPAA 4EB6A 1JQ0A 5EC2C 4J7JA 2FL4A 4GKKO 2E3CA 1FAFA 4JYAB 3WB1A 5CA0B 2ADQB 1ZAUA 4HNAB 2JIZG 4IL6Z 2IJJA 4DR1B 4MS2A 2YEVB 1R6NA 5L3GA 3D36A 1Q3EA 3E8GA 1WJZA 2JDIG 2A79B 1FXVA 4MT8A 3K08A 2HR3A 1AJPA 1KECA 4UB6Z 1I94O 4DR1O 4G2KA 2DE0X 2ZE6A 2Y69B 3CMAV 3FB5C 1KYOF 1EBOA 5J2TB 1IXMA 1FPOA 5LHHA 1P4RA 5DN6G 1Y66A 5DEDA 1S76D 1SQFA 2JGDA 3CB2A 2Z3YA 3A0HZ 4D6TH 1WPXA 3OMIB 1MA1A 4KP4A 4DV1B 5IY5B 4B3TO 4CS2A 3JYCA 1F51A 3DGEA 1ZL8B 2XAJA 5C8YA 2Y4UA 5KA5A 3ZS8C 4UCUA 3RYHA 3CRRA 5KHIA 1IBKO 1IBLB 1IDSA 5L3EA 1JJ2U 4B3MB 4PV1B 1QLEB 3L70H 4WFGA 1BS3A 2HVKC 4QJFB 2O57A 4TWKA 4UVBA 3W7TA 3EXAA 2JJ1G 4P30A 1AI7A 5BMVB 3CE2A 4KL1A 3K3WA 4LCUC 3JSNA 1AR5A 3UCSC 2UUBO 3FAVB 3HB3B 5B5EZ 1N4CA 4GKJO 1FFXB 3SYQA 2JEUA 3OMAB 4X9QA 3S3WA 1L0NH 4HBNA 4X1IB 2Q7GA 3CX5F 1GK9A 2EIKC 4JI3O 4FPPA 2EULA 5E79Z 1NR1A 2DYRB 1CP9A 3WG7B 4LF4O 3ICXA 5BR8B 1S72V 1HWYA 3N2KB 1RSOB 4B7KA 2JVDA 4JI7O 3T1YO 1KC8W 4O2BB 4J10A 4TT3G 3U11A 1GN6A 1R3KC 4HZ3A 3OFNG 2LO1A 2UXCO 2YIAA 5CN0A 1VQ7V 4R6ZA 2IJIA 1FXKB 3H1KH 1U96A 4I9QA 2EIMB 1LNQA 2UUCO 3BA8A 3WG7C 4JI2B 5LMNO 4JV5O 4NB5A 4JTDB 4LFBB 4P2ZA 1ZUQA 2DJVA 2GUZA 2GUZB 2ZIMA 2N04A 5LYJA 4ZI7B 4GZRB 4X62B 2A3QA 4CH4A 1M90W 4I50B 3W7XA 2X7RB 4F6RA 4DV1O 2UXXA 1AILA 2W6IG 2FKXA 3JAKB 3JASA 2Y0PA 2CTQA 1XHZA 5KUMA 3HKDB 4PDVA 5JH7A 1ZSPA 3CCVV 1XBLA 2V1DA 3DC6A 2YIBD 3K58A 4MVMA 2HFEC 1YZBA 1S77D 1VQLV 5CBFA 4HNAA 4NVPA 3ABMC 4PDRA 2EIJB 4QIWF 4Q20A 3Q4HB 3RT3C 4WFAV 2FYUH 3AEIA 4MTFA 4JYAO 2OTLV 3N2GB 4QNHB 2OWOA 4JI6O 4FLUA 3WFVA 5F2VO 3UKMA 3CCQV 3BA9A 5CBGA 1URFA 3JCZA 3A2FA 1I7FA 3ZMUA 1GRJA 1Q5OA 4MTGA 2PTMA 5BZBA 1VF7A 1NTZH 3OEEG 5IJ9B 4DV4O 1P84F 5IJ9A 1KBHA 3L9DA 4FFKA 2EZPA 4TQDA 1E1RG 2QWOB 2F95B 3OTFA 3FD9A 3OTOB 3IGAC 5KAFZ 3L71H 5KUKA 1VQOV 1GM8A 2GHYA 1XHXA 2WPDG 2UXDB 2AHYA 2KG7A 2ZCEA 2UUAO 4LF7O 5IJ0B 1DLBA 5E1AC 3ZHUA 3ML0A 1E79G 3LNMB 3CRAA 4IIJB 4J9ZB 3SPJA 3CWBH 4DV6O 1IZ3A 4GX1A 1M57C 3K9AA 3F7YC 1CEZA 4RUFA 2IBZH 2AHZA 5IWAB 3BABA 2ITDC 5KHGA 3E8FA 1JA8A 3HKCB 3HKEB 1FS0G 2GBOA 5GTHZ 5B3SC 5JWPA 1HNZB 1PL4A 1VQ4V 4QPKA 2HJFC 3LSUA 3UT5B 4JZGA 4BIZA 1Q81W 2BOBC 5B1BB 3IC9A 5BMVA 3SPCA 4FM1A 3J80N 4UVAA 2ZINA 2Q4PA 1H2LA 2DMXA 3WB0A 3K9SA 4J41A 5JCOA 1ZTEA 3K06A 3MHHC 3U0ZA 1XNQO 2A7WA 4FZ0A 2EZOA 4EEQA 3CCSV 2ZM6O 1JFFA 4JV5B 4O4IB 3AK1A 5J9PC 2D3OW 3H1IH 3APQA 1XMOB 4FMTA 1B6QA 5LP6B 2Y69C 1P7GA 4I7ZB 2EILC 1R3JC 3N2KA 4QGPA 3ZN1A 1FXKC 3CYOA 5LBQA 1DF4A 3JD1A 1N0NA 5HFLA 1N36O 3M99B 1NTMH 4NXMB 1V9PA 5JQGA 2B1IA 4DR3O 2JS5A 4DK1A 4TQFA 4FM0A 4JI5B 1GMGA 4KHPO 1A32A 5K1XA 4DR3B 4ZOLB 1NH2D 5KX5B 3CCJV 3TETA 1SC5B 1N34B 4YIOA 4XDLA 2WWWA 1SKVA 3E8BA 1R73A 3W7WA 5EIBC 2QSAA 3ETGA 1MZFA 1S5LZ 1AVMA 4UCVA 2Q7EA 3ABKC 1BQZA 2E5LB 1ZL8A 2P5OA 1V55B 1P7BA 3ZJZA 3FX7A 4ZI7A 2CDYA 3K04A 1KKDA 4JI4B 4Z2WA 4PD4F 4I50A 3J7AU 3STZC 2RNBA 3DXRB 4F6EA 1YCIA 3LSQA 3QNEA 4WFHA 4DV0B 2JJ2G 3A0RA 1JCHA 1YSCA 2PI5A 4DW1A 3L72H 3G6BA 1F23A 3FAVA 3K03A 4U7NA 3UO3A 1NKDA 3X2QC 2OTJV 5JVDB 4C7UA 5EBMC 4NXMO 3CMEV 1XNQB 1N36B 3RYIA 1KP2A 1US6A 1HNXB 4DR2O 2B5UA 1HDJA 5IYDO 4YXWG 4DUZB 3ABLC 4IHJB 3RYCA 3TK1A 4B3RB 2P06A 4CBCA 3ZMVA 2EJ7A 1ENVA 3E89A 4IGGA 3SDLA 2Q6AA 2DN9A 3LNNA 3OUFA 4JI4O 1K7DA 4DRXA 5JJJB 2GV9A 1Q90D 1QHTA 1SQQH 3OE7G 5FPOA 5LGNA 2OIGA 2WLLB 2RN9A 4DR7B 2WLLA 1FD9A 3W7UA 4NYKA 1VQ6V 4NKGB 3SYOA 4JAUA 4LFBO 3SJQC 3CC4V 1PPJH 1VEWA 4X64O 2OIEA 2IW5A 3OAAG 2X6AA 2WLKA 5KMGA 5LA6A 3AG1C 1F4NA 1DTOA 4NTWA 2HHHB 2LFSA 4LF9O 2ZQMA 4X1KA 3UM7A 4PA6A 2P6JA 2IM9A 4X1KB 3CS5A 1IX9A 3G4SV 5K1PA 3I5DA 1Q7YW 1PM9A 3ZEDA 4FLZA 4QPJA 2PYLA 4MVQA 3J81N 5JJEB 3N2GA 2DW4A 3ETQA 4K35A 2Q68A 4DR4B 4LC1A 4O2AB 4TV9A 4CS4A 3K5NA 3L73H 2R9AA 4I5SA 4DV4B 1SS3A 1RPOA 2H3OA 2ZXWB 2BSKB 5KLVH 5IYZA 3D3IA 4GKJB 4H0LB 5BXZA 1QBZA 2YIDA 2CUGA 3ZRWA 1HNZO 1XL6A 2QWQB 5KHHA 2Q5ZA 4X62O 1DF5A 5GONA 5GONB 2Q73A 1QQCA 2JEXA 4WFBV 3U10A 3K5OA 1VP7A 2OCCC 5CA3A 2NNUA 1RFYA 3L74H 3W7SA 4JPRA 4LF6B 2EILB 4R7CA 4DV7O 1QVFU 4XDJA 4WF9V 3MDSA 3JAMN 2P67A 1XILA 3ABTA 4LR3A 1TUBB 4LFAB 1JX9A 2F93B 4UVCA 2DYSB 4ZIBA 5B66Z 5B1AB 1NZ6A 5IE9A 4FLVA 4YHHB 1WAZA 2Y48A 2KQXA 4I55B 3OGIB 4WBNB 3ZMSA 1K4DC 4DV6B 4I4TB 3ZCCA 1H2MA 4E2LA 1YDXA 2QWRB 4DV2O 3BEHA 3AG2B 4DXWA 3H1JH 4R8CA 4DR6B 4IT5A 4GUNA 3QO8A 3KCYA 4XDKA 5IDJA 5LMNB 1MABG 3L75H 1XQ8A 5EC1C 3C90A 4JYBA 1VQPV 3RGBA 3OGCC 3GWKC 2EJRA 4LF8B 5A9GA 3M7MX 1RP3B 1L1FA 3FFQA 5EIBD 2ITCC 3QVNA 3CCRV 4RO2A 3AG4C 3ZHQA 4JI6B 3VQWA 1AJQA 1GN2A 5LP6A 5LHIA 4PI0A 1ORQC 1S0VA 1XMQB 1YF2A 1VQ5V 3CP1A 4MTOA 1QVGU 2CH7B 2Y4TA 1YI2V 2LGWA 2QDOA 4X1IA 4LWSA 4NR1A 4RQFA 1M93A 3JASB 4JTCB 4B08A 5JH7B 1GM9A 1S3JA 1PKXA 3AG2C 4KFMA 5C8YB 3HKEA 4DV2B 1SZTA 2RCVA 2W0XA 4JI2O 5CA0A 3F7VC 4QE9A 1VQNV 4GYCB 4CC6A 3TCUA 3CJHA 3E22A 3E35A 3VQXA 3WU2Z 3RBZA 3MHSC 3K59A 1Y74A 4N21A 1XEQA 4QE7A 3O9OA 2ETNA 4O4HA 2RDCA 3FYIB 2XTAA 2UUCB 4D7TA 5IYBO 3E86A 2LFRA 5IWAO 2GDSA 2IU3A 1KKCA 2HP8A 4RAIA 3IFXA 1VQMV 1E1QG 3OD4A 3ASNB 3BPZA 2X6CA 1W2BU 1YVWA 4ASUG 1I94B 1BMFG 4X20A 3ABUA 1UJWB 2Q69A 2QTOA 3ZRXA 3ETDA 1ZX3A 2YXLA 3CXCU 4KXRA 5LP6C 1WA8B 2RQ6A 3G67A 5FNVA 2HHHO 4B7EA 4FIPC 2CK3G 1VARA 3T1YB 2PY5A 5H5NA 1S5HC 4P9OA 5J2TA 3SYPA 4GX2A 2VQEB 1WNSA 1G8MA 1RM1C 4TOIA 1YITV 4JI1B 1Q43A 4O4JA 1TUBA 4OPHA 2JS3A 2WA3A 4G27B 4IHJA 5GTIZ 2QKSA 1O9HA 4JI5O 4CH3A 2ZDIA 4UUJC 2JGDB 3AG3C 4EB6B 3SJBC 2V4DA 5LA6B 1CPYA 1BE3H 2CGNA 5ITZB 1M1KW 4EKWA 1AB3A 4AQYO 3SJCC 2AXTZ 1V55C 4TV8B 1NH2B 3JAKA 2ODMA 4B3MO 1B3QA 4L87A 3NXSA 4DW0A 5LMUO 4IYHA 2P90A 3SGIA 2HKOA 2WLJA 2LGQA 3B77A 1SQGA 4P9PA 2YXHA 4JGSA 4X66B 1SA0A 2ZR2A 1AI4A 1V54B 4PI2A 2ZIOA 3APOA 2PI4A 4I4TA 4B3RO 1M9NA 3CHXA 3OM3B 3LDEA 3RFRA 2WLHA 4O4LA 3AK2A 3DTUB 4O4LB 3P3PA 4YJ3B 2CTPA 3JD0A 3QTCA 4MVRA 4RWUA 5FL7G 1QR8A 2F23A 4I9WA 3UQ8A 4UCSA 4DV3O 1I08A 4LP8A 3K57A 3BHPA 1RM1B 3QF7A 1OCCC 2IU0A 3NR7A 1UFIA 3FB7C 3B8MA 4DO2A 3K0GA 4TUYB 2ZXWC 4TUYA 4GT1A 2CAZC 4ABMA 3R66A 4JI7B 4X64B 2BCCH 1HNXO 1PNKA 4DV0O 1PV0A 1W0KG 2PZSA 4BR6A 2Q8VA 1IBMO 5AG2A 3DSQA 4W4LA 2YXYA 2IH1C 1H8EG 3G6EV 4B3SB 1Z5WA 2DWDC 1QCEA 5LOVB 4U3JA 4YJ2B 2P7TC 4E4EA 3H1LH 4FLYA 4BWAA 1MSDA 4WFFA 1N34O 2F4VO 2QKCA 3AK3A 1BQ0A 2QJ1A 3SYAA 3JATB 1M5IA 4AHCA 2Q0OC 4B3SO 3JARB 4JTAB 3SPHA 5J2UA 2UXBB 2NR5A 5C93A 3EVKA 5FNVB 1IBKB 4X65O 2KG7B 2WAMA 3B40A 1K5QA 4DV3B 3TJTA 2NN4A 1B04A 1SQPH 1B06A 1WB8A 4CS3A 1TA8A 5B1AC 2ARHA 4MVZA 5KHJA 1KB9F 2XAGA 2R70A 2GTAA 4H33A 4FJCC 2AW9A 2ZE5A 5B3SB 2VQFB 1Y4MA 2ATKC 3I56V 3HKDA 4CH5A 4DR7O 4X1YA 2BE3A 3OR6C 2LP7A 3OT7A 3SPGA 2E76B 2CTWA 1S5JA 4OXSA 2QM7A 4LNUB 2PUSA 2KSDA 2EINC 1SQXH 1PNLA 3GVMA 2IJHA 3CCEV 2HEPA 1PD3A 2RMKB 1YXBA 1LR1A 5H2FZ 3OW2U 2F1MA 1N8RW 3OMNB 4DR5B 4HAMA 3F5WC 1ROPA 4GLXA 2DYRC 5KAIZ 4CC5A 1TGOA 3VQYA 5LMUB 3OEHG 1DGSA 4FLWA 3AG7A 4O4IA 2QE7G 3ASOB 3CXHF 4BW9A 1AI6A 2QM8A 4FLXA 1YIJV 4DUYB 2UUAB 2VQFO 1KU9A 1Q6HA 2VS0A 2FTKA 1WB7A 3TXQA 3ABMB 1FJGB 1QLEC 2FMLA 2OYQA 1H2KA 2P4KA 2WLIA 4YIPA 2Y0IA 2YS8A 1TVKB 3CD6V 5H9CA 1YTFD 1XI1A 3JSLA 1N33O 3BFRA 3DXRA 2QTSA 3O65A 3ABLB 2Q67A 1FJGO 1T5EA 5L3CA 2Q9LA 3RYFB 4PA3A 3P30A 3ZRWB 2G38A 2P4VA 3HR0A 1XUQA 3G80A 5B1OA 4LF7B 1NR7A 4MVOA 3FKSG 1TAEA 1Z5VA 2M6YA 2XOKG 3LDDA 4L8JA 1G6UA 1K33A 3ASOC 4ZHQB 1PL0A 1XDCA 3EFFK 4JF3A 1BHBA 1M57B 3T2MA 1SETA 1H38A 4J42A 4MVUA 5L3FA 4X88A 1M56C 4YHHO 1YJ9V 2M7WA 4PA9A 1HNWB 2ZM6B 1OCZC 1WP8A 4JI0O 4DR2B
chains in the Genus database with same CATH topology
1ORQC 1OCRC 5BZBA 1S0VA 3OR7C 1XL4A 3CCUV 4PA4A 3CP1A 3OEEG 4MTOA 1QVGU 1VQ5V 3E8HA 4BAYA 2EZPA 1YI2V 1E1RG 2B1GA 4RQFA 1MSWD 1OHHG 3H01A 3IGAC 3SPIA 4JTCB 3MD0A 5KUKA 3CCMV 3CCLV 1GM9A 1S3JA 1PKXA 2HG5C 3AG2C 2WSSG 4KFMA 1VQOV 3AG3B 1H8HG 1GM8A 2GHYA 4R50A 4RUEA 1QLNA 4WFEA 1SZTA 1R3IC 1EZJA 2WPDG 2AHYA 1VQKV 3F7VC 4JASA 4QE9A 1VQNV 5CMUA 3ABKB 3TCUA 3JD4A 3E35A 3PJSK 1FFTB 1DLBA 4J9YB 5E1AC 2EIJC 4BIUA 4UXNA 3RVZA 3RBZA 3VOUA 1ZWIC 3JD3A 3MHSC 3ML0A 2EINB 1E79G 3LNMB 2YSUB 3ASNC 3ETEA 3X2QB 5HFMA 1K73W 1GKFA 4N21A 4J9ZB 4MTXA 3SPJA 2WLIB 2GSMB 4QE7A 4MW3A 5LGTA 4WCEV 4GX1A 5GW7A 3FYIB 1M57C 1AJNA 3K9AA 3P32A 1Q82W 3F7YC 1CEZA 4RUFA 2AHZA 1BL8A 4LBEC 1FXHA 3E86A 5IYBO 2ITDC 3GB7C 2QA4V 2LFRA 2QEXV 2EIKB 2IU3A 1J95A 3E8FA 4BW5A 1V54C 3I55V 4RAIA 1FS0G 3IFXA 2HVJC 4ZKIA 5B3SC 3QO5A 3T4ZA 1K97A 1VQMV 1E1QG 1OCOB 1VQ4V 3ASNB 4QPKA 2HJFC 2X6CA 1W2BU 2OT5A 4ASUG 5EK0A 2K1EA 3RVYA 1BMFG 1UJWB 3ABUA 2Q69A 4BIZA 2QTOA 3ZRXA 1Q81W 4FK5C 2BOBC 3ETDA 3CXCU 2R9RB 5B1BB 2V7QG 1AROP 3SPCA 4FIPC 4UVAA 3LUTB 2CK3G 4GCZA 1S5HC 4P9OA 2MK3A 3SYPA 4GX2A 3K06A 3MHHC 3CCSV 2EZOA 4X8AA 1G8MA 1RM1C 1YITV 5J9PC 2D3OW 1R3LC 4FMTA 2XASA 1B6QA 4TSFG 2WLNA 4G27B 2Y69C 4XBFA 2X6BA 2QKSA 3FB8C 2XAFA 4F4LA 5B1NA 2EILC 1R3JC 3R65A 3ZN1A 1FXKC 3CYOA 5LBQA 1DF4A 2ZDIA 3JD1A 4UUJC 5HFLA 1K9MW 3AG3C 3M99B 2XAHA 4Z1MG 1CPYA 2C2AA 2B1IA 1JPXA 1M1KW 1K3EA 4EKWA 1GMGA 4N23A 1V55C 1NH2B 1NH2D 1EFRG 3CCJV 5IY5C 2ZD9A 4MSWC 1AR1B 2JK5C 3TETA 3E83A 4L87A 3NXSA 4XDLA 2WWWA 2P90A 4UV9A 2X0LA 3E8BA 2HKOA 1R73A 2WLJA 1RPRA 3W7WA 3B77A 1Q86W 2H94A 1SERA 3FYEB 3HPLC 4U7OA 3ETGA 2YEVA 3CC7V 4P9PA 3ZMTA 4JGSA 2BOCC 2DQ0A 2ZR2A 1AI4A 1V54B 1THZA 2PI4A 1MOFA 1M9NA 3ABKC 3K0DA 1JOYA 4CZZA 3CPWU 1MG1A 3OM3B 1V55B 3LDEA 1P7BA 3BY6A 1OCRB 3LDCA 3ZJZA 3K04A 1KKDA 2WLHA 1VQ9V 3DTUB 4G28B 4H37A 1F4MA 1K4CC 3JD0A 3KG2A 3STZC 2W0FC 4MVRA 2Z5UA 4PDLA 4ZBMA 5FL7G 1QR8A 4I9WA 5EBLC 5H6QA 1SRYA 2IJKA 3LSQA 2A0LA 3QNEA 5EBWC 2HLDG 4WFHA 1KP3A 3VBBA 4LP8A 1NVPD 1YJNV 2JJ2G 2EIMC 3A0RA 1JCHA 1YSCA 2PI5A 3T1CA 2EBOA 1RM1B 1OCCC 2IU0A 1F23A 1I5YA 3K03A 3IC7A 4U7NA 5L3BA 1NKDA 3X2QC 1YJWV 2OTJV 3FB7C 4MW8A 3B8MA 4DO2A 5EBMC 3K0GA 2ZXWC 1JQ0A 5EC2C 3CMEV 4GT1A 1KP2A 3JD2A 2B5UA 1PNKA 5IYDO 5H6RA 4YXWG 1W0KG 3ABLC 4PA7A 2JIZG 1KQSU 3TK1A 5LGUA 2IJJA 3ZMVA 4CBCA 1ENVA 3E89A 4MS2A 2YEVB 1R6NA 5L3GA 4KUMA 3D36A 1OCZB 3E8GA 2IH1C 1PNMA 1H8EG 2JDIG 3G6EV 2A79B 1FXVA 2DWDC 2Q6AA 1NBMG 1QCEA 2ZR3A 2HR3A 3K08A 1AJPA 1KECA 4MT8A 1OCCB 2P7TC 3OUFA 1K7DA 1OCOC 1QR9A 4G2KA 4WFFA 2Y69B 5KA6A 1COWG 3CMAV 3FB5C 3OE7G 5LGNA 1EBOA 2WLLB 1IXMA 3SYAA 2WLLA 5LHHA 1I5XA 1P4RA 5DN6G 5IYCO 1Y66A 2NLJC 4JTAB 3W7UA 1S76D 3SPHA 1VQ6V 1NVPB 1K5SA 1OZ0A 3SYOA 1YHQV 2Z3YA 4JAUA 5C93A 4X89A 3SJQC 3CC4V 3EHBB 1WPXA 3OMIB 4KP4A 4GX0A 5IY5B 4JYCA 2WAMA 4JAVA 2IW5A 1K5QA 3OAAG 1R6KA 2X6AA 2WLKA 3ZRSA 3AG1C 1F4NA 3JYCA 1DTOA 1F51A 2XAJA 3DGEA 3SYCA 5KA5A 3GWOA 5B1AC 2LFSA 1K34A 4MVZA 1FXKA 2ZQMA 3CC2V 3UM7A 4PA6A 2P6JA 2XAGA 5L3EA 4H33A 1NQTA 3G4SV 4FJCC 1JJ2U 3LSSA 5B3SB 1H2GA 1Q7YW 1GO3F 1Y4MA 2H8PC 2ATKC 1QLEB 4QPJA 3G71V 5L3DA 5B1BC 3I56V 4MVQA 2F43G 4WFGA 3ZMZA 2HVKC 4QJFB 4TWKA 2DW4A 4UVBA 2Q68A 3OR6C 3W7TA 4LC1A 2LP7A 2JJ1G 4I5SA 3SPGA 4P30A 1AI7A 4OXSA 1G4YB 1YTFB 3QO7A 3K3WA 2QM7A 4LCUC 1RPOA 2ZXWB 3D3IA 3T4DA 3HB3B 2EINC 3SYQA 2JEUA 1PNLA 1BHAA 3OMAB 2IJHA 3CCEV 1PD3A 4RQEA 1QBZA 3ZRWA 1XL6A 2EIKC 1GK9A 3OW2U 4FPPA 1VQ8V 1N8RW 2KB1A 2A9HA 3OMNB 2WLMA 1NR1A 2DYRB 1CP9A 3WG7B 4HAMA 3F5WC 1DF5A 1ROPA 2DYRC 3STLC 1S72V 1HWYA 2JEXA 4WFBV 4PDMA 1KC8W 2OCCC 4TT3G 3OEHG 4HYOA 5CA3A 2NNUA 1R3KC 3ZIAG 4HZ3A 2OCCB 3OFNG 3W7SA 5CN0A 4JPRA 4R6ZA 1VQ7V 2EILB 2QE7G 2IJIA 3B8NA 3ASOB 4R7CA 1FXKB 1AI6A 2QM8A 5CBHA 1YIJV 1W0JG 2IH3C 2EIMB 1TUEB 4GX5A 1LNQA 3WG7C 1QVFU 4XDJA 4WF9V 3AG4B 2FTKA 2P67A 3ABTA 1SESA 3ABMB 4JTDB 1JX9A 3ZRVA 1QLEC 4P2ZA 5LHGA 1GTOA 1GM7A 2DYSB 4UVCA 2WLIA 3CD6V 5H9CA 1YTFD 5B1AB 2UXNA 1M90W 1K8AW 2DWEC 3W7XA 3K79A 2X7RB 2UXXA 2Y48A 3OUSA 2Q67A 3ABLB 2W6IG 3ZMSA 2R9IA 1K4DC 5KUMA 5L3CA 2DQ3A 4PDVA 3CCVV 3ZCCA 2V1DA 4PA3A 4E2LA 2W6JG 3BEHA 3P30A 2ZDIC 3ZRWB 3AG2B 3ZN0A 4MVMA 4DXWA 1NJIW 2HFEC 1S77D 2DYSC 1VQLV 3E2EA 5CBFA 5B1OA 3FB6C 4R8CA 3ABMC 4PDRA 2EIJB 4QIWF 1NR7A 4Q20A 3QO8A 4MVOA 3FKSG 2XOKG 3LDDA 1KD1W 4XDKA 4UV8A 1AI5A 4WFAV 3AEIA 5IDJA 1MABG 4MTFA 3AG1B 2OTLV 1K33A 2XAQA 2XNDG 4QNHB 3ASOC 5EC1C 1WLEA 4JYBA 3WFVA 1PL0A 1BHBA 3EFFK 4JF3A 1M57B 3T2MA 3UKMA 3CCQV 1VQPV 3OGCC 5CBGA 1SETA 4PELA 2EJRA 1H38A 4MVUA 5L3FA 3JCZA 4X88A 1M56C 1YJ9V 2M7WA 1L1FA 4MVSA 2ITCC 4PA9A 1JVMA 1M56B 3CCRV 1OCZC 3ZMUA 5DM6V 4RO2A 4MTGA 1K92A 3RW0A 3AG4C 1AJQA 5LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB1 A;  2A9H A;  1ORQ C;  1OCR C;  2WLN A;  2WLM A;  3OR7 C;  1XL4 A;  4G27 B;  2Y69 C;  5BZB A;  2X6B A;  2QKS A;  3ABL C;  3FB8 C;  4PA4 A;  4PA7 A;  3F5W C;  4MTO A;  3E8H A;  4CBC A;  2DYR C;  3STL C;  4F4L A;  3E89 A;  2EIL C;  1R3J C;  4MS2 A;  3R65 A;  4PDM A;  3E8G A;  2IH1 C;  4UUJ C;  2A79 B;  3AG3 C;  3IGA C;  4JTC B;  2OCC C;  2DWD C;  2Q6A A;  3SPI A;  4HYO A;  3K08 A;  5KUK A;  1R3K C;  2HG5 C;  4HZ3 A;  3AG2 C;  4KFM A;  2P7T C;  3OUF A;  1OCO C;  4R50 A;  4R6Z A;  4RUE A;  4EKW A;  4WFE A;  1R3I C;  4R7C A;  4WFF A;  2AHY A;  5CBH A;  2IH3 C;  3F7V C;  1V55 C;  3FB5 C;  4QE9 A;  4GX5 A;  1LNQ A;  2WLL B;  5IY5 C;  2ZD9 A;  4MSW C;  3TCU A;  3WG7 C;  4XDJ A;  2JK5 C;  3SYA A;  2WLL A;  3TET A;  3E83 A;  3PJS K;  4J9Y B;  4XDL A;  5E1A C;  2EIJ C;  4JTD B;  3RVZ A;  2NLJ C;  4JTA B;  3RBZ A;  1QLE C;  1ZWI C;  4P2Z A;  3E8B A;  3VOU A;  3LNM B;  2WLJ A;  3ASN C;  3SPH A;  3SYO A;  2WLI A;  4J9Z B;  3SPJ A;  2WLI B;  3HPL C;  4QE7 A;  4X89 A;  4MW3 A;  2YEV A;  3SJQ C;  4P9P A;  2DWE C;  4GX1 A;  1M57 C;  2BOC C;  4GX0 A;  3F7Y C;  3OUS A;  4RUF A;  2Q67 A;  1K4D C;  2AHZ A;  1BL8 A;  4LBE C;  5KUM A;  3E86 A;  2ITD C;  2WLK A;  2X6A A;  3ABK C;  3GB7 C;  3K0D A;  3AG1 C;  4PDV A;  3ZRS A;  3JYC A;  1J95 A;  3LDE A;  1P7B A;  3E8F A;  4PA3 A;  3SYC A;  1V54 C;  4BW5 A;  3LDC A;  3ZJZ A;  5B1A C;  3BEH A;  3K04 A;  1KKD A;  4MVZ A;  2WLH A;  4RAI A;  5B3S C;  3IFX A;  2HVJ C;  4MVM A;  4G28 B;  4H37 A;  3T4Z A;  3UM7 A;  4DXW A;  4PA6 A;  2HFE C;  1K4C C;  3KG2 A;  2DYS C;  3STZ C;  2W0F C;  2HJF C;  2X6C A;  4H33 A;  5CBF A;  3FB6 C;  4MVR A;  4R8C A;  3ABM C;  4PDR A;  4PDL A;  5EK0 A;  2K1E A;  4ZBM A;  3RVY A;  2H8P C;  2ATK C;  2Q69 A;  4MVO A;  2QTO A;  4I9W A;  5EBL C;  5B1B C;  3LDD A;  4XDK A;  2BOB C;  4MVQ A;  4WFG A;  2A0L A;  2HVK C;  5EBW C;  4MTF A;  4TWK A;  4WFH A;  2Q68 A;  2R9R B;  3OR6 C;  4LP8 A;  2EIM C;  3ASO C;  4QNH B;  5EC1 C;  3SPG A;  4P30 A;  3T1C A;  3SPC A;  3EFF K;  4OXS A;  1G4Y B;  1OCC C;  3LUT B;  3T2M A;  4LCU C;  3UKM A;  3OGC C;  5CBG A;  3K03 A;  4MVU A;  3T4D A;  3X2Q C;  3FB7 C;  4MW8 A;  4X88 A;  1M56 C;  1S5H C;  4P9O A;  2EIN C;  5EBM C;  3K0G A;  4GX2 A;  4MVS A;  3SYP A;  3SYQ A;  2ZXW C;  2ITC C;  5EC2 C;  3K06 A;  4PA9 A;  1JVM A;  4X8A A;  1OCZ C;  4RO2 A;  4MTG A;  3RW0 A;  3AG4 C;  5J9P C;  1XL6 A;  2EIK C;  1R3L C; 
#chains in the Genus database with same CATH topology
 3ZHV A;  5KHK A;  1XL4 A;  4NTX A;  4PA4 A;  4BAY A;  1XNR O;  2YI9 A;  1X59 A;  1MSW D;  1Q6U A;  4U3J B;  2WSS G;  4YY3 O;  3IJ4 A;  1XNR B;  3AG3 B;  4R50 A;  3RN4 A;  1QLN A;  4YJ3 A;  3SJA C;  2ZNJ A;  2OCH A;  1VQK V;  3JAL B;  4ICG A;  3ABK B;  4K0K O;  4X20 B;  3PJS K;  5FPR A;  2EIJ C;  4BIU A;  3RVZ A;  3A0B Z;  3VOU A;  3JD3 A;  2EIN B;  2YSU B;  3ASN C;  3ZBH A;  5HFM A;  1K73 W;  1GKF A;  4O2A A;  3C3S A;  2WLI B;  5LGT A;  4WCE V;  3JAT A;  1AJN A;  3P32 A;  1Q82 W;  3QG5 A;  2UUB B;  1O9G A;  2ZE7 A;  1FXH A;  4LF5 O;  1V54 C;  2AGA A;  1HR0 B;  4ZKI A;  2HVJ C;  2GTS A;  3QO5 A;  3T4Z A;  4AIL C;  4UCO A;  2OT5 A;  3B4S A;  5LYJ B;  2K1E A;  1Z2G A;  4JYY A;  3PN1 A;  1XRE A;  4ZHQ A;  4JI1 O;  2V7Q G;  1R6T A;  4DYL A;  3LUT B;  4JI8 B;  4GCZ A;  1GN3 A;  4BIO A;  5EYP A;  5EYP B;  3T1H O;  4NXN B;  3WB2 A;  1HR0 O;  1R3L C;  2XAS A;  4FFB A;  4AI8 A;  2WLN A;  3FB8 C;  1IBM B;  2UU9 O;  4F4L A;  4OX9 B;  2VQE O;  4K0K B;  1MMM A;  2ZKO A;  3Q4H A;  1SA0 B;  5JVD A;  2N74 A;  2RJZ A;  2QGN A;  4Z1M G;  2CH7 A;  2YIB A;  1K3E A;  4OX9 O;  1F7Y A;  2QKA A;  4N23 A;  3C3T A;  3THO A;  1JMK C;  2BTQ A;  1OV9 A;  1JR9 A;  2L35 A;  1EFR G;  1IVS A;  5IY5 C;  1AR1 B;  4MSW C;  2N05 A;  3UO2 A;  1VIB A;  3T1H B;  1J5E B;  2HJD A;  1OJH A;  1X4T A;  1W59 A;  4UV9 A;  2X0L A;  4J80 A;  1EN6 A;  1Q86 W;  2H94 A;  4LF4 B;  4GKK B;  3HPL C;  2UU9 B;  1G1X B;  1BSM A;  2YEV A;  3M8A A;  3CC7 V;  3ZMT A;  1HNW O;  1NT2 B;  2BSK A;  2BOC C;  4B3T B;  1MOF A;  3H1H H;  1JOY A;  3CPW U;  4TV9 B;  1OCR B;  2QR4 A;  2QWP B;  3LDC A;  1TVK A;  5A2Q N;  4H37 A;  2Q7H A;  1F4M A;  4LH6 A;  1K4C C;  3KG2 A;  1XOU A;  3ZHT A;  3VQV A;  4ZBM A;  3RYF A;  1AP6 A;  4F6R B;  5EBL C;  1Y76 B;  4LWS B;  2PYJ A;  4I55 A;  4WBN A;  2A0L A;  5EBW C;  1CXZ B;  5KMG B;  1XMQ O;  1KP3 A;  2Q0A A;  4W4K A;  3HKB A;  1YJN V;  2EIM C;  2PF4 E;  2XT9 A;  5BR8 O;  4JI0 B;  3B09 A;  1DK1 A;  1YJW V;  2UXB O;  2JRI A;  1Y6X A;  4H13 B;  3JD2 A;  4FFB B;  5H6R A;  2YDE A;  4U3F H;  5EZY A;  4PA7 A;  1KQS U;  5LGU A;  4A5U B;  2JGU A;  2MW2 B;  4JI3 B;  4KUM A;  1OCZ B;  1N33 B;  1PNM A;  4J11 A;  4NXN O;  1WN7 A;  1H2S B;  1NBM G;  2ZR3 A;  1MZE A;  1Y74 B;  2ZNI A;  1NS1 A;  1OCC B;  1OCO C;  1VF6 A;  1QR9 A;  4LFA O;  4CH6 A;  3RWR D;  3S3X A;  5KA6 A;  1COW G;  1HW7 A;  4DR6 O;  2XHB A;  1I5X A;  5IYC O;  1EM1 A;  4OGQ B;  2NLJ C;  3D8C A;  1NVP B;  1K5S A;  1OZ0 A;  1YHQ V;  5D5P A;  4X89 A;  4LH7 A;  3EHB B;  2ADP A;  4GX0 A;  4JYC A;  4JAV A;  1R6K A;  3ZRS A;  3SYC A;  2QWN B;  3GWO A;  4LF6 O;  1VF5 B;  1K34 A;  1FXK A;  2AZ2 A;  3CC2 V;  1NQT A;  3LSS A;  2LW7 A;  1H2G A;  1GO3 F;  2H8P C;  3G71 V;  4JI8 O;  5L3D A;  5B1B C;  4DV7 B;  4DV5 O;  3CSX A;  3KKY A;  2F43 G;  3ZMZ A;  5TIS Z;  4IIJ A;  4DK0 A;  1G4Y B;  1YTF B;  3QO7 A;  2YC0 A;  3T4D A;  5CA1 B;  2Z0A A;  2P22 C;  4UCT A;  1BHA A;  3E22 B;  2AZ0 A;  5JQG B;  2CTR A;  4RQE A;  1KMI Z;  4J7K A;  5ITZ A;  1VF6 C;  1VQ8 V;  4DR4 O;  4LFC O;  2KB1 A;  2A9H A;  2WLM A;  1BT8 A;  5EZY B;  3CRM A;  5KX5 A;  5CB4 B;  3STL C;  3F5T A;  1M4U A;  4PDM A;  1KUQ A;  4HYO A;  1IXB A;  4K8Z A;  3ZIA G;  2OCC B;  4LF9 B;  5JCO C;  3B8N A;  1HP8 A;  2QM4 A;  5CBH A;  1W0J G;  2IH3 C;  1QNM A;  1TUE B;  4GX5 A;  2CE4 A;  1L0L H;  3AG4 B;  1D2D A;  1SES A;  2ILM A;  3ZRV A;  5LHG A;  1GTO A;  1WA8 A;  1GM7 A;  4YY3 B;  1LUW A;  1IUR A;  1BCC H;  1D5N A;  3P3N A;  1ZLZ A;  2UXN A;  1K8A W;  3JAW A;  2DWE C;  4DR5 O;  3K79 A;  1RSO A;  1EZV H;  3OUS A;  4FVM A;  2K9P A;  4ZOL A;  2R9I A;  4TV8 A;  2DQ3 A;  5JJN B;  3CJH B;  1SZX A;  1FYJ A;  2W6J G;  1GN4 A;  2ZDI C;  3ZN0 A;  1NJI W;  3CRQ A;  4KHP B;  5BY1 A;  2DYS C;  3E2E A;  3FB6 C;  1N32 B;  2R72 A;  1KD1 W;  4UV8 A;  1AI5 A;  4EFB A;  4DV5 B;  2FB5 A;  4JAA A;  3BAA A;  3AG1 B;  2LW1 A;  2XAQ A;  2XND G;  3RYC B;  1WLE A;  1BZK A;  1QU7 A;  4Q6G A;  4PEL A;  1NU1 H;  3JAL A;  4MVS A;  3DC5 A;  3B2E E;  1JVM A;  1M56 B;  5IT9 N;  5DM6 V;  1K92 A;  3RW0 A;  3RYH B;  5FLX N;  3JAR A;  2YIC A;  1R1B A;  3JCU Z;  1OCR C;  5LXT A;  3OR7 C;  4UFZ A;  3CCU V;  2F4V B;  3BRC A;  3E8H A;  4IYI A;  1VMG A;  4X66 O;  2B1G A;  2EX3 A;  4Z1V A;  1OHH G;  2F66 C;  3H01 A;  3SPI A;  3MD0 A;  3OTO O;  3CCM V;  3CCL V;  2HG5 C;  1AR4 A;  1JJO A;  1H8H G;  2KKW A;  2UXC B;  2PGG A;  3K5L A;  4RUE A;  4O4J B;  4WFE A;  1R3I C;  3CRC A;  2UXD O;  1EZJ A;  5DEC A;  2A06 H;  4I0X B;  4JAS A;  5CMU A;  3TGU H;  3MAQ A;  1WPB A;  3JD4 A;  4UB8 Z;  1FFT B;  4J9Y B;  3SR2 C;  3RYI B;  4UXN A;  1NI8 A;  3D3Q A;  1P49 A;  1ZWI C;  4LFC B;  1D5A A;  1NTK H;  3ETE A;  3X2Q B;  4JZ2 A;  5LOV A;  4LF8 O;  4MTX A;  4YJ2 A;  2GSM B;  4PJ0 Z;  4MW3 A;  5GW7 A;  2B9Z A;  4NTY A;  4FM2 A;  1L8D A;  3D36 C;  4DUY O;  1BL8 A;  4LBE C;  3GB7 C;  2QA4 V;  2QEX V;  4LF5 B;  2EIK B;  1GH6 A;  1J95 A;  4BW5 A;  3I55 V;  4DRX B;  1MNG A;  1K97 A;  1OCO B;  4LNU A;  5J2U B;  3TXS A;  1SF9 A;  5EK0 A;  1YEW A;  3RVY A;  2WA4 A;  2YUA A;  2VWJ A;  4FK5 C;  2LQT A;  3HKB B;  1PP9 H;  4PHZ A;  2R9R B;  1ARO P;  2ZT9 B;  5LL6 Y;  4DUZ O;  2XUM A;  2BTQ B;  1AP5 A;  2MK3 A;  2VRZ A;  1Q6I A;  4X8A A;  1J5E O;  3ZHR A;  3HKC A;  3IAY A;  1XMO O;  4TSF G;  2VWK A;  4XBF A;  3N27 A;  2X6B A;  5CB4 A;  2XAF A;  5B1N A;  3R65 A;  3H9V A;  4X65 B;  3JAW B;  1K9M W;  2E74 B;  1N0J A;  4EFE A;  2XAH A;  2C2A A;  4K8X A;  1JPX A;  4K3A A;  1N32 O;  3CEI A;  2BTO A;  1GAX A;  1U97 A;  1EN4 A;  4O4H B;  4D7S A;  1EN5 A;  2L6L A;  4I0X A;  4H44 B;  1BGY H;  1FKA O;  2ZD9 A;  2JK5 C;  1WP7 A;  2CGO A;  3E83 A;  2D2C B;  1Y76 A;  5IJ0 A;  1JFF B;  3ZHS A;  5D5Q A;  4X1Y B;  1RPR A;  2YI8 A;  1SER A;  3FYE B;  4U7O A;  2LJ2 A;  3KCX A;  2DOS A;  1SQV H;  4O2B A;  1Q8I A;  2DQ0 A;  1I0H A;  4FLT A;  1THZ A;  3KZI Z;  2E5L O;  3K0D A;  4CZZ A;  1MG1 A;  4J7Z A;  3BY6 A;  4FZ1 A;  4UCR A;  1VQ9 V;  2ZE8 A;  4G28 B;  1LUV A;  3K5M A;  5LXT B;  2W0F C;  2Z5U A;  1Y67 A;  3ZX6 A;  3UT5 A;  4PDL A;  1UPG A;  1SRY A;  5H6Q A;  2IJK A;  5IYZ B;  2E75 B;  2HLD G;  1H2N A;  3VBB A;  1NVP D;  3BVO A;  3BCC H;  3T1C A;  2EBO A;  4AQY B;  1IBL O;  1I5Y A;  1SQB H;  5CA1 A;  3IC7 A;  5L3B A;  3A8T A;  4MW8 A;  1FFX A;  4OPA A;  4EB6 A;  1JQ0 A;  5EC2 C;  4J7J A;  2FL4 A;  4GKK O;  2E3C A;  1FAF A;  4JYA B;  3WB1 A;  5CA0 B;  2ADQ B;  1ZAU A;  4HNA B;  2JIZ G;  4IL6 Z;  2IJJ A;  4DR1 B;  4MS2 A;  2YEV B;  1R6N A;  5L3G A;  3D36 A;  1Q3E A;  3E8G A;  1WJZ A;  2JDI G;  2A79 B;  1FXV A;  4MT8 A;  3K08 A;  2HR3 A;  1AJP A;  1KEC A;  4UB6 Z;  1I94 O;  4DR1 O;  4G2K A;  2DE0 X;  2ZE6 A;  2Y69 B;  3CMA V;  3FB5 C;  1KYO F;  1EBO A;  5J2T B;  1IXM A;  1FPO A;  5LHH A;  1P4R A;  5DN6 G;  1Y66 A;  5DED A;  1S76 D;  1SQF A;  2JGD A;  3CB2 A;  2Z3Y A;  3A0H Z;  4D6T H;  1WPX A;  3OMI B;  1MA1 A;  4KP4 A;  4DV1 B;  5IY5 B;  4B3T O;  4CS2 A;  3JYC A;  1F51 A;  3DGE A;  1ZL8 B;  2XAJ A;  5C8Y A;  2Y4U A;  5KA5 A;  3ZS8 C;  4UCU A;  3RYH A;  3CRR A;  5KHI A;  1IBK O;  1IBL B;  1IDS A;  5L3E A;  1JJ2 U;  4B3M B;  4PV1 B;  1QLE B;  3L70 H;  4WFG A;  1BS3 A;  2HVK C;  4QJF B;  2O57 A;  4TWK A;  4UVB A;  3W7T A;  3EXA A;  2JJ1 G;  4P30 A;  1AI7 A;  5BMV B;  3CE2 A;  4KL1 A;  3K3W A;  4LCU C;  3JSN A;  1AR5 A;  3UCS C;  2UUB O;  3FAV B;  3HB3 B;  5B5E Z;  1N4C A;  4GKJ O;  1FFX B;  3SYQ A;  2JEU A;  3OMA B;  4X9Q A;  3S3W A;  1L0N H;  4HBN A;  4X1I B;  2Q7G A;  3CX5 F;  1GK9 A;  2EIK C;  4JI3 O;  4FPP A;  2EUL A;  5E79 Z;  1NR1 A;  2DYR B;  1CP9 A;  3WG7 B;  4LF4 O;  3ICX A;  5BR8 B;  1S72 V;  1HWY A;  3N2K B;  1RSO B;  4B7K A;  2JVD A;  4JI7 O;  3T1Y O;  1KC8 W;  4O2B B;  4J10 A;  4TT3 G;  3U11 A;  1GN6 A;  1R3K C;  4HZ3 A;  3OFN G;  2LO1 A;  2UXC O;  2YIA A;  5CN0 A;  1VQ7 V;  4R6Z A;  2IJI A;  1FXK B;  3H1K H;  1U96 A;  4I9Q A;  2EIM B;  1LNQ A;  2UUC O;  3BA8 A;  3WG7 C;  4JI2 B;  5LMN O;  4JV5 O;  4NB5 A;  4JTD B;  4LFB B;  4P2Z A;  1ZUQ A;  2DJV A;  2GUZ A;  2GUZ B;  2ZIM A;  2N04 A;  5LYJ A;  4ZI7 B;  4GZR B;  4X62 B;  2A3Q A;  4CH4 A;  1M90 W;  4I50 B;  3W7X A;  2X7R B;  4F6R A;  4DV1 O;  2UXX A;  1AIL A;  2W6I G;  2FKX A;  3JAK B;  3JAS A;  2Y0P A;  2CTQ A;  1XHZ A;  5KUM A;  3HKD B;  4PDV A;  5JH7 A;  1ZSP A;  3CCV V;  1XBL A;  2V1D A;  3DC6 A;  2YIB D;  3K58 A;  4MVM A;  2HFE C;  1YZB A;  1S77 D;  1VQL V;  5CBF A;  4HNA A;  4NVP A;  3ABM C;  4PDR A;  2EIJ B;  4QIW F;  4Q20 A;  3Q4H B;  3RT3 C;  4WFA V;  2FYU H;  3AEI A;  4MTF A;  4JYA O;  2OTL V;  3N2G B;  4QNH B;  2OWO A;  4JI6 O;  4FLU A;  3WFV A;  5F2V O;  3UKM A;  3CCQ V;  3BA9 A;  5CBG A;  1URF A;  3JCZ A;  3A2F A;  1I7F A;  3ZMU A;  1GRJ A;  1Q5O A;  4MTG A;  2PTM A;  5BZB A;  1VF7 A;  1NTZ H;  3OEE G;  5IJ9 B;  4DV4 O;  1P84 F;  5IJ9 A;  1KBH A;  3L9D A;  4FFK A;  2EZP A;  4TQD A;  1E1R G;  2QWO B;  2F95 B;  3OTF A;  3FD9 A;  3OTO B;  3IGA C;  5KAF Z;  3L71 H;  5KUK A;  1VQO V;  1GM8 A;  2GHY A;  1XHX A;  2WPD G;  2UXD B;  2AHY A;  2KG7 A;  2ZCE A;  2UUA O;  4LF7 O;  5IJ0 B;  1DLB A;  5E1A C;  3ZHU A;  3ML0 A;  1E79 G;  3LNM B;  3CRA A;  4IIJ B;  4J9Z B;  3SPJ A;  3CWB H;  4DV6 O;  1IZ3 A;  4GX1 A;  1M57 C;  3K9A A;  3F7Y C;  1CEZ A;  4RUF A;  2IBZ H;  2AHZ A;  5IWA B;  3BAB A;  2ITD C;  5KHG A;  3E8F A;  1JA8 A;  3HKC B;  3HKE B;  1FS0 G;  2GBO A;  5GTH Z;  5B3S C;  5JWP A;  1HNZ B;  1PL4 A;  1VQ4 V;  4QPK A;  2HJF C;  3LSU A;  3UT5 B;  4JZG A;  4BIZ A;  1Q81 W;  2BOB C;  5B1B B;  3IC9 A;  5BMV A;  3SPC A;  4FM1 A;  3J80 N;  4UVA A;  2ZIN A;  2Q4P A;  1H2L A;  2DMX A;  3WB0 A;  3K9S A;  4J41 A;  5JCO A;  1ZTE A;  3K06 A;  3MHH C;  3U0Z A;  1XNQ O;  2A7W A;  4FZ0 A;  2EZO A;  4EEQ A;  3CCS V;  2ZM6 O;  1JFF A;  4JV5 B;  4O4I B;  3AK1 A;  5J9P C;  2D3O W;  3H1I H;  3APQ A;  1XMO B;  4FMT A;  1B6Q A;  5LP6 B;  2Y69 C;  1P7G A;  4I7Z B;  2EIL C;  1R3J C;  3N2K A;  4QGP A;  3ZN1 A;  1FXK C;  3CYO A;  5LBQ A;  1DF4 A;  3JD1 A;  1N0N A;  5HFL A;  1N36 O;  3M99 B;  1NTM H;  4NXM B;  1V9P A;  5JQG A;  2B1I A;  4DR3 O;  2JS5 A;  4DK1 A;  4TQF A;  4FM0 A;  4JI5 B;  1GMG A;  4KHP O;  1A32 A;  5K1X A;  4DR3 B;  4ZOL B;  1NH2 D;  5KX5 B;  3CCJ V;  3TET A;  1SC5 B;  1N34 B;  4YIO A;  4XDL A;  2WWW A;  1SKV A;  3E8B A;  1R73 A;  3W7W A;  5EIB C;  2QSA A;  3ETG A;  1MZF A;  1S5L Z;  1AVM A;  4UCV A;  2Q7E A;  3ABK C;  1BQZ A;  2E5L B;  1ZL8 A;  2P5O A;  1V55 B;  1P7B A;  3ZJZ A;  3FX7 A;  4ZI7 A;  2CDY A;  3K04 A;  1KKD A;  4JI4 B;  4Z2W A;  4PD4 F;  4I50 A;  3J7A U;  3STZ C;  2RNB A;  3DXR B;  4F6E A;  1YCI A;  3LSQ A;  3QNE A;  4WFH A;  4DV0 B;  2JJ2 G;  3A0R A;  1JCH A;  1YSC A;  2PI5 A;  4DW1 A;  3L72 H;  3G6B A;  1F23 A;  3FAV A;  3K03 A;  4U7N A;  3UO3 A;  1NKD A;  3X2Q C;  2OTJ V;  5JVD B;  4C7U A;  5EBM C;  4NXM O;  3CME V;  1XNQ B;  1N36 B;  3RYI A;  1KP2 A;  1US6 A;  1HNX B;  4DR2 O;  2B5U A;  1HDJ A;  5IYD O;  4YXW G;  4DUZ B;  3ABL C;  4IHJ B;  3RYC A;  3TK1 A;  4B3R B;  2P06 A;  4CBC A;  3ZMV A;  2EJ7 A;  1ENV A;  3E89 A;  4IGG A;  3SDL A;  2Q6A A;  2DN9 A;  3LNN A;  3OUF A;  4JI4 O;  1K7D A;  4DRX A;  5JJJ B;  2GV9 A;  1Q90 D;  1QHT A;  1SQQ H;  3OE7 G;  5FPO A;  5LGN A;  2OIG A;  2WLL B;  2RN9 A;  4DR7 B;  2WLL A;  1FD9 A;  3W7U A;  4NYK A;  1VQ6 V;  4NKG B;  3SYO A;  4JAU A;  4LFB O;  3SJQ C;  3CC4 V;  1PPJ H;  1VEW A;  4X64 O;  2OIE A;  2IW5 A;  3OAA G;  2X6A A;  2WLK A;  5KMG A;  5LA6 A;  3AG1 C;  1F4N A;  1DTO A;  4NTW A;  2HHH B;  2LFS A;  4LF9 O;  2ZQM A;  4X1K A;  3UM7 A;  4PA6 A;  2P6J A;  2IM9 A;  4X1K B;  3CS5 A;  1IX9 A;  3G4S V;  5K1P A;  3I5D A;  1Q7Y W;  1PM9 A;  3ZED A;  4FLZ A;  4QPJ A;  2PYL A;  4MVQ A;  3J81 N;  5JJE B;  3N2G A;  2DW4 A;  3ETQ A;  4K35 A;  2Q68 A;  4DR4 B;  4LC1 A;  4O2A B;  4TV9 A;  4CS4 A;  3K5N A;  3L73 H;  2R9A A;  4I5S A;  4DV4 B;  1SS3 A;  1RPO A;  2H3O A;  2ZXW B;  2BSK B;  5KLV H;  5IYZ A;  3D3I A;  4GKJ B;  4H0L B;  5BXZ A;  1QBZ A;  2YID A;  2CUG A;  3ZRW A;  1HNZ O;  1XL6 A;  2QWQ B;  5KHH A;  2Q5Z A;  4X62 O;  1DF5 A;  5GON A;  5GON B;  2Q73 A;  1QQC A;  2JEX A;  4WFB V;  3U10 A;  3K5O A;  1VP7 A;  2OCC C;  5CA3 A;  2NNU A;  1RFY A;  3L74 H;  3W7S A;  4JPR A;  4LF6 B;  2EIL B;  4R7C A;  4DV7 O;  1QVF U;  4XDJ A;  4WF9 V;  3MDS A;  3JAM N;  2P67 A;  1XIL A;  3ABT A;  4LR3 A;  1TUB B;  4LFA B;  1JX9 A;  2F93 B;  4UVC A;  2DYS B;  4ZIB A;  5B66 Z;  5B1A B;  1NZ6 A;  5IE9 A;  4FLV A;  4YHH B;  1WAZ A;  2Y48 A;  2KQX A;  4I55 B;  3OGI B;  4WBN B;  3ZMS A;  1K4D C;  4DV6 B;  4I4T B;  3ZCC A;  1H2M A;  4E2L A;  1YDX A;  2QWR B;  4DV2 O;  3BEH A;  3AG2 B;  4DXW A;  3H1J H;  4R8C A;  4DR6 B;  4IT5 A;  4GUN A;  3QO8 A;  3KCY A;  4XDK A;  5IDJ A;  5LMN B;  1MAB G;  3L75 H;  1XQ8 A;  5EC1 C;  3C90 A;  4JYB A;  1VQP V;  3RGB A;  3OGC C;  3GWK C;  2EJR A;  4LF8 B;  5A9G A;  3M7M X;  1RP3 B;  1L1F A;  3FFQ A;  5EIB D;  2ITC C;  3QVN A;  3CCR V;  4RO2 A;  3AG4 C;  3ZHQ A;  4JI6 B;  3VQW A;  1AJQ A;  1GN2 A;  5LP6 A;  5LHI A;  4PI0 A;  1ORQ C;  1S0V A;  1XMQ B;  1YF2 A;  1VQ5 V;  3CP1 A;  4MTO A;  1QVG U;  2CH7 B;  2Y4T A;  1YI2 V;  2LGW A;  2QDO A;  4X1I A;  4LWS A;  4NR1 A;  4RQF A;  1M93 A;  3JAS B;  4JTC B;  4B08 A;  5JH7 B;  1GM9 A;  1S3J A;  1PKX A;  3AG2 C;  4KFM A;  5C8Y B;  3HKE A;  4DV2 B;  1SZT A;  2RCV A;  2W0X A;  4JI2 O;  5CA0 A;  3F7V C;  4QE9 A;  1VQN V;  4GYC B;  4CC6 A;  3TCU A;  3CJH A;  3E22 A;  3E35 A;  3VQX A;  3WU2 Z;  3RBZ A;  3MHS C;  3K59 A;  1Y74 A;  4N21 A;  1XEQ A;  4QE7 A;  3O9O A;  2ETN A;  4O4H A;  2RDC A;  3FYI B;  2XTA A;  2UUC B;  4D7T A;  5IYB O;  3E86 A;  2LFR A;  5IWA O;  2GDS A;  2IU3 A;  1KKC A;  2HP8 A;  4RAI A;  3IFX A;  1VQM V;  1E1Q G;  3OD4 A;  3ASN B;  3BPZ A;  2X6C A;  1W2B U;  1YVW A;  4ASU G;  1I94 B;  1BMF G;  4X20 A;  3ABU A;  1UJW B;  2Q69 A;  2QTO A;  3ZRX A;  3ETD A;  1ZX3 A;  2YXL A;  3CXC U;  4KXR A;  5LP6 C;  1WA8 B;  2RQ6 A;  3G67 A;  5FNV A;  2HHH O;  4B7E A;  4FIP C;  2CK3 G;  1VAR A;  3T1Y B;  2PY5 A;  5H5N A;  1S5H C;  4P9O A;  5J2T A;  3SYP A;  4GX2 A;  2VQE B;  1WNS A;  1G8M A;  1RM1 C;  4TOI A;  1YIT V;  4JI1 B;  1Q43 A;  4O4J A;  1TUB A;  4OPH A;  2JS3 A;  2WA3 A;  4G27 B;  4IHJ A;  5GTI Z;  2QKS A;  1O9H A;  4JI5 O;  4CH3 A;  2ZDI A;  4UUJ C;  2JGD B;  3AG3 C;  4EB6 B;  3SJB C;  2V4D A;  5LA6 B;  1CPY A;  1BE3 H;  2CGN A;  5ITZ B;  1M1K W;  4EKW A;  1AB3 A;  4AQY O;  3SJC C;  2AXT Z;  1V55 C;  4TV8 B;  1NH2 B;  3JAK A;  2ODM A;  4B3M O;  1B3Q A;  4L87 A;  3NXS A;  4DW0 A;  5LMU O;  4IYH A;  2P90 A;  3SGI A;  2HKO A;  2WLJ A;  2LGQ A;  3B77 A;  1SQG A;  4P9P A;  2YXH A;  4JGS A;  4X66 B;  1SA0 A;  2ZR2 A;  1AI4 A;  1V54 B;  4PI2 A;  2ZIO A;  3APO A;  2PI4 A;  4I4T A;  4B3R O;  1M9N A;  3CHX A;  3OM3 B;  3LDE A;  3RFR A;  2WLH A;  4O4L A;  3AK2 A;  3DTU B;  4O4L B;  3P3P A;  4YJ3 B;  2CTP A;  3JD0 A;  3QTC A;  4MVR A;  4RWU A;  5FL7 G;  1QR8 A;  2F23 A;  4I9W A;  3UQ8 A;  4UCS A;  4DV3 O;  1I08 A;  4LP8 A;  3K57 A;  3BHP A;  1RM1 B;  3QF7 A;  1OCC C;  2IU0 A;  3NR7 A;  1UFI A;  3FB7 C;  3B8M A;  4DO2 A;  3K0G A;  4TUY B;  2ZXW C;  4TUY A;  4GT1 A;  2CAZ C;  4ABM A;  3R66 A;  4JI7 B;  4X64 B;  2BCC H;  1HNX O;  1PNK A;  4DV0 O;  1PV0 A;  1W0K G;  2PZS A;  4BR6 A;  2Q8V A;  1IBM O;  5AG2 A;  3DSQ A;  4W4L A;  2YXY A;  2IH1 C;  1H8E G;  3G6E V;  4B3S B;  1Z5W A;  2DWD C;  1QCE A;  5LOV B;  4U3J A;  4YJ2 B;  2P7T C;  4E4E A;  3H1L H;  4FLY A;  4BWA A;  1MSD A;  4WFF A;  1N34 O;  2F4V O;  2QKC A;  3AK3 A;  1BQ0 A;  2QJ1 A;  3SYA A;  3JAT B;  1M5I A;  4AHC A;  2Q0O C;  4B3S O;  3JAR B;  4JTA B;  3SPH A;  5J2U A;  2UXB B;  2NR5 A;  5C93 A;  3EVK A;  5FNV B;  1IBK B;  4X65 O;  2KG7 B;  2WAM A;  3B40 A;  1K5Q A;  4DV3 B;  3TJT A;  2NN4 A;  1B04 A;  1SQP H;  1B06 A;  1WB8 A;  4CS3 A;  1TA8 A;  5B1A C;  2ARH A;  4MVZ A;  5KHJ A;  1KB9 F;  2XAG A;  2R70 A;  2GTA A;  4H33 A;  4FJC C;  2AW9 A;  2ZE5 A;  5B3S B;  2VQF B;  1Y4M A;  2ATK C;  3I56 V;  3HKD A;  4CH5 A;  4DR7 O;  4X1Y A;  2BE3 A;  3OR6 C;  2LP7 A;  3OT7 A;  3SPG A;  2E76 B;  2CTW A;  1S5J A;  4OXS A;  2QM7 A;  4LNU B;  2PUS A;  2KSD A;  2EIN C;  1SQX H;  1PNL A;  3GVM A;  2IJH A;  3CCE V;  2HEP A;  1PD3 A;  2RMK B;  1YXB A;  1LR1 A;  5H2F Z;  3OW2 U;  2F1M A;  1N8R W;  3OMN B;  4DR5 B;  4HAM A;  3F5W C;  1ROP A;  4GLX A;  2DYR C;  5KAI Z;  4CC5 A;  1TGO A;  3VQY A;  5LMU B;  3OEH G;  1DGS A;  4FLW A;  3AG7 A;  4O4I A;  2QE7 G;  3ASO B;  3CXH F;  4BW9 A;  1AI6 A;  2QM8 A;  4FLX A;  1YIJ V;  4DUY B;  2UUA B;  2VQF O;  1KU9 A;  1Q6H A;  2VS0 A;  2FTK A;  1WB7 A;  3TXQ A;  3ABM B;  1FJG B;  1QLE C;  2FML A;  2OYQ A;  1H2K A;  2P4K A;  2WLI A;  4YIP A;  2Y0I A;  2YS8 A;  1TVK B;  3CD6 V;  5H9C A;  1YTF D;  1XI1 A;  3JSL A;  1N33 O;  3BFR A;  3DXR A;  2QTS A;  3O65 A;  3ABL B;  2Q67 A;  1FJG O;  1T5E A;  5L3C A;  2Q9L A;  3RYF B;  4PA3 A;  3P30 A;  3ZRW B;  2G38 A;  2P4V A;  3HR0 A;  1XUQ A;  3G80 A;  5B1O A;  4LF7 B;  1NR7 A;  4MVO A;  3FKS G;  1TAE A;  1Z5V A;  2M6Y A;  2XOK G;  3LDD A;  4L8J A;  1G6U A;  1K33 A;  3ASO C;  4ZHQ B;  1PL0 A;  1XDC A;  3EFF K;  4JF3 A;  1BHB A;  1M57 B;  3T2M A;  1SET A;  1H38 A;  4J42 A;  4MVU A;  5L3F A;  4X88 A;  1M56 C;  4YHH O;  1YJ9 V;  2M7W A;  4PA9 A;  1HNW B;  2ZM6 B;  1OCZ C;  1WP8 A;  4JI0 O;  4DR2 B; 
#chains in the Genus database with same CATH homology
 1ORQ C;  1OCR C;  5BZB A;  1S0V A;  3OR7 C;  1XL4 A;  3CCU V;  4PA4 A;  3CP1 A;  3OEE G;  4MTO A;  1QVG U;  1VQ5 V;  3E8H A;  4BAY A;  2EZP A;  1YI2 V;  1E1R G;  2B1G A;  4RQF A;  1MSW D;  1OHH G;  3H01 A;  3IGA C;  3SPI A;  4JTC B;  3MD0 A;  5KUK A;  3CCM V;  3CCL V;  1GM9 A;  1S3J A;  1PKX A;  2HG5 C;  3AG2 C;  2WSS G;  4KFM A;  1VQO V;  3AG3 B;  1H8H G;  1GM8 A;  2GHY A;  4R50 A;  4RUE A;  1QLN A;  4WFE A;  1SZT A;  1R3I C;  1EZJ A;  2WPD G;  2AHY A;  1VQK V;  3F7V C;  4JAS A;  4QE9 A;  1VQN V;  5CMU A;  3ABK B;  3TCU A;  3JD4 A;  3E35 A;  3PJS K;  1FFT B;  1DLB A;  4J9Y B;  5E1A C;  2EIJ C;  4BIU A;  4UXN A;  3RVZ A;  3RBZ A;  3VOU A;  1ZWI C;  3JD3 A;  3MHS C;  3ML0 A;  2EIN B;  1E79 G;  3LNM B;  2YSU B;  3ASN C;  3ETE A;  3X2Q B;  5HFM A;  1K73 W;  1GKF A;  4N21 A;  4J9Z B;  4MTX A;  3SPJ A;  2WLI B;  2GSM B;  4QE7 A;  4MW3 A;  5LGT A;  4WCE V;  4GX1 A;  5GW7 A;  3FYI B;  1M57 C;  1AJN A;  3K9A A;  3P32 A;  1Q82 W;  3F7Y C;  1CEZ A;  4RUF A;  2AHZ A;  1BL8 A;  4LBE C;  1FXH A;  3E86 A;  5IYB O;  2ITD C;  3GB7 C;  2QA4 V;  2LFR A;  2QEX V;  2EIK B;  2IU3 A;  1J95 A;  3E8F A;  4BW5 A;  1V54 C;  3I55 V;  4RAI A;  1FS0 G;  3IFX A;  2HVJ C;  4ZKI A;  5B3S C;  3QO5 A;  3T4Z A;  1K97 A;  1VQM V;  1E1Q G;  1OCO B;  1VQ4 V;  3ASN B;  4QPK A;  2HJF C;  2X6C A;  1W2B U;  2OT5 A;  4ASU G;  5EK0 A;  2K1E A;  3RVY A;  1BMF G;  1UJW B;  3ABU A;  2Q69 A;  4BIZ A;  2QTO A;  3ZRX A;  1Q81 W;  4FK5 C;  2BOB C;  3ETD A;  3CXC U;  2R9R B;  5B1B B;  2V7Q G;  1ARO P;  3SPC A;  4FIP C;  4UVA A;  3LUT B;  2CK3 G;  4GCZ A;  1S5H C;  4P9O A;  2MK3 A;  3SYP A;  4GX2 A;  3K06 A;  3MHH C;  3CCS V;  2EZO A;  4X8A A;  1G8M A;  1RM1 C;  1YIT V;  5J9P C;  2D3O W;  1R3L C;  4FMT A;  2XAS A;  1B6Q A;  4TSF G;  2WLN A;  4G27 B;  2Y69 C;  4XBF A;  2X6B A;  2QKS A;  3FB8 C;  2XAF A;  4F4L A;  5B1N A;  2EIL C;  1R3J C;  3R65 A;  3ZN1 A;  1FXK C;  3CYO A;  5LBQ A;  1DF4 A;  2ZDI A;  3JD1 A;  4UUJ C;  5HFL A;  1K9M W;  3AG3 C;  3M99 B;  2XAH A;  4Z1M G;  1CPY A;  2C2A A;  2B1I A;  1JPX A;  1M1K W;  1K3E A;  4EKW A;  1GMG A;  4N23 A;  1V55 C;  1NH2 B;  1NH2 D;  1EFR G;  3CCJ V;  5IY5 C;  2ZD9 A;  4MSW C;  1AR1 B;  2JK5 C;  3TET A;  3E83 A;  4L87 A;  3NXS A;  4XDL A;  2WWW A;  2P90 A;  4UV9 A;  2X0L A;  3E8B A;  2HKO A;  1R73 A;  2WLJ A;  1RPR A;  3W7W A;  3B77 A;  1Q86 W;  2H94 A;  1SER A;  3FYE B;  3HPL C;  4U7O A;  3ETG A;  2YEV A;  3CC7 V;  4P9P A;  3ZMT A;  4JGS A;  2BOC C;  2DQ0 A;  2ZR2 A;  1AI4 A;  1V54 B;  1THZ A;  2PI4 A;  1MOF A;  1M9N A;  3ABK C;  3K0D A;  1JOY A;  4CZZ A;  3CPW U;  1MG1 A;  3OM3 B;  1V55 B;  3LDE A;  1P7B A;  3BY6 A;  1OCR B;  3LDC A;  3ZJZ A;  3K04 A;  1KKD A;  2WLH A;  1VQ9 V;  3DTU B;  4G28 B;  4H37 A;  1F4M A;  1K4C C;  3JD0 A;  3KG2 A;  3STZ C;  2W0F C;  4MVR A;  2Z5U A;  4PDL A;  4ZBM A;  5FL7 G;  1QR8 A;  4I9W A;  5EBL C;  5H6Q A;  1SRY A;  2IJK A;  3LSQ A;  2A0L A;  3QNE A;  5EBW C;  2HLD G;  4WFH A;  1KP3 A;  3VBB A;  4LP8 A;  1NVP D;  1YJN V;  2JJ2 G;  2EIM C;  3A0R A;  1JCH A;  1YSC A;  2PI5 A;  3T1C A;  2EBO A;  1RM1 B;  1OCC C;  2IU0 A;  1F23 A;  1I5Y A;  3K03 A;  3IC7 A;  4U7N A;  5L3B A;  1NKD A;  3X2Q C;  1YJW V;  2OTJ V;  3FB7 C;  4MW8 A;  3B8M A;  4DO2 A;  5EBM C;  3K0G A;  2ZXW C;  1JQ0 A;  5EC2 C;  3CME V;  4GT1 A;  1KP2 A;  3JD2 A;  2B5U A;  1PNK A;  5IYD O;  5H6R A;  4YXW G;  1W0K G;  3ABL C;  4PA7 A;  2JIZ G;  1KQS U;  3TK1 A;  5LGU A;  2IJJ A;  3ZMV A;  4CBC A;  1ENV A;  3E89 A;  4MS2 A;  2YEV B;  1R6N A;  5L3G A;  4KUM A;  3D36 A;  1OCZ B;  3E8G A;  2IH1 C;  1PNM A;  1H8E G;  2JDI G;  3G6E V;  2A79 B;  1FXV A;  2DWD C;  2Q6A A;  1NBM G;  1QCE A;  2ZR3 A;  2HR3 A;  3K08 A;  1AJP A;  1KEC A;  4MT8 A;  1OCC B;  2P7T C;  3OUF A;  1K7D A;  1OCO C;  1QR9 A;  4G2K A;  4WFF A;  2Y69 B;  5KA6 A;  1COW G;  3CMA V;  3FB5 C;  3OE7 G;  5LGN A;  1EBO A;  2WLL B;  1IXM A;  3SYA A;  2WLL A;  5LHH A;  1I5X A;  1P4R A;  5DN6 G;  5IYC O;  1Y66 A;  2NLJ C;  4JTA B;  3W7U A;  1S76 D;  3SPH A;  1VQ6 V;  1NVP B;  1K5S A;  1OZ0 A;  3SYO A;  1YHQ V;  2Z3Y A;  4JAU A;  5C93 A;  4X89 A;  3SJQ C;  3CC4 V;  3EHB B;  1WPX A;  3OMI B;  4KP4 A;  4GX0 A;  5IY5 B;  4JYC A;  2WAM A;  4JAV A;  2IW5 A;  1K5Q A;  3OAA G;  1R6K A;  2X6A A;  2WLK A;  3ZRS A;  3AG1 C;  1F4N A;  3JYC A;  1DTO A;  1F51 A;  2XAJ A;  3DGE A;  3SYC A;  5KA5 A;  3GWO A;  5B1A C;  2LFS A;  1K34 A;  4MVZ A;  1FXK A;  2ZQM A;  3CC2 V;  3UM7 A;  4PA6 A;  2P6J A;  2XAG A;  5L3E A;  4H33 A;  1NQT A;  3G4S V;  4FJC C;  1JJ2 U;  3LSS A;  5B3S B;  1H2G A;  1Q7Y W;  1GO3 F;  1Y4M A;  2H8P C;  2ATK C;  1QLE B;  4QPJ A;  3G71 V;  5L3D A;  5B1B C;  3I56 V;  4MVQ A;  2F43 G;  4WFG A;  3ZMZ A;  2HVK C;  4QJF B;  4TWK A;  2DW4 A;  4UVB A;  2Q68 A;  3OR6 C;  3W7T A;  4LC1 A;  2LP7 A;  2JJ1 G;  4I5S A;  3SPG A;  4P30 A;  1AI7 A;  4OXS A;  1G4Y B;  1YTF B;  3QO7 A;  3K3W A;  2QM7 A;  4LCU C;  1RPO A;  2ZXW B;  3D3I A;  3T4D A;  3HB3 B;  2EIN C;  3SYQ A;  2JEU A;  1PNL A;  1BHA A;  3OMA B;  2IJH A;  3CCE V;  1PD3 A;  4RQE A;  1QBZ A;  3ZRW A;  1XL6 A;  2EIK C;  1GK9 A;  3OW2 U;  4FPP A;  1VQ8 V;  1N8R W;  2KB1 A;  2A9H A;  3OMN B;  2WLM A;  1NR1 A;  2DYR B;  1CP9 A;  3WG7 B;  4HAM A;  3F5W C;  1DF5 A;  1ROP A;  2DYR C;  3STL C;  1S72 V;  1HWY A;  2JEX A;  4WFB V;  4PDM A;  1KC8 W;  2OCC C;  4TT3 G;  3OEH G;  4HYO A;  5CA3 A;  2NNU A;  1R3K C;  3ZIA G;  4HZ3 A;  2OCC B;  3OFN G;  3W7S A;  5CN0 A;  4JPR A;  4R6Z A;  1VQ7 V;  2EIL B;  2QE7 G;  2IJI A;  3B8N A;  3ASO B;  4R7C A;  1FXK B;  1AI6 A;  2QM8 A;  5CBH A;  1YIJ V;  1W0J G;  2IH3 C;  2EIM B;  1TUE B;  4GX5 A;  1LNQ A;  3WG7 C;  1QVF U;  4XDJ A;  4WF9 V;  3AG4 B;  2FTK A;  2P67 A;  3ABT A;  1SES A;  3ABM B;  4JTD B;  1JX9 A;  3ZRV A;  1QLE C;  4P2Z A;  5LHG A;  1GTO A;  1GM7 A;  2DYS B;  4UVC A;  2WLI A;  3CD6 V;  5H9C A;  1YTF D;  5B1A B;  2UXN A;  1M90 W;  1K8A W;  2DWE C;  3W7X A;  3K79 A;  2X7R B;  2UXX A;  2Y48 A;  3OUS A;  2Q67 A;  3ABL B;  2W6I G;  3ZMS A;  2R9I A;  1K4D C;  5KUM A;  5L3C A;  2DQ3 A;  4PDV A;  3CCV V;  3ZCC A;  2V1D A;  4PA3 A;  4E2L A;  2W6J G;  3BEH A;  3P30 A;  2ZDI C;  3ZRW B;  3AG2 B;  3ZN0 A;  4MVM A;  4DXW A;  1NJI W;  2HFE C;  1S77 D;  2DYS C;  1VQL V;  3E2E A;  5CBF A;  5B1O A;  3FB6 C;  4R8C A;  3ABM C;  4PDR A;  2EIJ B;  4QIW F;  1NR7 A;  4Q20 A;  3QO8 A;  4MVO A;  3FKS G;  2XOK G;  3LDD A;  1KD1 W;  4XDK A;  4UV8 A;  1AI5 A;  4WFA V;  3AEI A;  5IDJ A;  1MAB G;  4MTF A;  3AG1 B;  2OTL V;  1K33 A;  2XAQ A;  2XND G;  4QNH B;  3ASO C;  5EC1 C;  1WLE A;  4JYB A;  3WFV A;  1PL0 A;  1BHB A;  3EFF K;  4JF3 A;  1M57 B;  3T2M A;  3UKM A;  3CCQ V;  1VQP V;  3OGC C;  5CBG A;  1SET A;  4PEL A;  2EJR A;  1H38 A;  4MVU A;  5L3F A;  3JCZ A;  4X88 A;  1M56 C;  1YJ9 V;  2M7W A;  1L1F A;  4MVS A;  2ITC C;  4PA9 A;  1JVM A;  1M56 B;  3CCR V;  1OCZ C;  3ZMU A;  5DM6 V;  4RO2 A;  4MTG A;  1K92 A;  3RW0 A;  3AG4 C;  1AJQ A;  5LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...