4PDVA

Structure of k+ selective nak mutant in barium and potassium
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdvA00
4MVUA 3ABKC 2HVKC 3OGCC 1QLEC 2A79B 3K0DA 2HVJC 3OUFA 4H37A 3ZJZA 2HJFC 4PDMA 2EINC 4X89A 3E8GA 3SPHA 4PDVA 3EFFK 3F7VC 4H33A 1G4YB 1OCRC 4PDRA 3X2QC 1XL4A 3TETA 4G28B 2ZD9A 1OCZC 4GX5A 4MVQA 4P9OA 4MSWC 3LDCA 2QKSA 2Q68A 3E83A 1M57C 3FB8C 3GB7C 4HZ3A 2WLIA 4P30A 4DXWA 1OCCC 4J9ZB 4UUJC 5BZBA 2WLJA 3R65A 3ABLC 2ATKC 3OUSA 3SPGA 2Y69C 3SPJA 1XL6A 4PA3A 1S5HC 4P2ZA 2IH1C 2HFEC 2Q69A 4RO2A 2EIKC 4EKWA 3K0GA 4WFFA 5IY5C 1JVMA 1V54C 2EILC 2WLIB 5EBMC 3ASNC 4MTFA 3E8BA 2BOBC 3K08A 3SYAA 4WFHA 5EK0A 4TWKA 4ZBMA 3LNMB 3E89A 3OR6C 3RVYA 4X88A 3TCUA 3FB7C 2WLNA 3BEHA 4PA9A 3SPIA 4CBCA 2WLLA 5CBFA 2X6BA 4G27B 3FB6C 2A9HA 4OXSA 1OCOC 4R6ZA 3E8HA 1R3LC 2YEVA 4XDJA 1LNQA 5EBWC 1K4CC 2NLJC 3K03A 5E1AC 3SJQC 4BW5A 2ITCC 2Q6AA 4R8CA 2KB1A 3LDEA 3IFXA 3SYPA 2DYRC 1P7BA 2Q67A 2BOCC 3E8FA 3K04A 1R3JC 4MVZA 2WLHA 3UKMA 3PJSK 2WLLB 3IGAC 1M56C 2IH3C 1ZWIC 3ASOC 5B3SC 2H8PC 3F5WC 4QE7A 4MVMA 3SPCA 1ORQC 4P9PA 3F7YC 1BL8A 2P7TC 2OCCC 4MS2A 4R50A 3T4ZA 2QTOA 4PDLA 4KFMA 3STZC 3SYOA 3HPLC 2WLMA 4GX1A 4LBEC 2HG5C 3RBZA 1KKDA 2K1EA 5KUKA 4LCUC 1J95A 2ITDC 3AG4C 2R9RB 4RAIA 4QNHB 1R3KC 2ZXWC 4F4LA 5J9PC 2JK5C 4X8AA 4RUFA 4J9YB 4WFEA 4QE9A 5KUMA 2A0LA 3VOUA 4I9WA 5EC1C 2EIMC 3KG2A 4PA6A 3SYQA 4WFGA 3OR7C 4MTGA 3ABMC 4MVSA 2WLKA 4PA4A 4PA7A 3RW0A 1V55C 4JTAB 2DYSC 4JTDB 2W0FC 5EC2C 3WG7C 3AG2C 3FB5C 5CBGA 3LUTB 3T1CA 3AG1C 4HYOA 3ZRSA 4LP8A 5B1AC 3AG3C 2EIJC 3JYCA 2AHYA 4MVRA 5EBLC 3E86A 4MW3A 4XDKA 5B1BC 3RVZA 3STLC 4MTOA 2AHZA 2DWDC 4RUEA 1K4DC 2X6AA 2DWEC 3K06A 4MVOA 3T4DA 5CBHA 4GX0A 3SYCA 4MW8A 3UM7A 1R3IC 4JTCB 4GX2A 4R7CA 3T2MA 2X6CA 4XDLA 3LDDA
chains in the Genus database with same CATH superfamily
3L72H 1D5NA 2E3CA 3JARA 1PPJH 4J80A 2P6JA 4LF6B 1GKFA 1QLEB 3F7VC 5HFMA 1YITV 1ZL8A 1HNWO 2XAQA 4JYBA 5L3FA 4LC1A 3ICXA 4P30A 4O2AB 2Q0OC 5LHHA 1URFA 1XNRB 1YIJV 4DV5B 1AB3A 4JV5B 4BW9A 1VARA 3ABLB 4DV2B 4JAAA 4DR7B 2BOBC 4FIPC 4WFHA 4BAYA 3UO2A 1R6NA 1F23A 1PNKA 3A8TA 1L1FA 2WLLA 4TQFA 3FB6C 1NJIW 4WFAV 4B7EA 4DR3O 3K03A 4UV9A 4BW5A 2Q6AA 5FL7G 2OT5A 5KX5A 1P7BA 3VBBA 2Q7HA 2F1MA 4EEQA 4UVCA 4JI0B 4DR4B 2YDEA 3SPCA 1ORQC 4MS2A 2OCCC 3H1LH 5EZYA 4EFBA 4X65O 4NXMB 4AILC 4J7KA 4UB6Z 1RM1C 4LCUC 1TA8A 5L3EA 5KUMA 1BZKA 1ENVA 2WA4A 3OGIB 5KHHA 4PA4A 4JTAB 3OEHG 4PELA 2QSAA 4GKJO 1PKXA 1UFIA 1VQLV 5EBLC 2IW5A 1UPGA 1W0JG 1HP8A 1COWG 1JPXA 1XOUA 2B1IA 5KHJA 4R7CA 5TISZ 1VQ4V 5EYPB 2IJIA 3OM3B 4K0KO 3OGCC 3ZJZA 2HVJC 4JI6O 2UXDO 4DR5B 4X89A 4E4EA 4DR6B 4DV0B 1VF5B 2BSKA 3AG7A 4ABMA 4JI2B 2KSDA 2RNBA 2K9PA 4IT5A 2Z5UA 1BCCH 1LR1A 1QBZA 4FLVA 4EKWA 4WFFA 2GTSA 1Y74A 1AJQA 3ETQA 3ASNC 2D2CB 4K8ZA 5EK0A 2UXXA 1GAXA 3FB7C 3BEHA 1VQKV 1LUWA 3VQWA 4JI4O 2NLJC 4K3AA 3G6BA 1M90W 2WWWA 1MA1A 3ZCCA 4JASA 1VQ5V 3M99B 1HNXO 2HP8A 3BPZA 3WB2A 2PYJA 1F7YA 5KAFZ 4EFEA 4JI1B 2QTOA 1N36O 1BQ0A 1NT2B 3HPLC 2WLMA 4NB5A 4I0XA 3T1HB 2FL4A 4FPPA 3T1YO 4KL1A 4YY3O 4JF3A 4LH7A 3H1IH 1V55C 3LNNA 3FKSG 1AROP 5EIBD 2DYSB 4DV4O 3ASOB 4JI3O 1FXKC 1KECA 4U7OA 2E74B 4DV7O 3EXAA 1Q3EA 2RDCA 3KCYA 5CBHA 3P3NA 2BTQA 3ZRVA 5B5EZ 3QO5A 1HNZB 3AG4B 3B2EE 4ZHQB 1Q6IA 1W2BU 1FXKA 1KB9F 1OCRC 5F2VO 5ITZB 4G28B 2Q4PA 2AXTZ 2QM4A 2EULA 4EB6B 4IIJB 4J10A 5FPOA 2UUCB 1NQTA 3CX5F 1XMQB 4BIZA 1RSOB 2QE7G 1KU9A 3HR0A 3LSSA 3K59A 2JJ1G 3RYCA 1GH6A 5EBMC 2CDYA 3B8MA 4MTFA 3D36C 1AP5A 1Q7YW 3TCUA 1K5SA 2CAZC 2PY5A 2V4DA 2JDIG 3R66A 2ZM6B 3N2KB 3CE2A 4U3JA 3D36A 2YXLA 3SJAC 1SZTA 2HEPA 2VQFO 3IGAC 4TQDA 1XNRO 1PL0A 4DV5O 4UB8Z 2IBZH 3CD6V 3JAKA 4JV5O 3QVNA 3JAMN 2CGNA 1PNLA 2NR5A 2XAHA 3RBZA 1P49A 3QTCA 4B3MB 2YC0A 1IDSA 2ZXWC 5IT9N 4FZ1A 2Y4TA 2F95B 3FAVA 1Q86W 1TUEB 3CJHA 2ADQB 4BWAA 4I50A 4PA7A 1XILA 5CA0B 1XHZA 2QWQB 3CXHF 4NXNO 2QJ1A 5DM6V 4ZI7B 3T1CA 3EHBB 3M8AA 4MW3A 3IC7A 5CA3A 4QJFB 2QDOA 4JI0O 4DR4O 5LXTA 4XDLA 4LF5B 4NXMO 4AQYB 4ICGA 3JD3A 3H01A 1K92A 3GWKC 1Y66A 2P67A 2C2AA 4LNUB 4JI7B 3AG2B 2HHHO 4HZ3A 2XNDG 3ZHVA 1UJWB 3SPGA 2ZE7A 3HKEA 3E22A 2ZNJA 2IJHA 2DN9A 5JJEB 5IJ9A 3VQYA 2EINB 3RYIB 3RFRA 4LF4B 2DJVA 3GVMA 1E79G 1FFXB 1K9MW 4OXSA 1FJGB 1SKVA 1SRYA 5LMNB 4DR6O 1D2DA 3ZEDA 3IFXA 5H5NA 2BOCC 5JJNB 4TV9B 1FPOA 4JI2O 3WU2Z 1AI6A 4O2BB 1KQSU 1HR0B 4MVMA 1N32B 3OMIB 1RPOA 1AR1B 5LA6A 5LOVB 4OX9O 4KFMA 3STZC 1TUBB 3W7WA 1I5XA 1RPRA 5HFLA 2AW9A 1BT8A 1G8MA 3HKDA 2XHBA 1YXBA 5JVDB 2FKXA 1OCOB 3CPWU 3OR7C 2BCCH 3B8NA 5LHGA 3JASA 1IXBA 1XNQB 1MSWD 1VF6C 3C90A 2ZCEA 2LGWA 3ZRXA 1PM9A 3WG7B 3IAYA 1ROPA 1S5LZ 1Q8IA 4LH6A 1KBHA 1XDCA 1GM7A 3SJBC 4DK1A 1YJNV 2EJ7A 1US6A 1VIBA 1BHAA 1NKDA 1R3IC 4JTCB 1WB7A 4UFZA 1VF6A 4L87A 3SR2C 2R9IA 3ZBHA 2E5LB 4O2AA 2EJRA 1IURA 5B1OA 4D7TA 2Q9LA 2W6JG 3TETA 4GX5A 3W7UA 2HR3A 1MG1A 4Q20A 4TUYB 4JI8O 4J9ZB 1QCEA 2WLJA 2XT9A 3OEEG 2GUZB 1K97A 1YZBA 1JA8A 4FLYA 1K8AW 2ETNA 4TT3G 2E75B 3ZN1A 4J11A 1F4NA 1CPYA 1DTOA 3DSQA 2PGGA 5FNVB 3RVYA 2JVDA 3DC5A 5CBFA 3SJCC 5KHGA 3CRMA 2P06A 3E8HA 4I4TB 4LF8B 2F23A 3G80A 5L3BA 2WLHA 1TGOA 3E2EA 3RT3C 4WFBV 1ZSPA 1WB8A 1PNMA 5BXZA 1Y67A 1M9NA 4YIPA 3FD9A 4GX1A 4AI8A 4TSFG 4CS3A 1S76D 2QA4V 3ZMTA 4LWSB 3U11A 1BQZA 2YS8A 2ZM6O 4FFBB 5JWPA 3K5MA 5EYPA 1FKAO 3D8CA 2ILMA 1XMOB 1AJNA 3RVZA 3T4DA 1R1BA 3CC2V 4IGGA 3LDDA 1XREA 4LFBB 1KKCA 3K0DA 4PDMA 4UCRA 1YCIA 2GDSA 5FLXN 1NH2B 3ABMB 4L8JA 4P9OA 3RYHB 2VQEB 3QO7A 5IYCO 3GB7C 2B5UA 2RCVA 5KA5A 4BR6A 2Y69C 3K9AA 3P3PA 4WBNB 1QNMA 2JS5A 1NU1H 5KHIA 1JVMA 4BIOA 1V54C 3OMNB 2WLIB 1GM9A 3JD0A 3OT7A 2UXCB 3LNMB 2JGUA 3OR6C 4WCEV 2LQTA 2YIDA 3IC9A 4CS4A 1T5EA 3BA9A 4F6EA 4CC5A 3LSQA 2PZSA 3ZIAG 2CGOA 4KXRA 2ITCC 5H6RA 4R8CA 3LDEA 3HB3B 2ZE5A 2PI4A 1YSCA 5LYJB 3B4SA 2EIKB 1N33B 3ASOC 1GRJA 2XOKG 4IYHA 2MW2B 4B3RB 5FPRA 4QE7A 5IY5B 4CS2A 1SQPH 2RJZA 3CEIA 2LW1A 2JIZG 3OW2U 1K5QA 3AG4C 4I55B 4QNHB 1NVPB 3O65A 5L3DA 2IM9A 4QGPA 5LP6B 1N34B 3RW0A 4B08A 3OTFA 5KLVH 1JFFB 5LMNO 1WNSA 4U3FH 5IYBO 2KQXA 4ZHQA 4F6RB 4X20B 1AR5A 2BTOA 3CCLV 2R9AA 5B1AB 3L9DA 1MNGA 5ITZA 3S3XA 1ZX3A 2KG7B 3B09A 4EB6A 4IIJA 1M4UA 3DXRB 1RSOA 2UXBO 4MSWC 3W7TA 1WP8A 3Q4HB 3ZMZA 1NH2D 4YJ2B 1KP2A 3AG3B 1XNQO 2ODMA 2Q69A 3K0GA 5LHIA 2P4KA 2WSSG 1KYOF 1P7GA 2XAJA 3N2KA 5DEDA 5L3GA 5KA6A 2E5LO 5LGUA 1IBLO 2N74A 2YXYA 2CH7B 4UVAA 4KHPB 2Q8VA 2V7QG 1SS3A 5EBWC 4GZRB 5E1AC 3A0RA 5LL6Y 1OCCB 2X7RB 5C8YB 2EZPA 3CCVV 3E8FA 3G67A 3UKMA 5A2QN 1YVWA 5IYDO 4OPHA 2Z0AA 4DV6B 4NTXA 4Z1VA 3C3TA 1V9PA 3F7YC 4YJ3B 3ZMUA 2YUAA 1XQ8A 4B3SB 1VMGA 2HG5C 5CA0A 4ZI7A 3ZHRA 1FAFA 1M5IA 5JCOC 1GO3F 1NVPD 3J81N 1NI8A 4Z1MG 1XUQA 3LSUA 3AG2C 3CS5A 3HKCB 4LF8O 5JJJB 2V1DA 2XUMA 1AILA 4LP8A 3AG1B 2JS3A 5JCOA 4X1KB 1K4DC 2YIBD 3K06A 2FMLA 4LNUA 1IXMA 4FM1A 1THZA 3KCXA 5LBQA 1XBLA 2EINC 1EN6A 2LW7A 5A9GA 4CH3A 2JEUA 5KMGB 1XL4A 1Y76B 2D3OW 2H3OA 3MHHC 3E83A 4UUJC 5J2UB 2NNUA 3CWBH 5J2TB 3RYIA 4X1IB 1YI2V 4X62B 1FFXA 1I0HA 1YF2A 1I08A 1XMOO 4DV1B 4TWKA 5GTHZ 4TV9A 2WLNA 4PA9A 3SPIA 2ADPA 4UCVA 4GKKO 4LFBO 4PHZA 5GONB 4O2BA 3ZHTA 2DW4A 1IX9A 1OCOC 4DR1B 4J41A 4JYCA 5IWAO 4O4IB 3OFNG 5LOVA 4UV8A 1EN5A 1TUBA 2Q67A 4GUNA 4MVZA 2UUAB 3ZX6A 2Q7EA 1GN2A 1FFTB 4CH4A 1GK9A 5JVDA 1KMIZ 3DTUB 4P9PA 1L0NH 5GW7A 1GTOA 3CMEV 4J7JA 2OCCB 4G2KA 4LF6O 4DV3B 5DECA 4F4LA 4B7KA 2JK5C 1SQGA 1RM1B 2UXCO 3CMAV 1FS0G 2ZR3A 1HWYA 3FYEB 1ZAUA 2DQ3A 3B77A 3P32A 4X64B 4CH5A 1YJWV 2IJKA 5CN0A 5B3SB 2ZR2A 1GN3A 3VOUA 3STLC 5B1BC 1NR7A 4DV2O 2DWDC 5JH7B 3DC6A 4DR7O 2X6AA 1N33O 3I56V 3ZMVA 1U96A 3I5DA 4GX0A 4MW8A 4B3RO 1WA8B 3T2MA 4TUYA 1QLNA 4H37A 3U0ZA 2HJFC 1WPXA 1OJHA 3JSLA 2GUZA 1N8RW 3L75H 5LGTA 3ZRWB 1I94B 4PD4F 4HAMA 2OYQA 1P4RA 5BZBA 5KHKA 3OTOB 4GLXA 3JAWB 5FNVA 1AI5A 4O4JB 1S5HC 4MTXA 1IBKB 1ZTEA 1Q5OA 2AZ0A 4JYAB 4QPKA 3CSXA 4I4TA 2XASA 3E8BA 5E79Z 1N0JA 1B04A 3ABTA 3E89A 3H1HH 1S77D 3X2QB 4G27B 2ZE8A 2L35A 1R3LC 1LNQA 3CC7V 1EBOA 2ZKOA 4PI2A 3H1KH 3UCSC 1BS3A 2GSMB 2WPDG 2UUBB 4LWSA 3K58A 3J7AU 1NTMH 1DF5A 2RN9A 1K7DA 4FFBA 4DR5O 1Z5VA 4QE9A 4DV0O 2QKAA 4IYIA 3ABMC 3OE7G 4KUMA 2DYRB 1PD3A 1J5EB 4AHCA 5BR8B 2W0FC 1SQXH 3QNEA 5IDJA 1PL4A 1V55B 1WAZA 3WB1A 2EIJC 2AHYA 3ABUA 1KP3A 2AHZA 4JAVA 3SYCA 4I9QA 3BRCA 4DV6O 4GX2A 3RYHA 1HDJA 4X65B 4TOIA 1QLEC 1NS1A 1R6TA 2CTWA 3CCEV 3ETDA 4B3SO 1IBMB 3CCJV 2R70A 3SPHA 4DRXB 4WBNA 1OZ0A 2IU0A 4NVPA 3LDCA 2QKSA 3BCCH 2Q5ZA 4JYYA 1HW7A 2WLIA 4DR2B 2OIGA 3N2GB 3ABLC 3OUSA 4DYLA 1XL6A 1NTKH 4OGQB 2EIKC 3RYFB 1K33A 3JATB 1YTFD 4JI1O 5IY5C 3MHSC 4BIUA 3T1HO 4YIOA 5CB4B 4K0KB 3BA8A 1SESA 4JI6B 1X59A 5LYJA 1H2KA 2A9HA 1OCZB 4YHHB 1KD1W 2YIAA 1Q6UA 1M57B 2P22C 1G6UA 1LUVA 3QG5A 4UXNA 2PI5A 1WJZA 1QQCA 4FM0A 2M6YA 1P84F 4I55A 4MT8A 1FXHA 3F5WC 1NBMG 2EILB 1DLBA 4LFCB 2DQ0A 4X62O 4ZOLB 5LP6A 1HNZO 4ASUG 3K3WA 3K9SA 1KKDA 3APQA 5KUKA 1MZEA 3BVOA 3W7XA 2PYLA 1JFFA 1GN6A 1SQFA 1SERA 2A3QA 3VQXA 5EC1C 4F6RA 5EIBC 4X20A 4MTGA 1K34A 1VQ7V 2LP7A 4IHJB 2ZNIA 1AI7A 4DR1O 2KKWA 2KG7A 2WAMA 2ZINA 3L74H 2QKCA 3JD4A 5CA1B 2UUCO 1EZJA 5H9CA 1XMQO 1M56B 1SA0B 1HNXB 4HYOA 4PJ0Z 3AG3C 4E2LA 4MTOA 4RUEA 3VQVA 1B6QA 3DXRA 2UUAO 4CC6A 1OV9A 1PP9H 1TVKB 1N36B 1FD9A 3Q4HA 3AEIA 3WFVA 4W4LA 2A79B 4YJ2A 4X1YB 5B1NA 3E8GA 4PDVA 4PDRA 1JJOA 2JRIA 4MVQA 2OTLV 5BMVB 1OCCC 2QEXV 1F4MA 1TAEA 1Q6HA 1OHHG 4NTYA 1AJPA 1JMKC 2HFEC 3BABA 4JI3B 3ZHQA 1VQOV 3THOA 1VQ9V 3O9OA 2CH7A 1S72V 3JD1A 3OD4A 4RWUA 5C8YA 4RQEA 4I7ZB 4B3MO 1JX9A 4CBCA 4J7ZA 4NTWA 4PV1B 3G71V 2DE0X 3APOA 1D5AA 2EZOA 5JQGB 4YJ3A 1JCHA 1M1KW 2P90A 1QR9A 2CTQA 1I94O 5AG2A 2H8PC 4O4HB 1WN7A 2YEVB 1SQVH 4FVMA 2XAGA 1XI1A 1IBKO 2N04A 3OAAG 2ZE6A 1Q90D 3HKCA 4LF5O 2R9RB 4AQYO 2OCHA 3QF7A 3QO8A 4FZ0A 4DUZB 1YDXA 4X1KA 1Q82W 2N05A 1S0VA 1M93A 4JI7O 2DYSC 3FB5C 1CP9A 2YSUB 2ZIMA 2YI8A 1AR4A 1X4TA 2A06H 3UO3A 2VQFB 3SYAA 4D6TH 4JI5B 4XDKA 1Y6XA 2P4VA 1AI4A 2FB5A 5KMGA 5BY1A 3CYOA 3RWRD 1Y76A 1SF9A 3TGUH 2X6CA 2HVKC 1S5JA 2ARHA 5LMUB 4LF4O 2UUBO 5J2UA 1CXZB 5J2TA 2JEXA 1RFYA 2Y48A 1BSMA 3EFFK 1RP3B 1FJGO 4X1IA 3CC4V 3F5TA 1W59A 4HBNA 2A7WA 3CB2A 2HJDA 2Q68A 2Y0PA 3D3IA 4FLTA 3HKBB 2UU9B 3JALB 1O9GA 1VQ8V 1MZFA 4NXNB 4FK5C 2F66C 1J5EO 5BR8O 4FMTA 4DK0A 1H2MA 2GTAA 1EM1A 4GCZA 4X9QA 3BFRA 4RO2A 4ZKIA 1HR0O 1N32O 3L70H 5GONA 3CRRA 3TXSA 3ABKB 4O4IA 1XEQA 1WP7A 3MD0A 4FLWA 1I5YA 5D5QA 2X6BA 4HNAB 2OIEA 1VEWA 4XDJA 1IBMO 3SGIA 1K4CC 1JJ2U 4TV8B 3SYPA 3IJ4A 2HHHB 3K04A 3ETEA 1R6KA 4JGSA 3D3QA 4DR2O 1EN4A 2JJ2G 5B3SC 4FJCC 1VQ6V 3K5LA 3ZS8C 3H1JH 4JPRA 4R50A 1SC5B 4PDLA 1EZVH 5L3CA 1SQBH 2K1EA 1H8HG 4RAIA 1KUQA 4N23A 4X8AA 4RUFA 2GHYA 1XHXA 4CZZA 5K1PA 4FLUA 4NYKA 3SYQA 5JH7A 4QPJA 4YHHO 1WA8A 5CBGA 3UT5B 2AGAA 2EBOA 5IJ0B 4FFKA 3JYCA 4I5SA 2JGDB 2H94A 3ZMSA 1QVFU 1H2NA 5IYZB 2LJ2A 2NN4A 3UM7A 4OX9B 4WF9V 3ZRWA 1K3EA 3OUFA 3GWOA 4LFCO 4O4LB 2YI9A 4LFAB 3JAWA 4O4JA 1QVGU 2EIMB 5KAIZ 4H33A 3X2QC 3L73H 4JAUA 4Q6GA 4K8XA 3JARB 2L6LA 3CRCA 4LF7B 4N21A 2Z3YA 3I55V 2BE3A 2IH1C 4X66B 1ZL8B 2Y69B 4OPAA 3FX7A 1N0NA 2EX3A 1VQMV 3JCZA 1JQ0A 4ZBMA 1V54B 2ZDIC 3CRQA 2B1GA 3K5OA 1S3JA 3ETGA 3SJQC 4DW1A 1AVMA 1A32A 1NTZH 2DYRC 4JI8B 2ZDIA 5H6QA 2WLLB 3K57A 1AP6A 4A5UB 1W0KG 1GMGA 2QWRB 3T4ZA 5KX5B 2LFSA 3JCUZ 1O9HA 4LBEC 1F51A 1ZLZA 4UCOA 3A0BZ 2P5OA 1YEWA 1FYJA 1NR1A 1R3KC 3FYIB 4J9YB 2PTMA 1DF4A 2QWOB 2RMKB 5EZYB 5B66Z 2VQEO 2YXHA 3ZHUA 3WG7C 4FM2A 2CE4A 4DUYB 3J80N 1PV0A 4RQFA 1DGSA 3E86A 4DRXA 1L0LH 1Q81W 3TK1A 2QM8A 3RN4A 1B3QA 2ZIOA 4JZGA 1JR9A 4B3TB 3G4SV 2B9ZA 3N2GA 2FTKA 3AK2A 2Q7GA 4PI0A 3RYFA 1OCZC 3BHPA 3JATA 2HLDG 4ZIBA 4Z2WA 5C93A 1M57C 4DUZO 4FLXA 1N4CA 4LF9B 3DGEA 2CTPA 5CB4A 1K73W 1GN4A 2ATKC 2OWOA 1H2SB 2MK3A 3SPJA 1QR8A 4H44B 2BSKB 3FFQA 3BAAA 4JI5O 1SQQH 1B06A 4D7SA 2EILC 3K79A 2PF4E 3E35A 3KKYA 1IVSA 3PN1A 5LMUO 4J42A 1Y74B 3CRAA 2DOSA 3UQ8A 1N34O 2PUSA 5IE9A 2LGQA 3MDSA 2VWJA 1YTFB 2KB1A 2Q0AA 4ZOLA 1R73A 2UU9O 1M56C 3ML0A 1Q43A 5K1XA 2F4VB 1H8EG 2P7TC 3ASNB 4UCTA 2ZT9B 1H2LA 3SDLA 4IHJA 2M7WA 1L8DA 5CA1A 3G6EV 3CCUV 1VP7A 1HNWB 1SA0A 3MAQA 4WFEA 2OTJV 4UCUA 2GV9A 4I0XB 1TVKA 4UCSA 3A0HZ 3LUTB 3KZIZ 2W0XA 2QGNA 2ZQMA 3ZRSA 4IL6Z 4X1YA 1SETA 4W4KA 2X0LA 2DWEC 4MVOA 2FYUH 3CP1A 1MMMA 5BMVA 3H9VA 1YHQV 4DR3B 3ZN0A 5H2FZ 4KHPO 1VF7A 3CXCU 4XBFA 2G38A 2BTQB 2VWKA 3A2FA 5DN6G 3FB8C 4C7UA 3CHXA 2LO1A 4NKGB 1NZ6A 1FXKB 4U7NA 3BY6A 1Z2GA 3B40A 1ZUQA 5JQGA 5CMUA 3RGBA 2UXNA 3K08A 4CH6A 1VQPV 2AZ2A 4NR1A 3TJTA 1IZ3A 4QIWF 1OCRB 2QR4A 3K5NA 2Q73A 4O4HA 4LFAO 2YEVA 2RQ6A 3RYCB 2UXBB 4GKJB 3CCRV 3PJSK 1SZXA 2YICA 4LF7O 2IH3C 1ZWIC 3AK3A 2XTAA 4X66O 4U3JB 2UXDB 2IU3A 2A0LA 5LP6C 1IBLB 1QHTA 3JAKB 4I9WA 4WFGA 2F43G 4MVSA 2WLKA 1GM8A 1H38A 3W7SA 3TXQA 1G1XB 1WLEA 4UVBA 3FAVB 5B1AC 2CUGA 2DMXA 1Z5WA 4MVRA 3CJHB 4I50B 5GTIZ 5B1BB 1I7FA 4GYCB 1VQNV 4DV1O 2YIBA 4MVUA 3ABKC 3HKBA 3JALA 2VRZA 2ZXWB 4JZ2A 2QM7A 4JI4B 2W6IG 3P30A 2GBOA 3ZHSA 1G4YB 4KP4A 1EFRG 2ZD9A 5LXTB 1KC8W 3C3SA 3OMAB 1MABG 2QWPB 4DXWA 1BHBA 1BMFG 3R65A 2F93B 1H2GA 4PA3A 1E1QG 4P2ZA 1YJ9V 2R72A 4DUYO 2QWNB 4H13B 4HNAA 1DK1A 2E76B 4TV8A 4DV3O 2HKOA 4X88A 3T1YB 1CEZA 4YY3B 1WPBA 3HKEB 3S3WA 2O57A 3E22B 4B3TO 3CCQV 2Y4UA 3U10A 4R6ZA 2QTSA 1BGYH 4X64O 4DV4B 5IJ9B 2VS0A 4LR3A 1R3JC 2CTRA 4DW0A 3JD2A 3NR7A 4DV7B 1FXVA 4LF9O 2IJJA 3JSNA 2Y0IA 3AK1A 1BL8A 2WA3A 1Y4MA 3WB0A 3SYOA 1BE3H 1QU7A 1J95A 2ITDC 3UT5A 5J9PC 4H0LB 5IJ0A 3CCSV 3EVKA 4GKKB 1MSDA 1MOFA 2EIMC 5LA6B 3KG2A 4PA6A 3CCMV 2JGDA 2CK3G 2XAFA 5IYZA 5IWAB 2LFRA 5LGNA 1E1RG 4JTDB 5EC2C 3N27A 4YXWG 3HKDB 3L71H 3OTOO 5D5PA 4K35A 4FLZA 4DO2A 3AG1C 4O4LA 1U97A 4GT1A 4JYAO 2EIJB 3JASB 1JOYA 3NXSA 3M7MX 2F4VO
chains in the Genus database with same CATH topology
1QLNA 3ZRWA 1K3EA 3OUFA 3GWOA 2P6JA 4H37A 2HJFC 1GKFA 1WPXA 2EJRA 1QLEB 5B1OA 2EIMB 1QVGU 3F7VC 5HFMA 4H33A 1YITV 2W6JG 3X2QC 3TETA 4GX5A 3W7UA 2XAQA 4JYBA 5L3FA 4LC1A 2HR3A 1N8RW 4JAUA 1MG1A 4Q20A 5LGTA 4P30A 3ZRWB 4HAMA 5LHHA 4J9ZB 1QCEA 1P4RA 5BZBA 1YIJV 2WLJA 4N21A 2Z3YA 1AI5A 3I55V 1S5HC 3OEEG 2IH1C 4MTXA 3ABLB 1K97A 2Y69B 1VQMV 1K8AW 4QPKA 4TT3G 2XASA 3ZN1A 3JCZA 1F4NA 1CPYA 1JQ0A 3E8BA 2BOBC 4FIPC 1DTOA 4WFHA 4BAYA 3ABTA 4ZBMA 1V54B 1R6NA 3E89A 3RVYA 1F23A 2ZDIC 1PNKA 1S77D 2B1GA 1L1FA 1S3JA 2WLLA 5CBFA 3ETGA 3X2QB 4G27B 3FB6C 1NJIW 3E8HA 1R3LC 4WFAV 1LNQA 3K03A 4UV9A 3CC7V 3SJQC 4BW5A 2Q6AA 1EBOA 5FL7G 2OT5A 2DYRC 1P7BA 3VBBA 5L3BA 2ZDIA 2WLHA 5H6QA 2WLLB 3E2EA 4UVCA 1W0KG 1GMGA 4WFBV 3SPCA 1ORQC 1PNMA 2GSMB 2WPDG 4MS2A 2OCCC 3T4ZA 1M9NA 2LFSA 4LBEC 4GX1A 1F51A 1DF5A 1K7DA 1RM1C 4LCUC 1NR1A 1R3KC 3FYIB 4TSFG 5L3EA 4J9YB 5KUMA 4QE9A 1ENVA 1DF4A 1S76D 2QA4V 3ABMC 3OE7G 3ZMTA 4PA4A 4KUMA 2DYRB 1PD3A 4JTAB 3OEHG 2W0FC 3WG7C 4PELA 3QNEA 1PKXA 1V55B 5IDJA 1VQLV 2EIJC 5EBLC 2AHYA 3ABUA 2IW5A 1AJNA 3E86A 1KP3A 3RVZA 4RQFA 1W0JG 2AHZA 1COWG 1JPXA 2B1IA 4JAVA 1Q81W 3T4DA 3TK1A 3SYCA 2QM8A 3CC2V 4R7CA 4GX2A 1VQ4V 2IJIA 3LDDA 3OM3B 3OGCC 1QLEC 3K0DA 3ZJZA 2HVJC 3G4SV 3CCEV 3ETDA 4PDMA 4X89A 2FTKA 3CCJV 3SPHA 1OZ0A 2IU0A 1NH2B 3ABMB 4P9OA 1OCZC 2HLDG 2QKSA 3LDCA 5C93A 3QO7A 1M57C 5IYCO 3GB7C 2WLIA 2B5UA 3DGEA 5KA5A 3ABLC 1K73W 2ATKC 2Z5UA 3OUSA 2MK3A 2Y69C 3K9AA 1QR8A 1XL6A 3SPJA 1QBZA 2EIKC 4EKWA 1K33A 1YTFD 4WFFA 1AJQA 5IY5C 1JVMA 3MHSC 3CCMV 1V54C 3OMNB 2EILC 2WLIB 3ASNC 4BIUA 1GM9A 3JD0A 5EK0A 3K79A 2UXXA 3LNMB 3OR6C 3E35A 1SESA 3FB7C 4WCEV 3BEHA 1VQKV 2A9HA 1OCZB 1KD1W 3LSQA 3ZIAG 2NLJC 1M57B 1M90W 2ITCC 2WWWA 4R8CA 2KB1A 4UXNA 3LDEA 5H6RA 3ZCCA 4JASA 1YTFB 1VQ5V 3HB3B 2PI5A 3M99B 1R73A 2PI4A 1YSCA 2EIKB 1M56C 3ML0A 4MT8A 3ASOC 1FXHA 2XOKG 3F5WC 4QE7A 5IY5B 1NBMG 2EILB 1H8EG 3ASNB 2P7TC 1DLBA 2QTOA 2DQ0A 4ASUG 3HPLC 2WLMA 3K3WA 2JIZG 2M7WA 1KKDA 5KUKA 3OW2U 3W7XA 1K5QA 3AG4C 3G6EV 3CCUV 4QNHB 1NVPB 4WFEA 1SERA 2OTJV 4FPPA 5EC1C 5L3DA 4JF3A 4MTGA 1K34A 3RW0A 1VQ7V 1V55C 2LP7A 1AI7A 2WAMA 3JD4A 3FKSG 1EZJA 5H9CA 1AROP 3LUTB 1M56B 2DYSB 3ASOB 2ZQMA 4HYOA 5IYBO 3ZRSA 3AG3C 1FXKC 4E2LA 1KECA 4MTOA 1SETA 4RUEA 4U7OA 1B6QA 2X0LA 3CCLV 5B1AB 2DWEC 4MVOA 5CBHA 3CP1A 3ZRVA 3QO5A 3AEIA 1YHQV 3AG4B 3WFVA 2A79B 5B1NA 1W2BU 3E8GA 1FXKA 4PDVA 3ZN0A 1OCRC 4PDRA 3CXCU 4G28B 4XBFA 4MVQA 4MSWC 2OTLV 5DN6G 3W7TA 3ZMZA 1NH2D 3FB8C 1OCCC 2QEXV 1F4MA 1NQTA 1OHHG 1KP2A 3AG3B 1AJPA 1FXKB 4BIZA 2HFEC 4U7NA 2Q69A 2QE7G 3BY6A 3K0GA 1VQOV 5LHIA 3LSSA 1VQ9V 2JJ1G 2WSSG 1S72V 3JD1A 5EBMC 2XAJA 5CMUA 3B8MA 4MTFA 2UXNA 3K08A 1VQPV 4RQEA 5L3GA 1Q7YW 5KA6A 3TCUA 1JX9A 1K5SA 4CBCA 5LGUA 4QIWF 1OCRB 3G71V 2JDIG 4UVAA 2V7QG 2YEVA 5EBWC 2EZOA 5E1AC 3A0RA 1JCHA 1M1KW 2P90A 1QR9A 1OCCB 2X7RB 3D36A 2EZPA 3CCVV 3E8FA 1SZTA 3CCRV 3UKMA 3PJSK 5IYDO 3IGAC 2IH3C 1ZWIC 2H8PC 1PL0A 2YEVB 3CD6V 3ZMUA 3F7YC 1PNLA 2XAGA 3OAAG 2XAHA 2HG5C 3RBZA 2R9RB 2ZXWC 2IU3A 2A0LA 1Q86W 3QO8A 4I9WA 1GO3F 1NVPD 4WFGA 2F43G 1TUEB 4MVSA 1Q82W 2WLKA 4PA7A 1GM8A 1S0VA 1H38A 4Z1MG 3W7SA 2DYSC 3AG2C 3FB5C 1WLEA 1CP9A 2YSUB 5DM6V 3T1CA 4UVBA 2V1DA 3EHBB 4LP8A 5B1AC 3SYAA 4MVRA 4XDKA 4MW3A 3AG1B 3IC7A 5CA3A 1AI4A 1K4DC 4QJFB 3K06A 3CYOA 5B1BB 1VQNV 2X6CA 4XDLA 1IXMA 1THZA 3ABKC 2HVKC 4MVUA 5LBQA 2ZXWB 2QM7A 2EINC 2JEXA 2W6IG 3P30A 2Y48A 3EFFK 1G4YB 3JD3A 3CC4V 2JEUA 3H01A 1K92A 1XL4A 1EFRG 4KP4A 2D3OW 2ZD9A 1Y66A 3MHHC 1KC8W 2P67A 3OMAB 2Q68A 2C2AA 3E83A 3D3IA 3AG2B 1MABG 4HZ3A 4DXWA 1BHBA 4UUJC 1BMFG 1VQ8V 4FK5C 2XNDG 2NNUA 3R65A 1UJWB 4FMTA 3SPGA 1H2GA 4PA3A 1E1QG 4P2ZA 1YJ9V 4GCZA 4RO2A 4ZKIA 1YI2V 2IJHA 3ABKB 4TWKA 2EINB 2HKOA 4X88A 3MD0A 2WLNA 4PA9A 1CEZA 3SPIA 1I5YA 1E79G 2X6BA 3CCQV 1K9MW 4OXSA 2DW4A 1OCOC 4R6ZA 4JYCA 4XDJA 1K4CC 1JJ2U 1SRYA 3OFNG 4UV8A 3IFXA 3SYPA 2Q67A 2BOCC 3ETEA 3K04A 1R3JC 1R6KA 4MVZA 4JGSA 3JD2A 1FXVA 1FFTB 1AI6A 1GK9A 2JJ2G 5B3SC 4FJCC 1KQSU 2IJJA 4MVMA 3OMIB 1VQ6V 1RPOA 3DTUB 1AR1B 4P9PA 4JPRA 4R50A 1BL8A 5GW7A 1GTOA 1Y4MA 4PDLA 4KFMA 3STZC 3CMEV 3SYOA 3W7WA 5L3CA 1I5XA 1RPRA 2OCCB 5HFLA 2K1EA 4G2KA 1J95A 2ITDC 1G8MA 1H8HG 4RAIA 4F4LA 4N23A 5J9PC 2JK5C 4X8AA 4RUFA 2GHYA 1RM1B 4CZZA 1OCOB 3CCSV 3CMAV 3CPWU 1FS0G 2ZR3A 1HWYA 1MOFA 2EIMC 3FYEB 2DQ3A 3B77A 3KG2A 3OR7C 4PA6A 3SYQA 2CK3G 2XAFA 3B8NA 5LHGA 3P32A 4QPJA 2LFRA 5LGNA 1E1RG 4JTDB 5EC2C 1YJWV 1MSWD 2IJKA 5CBGA 3ZRXA 4YXWG 5CN0A 4DO2A 3AG1C 2EBOA 3WG7B 1ROPA 2ZR2A 5B3SB 3JYCA 3VOUA 3STLC 5B1BC 1NR7A 4I5SA 1GM7A 4GT1A 2DWDC 1YJNV 3ZMSA 2H94A 1QVFU 2X6AA 2EIJB 3I56V 3ZMVA 4GX0A 1JOYA 4MW8A 3UM7A 1NKDA 1R3IC 3NXSA 4JTCB 3T2MA 1BHAA 4WF9V 4L87A 2R9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVU A;  3ABK C;  2HVK C;  3OGC C;  1QLE C;  2A79 B;  3K0D A;  2HVJ C;  3OUF A;  4H37 A;  3ZJZ A;  2HJF C;  4PDM A;  2EIN C;  4X89 A;  3E8G A;  3SPH A;  4PDV A;  3EFF K;  3F7V C;  4H33 A;  1G4Y B;  1OCR C;  4PDR A;  3X2Q C;  1XL4 A;  3TET A;  4G28 B;  2ZD9 A;  1OCZ C;  4GX5 A;  4MVQ A;  4P9O A;  4MSW C;  3LDC A;  2QKS A;  2Q68 A;  3E83 A;  1M57 C;  3FB8 C;  3GB7 C;  4HZ3 A;  2WLI A;  4P30 A;  4DXW A;  1OCC C;  4J9Z B;  4UUJ C;  5BZB A;  2WLJ A;  3R65 A;  3ABL C;  2ATK C;  3OUS A;  3SPG A;  2Y69 C;  3SPJ A;  1XL6 A;  4PA3 A;  1S5H C;  4P2Z A;  2IH1 C;  2HFE C;  2Q69 A;  4RO2 A;  2EIK C;  4EKW A;  3K0G A;  4WFF A;  5IY5 C;  1JVM A;  1V54 C;  2EIL C;  2WLI B;  5EBM C;  3ASN C;  4MTF A;  3E8B A;  2BOB C;  3K08 A;  3SYA A;  4WFH A;  5EK0 A;  4TWK A;  4ZBM A;  3LNM B;  3E89 A;  3OR6 C;  3RVY A;  4X88 A;  3TCU A;  3FB7 C;  2WLN A;  3BEH A;  4PA9 A;  3SPI A;  4CBC A;  2WLL A;  5CBF A;  2X6B A;  4G27 B;  3FB6 C;  2A9H A;  4OXS A;  1OCO C;  4R6Z A;  3E8H A;  1R3L C;  2YEV A;  4XDJ A;  1LNQ A;  5EBW C;  1K4C C;  2NLJ C;  3K03 A;  5E1A C;  3SJQ C;  4BW5 A;  2ITC C;  2Q6A A;  4R8C A;  2KB1 A;  3LDE A;  3IFX A;  3SYP A;  2DYR C;  1P7B A;  2Q67 A;  2BOC C;  3E8F A;  3K04 A;  1R3J C;  4MVZ A;  2WLH A;  3UKM A;  3PJS K;  2WLL B;  3IGA C;  1M56 C;  2IH3 C;  1ZWI C;  3ASO C;  5B3S C;  2H8P C;  3F5W C;  4QE7 A;  4MVM A;  3SPC A;  1ORQ C;  4P9P A;  3F7Y C;  1BL8 A;  2P7T C;  2OCC C;  4MS2 A;  4R50 A;  3T4Z A;  2QTO A;  4PDL A;  4KFM A;  3STZ C;  3SYO A;  3HPL C;  2WLM A;  4GX1 A;  4LBE C;  2HG5 C;  3RBZ A;  1KKD A;  2K1E A;  5KUK A;  4LCU C;  1J95 A;  2ITD C;  3AG4 C;  2R9R B;  4RAI A;  4QNH B;  1R3K C;  2ZXW C;  4F4L A;  5J9P C;  2JK5 C;  4X8A A;  4RUF A;  4J9Y B;  4WFE A;  4QE9 A;  5KUM A;  2A0L A;  3VOU A;  4I9W A;  5EC1 C;  2EIM C;  3KG2 A;  4PA6 A;  3SYQ A;  4WFG A;  3OR7 C;  4MTG A;  3ABM C;  4MVS A;  2WLK A;  4PA4 A;  4PA7 A;  3RW0 A;  1V55 C;  4JTA B;  2DYS C;  4JTD B;  2W0F C;  5EC2 C;  3WG7 C;  3AG2 C;  3FB5 C;  5CBG A;  3LUT B;  3T1C A;  3AG1 C;  4HYO A;  3ZRS A;  4LP8 A;  5B1A C;  3AG3 C;  2EIJ C;  3JYC A;  2AHY A;  4MVR A;  5EBL C;  3E86 A;  4MW3 A;  4XDK A;  5B1B C;  3RVZ A;  3STL C;  4MTO A;  2AHZ A;  2DWD C;  4RUE A;  1K4D C;  2X6A A;  2DWE C;  3K06 A;  4MVO A;  3T4D A;  5CBH A;  4GX0 A;  3SYC A;  4MW8 A;  3UM7 A;  1R3I C;  4JTC B;  4GX2 A;  4R7C A;  3T2M A;  2X6C A;  4XDL A;  3LDD A; 
#chains in the Genus database with same CATH topology
 3L72 H;  1D5N A;  2E3C A;  3JAR A;  1PPJ H;  4J80 A;  2P6J A;  4LF6 B;  1GKF A;  1QLE B;  3F7V C;  5HFM A;  1YIT V;  1ZL8 A;  1HNW O;  2XAQ A;  4JYB A;  5L3F A;  4LC1 A;  3ICX A;  4P30 A;  4O2A B;  2Q0O C;  5LHH A;  1URF A;  1XNR B;  1YIJ V;  4DV5 B;  1AB3 A;  4JV5 B;  4BW9 A;  1VAR A;  3ABL B;  4DV2 B;  4JAA A;  4DR7 B;  2BOB C;  4FIP C;  4WFH A;  4BAY A;  3UO2 A;  1R6N A;  1F23 A;  1PNK A;  3A8T A;  1L1F A;  2WLL A;  4TQF A;  3FB6 C;  1NJI W;  4WFA V;  4B7E A;  4DR3 O;  3K03 A;  4UV9 A;  4BW5 A;  2Q6A A;  5FL7 G;  2OT5 A;  5KX5 A;  1P7B A;  3VBB A;  2Q7H A;  2F1M A;  4EEQ A;  4UVC A;  4JI0 B;  4DR4 B;  2YDE A;  3SPC A;  1ORQ C;  4MS2 A;  2OCC C;  3H1L H;  5EZY A;  4EFB A;  4X65 O;  4NXM B;  4AIL C;  4J7K A;  4UB6 Z;  1RM1 C;  4LCU C;  1TA8 A;  5L3E A;  5KUM A;  1BZK A;  1ENV A;  2WA4 A;  3OGI B;  5KHH A;  4PA4 A;  4JTA B;  3OEH G;  4PEL A;  2QSA A;  4GKJ O;  1PKX A;  1UFI A;  1VQL V;  5EBL C;  2IW5 A;  1UPG A;  1W0J G;  1HP8 A;  1COW G;  1JPX A;  1XOU A;  2B1I A;  5KHJ A;  4R7C A;  5TIS Z;  1VQ4 V;  5EYP B;  2IJI A;  3OM3 B;  4K0K O;  3OGC C;  3ZJZ A;  2HVJ C;  4JI6 O;  2UXD O;  4DR5 B;  4X89 A;  4E4E A;  4DR6 B;  4DV0 B;  1VF5 B;  2BSK A;  3AG7 A;  4ABM A;  4JI2 B;  2KSD A;  2RNB A;  2K9P A;  4IT5 A;  2Z5U A;  1BCC H;  1LR1 A;  1QBZ A;  4FLV A;  4EKW A;  4WFF A;  2GTS A;  1Y74 A;  1AJQ A;  3ETQ A;  3ASN C;  2D2C B;  4K8Z A;  5EK0 A;  2UXX A;  1GAX A;  3FB7 C;  3BEH A;  1VQK V;  1LUW A;  3VQW A;  4JI4 O;  2NLJ C;  4K3A A;  3G6B A;  1M90 W;  2WWW A;  1MA1 A;  3ZCC A;  4JAS A;  1VQ5 V;  3M99 B;  1HNX O;  2HP8 A;  3BPZ A;  3WB2 A;  2PYJ A;  1F7Y A;  5KAF Z;  4EFE A;  4JI1 B;  2QTO A;  1N36 O;  1BQ0 A;  1NT2 B;  3HPL C;  2WLM A;  4NB5 A;  4I0X A;  3T1H B;  2FL4 A;  4FPP A;  3T1Y O;  4KL1 A;  4YY3 O;  4JF3 A;  4LH7 A;  3H1I H;  1V55 C;  3LNN A;  3FKS G;  1ARO P;  5EIB D;  2DYS B;  4DV4 O;  3ASO B;  4JI3 O;  1FXK C;  1KEC A;  4U7O A;  2E74 B;  4DV7 O;  3EXA A;  1Q3E A;  2RDC A;  3KCY A;  5CBH A;  3P3N A;  2BTQ A;  3ZRV A;  5B5E Z;  3QO5 A;  1HNZ B;  3AG4 B;  3B2E E;  4ZHQ B;  1Q6I A;  1W2B U;  1FXK A;  1KB9 F;  1OCR C;  5F2V O;  5ITZ B;  4G28 B;  2Q4P A;  2AXT Z;  2QM4 A;  2EUL A;  4EB6 B;  4IIJ B;  4J10 A;  5FPO A;  2UUC B;  1NQT A;  3CX5 F;  1XMQ B;  4BIZ A;  1RSO B;  2QE7 G;  1KU9 A;  3HR0 A;  3LSS A;  3K59 A;  2JJ1 G;  3RYC A;  1GH6 A;  5EBM C;  2CDY A;  3B8M A;  4MTF A;  3D36 C;  1AP5 A;  1Q7Y W;  3TCU A;  1K5S A;  2CAZ C;  2PY5 A;  2V4D A;  2JDI G;  3R66 A;  2ZM6 B;  3N2K B;  3CE2 A;  4U3J A;  3D36 A;  2YXL A;  3SJA C;  1SZT A;  2HEP A;  2VQF O;  3IGA C;  4TQD A;  1XNR O;  1PL0 A;  4DV5 O;  4UB8 Z;  2IBZ H;  3CD6 V;  3JAK A;  4JV5 O;  3QVN A;  3JAM N;  2CGN A;  1PNL A;  2NR5 A;  2XAH A;  3RBZ A;  1P49 A;  3QTC A;  4B3M B;  2YC0 A;  1IDS A;  2ZXW C;  5IT9 N;  4FZ1 A;  2Y4T A;  2F95 B;  3FAV A;  1Q86 W;  1TUE B;  3CJH A;  2ADQ B;  4BWA A;  4I50 A;  4PA7 A;  1XIL A;  5CA0 B;  1XHZ A;  2QWQ B;  3CXH F;  4NXN O;  2QJ1 A;  5DM6 V;  4ZI7 B;  3T1C A;  3EHB B;  3M8A A;  4MW3 A;  3IC7 A;  5CA3 A;  4QJF B;  2QDO A;  4JI0 O;  4DR4 O;  5LXT A;  4XDL A;  4LF5 B;  4NXM O;  4AQY B;  4ICG A;  3JD3 A;  3H01 A;  1K92 A;  3GWK C;  1Y66 A;  2P67 A;  2C2A A;  4LNU B;  4JI7 B;  3AG2 B;  2HHH O;  4HZ3 A;  2XND G;  3ZHV A;  1UJW B;  3SPG A;  2ZE7 A;  3HKE A;  3E22 A;  2ZNJ A;  2IJH A;  2DN9 A;  5JJE B;  5IJ9 A;  3VQY A;  2EIN B;  3RYI B;  3RFR A;  4LF4 B;  2DJV A;  3GVM A;  1E79 G;  1FFX B;  1K9M W;  4OXS A;  1FJG B;  1SKV A;  1SRY A;  5LMN B;  4DR6 O;  1D2D A;  3ZED A;  3IFX A;  5H5N A;  2BOC C;  5JJN B;  4TV9 B;  1FPO A;  4JI2 O;  3WU2 Z;  1AI6 A;  4O2B B;  1KQS U;  1HR0 B;  4MVM A;  1N32 B;  3OMI B;  1RPO A;  1AR1 B;  5LA6 A;  5LOV B;  4OX9 O;  4KFM A;  3STZ C;  1TUB B;  3W7W A;  1I5X A;  1RPR A;  5HFL A;  2AW9 A;  1BT8 A;  1G8M A;  3HKD A;  2XHB A;  1YXB A;  5JVD B;  2FKX A;  1OCO B;  3CPW U;  3OR7 C;  2BCC H;  3B8N A;  5LHG A;  3JAS A;  1IXB A;  1XNQ B;  1MSW D;  1VF6 C;  3C90 A;  2ZCE A;  2LGW A;  3ZRX A;  1PM9 A;  3WG7 B;  3IAY A;  1ROP A;  1S5L Z;  1Q8I A;  4LH6 A;  1KBH A;  1XDC A;  1GM7 A;  3SJB C;  4DK1 A;  1YJN V;  2EJ7 A;  1US6 A;  1VIB A;  1BHA A;  1NKD A;  1R3I C;  4JTC B;  1WB7 A;  4UFZ A;  1VF6 A;  4L87 A;  3SR2 C;  2R9I A;  3ZBH A;  2E5L B;  4O2A A;  2EJR A;  1IUR A;  5B1O A;  4D7T A;  2Q9L A;  2W6J G;  3TET A;  4GX5 A;  3W7U A;  2HR3 A;  1MG1 A;  4Q20 A;  4TUY B;  4JI8 O;  4J9Z B;  1QCE A;  2WLJ A;  2XT9 A;  3OEE G;  2GUZ B;  1K97 A;  1YZB A;  1JA8 A;  4FLY A;  1K8A W;  2ETN A;  4TT3 G;  2E75 B;  3ZN1 A;  4J11 A;  1F4N A;  1CPY A;  1DTO A;  3DSQ A;  2PGG A;  5FNV B;  3RVY A;  2JVD A;  3DC5 A;  5CBF A;  3SJC C;  5KHG A;  3CRM A;  2P06 A;  3E8H A;  4I4T B;  4LF8 B;  2F23 A;  3G80 A;  5L3B A;  2WLH A;  1TGO A;  3E2E A;  3RT3 C;  4WFB V;  1ZSP A;  1WB8 A;  1PNM A;  5BXZ A;  1Y67 A;  1M9N A;  4YIP A;  3FD9 A;  4GX1 A;  4AI8 A;  4TSF G;  4CS3 A;  1S76 D;  2QA4 V;  3ZMT A;  4LWS B;  3U11 A;  1BQZ A;  2YS8 A;  2ZM6 O;  4FFB B;  5JWP A;  3K5M A;  5EYP A;  1FKA O;  3D8C A;  2ILM A;  1XMO B;  1AJN A;  3RVZ A;  3T4D A;  1R1B A;  3CC2 V;  4IGG A;  3LDD A;  1XRE A;  4LFB B;  1KKC A;  3K0D A;  4PDM A;  4UCR A;  1YCI A;  2GDS A;  5FLX N;  1NH2 B;  3ABM B;  4L8J A;  4P9O A;  3RYH B;  2VQE B;  3QO7 A;  5IYC O;  3GB7 C;  2B5U A;  2RCV A;  5KA5 A;  4BR6 A;  2Y69 C;  3K9A A;  3P3P A;  4WBN B;  1QNM A;  2JS5 A;  1NU1 H;  5KHI A;  1JVM A;  4BIO A;  1V54 C;  3OMN B;  2WLI B;  1GM9 A;  3JD0 A;  3OT7 A;  2UXC B;  3LNM B;  2JGU A;  3OR6 C;  4WCE V;  2LQT A;  2YID A;  3IC9 A;  4CS4 A;  1T5E A;  3BA9 A;  4F6E A;  4CC5 A;  3LSQ A;  2PZS A;  3ZIA G;  2CGO A;  4KXR A;  2ITC C;  5H6R A;  4R8C A;  3LDE A;  3HB3 B;  2ZE5 A;  2PI4 A;  1YSC A;  5LYJ B;  3B4S A;  2EIK B;  1N33 B;  3ASO C;  1GRJ A;  2XOK G;  4IYH A;  2MW2 B;  4B3R B;  5FPR A;  4QE7 A;  5IY5 B;  4CS2 A;  1SQP H;  2RJZ A;  3CEI A;  2LW1 A;  2JIZ G;  3OW2 U;  1K5Q A;  3AG4 C;  4I55 B;  4QNH B;  1NVP B;  3O65 A;  5L3D A;  2IM9 A;  4QGP A;  5LP6 B;  1N34 B;  3RW0 A;  4B08 A;  3OTF A;  5KLV H;  1JFF B;  5LMN O;  1WNS A;  4U3F H;  5IYB O;  2KQX A;  4ZHQ A;  4F6R B;  4X20 B;  1AR5 A;  2BTO A;  3CCL V;  2R9A A;  5B1A B;  3L9D A;  1MNG A;  5ITZ A;  3S3X A;  1ZX3 A;  2KG7 B;  3B09 A;  4EB6 A;  4IIJ A;  1M4U A;  3DXR B;  1RSO A;  2UXB O;  4MSW C;  3W7T A;  1WP8 A;  3Q4H B;  3ZMZ A;  1NH2 D;  4YJ2 B;  1KP2 A;  3AG3 B;  1XNQ O;  2ODM A;  2Q69 A;  3K0G A;  5LHI A;  2P4K A;  2WSS G;  1KYO F;  1P7G A;  2XAJ A;  3N2K A;  5DED A;  5L3G A;  5KA6 A;  2E5L O;  5LGU A;  1IBL O;  2N74 A;  2YXY A;  2CH7 B;  4UVA A;  4KHP B;  2Q8V A;  2V7Q G;  1SS3 A;  5EBW C;  4GZR B;  5E1A C;  3A0R A;  5LL6 Y;  1OCC B;  2X7R B;  5C8Y B;  2EZP A;  3CCV V;  3E8F A;  3G67 A;  3UKM A;  5A2Q N;  1YVW A;  5IYD O;  4OPH A;  2Z0A A;  4DV6 B;  4NTX A;  4Z1V A;  3C3T A;  1V9P A;  3F7Y C;  4YJ3 B;  3ZMU A;  2YUA A;  1XQ8 A;  4B3S B;  1VMG A;  2HG5 C;  5CA0 A;  4ZI7 A;  3ZHR A;  1FAF A;  1M5I A;  5JCO C;  1GO3 F;  1NVP D;  3J81 N;  1NI8 A;  4Z1M G;  1XUQ A;  3LSU A;  3AG2 C;  3CS5 A;  3HKC B;  4LF8 O;  5JJJ B;  2V1D A;  2XUM A;  1AIL A;  4LP8 A;  3AG1 B;  2JS3 A;  5JCO A;  4X1K B;  1K4D C;  2YIB D;  3K06 A;  2FML A;  4LNU A;  1IXM A;  4FM1 A;  1THZ A;  3KCX A;  5LBQ A;  1XBL A;  2EIN C;  1EN6 A;  2LW7 A;  5A9G A;  4CH3 A;  2JEU A;  5KMG B;  1XL4 A;  1Y76 B;  2D3O W;  2H3O A;  3MHH C;  3E83 A;  4UUJ C;  5J2U B;  2NNU A;  3CWB H;  5J2T B;  3RYI A;  4X1I B;  1YI2 V;  4X62 B;  1FFX A;  1I0H A;  1YF2 A;  1I08 A;  1XMO O;  4DV1 B;  4TWK A;  5GTH Z;  4TV9 A;  2WLN A;  4PA9 A;  3SPI A;  2ADP A;  4UCV A;  4GKK O;  4LFB O;  4PHZ A;  5GON B;  4O2B A;  3ZHT A;  2DW4 A;  1IX9 A;  1OCO C;  4DR1 B;  4J41 A;  4JYC A;  5IWA O;  4O4I B;  3OFN G;  5LOV A;  4UV8 A;  1EN5 A;  1TUB A;  2Q67 A;  4GUN A;  4MVZ A;  2UUA B;  3ZX6 A;  2Q7E A;  1GN2 A;  1FFT B;  4CH4 A;  1GK9 A;  5JVD A;  1KMI Z;  3DTU B;  4P9P A;  1L0N H;  5GW7 A;  1GTO A;  3CME V;  4J7J A;  2OCC B;  4G2K A;  4LF6 O;  4DV3 B;  5DEC A;  4F4L A;  4B7K A;  2JK5 C;  1SQG A;  1RM1 B;  2UXC O;  3CMA V;  1FS0 G;  2ZR3 A;  1HWY A;  3FYE B;  1ZAU A;  2DQ3 A;  3B77 A;  3P32 A;  4X64 B;  4CH5 A;  1YJW V;  2IJK A;  5CN0 A;  5B3S B;  2ZR2 A;  1GN3 A;  3VOU A;  3STL C;  5B1B C;  1NR7 A;  4DV2 O;  2DWD C;  5JH7 B;  3DC6 A;  4DR7 O;  2X6A A;  1N33 O;  3I56 V;  3ZMV A;  1U96 A;  3I5D A;  4GX0 A;  4MW8 A;  4B3R O;  1WA8 B;  3T2M A;  4TUY A;  1QLN A;  4H37 A;  3U0Z A;  2HJF C;  1WPX A;  1OJH A;  3JSL A;  2GUZ A;  1N8R W;  3L75 H;  5LGT A;  3ZRW B;  1I94 B;  4PD4 F;  4HAM A;  2OYQ A;  1P4R A;  5BZB A;  5KHK A;  3OTO B;  4GLX A;  3JAW B;  5FNV A;  1AI5 A;  4O4J B;  1S5H C;  4MTX A;  1IBK B;  1ZTE A;  1Q5O A;  2AZ0 A;  4JYA B;  4QPK A;  3CSX A;  4I4T A;  2XAS A;  3E8B A;  5E79 Z;  1N0J A;  1B04 A;  3ABT A;  3E89 A;  3H1H H;  1S77 D;  3X2Q B;  4G27 B;  2ZE8 A;  2L35 A;  1R3L C;  1LNQ A;  3CC7 V;  1EBO A;  2ZKO A;  4PI2 A;  3H1K H;  3UCS C;  1BS3 A;  2GSM B;  2WPD G;  2UUB B;  4LWS A;  3K58 A;  3J7A U;  1NTM H;  1DF5 A;  2RN9 A;  1K7D A;  4FFB A;  4DR5 O;  1Z5V A;  4QE9 A;  4DV0 O;  2QKA A;  4IYI A;  3ABM C;  3OE7 G;  4KUM A;  2DYR B;  1PD3 A;  1J5E B;  4AHC A;  5BR8 B;  2W0F C;  1SQX H;  3QNE A;  5IDJ A;  1PL4 A;  1V55 B;  1WAZ A;  3WB1 A;  2EIJ C;  2AHY A;  3ABU A;  1KP3 A;  2AHZ A;  4JAV A;  3SYC A;  4I9Q A;  3BRC A;  4DV6 O;  4GX2 A;  3RYH A;  1HDJ A;  4X65 B;  4TOI A;  1QLE C;  1NS1 A;  1R6T A;  2CTW A;  3CCE V;  3ETD A;  4B3S O;  1IBM B;  3CCJ V;  2R70 A;  3SPH A;  4DRX B;  4WBN A;  1OZ0 A;  2IU0 A;  4NVP A;  3LDC A;  2QKS A;  3BCC H;  2Q5Z A;  4JYY A;  1HW7 A;  2WLI A;  4DR2 B;  2OIG A;  3N2G B;  3ABL C;  3OUS A;  4DYL A;  1XL6 A;  1NTK H;  4OGQ B;  2EIK C;  3RYF B;  1K33 A;  3JAT B;  1YTF D;  4JI1 O;  5IY5 C;  3MHS C;  4BIU A;  3T1H O;  4YIO A;  5CB4 B;  4K0K B;  3BA8 A;  1SES A;  4JI6 B;  1X59 A;  5LYJ A;  1H2K A;  2A9H A;  1OCZ B;  4YHH B;  1KD1 W;  2YIA A;  1Q6U A;  1M57 B;  2P22 C;  1G6U A;  1LUV A;  3QG5 A;  4UXN A;  2PI5 A;  1WJZ A;  1QQC A;  4FM0 A;  2M6Y A;  1P84 F;  4I55 A;  4MT8 A;  1FXH A;  3F5W C;  1NBM G;  2EIL B;  1DLB A;  4LFC B;  2DQ0 A;  4X62 O;  4ZOL B;  5LP6 A;  1HNZ O;  4ASU G;  3K3W A;  3K9S A;  1KKD A;  3APQ A;  5KUK A;  1MZE A;  3BVO A;  3W7X A;  2PYL A;  1JFF A;  1GN6 A;  1SQF A;  1SER A;  2A3Q A;  3VQX A;  5EC1 C;  4F6R A;  5EIB C;  4X20 A;  4MTG A;  1K34 A;  1VQ7 V;  2LP7 A;  4IHJ B;  2ZNI A;  1AI7 A;  4DR1 O;  2KKW A;  2KG7 A;  2WAM A;  2ZIN A;  3L74 H;  2QKC A;  3JD4 A;  5CA1 B;  2UUC O;  1EZJ A;  5H9C A;  1XMQ O;  1M56 B;  1SA0 B;  1HNX B;  4HYO A;  4PJ0 Z;  3AG3 C;  4E2L A;  4MTO A;  4RUE A;  3VQV A;  1B6Q A;  3DXR A;  2UUA O;  4CC6 A;  1OV9 A;  1PP9 H;  1TVK B;  1N36 B;  1FD9 A;  3Q4H A;  3AEI A;  3WFV A;  4W4L A;  2A79 B;  4YJ2 A;  4X1Y B;  5B1N A;  3E8G A;  4PDV A;  4PDR A;  1JJO A;  2JRI A;  4MVQ A;  2OTL V;  5BMV B;  1OCC C;  2QEX V;  1F4M A;  1TAE A;  1Q6H A;  1OHH G;  4NTY A;  1AJP A;  1JMK C;  2HFE C;  3BAB A;  4JI3 B;  3ZHQ A;  1VQO V;  3THO A;  1VQ9 V;  3O9O A;  2CH7 A;  1S72 V;  3JD1 A;  3OD4 A;  4RWU A;  5C8Y A;  4RQE A;  4I7Z B;  4B3M O;  1JX9 A;  4CBC A;  4J7Z A;  4NTW A;  4PV1 B;  3G71 V;  2DE0 X;  3APO A;  1D5A A;  2EZO A;  5JQG B;  4YJ3 A;  1JCH A;  1M1K W;  2P90 A;  1QR9 A;  2CTQ A;  1I94 O;  5AG2 A;  2H8P C;  4O4H B;  1WN7 A;  2YEV B;  1SQV H;  4FVM A;  2XAG A;  1XI1 A;  1IBK O;  2N04 A;  3OAA G;  2ZE6 A;  1Q90 D;  3HKC A;  4LF5 O;  2R9R B;  4AQY O;  2OCH A;  3QF7 A;  3QO8 A;  4FZ0 A;  4DUZ B;  1YDX A;  4X1K A;  1Q82 W;  2N05 A;  1S0V A;  1M93 A;  4JI7 O;  2DYS C;  3FB5 C;  1CP9 A;  2YSU B;  2ZIM A;  2YI8 A;  1AR4 A;  1X4T A;  2A06 H;  3UO3 A;  2VQF B;  3SYA A;  4D6T H;  4JI5 B;  4XDK A;  1Y6X A;  2P4V A;  1AI4 A;  2FB5 A;  5KMG A;  5BY1 A;  3CYO A;  3RWR D;  1Y76 A;  1SF9 A;  3TGU H;  2X6C A;  2HVK C;  1S5J A;  2ARH A;  5LMU B;  4LF4 O;  2UUB O;  5J2U A;  1CXZ B;  5J2T A;  2JEX A;  1RFY A;  2Y48 A;  1BSM A;  3EFF K;  1RP3 B;  1FJG O;  4X1I A;  3CC4 V;  3F5T A;  1W59 A;  4HBN A;  2A7W A;  3CB2 A;  2HJD A;  2Q68 A;  2Y0P A;  3D3I A;  4FLT A;  3HKB B;  2UU9 B;  3JAL B;  1O9G A;  1VQ8 V;  1MZF A;  4NXN B;  4FK5 C;  2F66 C;  1J5E O;  5BR8 O;  4FMT A;  4DK0 A;  1H2M A;  2GTA A;  1EM1 A;  4GCZ A;  4X9Q A;  3BFR A;  4RO2 A;  4ZKI A;  1HR0 O;  1N32 O;  3L70 H;  5GON A;  3CRR A;  3TXS A;  3ABK B;  4O4I A;  1XEQ A;  1WP7 A;  3MD0 A;  4FLW A;  1I5Y A;  5D5Q A;  2X6B A;  4HNA B;  2OIE A;  1VEW A;  4XDJ A;  1IBM O;  3SGI A;  1K4C C;  1JJ2 U;  4TV8 B;  3SYP A;  3IJ4 A;  2HHH B;  3K04 A;  3ETE A;  1R6K A;  4JGS A;  3D3Q A;  4DR2 O;  1EN4 A;  2JJ2 G;  5B3S C;  4FJC C;  1VQ6 V;  3K5L A;  3ZS8 C;  3H1J H;  4JPR A;  4R50 A;  1SC5 B;  4PDL A;  1EZV H;  5L3C A;  1SQB H;  2K1E A;  1H8H G;  4RAI A;  1KUQ A;  4N23 A;  4X8A A;  4RUF A;  2GHY A;  1XHX A;  4CZZ A;  5K1P A;  4FLU A;  4NYK A;  3SYQ A;  5JH7 A;  4QPJ A;  4YHH O;  1WA8 A;  5CBG A;  3UT5 B;  2AGA A;  2EBO A;  5IJ0 B;  4FFK A;  3JYC A;  4I5S A;  2JGD B;  2H94 A;  3ZMS A;  1QVF U;  1H2N A;  5IYZ B;  2LJ2 A;  2NN4 A;  3UM7 A;  4OX9 B;  4WF9 V;  3ZRW A;  1K3E A;  3OUF A;  3GWO A;  4LFC O;  4O4L B;  2YI9 A;  4LFA B;  3JAW A;  4O4J A;  1QVG U;  2EIM B;  5KAI Z;  4H33 A;  3X2Q C;  3L73 H;  4JAU A;  4Q6G A;  4K8X A;  3JAR B;  2L6L A;  3CRC A;  4LF7 B;  4N21 A;  2Z3Y A;  3I55 V;  2BE3 A;  2IH1 C;  4X66 B;  1ZL8 B;  2Y69 B;  4OPA A;  3FX7 A;  1N0N A;  2EX3 A;  1VQM V;  3JCZ A;  1JQ0 A;  4ZBM A;  1V54 B;  2ZDI C;  3CRQ A;  2B1G A;  3K5O A;  1S3J A;  3ETG A;  3SJQ C;  4DW1 A;  1AVM A;  1A32 A;  1NTZ H;  2DYR C;  4JI8 B;  2ZDI A;  5H6Q A;  2WLL B;  3K57 A;  1AP6 A;  4A5U B;  1W0K G;  1GMG A;  2QWR B;  3T4Z A;  5KX5 B;  2LFS A;  3JCU Z;  1O9H A;  4LBE C;  1F51 A;  1ZLZ A;  4UCO A;  3A0B Z;  2P5O A;  1YEW A;  1FYJ A;  1NR1 A;  1R3K C;  3FYI B;  4J9Y B;  2PTM A;  1DF4 A;  2QWO B;  2RMK B;  5EZY B;  5B66 Z;  2VQE O;  2YXH A;  3ZHU A;  3WG7 C;  4FM2 A;  2CE4 A;  4DUY B;  3J80 N;  1PV0 A;  4RQF A;  1DGS A;  3E86 A;  4DRX A;  1L0L H;  1Q81 W;  3TK1 A;  2QM8 A;  3RN4 A;  1B3Q A;  2ZIO A;  4JZG A;  1JR9 A;  4B3T B;  3G4S V;  2B9Z A;  3N2G A;  2FTK A;  3AK2 A;  2Q7G A;  4PI0 A;  3RYF A;  1OCZ C;  3BHP A;  3JAT A;  2HLD G;  4ZIB A;  4Z2W A;  5C93 A;  1M57 C;  4DUZ O;  4FLX A;  1N4C A;  4LF9 B;  3DGE A;  2CTP A;  5CB4 A;  1K73 W;  1GN4 A;  2ATK C;  2OWO A;  1H2S B;  2MK3 A;  3SPJ A;  1QR8 A;  4H44 B;  2BSK B;  3FFQ A;  3BAA A;  4JI5 O;  1SQQ H;  1B06 A;  4D7S A;  2EIL C;  3K79 A;  2PF4 E;  3E35 A;  3KKY A;  1IVS A;  3PN1 A;  5LMU O;  4J42 A;  1Y74 B;  3CRA A;  2DOS A;  3UQ8 A;  1N34 O;  2PUS A;  5IE9 A;  2LGQ A;  3MDS A;  2VWJ A;  1YTF B;  2KB1 A;  2Q0A A;  4ZOL A;  1R73 A;  2UU9 O;  1M56 C;  3ML0 A;  1Q43 A;  5K1X A;  2F4V B;  1H8E G;  2P7T C;  3ASN B;  4UCT A;  2ZT9 B;  1H2L A;  3SDL A;  4IHJ A;  2M7W A;  1L8D A;  5CA1 A;  3G6E V;  3CCU V;  1VP7 A;  1HNW B;  1SA0 A;  3MAQ A;  4WFE A;  2OTJ V;  4UCU A;  2GV9 A;  4I0X B;  1TVK A;  4UCS A;  3A0H Z;  3LUT B;  3KZI Z;  2W0X A;  2QGN A;  2ZQM A;  3ZRS A;  4IL6 Z;  4X1Y A;  1SET A;  4W4K A;  2X0L A;  2DWE C;  4MVO A;  2FYU H;  3CP1 A;  1MMM A;  5BMV A;  3H9V A;  1YHQ V;  4DR3 B;  3ZN0 A;  5H2F Z;  4KHP O;  1VF7 A;  3CXC U;  4XBF A;  2G38 A;  2BTQ B;  2VWK A;  3A2F A;  5DN6 G;  3FB8 C;  4C7U A;  3CHX A;  2LO1 A;  4NKG B;  1NZ6 A;  1FXK B;  4U7N A;  3BY6 A;  1Z2G A;  3B40 A;  1ZUQ A;  5JQG A;  5CMU A;  3RGB A;  2UXN A;  3K08 A;  4CH6 A;  1VQP V;  2AZ2 A;  4NR1 A;  3TJT A;  1IZ3 A;  4QIW F;  1OCR B;  2QR4 A;  3K5N A;  2Q73 A;  4O4H A;  4LFA O;  2YEV A;  2RQ6 A;  3RYC B;  2UXB B;  4GKJ B;  3CCR V;  3PJS K;  1SZX A;  2YIC A;  4LF7 O;  2IH3 C;  1ZWI C;  3AK3 A;  2XTA A;  4X66 O;  4U3J B;  2UXD B;  2IU3 A;  2A0L A;  5LP6 C;  1IBL B;  1QHT A;  3JAK B;  4I9W A;  4WFG A;  2F43 G;  4MVS A;  2WLK A;  1GM8 A;  1H38 A;  3W7S A;  3TXQ A;  1G1X B;  1WLE A;  4UVB A;  3FAV B;  5B1A C;  2CUG A;  2DMX A;  1Z5W A;  4MVR A;  3CJH B;  4I50 B;  5GTI Z;  5B1B B;  1I7F A;  4GYC B;  1VQN V;  4DV1 O;  2YIB A;  4MVU A;  3ABK C;  3HKB A;  3JAL A;  2VRZ A;  2ZXW B;  4JZ2 A;  2QM7 A;  4JI4 B;  2W6I G;  3P30 A;  2GBO A;  3ZHS A;  1G4Y B;  4KP4 A;  1EFR G;  2ZD9 A;  5LXT B;  1KC8 W;  3C3S A;  3OMA B;  1MAB G;  2QWP B;  4DXW A;  1BHB A;  1BMF G;  3R65 A;  2F93 B;  1H2G A;  4PA3 A;  1E1Q G;  4P2Z A;  1YJ9 V;  2R72 A;  4DUY O;  2QWN B;  4H13 B;  4HNA A;  1DK1 A;  2E76 B;  4TV8 A;  4DV3 O;  2HKO A;  4X88 A;  3T1Y B;  1CEZ A;  4YY3 B;  1WPB A;  3HKE B;  3S3W A;  2O57 A;  3E22 B;  4B3T O;  3CCQ V;  2Y4U A;  3U10 A;  4R6Z A;  2QTS A;  1BGY H;  4X64 O;  4DV4 B;  5IJ9 B;  2VS0 A;  4LR3 A;  1R3J C;  2CTR A;  4DW0 A;  3JD2 A;  3NR7 A;  4DV7 B;  1FXV A;  4LF9 O;  2IJJ A;  3JSN A;  2Y0I A;  3AK1 A;  1BL8 A;  2WA3 A;  1Y4M A;  3WB0 A;  3SYO A;  1BE3 H;  1QU7 A;  1J95 A;  2ITD C;  3UT5 A;  5J9P C;  4H0L B;  5IJ0 A;  3CCS V;  3EVK A;  4GKK B;  1MSD A;  1MOF A;  2EIM C;  5LA6 B;  3KG2 A;  4PA6 A;  3CCM V;  2JGD A;  2CK3 G;  2XAF A;  5IYZ A;  5IWA B;  2LFR A;  5LGN A;  1E1R G;  4JTD B;  5EC2 C;  3N27 A;  4YXW G;  3HKD B;  3L71 H;  3OTO O;  5D5P A;  4K35 A;  4FLZ A;  4DO2 A;  3AG1 C;  4O4L A;  1U97 A;  4GT1 A;  4JYA O;  2EIJ B;  3JAS B;  1JOY A;  3NXS A;  3M7M X;  2F4V O; 
#chains in the Genus database with same CATH homology
 1QLN A;  3ZRW A;  1K3E A;  3OUF A;  3GWO A;  2P6J A;  4H37 A;  2HJF C;  1GKF A;  1WPX A;  2EJR A;  1QLE B;  5B1O A;  2EIM B;  1QVG U;  3F7V C;  5HFM A;  4H33 A;  1YIT V;  2W6J G;  3X2Q C;  3TET A;  4GX5 A;  3W7U A;  2XAQ A;  4JYB A;  5L3F A;  4LC1 A;  2HR3 A;  1N8R W;  4JAU A;  1MG1 A;  4Q20 A;  5LGT A;  4P30 A;  3ZRW B;  4HAM A;  5LHH A;  4J9Z B;  1QCE A;  1P4R A;  5BZB A;  1YIJ V;  2WLJ A;  4N21 A;  2Z3Y A;  1AI5 A;  3I55 V;  1S5H C;  3OEE G;  2IH1 C;  4MTX A;  3ABL B;  1K97 A;  2Y69 B;  1VQM V;  1K8A W;  4QPK A;  4TT3 G;  2XAS A;  3ZN1 A;  3JCZ A;  1F4N A;  1CPY A;  1JQ0 A;  3E8B A;  2BOB C;  4FIP C;  1DTO A;  4WFH A;  4BAY A;  3ABT A;  4ZBM A;  1V54 B;  1R6N A;  3E89 A;  3RVY A;  1F23 A;  2ZDI C;  1PNK A;  1S77 D;  2B1G A;  1L1F A;  1S3J A;  2WLL A;  5CBF A;  3ETG A;  3X2Q B;  4G27 B;  3FB6 C;  1NJI W;  3E8H A;  1R3L C;  4WFA V;  1LNQ A;  3K03 A;  4UV9 A;  3CC7 V;  3SJQ C;  4BW5 A;  2Q6A A;  1EBO A;  5FL7 G;  2OT5 A;  2DYR C;  1P7B A;  3VBB A;  5L3B A;  2ZDI A;  2WLH A;  5H6Q A;  2WLL B;  3E2E A;  4UVC A;  1W0K G;  1GMG A;  4WFB V;  3SPC A;  1ORQ C;  1PNM A;  2GSM B;  2WPD G;  4MS2 A;  2OCC C;  3T4Z A;  1M9N A;  2LFS A;  4LBE C;  4GX1 A;  1F51 A;  1DF5 A;  1K7D A;  1RM1 C;  4LCU C;  1NR1 A;  1R3K C;  3FYI B;  4TSF G;  5L3E A;  4J9Y B;  5KUM A;  4QE9 A;  1ENV A;  1DF4 A;  1S76 D;  2QA4 V;  3ABM C;  3OE7 G;  3ZMT A;  4PA4 A;  4KUM A;  2DYR B;  1PD3 A;  4JTA B;  3OEH G;  2W0F C;  3WG7 C;  4PEL A;  3QNE A;  1PKX A;  1V55 B;  5IDJ A;  1VQL V;  2EIJ C;  5EBL C;  2AHY A;  3ABU A;  2IW5 A;  1AJN A;  3E86 A;  1KP3 A;  3RVZ A;  4RQF A;  1W0J G;  2AHZ A;  1COW G;  1JPX A;  2B1I A;  4JAV A;  1Q81 W;  3T4D A;  3TK1 A;  3SYC A;  2QM8 A;  3CC2 V;  4R7C A;  4GX2 A;  1VQ4 V;  2IJI A;  3LDD A;  3OM3 B;  3OGC C;  1QLE C;  3K0D A;  3ZJZ A;  2HVJ C;  3G4S V;  3CCE V;  3ETD A;  4PDM A;  4X89 A;  2FTK A;  3CCJ V;  3SPH A;  1OZ0 A;  2IU0 A;  1NH2 B;  3ABM B;  4P9O A;  1OCZ C;  2HLD G;  2QKS A;  3LDC A;  5C93 A;  3QO7 A;  1M57 C;  5IYC O;  3GB7 C;  2WLI A;  2B5U A;  3DGE A;  5KA5 A;  3ABL C;  1K73 W;  2ATK C;  2Z5U A;  3OUS A;  2MK3 A;  2Y69 C;  3K9A A;  1QR8 A;  1XL6 A;  3SPJ A;  1QBZ A;  2EIK C;  4EKW A;  1K33 A;  1YTF D;  4WFF A;  1AJQ A;  5IY5 C;  1JVM A;  3MHS C;  3CCM V;  1V54 C;  3OMN B;  2EIL C;  2WLI B;  3ASN C;  4BIU A;  1GM9 A;  3JD0 A;  5EK0 A;  3K79 A;  2UXX A;  3LNM B;  3OR6 C;  3E35 A;  1SES A;  3FB7 C;  4WCE V;  3BEH A;  1VQK V;  2A9H A;  1OCZ B;  1KD1 W;  3LSQ A;  3ZIA G;  2NLJ C;  1M57 B;  1M90 W;  2ITC C;  2WWW A;  4R8C A;  2KB1 A;  4UXN A;  3LDE A;  5H6R A;  3ZCC A;  4JAS A;  1YTF B;  1VQ5 V;  3HB3 B;  2PI5 A;  3M99 B;  1R73 A;  2PI4 A;  1YSC A;  2EIK B;  1M56 C;  3ML0 A;  4MT8 A;  3ASO C;  1FXH A;  2XOK G;  3F5W C;  4QE7 A;  5IY5 B;  1NBM G;  2EIL B;  1H8E G;  3ASN B;  2P7T C;  1DLB A;  2QTO A;  2DQ0 A;  4ASU G;  3HPL C;  2WLM A;  3K3W A;  2JIZ G;  2M7W A;  1KKD A;  5KUK A;  3OW2 U;  3W7X A;  1K5Q A;  3AG4 C;  3G6E V;  3CCU V;  4QNH B;  1NVP B;  4WFE A;  1SER A;  2OTJ V;  4FPP A;  5EC1 C;  5L3D A;  4JF3 A;  4MTG A;  1K34 A;  3RW0 A;  1VQ7 V;  1V55 C;  2LP7 A;  1AI7 A;  2WAM A;  3JD4 A;  3FKS G;  1EZJ A;  5H9C A;  1ARO P;  3LUT B;  1M56 B;  2DYS B;  3ASO B;  2ZQM A;  4HYO A;  5IYB O;  3ZRS A;  3AG3 C;  1FXK C;  4E2L A;  1KEC A;  4MTO A;  1SET A;  4RUE A;  4U7O A;  1B6Q A;  2X0L A;  3CCL V;  5B1A B;  2DWE C;  4MVO A;  5CBH A;  3CP1 A;  3ZRV A;  3QO5 A;  3AEI A;  1YHQ V;  3AG4 B;  3WFV A;  2A79 B;  5B1N A;  1W2B U;  3E8G A;  1FXK A;  4PDV A;  3ZN0 A;  1OCR C;  4PDR A;  3CXC U;  4G28 B;  4XBF A;  4MVQ A;  4MSW C;  2OTL V;  5DN6 G;  3W7T A;  3ZMZ A;  1NH2 D;  3FB8 C;  1OCC C;  2QEX V;  1F4M A;  1NQT A;  1OHH G;  1KP2 A;  3AG3 B;  1AJP A;  1FXK B;  4BIZ A;  2HFE C;  4U7N A;  2Q69 A;  2QE7 G;  3BY6 A;  3K0G A;  1VQO V;  5LHI A;  3LSS A;  1VQ9 V;  2JJ1 G;  2WSS G;  1S72 V;  3JD1 A;  5EBM C;  2XAJ A;  5CMU A;  3B8M A;  4MTF A;  2UXN A;  3K08 A;  1VQP V;  4RQE A;  5L3G A;  1Q7Y W;  5KA6 A;  3TCU A;  1JX9 A;  1K5S A;  4CBC A;  5LGU A;  4QIW F;  1OCR B;  3G71 V;  2JDI G;  4UVA A;  2V7Q G;  2YEV A;  5EBW C;  2EZO A;  5E1A C;  3A0R A;  1JCH A;  1M1K W;  2P90 A;  1QR9 A;  1OCC B;  2X7R B;  3D36 A;  2EZP A;  3CCV V;  3E8F A;  1SZT A;  3CCR V;  3UKM A;  3PJS K;  5IYD O;  3IGA C;  2IH3 C;  1ZWI C;  2H8P C;  1PL0 A;  2YEV B;  3CD6 V;  3ZMU A;  3F7Y C;  1PNL A;  2XAG A;  3OAA G;  2XAH A;  2HG5 C;  3RBZ A;  2R9R B;  2ZXW C;  2IU3 A;  2A0L A;  1Q86 W;  3QO8 A;  4I9W A;  1GO3 F;  1NVP D;  4WFG A;  2F43 G;  1TUE B;  4MVS A;  1Q82 W;  2WLK A;  4PA7 A;  1GM8 A;  1S0V A;  1H38 A;  4Z1M G;  3W7S A;  2DYS C;  3AG2 C;  3FB5 C;  1WLE A;  1CP9 A;  2YSU B;  5DM6 V;  3T1C A;  4UVB A;  2V1D A;  3EHB B;  4LP8 A;  5B1A C;  3SYA A;  4MVR A;  4XDK A;  4MW3 A;  3AG1 B;  3IC7 A;  5CA3 A;  1AI4 A;  1K4D C;  4QJF B;  3K06 A;  3CYO A;  5B1B B;  1VQN V;  2X6C A;  4XDL A;  1IXM A;  1THZ A;  3ABK C;  2HVK C;  4MVU A;  5LBQ A;  2ZXW B;  2QM7 A;  2EIN C;  2JEX A;  2W6I G;  3P30 A;  2Y48 A;  3EFF K;  1G4Y B;  3JD3 A;  3CC4 V;  2JEU A;  3H01 A;  1K92 A;  1XL4 A;  1EFR G;  4KP4 A;  2D3O W;  2ZD9 A;  1Y66 A;  3MHH C;  1KC8 W;  2P67 A;  3OMA B;  2Q68 A;  2C2A A;  3E83 A;  3D3I A;  3AG2 B;  1MAB G;  4HZ3 A;  4DXW A;  1BHB A;  4UUJ C;  1BMF G;  1VQ8 V;  4FK5 C;  2XND G;  2NNU A;  3R65 A;  1UJW B;  4FMT A;  3SPG A;  1H2G A;  4PA3 A;  1E1Q G;  4P2Z A;  1YJ9 V;  4GCZ A;  4RO2 A;  4ZKI A;  1YI2 V;  2IJH A;  3ABK B;  4TWK A;  2EIN B;  2HKO A;  4X88 A;  3MD0 A;  2WLN A;  4PA9 A;  1CEZ A;  3SPI A;  1I5Y A;  1E79 G;  2X6B A;  3CCQ V;  1K9M W;  4OXS A;  2DW4 A;  1OCO C;  4R6Z A;  4JYC A;  4XDJ A;  1K4C C;  1JJ2 U;  1SRY A;  3OFN G;  4UV8 A;  3IFX A;  3SYP A;  2Q67 A;  2BOC C;  3ETE A;  3K04 A;  1R3J C;  1R6K A;  4MVZ A;  4JGS A;  3JD2 A;  1FXV A;  1FFT B;  1AI6 A;  1GK9 A;  2JJ2 G;  5B3S C;  4FJC C;  1KQS U;  2IJJ A;  4MVM A;  3OMI B;  1VQ6 V;  1RPO A;  3DTU B;  1AR1 B;  4P9P A;  4JPR A;  4R50 A;  1BL8 A;  5GW7 A;  1GTO A;  1Y4M A;  4PDL A;  4KFM A;  3STZ C;  3CME V;  3SYO A;  3W7W A;  5L3C A;  1I5X A;  1RPR A;  2OCC B;  5HFL A;  2K1E A;  4G2K A;  1J95 A;  2ITD C;  1G8M A;  1H8H G;  4RAI A;  4F4L A;  4N23 A;  5J9P C;  2JK5 C;  4X8A A;  4RUF A;  2GHY A;  1RM1 B;  4CZZ A;  1OCO B;  3CCS V;  3CMA V;  3CPW U;  1FS0 G;  2ZR3 A;  1HWY A;  1MOF A;  2EIM C;  3FYE B;  2DQ3 A;  3B77 A;  3KG2 A;  3OR7 C;  4PA6 A;  3SYQ A;  2CK3 G;  2XAF A;  3B8N A;  5LHG A;  3P32 A;  4QPJ A;  2LFR A;  5LGN A;  1E1R G;  4JTD B;  5EC2 C;  1YJW V;  1MSW D;  2IJK A;  5CBG A;  3ZRX A;  4YXW G;  5CN0 A;  4DO2 A;  3AG1 C;  2EBO A;  3WG7 B;  1ROP A;  2ZR2 A;  5B3S B;  3JYC A;  3VOU A;  3STL C;  5B1B C;  1NR7 A;  4I5S A;  1GM7 A;  4GT1 A;  2DWD C;  1YJN V;  3ZMS A;  2H94 A;  1QVF U;  2X6A A;  2EIJ B;  3I56 V;  3ZMV A;  4GX0 A;  1JOY A;  4MW8 A;  3UM7 A;  1NKD A;  1R3I C;  3NXS A;  4JTC B;  3T2M A;  1BHA A;  4WF9 V;  4L87 A;  2R9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...