4PDVA

Structure of k+ selective nak mutant in barium and potassium
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdvA00
3UM7A 4GX2A 4BW5A 4MSWC 2WLNA 4GX5A 5CBFA 3FB5C 3LUTB 2ITCC 5EBMC 5EBLC 4RUFA 3E8BA 3SPIA 2QTOA 4RUEA 1R3JC 3ASNC 2EINC 2A79B 4RO2A 3X2QC 4P9OA 3GB7C 1S5HC 4XDJA 5B3SC 2Q69A 3E86A 3KG2A 1QLEC 2WLMA 3AG4C 4EKWA 3K04A 3SYAA 2R9RB 2WLHA 2X6BA 4WFFA 4X8AA 2Q67A 2OCCC 3JYCA 3T4DA 3AG3C 3K08A 1OCCC 2ZD9A 2EIMC 1J95A 3SYOA 2W0FC 4PA7A 3E8FA 4WFEA 2BOCC 4RAIA 1K4CC 2AHZA 3RVYA 3LDDA 3IFXA 3IGAC 4MVMA 5BZBA 2QKSA 3T4ZA 4PA3A 2DWDC 5B1AC 2P7TC 2ITDC 3LDCA 3E8GA 4KFMA 4PDMA 4MTFA 2JK5C 3LNMB 2Q68A 3FB7C 3ABLC 1OCOC 3ABMC 4P9PA 1R3KC 4MVQA 3SJQC 1XL6A 3SPHA 2HFEC 3OR7C 4QNHB 4UUJC 1V54C 3TCUA 3K0GA 3EFFK 4LP8A 1JVMA 3R65A 4XDLA 5EK0A 1OCZC 4MS2A 4H33A 1M57C 3AG2C 4CBCA 4I9WA 4PDLA 2EIKC 2X6CA 2IH3C 4R8CA 3T2MA 5J9PC 2NLJC 2WLLB 4R50A 2X6AA 4J9YB 5EC1C 3E8HA 2BOBC 2KB1A 4WFHA 4G28B 3F5WC 3RBZA 2ZXWC 4X88A 3FB6C 1R3LC 2YEVA 3F7YC 1P7BA 3RW0A 4QE7A 1ZWIC 3LDEA 5IY5C 3ZRSA 1XL4A 4R6ZA 2WLIB 2WLJA 3WG7C 5CBHA 3SYCA 3BEHA 4OXSA 3OGCC 3K03A 1BL8A 3ASOC 1OCRC 4PDVA 2ATKC 4X89A 4XDKA 4MTGA 1V55C 4DXWA 2EILC 2EIJC 4MTOA 1G4YB 3OUSA 1R3IC 4J9ZB 4WFGA 3SPJA 4HZ3A 3F7VC 4PA9A 1ORQC 3K06A 5KUKA 3OUFA 4GX1A 1LNQA 2HG5C 2IH1C 4MW3A 4TWKA 3T1CA 4PA4A 2DYSC 4LBEC 1KKDA 2AHYA 5EBWC 4MVZA 2WLLA 3PJSK 4MVRA 4G27B 4JTAB 4PA6A 3SPCA 5EC2C 2WLKA 3STLC 3STZC 3SYPA 4P30A 4HYOA 2Y69C 4MW8A 4MVOA 5E1AC 3FB8C 4ZBMA 2Q6AA 4QE9A 2H8PC 3ABKC 3UKMA 2A0LA 3RVZA 2DWEC 3AG1C 3TETA 4F4LA 1K4DC 4P2ZA 5KUMA 2WLIA 4R7CA 3HPLC 2A9HA 4MVSA 2DYRC 4JTCB 3SYQA 4GX0A 3E89A 3SPGA 4LCUC 2HJFC 2HVJC 4MVUA 3VOUA 2K1EA 3ZJZA 5CBGA 1M56C 4H37A 4JTDB 2HVKC 4PDRA 3K0DA 3OR6C 5B1BC 3E83A
chains in the Genus database with same CATH superfamily
5LOVA 2YIDA 1QR9A 5FPOA 2PI5A 1IBMB 1P49A 4HNAB 1AR4A 2GHYA 3ASNC 5LL6Y 4UB6Z 1F23A 1QLEC 3I5DA 3S3WA 4GKKO 2WA3A 2O57A 1IXMA 4FK5C 3HKEB 5ITZB 5JVDA 5EZYB 3AK1A 3RWRD 3AEIA 2Q4PA 4CH6A 4DK0A 3A0HZ 2LP7A 1YTFB 3C90A 3JAKB 1SZXA 4MT8A 1FAFA 5IJ0B 4GKJO 1JR9A 1OZ0A 1N8RW 2GTAA 2QDOA 2KQXA 1JVMA 1SZTA 3CRCA 5EK0A 4MS2A 1PP9H 5J2TA 1F4MA 4GKKB 4U7OA 2CE4A 1SQQH 2Z3YA 4PJ0Z 2UXCB 2E3CA 2YUAA 5HFLA 1WAZA 4K8ZA 4G28B 1R3LC 3F7YC 3LDEA 2D2CB 3SGIA 3ZRSA 1Q5OA 3AG2B 2KSDA 4JI5O 3ZHSA 2DN9A 2GTSA 5KHKA 1XOUA 5KHJA 5FNVA 4WFGA 4CS3A 5B1OA 1VMGA 1R6NA 5CA0A 2IH1C 4TUYB 1YJWV 2QWNB 2OTJV 2WLKA 1GRJA 3A2FA 2IU0A 4MVOA 2UUBB 1VQNV 5BR8O 3WG7B 4JI2O 3OT7A 1ZX3A 3FKSG 3FYEB 3ASOB 1M57B 1O9HA 4ZHQB 2RJZA 4B7EA 4LCUC 2YI9A 5CBGA 5CA0B 4YXWG 4JI3B 5CA3A 1W0JG 4BW5A 4RQFA 5EYPB 3FB5C 1JA8A 4F6EA 4I7ZB 3SPIA 3DXRB 2A79B 4Q6GA 3OW2U 3JAKA 1XHXA 3O65A 1M4UA 3ZMVA 3ABLB 2QKCA 2LFSA 4DV4B 5KHGA 3N2KB 1GAXA 4UV9A 1FXKA 2BOCC 2FL4A 2NN4A 3RYIA 1O9GA 3IGAC 1NBMG 2DWDC 4O4JB 5B1AC 1IBMO 2EIJB 2ARHA 4JI6B 4JYAO 3SJQC 1WP8A 2HFEC 1CXZB 1V54C 2KKWA 2X0LA 1N0JA 3K0GA 1TVKB 4FLVA 3P30A 2EULA 1Q6UA 2ETNA 1H2KA 3WB1A 4UFZA 2XOKG 2UUCB 3P32A 4NXMB 5CA1B 2CAZC 2ZDIC 2ZT9B 4O2AA 1PM9A 4WBNA 1XL4A 2WLJA 3G67A 3OMIB 1D2DA 4DV6B 4GUNA 3TXQA 4PDVA 2EILC 4PA9A 4UCUA 2YXYA 2HG5C 3JATA 4NR1A 2F4VO 1US6A 4B3MB 4CH3A 3PJSK 3OEHG 3STLC 4JTAB 4JPRA 2EJ7A 4ZBMA 1HNXO 2DWEC 3AG1C 3CC2V 4P2ZA 2WLIA 1D5AA 4H44B 5KA6A 5L3DA 2P4KA 2UXBB 2QWRB 2IU3A 4DV7B 5B1BC 2LQTA 3FFQA 1K5QA 1TUEB 1NKDA 5EBLC 3BA8A 2NR5A 4RUEA 4AQYO 2UXBO 1XEQA 4TQFA 3H1JH 4FM0A 1S5HC 2IJHA 3VQYA 3JSNA 1QNMA 3G80A 1KKCA 2X6BA 4O4HB 4YY3B 3CPWU 1Q7YW 1SRYA 1IBLO 1XDCA 2EIMC 1JOYA 3I55V 1Q82W 4FLYA 2UXDO 3E8FA 3DSQA 5K1XA 1YSCA 1WB7A 3B8MA 1H38A 5BZBA 2QKSA 4OGQB 4YIOA 3W7WA 1Y74B 4JZ2A 2GBOA 3HKBA 1VARA 4QNHB 2E76B 2GV9A 4ZIBA 2LJ2A 1P7GA 3CJHA 1IX9A 4PDLA 3B8NA 4L8JA 4H13B 5CB4A 4I0XB 3ZRXA 5LA6B 3RT3C 4X88A 1UFIA 3AK2A 1NS1A 1BL8A 4TT3G 4FFBB 1Q81W 4XDKA 3CWBH 4DV2B 3ZBHA 3N2KA 1G4YB 4MTOA 1V55B 4DUZO 3U11A 1FXKB 2C2AA 1I5YA 2DYSC 4FLWA 5JCOA 1NH2D 4JI4O 1YCIA 2IM9A 5H6RA 1DF5A 5LMUO 3JASA 4Q20A 4DUZB 4HYOA 2GUZB 4QE9A 4H0LB 1YVWA 4O4IA 4MVSA 1N32B 1HNWO 4DR5B 4GX0A 3E89A 3SJCC 2XAFA 4CC5A 1KC8W 4FLZA 4B3MO 4GX5A 3U0ZA 2D3OW 4X64B 1M9NA 3CRAA 1YITV 2ZM6O 3VQWA 4F6RA 5H5NA 3CCQV 3QO8A 5GONA 3K5MA 3CCMV 3AG3C 4JI2B 5FNVB 4ZKIA 1KBHA 1AROP 3HB3B 2DW4A 1EN6A 1TA8A 2EILB 4DR7O 4DV1B 2HLDG 4DUYB 2JIZG 2YIBA 3RGBA 3QNEA 5KMGB 1WP7A 3CC4V 1XILA 1YI2V 5H9CA 3E8GA 4K0KO 1XNRO 4MTFA 1KECA 3ABMC 1MSWD 3H1HH 2B1GA 4DV3B 3RYHB 1FJGB 4LP8A 1MMMA 2QM7A 1Q8IA 4QPKA 3D8CA 2B9ZA 4BW9A 2YXHA 4FIPC 2AZ0A 2ZR2A 2PZSA 4DR2O 2YDEA 1WA8A 4CZZA 3ABKB 1N33B 1RP3B 3FD9A 4EFBA 1OCCB 2FTKA 3OD4A 3SJAC 4EB6A 4PV1B 2DE0X 2K9PA 4PI2A 4YIPA 1R3IC 5L3CA 5ITZA 4X65O 3T1CA 2CTWA 3JD2A 3IC7A 1KD1W 3SPCA 1P84F 1GN6A 1B04A 1I5XA 3VQVA 3X2QB 3SDLA 5B3SB 1PNMA 2X7RB 2F43G 1AJPA 5L3GA 4B3TO 3SYQA 4E2LA 2MW2B 5L3FA 1V54B 4PDRA 5JJEB 4NXMO 1RM1B 3UM7A 3BFRA 3ZHVA 4I9QA 4IYIA 3ETEA 1NU1H 1QR8A 4JYBA 1R3JC 4CS2A 3GB7C 2JGUA 4D6TH 4X1YB 1Q6HA 4ZOLB 1FXKC 1YIJV 3B4SA 4B3RB 4JAUA 4LF7O 3WFVA 4NTWA 1J95A 4J10A 2F1MA 1VP7A 4LWSB 5LP6A 1ZL8B 3ZHQA 3CRMA 2AHZA 1K92A 3HKDB 1WA8B 3AK3A 3JD4A 1SQFA 2PYLA 1DTOA 1OCOC 4JI8O 4IHJA 3ZEDA 2UUAO 2IW5A 2Q8VA 3DC5A 3VBBA 4DV2O 1VQ7V 2V4DA 2JJ1G 1KB9F 4UCVA 2R72A 1F7YA 1WPXA 4KL1A 3K5LA 3TGUH 4IIJA 2HR3A 4J9YB 2HEPA 1X59A 3CYOA 1AI4A 5D5PA 2F23A 1VQ9V 1JX9A 1NTZH 1MA1A 1SF9A 2QA4V 4G2KA 4EFEA 1Q6IA 2WSSG 3K03A 3C3TA 1MG1A 3T1HB 3CS5A 1G8MA 1E1RG 5BR8B 4O2BA 2JJ2G 1ORQC 2CGOA 3J80N 4TV8B 5J2UB 2ZM6B 3BABA 5CB4B 1H2MA 1QVFU 1Y67A 1IBKB 3ABKC 2ZE5A 4TSFG 4JTCB 3G71V 3A0BZ 2XT9A 4DV0O 2YICA 2LGQA 2E5LB 1SQXH 3JATB 4B3SB 2PF4E 1EN4A 3FX7A 4DR2B 5LMUB 2Q7HA 4ZI7A 2EZOA 3N2GB 5B3SC 3AG4C 5KHHA 3SYAA 1PNLA 1VF6C 3T4DA 3ZRWB 2R9IA 2FMLA 3AG3B 2KG7B 4O4LB 1URFA 1WN7A 2ODMA 4JI3O 1CPYA 3D3IA 3LDDA 3ZN0A 1FXVA 2P7TC 1DF4A 3K9AA 2JK5C 5GTIZ 4DUYO 2OYQA 2Y0IA 1M56B 2CDYA 2RDCA 2N04A 3ZMZA 4B3TB 1JCHA 1EBOA 1IVSA 4K3AA 4LH6A 1J5EO 1KMIZ 1K7DA 1SQBH 1K34A 3E8HA 3DXRA 4WFHA 1OCOB 4UVBA 1FFXB 2PGGA 1NT2B 4QPJA 2UUCO 3CP1A 1TUBA 4LNUB 4ZOLA 3E2EA 1PD3A 2JEUA 1PKXA 3BEHA 5GONB 1XI1A 3WU2Z 5JCOC 3RYHA 5LYJB 1VQLV 4LH7A 2CK3G 3P3PA 1AILA 3OUSA 2N74A 4J7ZA 1OV9A 4Z1VA 2XAJA 3I56V 2ZXWB 4B08A 5KHIA 2QEXV 1N33O 2AHYA 2UXCO 5L3BA 3STZC 4G27B 5EC2C 3JCUZ 1GKFA 4A5UB 1YJNV 1Q86W 3ZS8C 4X1IB 4JI4B 2EX3A 4F4LA 4TV9A 2LGWA 2YIBD 2HJDA 3CHXA 3SPGA 5J2TB 1ZAUA 4DV3O 1ZSPA 3OAAG 1VQMV 1N36B 3OFNG 2ZE7A 1BQZA 3BRCA 3ZX6A 3OMAB 5LA6A 5CBFA 1RFYA 3JARB 4PHZA 2AW9A 4RO2A 3WB0A 1DGSA 2YEVB 1N4CA 2XUMA 1B06A 4DV1O 2CH7B 3CXHF 3JYCA 2VWJA 5D5QA 5EIBC 4FFBA 3MDSA 5IYDO 1JMKC 4U3JA 4RAIA 1Y76B 4X20B 3W7XA 5J2UA 3BPZA 5IYZA 3M99B 4L87A 2BTOA 2ITDC 1FPOA 3AG4B 4LFAB 3FB7C 1DLBA 3ABLC 4MVQA 3SPHA 3KKYA 3CB2A 1K3EA 3BVOA 4EB6B 3APQA 1FFTB 1GK9A 2PTMA 4H33A 3AG2C 1XHZA 2IH3C 4TV8A 2ILMA 1AI5A 3OE7G 1GTOA 4FJCC 1N34O 1GO3F 3RN4A 3JARA 1K33A 4ZI7B 3F5WC 1S0VA 4LC1A 4JI1B 5DEDA 2JDIG 3JSLA 1QLNA 1V55C 2EIJC 1HW7A 1ENVA 3GVMA 3B77A 3NXSA 1ZL8A 2QGNA 2YI8A 4JI7B 3QTCA 1FXHA 3OM3B 5KMGA 2NNUA 4RWUA 1Y66A 4FMTA 3CRRA 1DK1A 2Q73A 1H2GA 4YJ2A 4FM1A 5JWPA 3EXAA 2DYRC 1PV0A 2PI4A 2AZ2A 1PPJH 1SETA 4BIZA 3QO7A 1S76D 2HVKC 1RPRA 2GSMB 2Y4TA 4GX2A 3HKDA 5LGUA 2P06A 2E5LO 1GN3A 4DV0B 4DO2A 2EINC 3UO3A 4X66B 4WFAV 3B2EE 3NR7A 3FYIB 4KHPB 2Q67A 1M90W 4UCOA 4X9QA 4UVAA 2DYSB 4UXNA 2ZD9A 4JV5B 1MZFA 2EINB 3RYFB 4UVCA 4X62B 1J5EB 2ZQMA 4HBNA 5CA1A 5LOVB 4CS4A 3RVYA 1HNZO 3O9OA 3K5OA 1SQPH 2RNBA 3W7TA 1SC5B 1UPGA 3OR7C 4I50B 3H1KH 1SERA 2ZE6A 4ABMA 1L0LH 4I55B 4J80A 4CBCA 1W2BU 2XAHA 4YHHO 3CCSV 2YSUB 1Y76A 4X20A 2CGNA 5B1BB 3OGIB 2GUZA 4RQEA 2A3QA 2ADQB 4OX9B 4QE7A 2JS3A 2DJVA 2N05A 3SYCA 4OXSA 3ZRWA 4Z1MG 2CH7A 1NVPB 5LBQA 2BTQB 2LFRA 4DV6O 1RSOB 3TK1A 5EYPA 3T1YO 1KYOF 5JQGB 1Y4MA 4DR4O 4N21A 4X1KB 4JV5O 3H1LH 1FKAO 2VRZA 1MABG 2PUSA 2K1EA 3ZJZA 3ZMTA 1M56C 1RM1C 4IIJB 4X66O 2Q0OC 1WJZA 4C7UA 4ICGA 4RUFA 5LMNO 2UXNA 4N23A 3OTOO 1I0HA 1MNGA 1UJWB 3Q4HB 1GM7A 2OCHA 1I08A 4DYLA 1IDSA 1AR5A 2HP8A 2Q7GA 4DR3O 3J81N 2Y69B 5LHGA 1YZBA 4U7NA 1M1KW 5DECA 3CSXA 4NVPA 1AB3A 2P4VA 2XTAA 1NR1A 1R6TA 5JQGA 3OMNB 3L70H 4LFCO 2RN9A 5LXTB 1JJ2U 3QVNA 2EIMB 2P90A 4GCZA 2H3OA 4YJ2B 3LSSA 5H6QA 5LHIA 3K59A 2VS0A 4XDLA 3UT5B 3CEIA 5F2VO 3GWKC 2F66C 3JD0A 2VQFO 4FM2A 3B40A 3ZRVA 2P5OA 1WLEA 3JALB 3GWOA 1HNZB 1P7BA 3CE2A 3BHPA 3N2GA 2ZNJA 4EEQA 4X62O 3SR2C 2L6LA 1TVKA 3IC9A 1Q90D 1NJIW 2JS5A 4MTGA 1AP5A 1IBKO 3K79A 5L3EA 2V1DA 4HZ3A 3ETGA 1S5JA 4U3JB 1JQ0A 2AGAA 2PY5A 1QBZA 3RYIB 2OCCB 4J42A 5IY5B 1V9PA 1BQ0A 2F95B 2VQFB 1XNQO 2A0LA 4MTXA 1VF7A 1YHQV 2HKOA 3E35A 3CJHB 3M8AA 3ZCCA 3JAMN 3VOUA 3RYCB 5JVDB 4LF9O 1XMOO 3OR6C 4LF5O 4TUYA 1Z5WA 4BWAA 1H2SB 4LFCB 3S3XA 3CC7V 3E8BA 2QTOA 3BAAA 2BE3A 2Q69A 2WLMA 1W0KG 1N36O 2WLHA 1FYJA 3ETDA 4WFFA 2QWQB 2QWPB 1SS3A 1Z2GA 5GTHZ 2EBOA 2ZKOA 3LNNA 4UCRA 4K35A 4FVMA 5KA5A 2F93B 1XMQB 2UXXA 1KU9A 3AG7A 1K4CC 5LGNA 3CCEV 4MVMA 5JH7A 1X4TA 1GM8A 5LP6C 4LF7B 3BY6A 3PN1A 1MZEA 3J7AU 1OHHG 1XL6A 2FB5A 4UUJC 3CCLV 3R65A 1XNRB 3L72H 5HFMA 3ASNB 5E79Z 4KHPO 2R70A 4FZ0A 3CCJV 5GW7A 4JYYA 2KB1A 2V7QG 1IXBA 2M7WA 2XASA 2IJJA 3Q4HA 4CH5A 3CX5F 4O4IB 1KP2A 3WG7C 2EZPA 3OGCC 1VEWA 1VQKV 3ASOC 4X89A 1HP8A 2RCVA 2BCCH 4J9ZB 3CMEV 4DV5O 3A8TA 4AHCA 4PA4A 2XNDG 3ZIAG 4FLXA 3DTUB 2WLLA 2WA4A 4PA6A 1TAEA 3SYPA 3D36A 5E1AC 4JI7O 4YY3O 3APOA 1HNWB 4IL6Z 1Y6XA 1K4DC 3HPLC 3D36C 4JI8B 3KZIZ 3L75H 4CC6A 1E79G 3ZHTA 3QG5A 2BSKA 4LF8O 1RSOA 3ABMB 4I0XA 2H94A 4NXNO 5B5EZ 5CN0A 1QU7A 5LGTA 1T5EA 4XDJA 1CP9A 4B3SO 3WB2A 4GYCB 4I50A 3K04A 2VQEO 2R9RB 1XREA 1HDJA 5JJJB 1AJNA 1YF2A 3JD3A 1EZVH 1VF6A 1AI7A 2E75B 2Z0AA 3HR0A 3CD6V 3W7UA 4LFAO 3IFXA 1I94B 3K5NA 4PDMA 3HKCA 1YXBA 3LDCA 1XUQA 1BS3A 4NYKA 3CRQA 4P9PA 4LR3A 4AILC 1E1QG 1GMGA 1GH6A 4I4TA 4I9WA 3R66A 3N27A 2VWKA 2Y48A 5DM6V 2BOBC 4CH4A 1LUWA 1ZWIC 1K9MW 2YXLA 5CBHA 5IDJA 1TGOA 3MAQA 4DXWA 3SPJA 5KUKA 4UB8Z 4GX1A 4NXNB 4MW3A 5LP6B 3L73H 2B1IA 4FLUA 2G38A 1QVGU 1ZUQA 4JI0O 2HHHO 3HKCB 4DV4O 1FJGO 4U3FH 1COWG 5IJ0A 1K73W 5FPRA 5TISZ 1F51A 3THOA 4I55A 1NQTA 1VQ8V 4MVUA 3JCZA 1OCZB 2Y0PA 4NKGB 1VIBA 4KUMA 4DV5B 5EBMC 4J7KA 2P22C 3JALA 3X2QC 3H01A 4J41A 1LUVA 2JVDA 1XNQB 3FAVB 2ZNIA 1HWYA 2ZIMA 4O2BB 4UV8A 2XAQA 1S77D 1XQ8A 1VQOV 1JPXA 2UXDB 1XBLA 3JASB 4PA3A 3D3QA 1IBLB 1W59A 3MHHC 1QLEB 2YIAA 4HAMA 5IT9N 1WNSA 1R3KC 3L74H 1N32O 4JI5B 2VQEB 2Q0AA 1B3QA 1EN5A 4DW1A 4WCEV 1OCZC 3EVKA 1YTFD 2BSKB 2NLJC 1FS0G 2QR4A 5BXZA 2Y4UA 3RBZA 2ZXWC 4J11A 3RW0A 5IY5C 4R6ZA 5BMVA 4GKJB 4ZHQA 4KXRA 2DYRB 2ATKC 5KAFZ 1HNXB 1ZLZA 1YDXA 4B3RO 3K06A 1Z5VA 1LNQA 4TWKA 5C8YB 1SQVH 4MVZA 3UO2A 4K0KB 3EHBB 1JFFB 3OTFA 1NVPD 4BIOA 4E4EA 4AI8A 4JYCA 3FB8C 5KX5B 4FPPA 4LFBO 5LXTA 1FFXA 3TETA 3TJTA 2CTQA 4WBNB 1BZKA 1GM9A 5CMUA 2YC0A 3ETQA 4DW0A 4LF6O 3LSUA 5IJ9A 1IURA 2P67A 3T1HO 2MK3A 2HJFC 2HVJC 3K58A 2UU9B 2E74B 5EZYA 4DR1B 1I94O 4FZ1A 2IBZH 2WLNA 1OJHA 2Z5UA 2OIGA 4KP4A 1BGYH 4DK1A 4OPAA 5KX5A 4O2AB 4TOIA 4YJ3A 3CCVV 4X8AA 2LW1A 4DR4B 3G4SV 2BTQA 5A9GA 3SYOA 4PA7A 1CEZA 3L9DA 1H2NA 1SESA 3BCCH 3KCYA 3ZHRA 1MOFA 4DV7O 4TQDA 2ZE8A 2FYUH 2DOSA 3JAWA 4KFMA 3UQ8A 1BHAA 1EZJA 3K9SA 4JASA 4LF4O 4GLXA 1RPOA 1VQPV 1M57C 1H8HG 4D7TA 4ASUG 1S3JA 1QHTA 2EIKC 3IJ4A 1Q43A 4OPHA 1GN4A 2EIKB 1VF5B 2QKAA 2WWWA 3SJBC 4HNAA 5IYBO 2YEVA 4W4KA 1D5NA 3G6EV 3QO5A 2DQ0A 3F5TA 4PI0A 4DR1O 1P4RA 4YJ3B 1NH2B 1ROPA 2QM8A 3DGEA 1LR1A 3LSQA 3UT5A 2UUBO 1THZA 3F7VC 2FKXA 1G6UA 4J7JA 4WF9V 1H8EG 1M5IA 4LFBB 4NTYA 4QGPA 2Y69C 1BE3H 4UCTA 5JH7B 3K3WA 4IT5A 4IHJB 2ZDIA 5C93A 1K8AW 4GZRB 4O4HA 4BAYA 1QCEA 4JYAB 3ABUA 5BMVB 2EJRA 3JD1A 2UUAB 1EFRG 1K97A 4H37A 3QF7A 2ZINA 4LF4B 4IYHA 4IGGA 1YJ9V 3CCUV 4LNUA 3KG2A 4EKWA 4LF8B 4FLTA 2A7WA 3K08A 3BA9A 1BT8A 3AG1B 1OCRB 2DQ3A 1I7FA 3T4ZA 2OT5A 4DR3B 5DN6G 1A32A 1SA0A 4DR7B 2A06H 2AXTZ 4JI1O 2XAGA 2UU9O 2QE7G 2WPDG 2GDSA 1BCCH 2Q7EA 3RYCA 4LF6B 4O4LA 1N34B 4R8CA 3E22B 4LWSA 1N0NA 1U96A 2WLLB 4XBFA 2X6AA 4NTXA 1EM1A 4JF3A 5EC1C 1QQCA 4X64O 2QTSA 1WB8A 4X1YA 5IE9A 3P3NA 2P6JA 4X65B 2R9AA 1HR0B 1MSDA 1OCRC 3U10A 2L35A 1PL4A 1S5LZ 3OUFA 2OTLV 1ZTEA 3TXSA 1KKDA 3E22A 4QIWF 2CTPA 2QWOB 3M7MX 1U97A 4UCSA 2Q6AA 3JAWB 4JAVA 3UKMA 2YS8A 3HKBB 1XMQO 1SA0B 2B5UA 2A9HA 4DR6O 2PYJA 3G6BA 4JTDB 1AP6A 3K0DA 2ZCEA 4DRXB 1BHBA 4PELA 4MSWC 3DC6A 3LUTB 5IWAB 4B7KA 3W7SA 1GN2A 4WFBV 3CXCU 2Q5ZA 2OCCC 2WAMA 4I5SA 3OTOB 5B66Z 5JJNB 1H2LA 1NZ6A 2JGDA 5BY1A 5K1PA 1R1BA 5IYCO 3ZMUA 1AVMA 2OIEA 3ZMSA 3LNMB 2Q68A 1TUBB 4D7SA 2IJKA 3L71H 3CCRV 3EFFK 3A0RA 4JZGA 2W6IG 4DR5O 4GT1A 5EIBD 5H2FZ 5A2QN 4R50A 2HHHB 4JI0B 1VQ6V 4AQYB 5IYZB 1G1XB 2Q9LA 1S72V 4F6RB 2LW7A 3FAVA 2DMXA 2KG7A 4BR6A 3CMAV 1JJOA 1BMFG 1SKVA 2JEXA 5B1AB 4BIUA 4I4TB 5IWAO 1IZ3A 5EBWC 4MVRA 2LO1A 3MHSC 3ABTA 1AI6A 4QJFB 2CTRA 1L0NH 5B1NA 4O4JA 2H8PC 4DR6B 1Y74A 4PD4F 1B6QA 4LF5B 4R7CA 5AG2A 1XMOB 1BSMA 1Q3EA 4JGSA 3VQXA 3H1IH 1R6KA 2OWOA 2ITCC 5FLXN 5LHHA 2IJIA 3OEEG 4NB5A 3C3SA 4P9OA 2QJ1A 1KP3A 3E86A 1HR0O 1NR7A 4FFKA 3RFRA 5LYJA 2QSAA 1OCCC 3KCXA 2W0FC 1VQ4V 2ADPA 4JAAA 4WFEA 5KLVH 4JI6O 4W4LA 1L8DA 4X1IA 3IAYA 3T1YB 3ML0A 1KUQA 5FL7G 1KQSU 4TV9B 2CUGA 3TCUA 1YEWA 1AJQA 4X1KA 1M93A 3ZN1A 5IJ9B 3ICXA 1R73A 4DRXA 2X6CA 5C8YA 3T2MA 5J9PC 3RYFA 1F4NA 4OX9O 1JFFA 2JGDB 1L1FA 2RQ6A 3FB6C 1SQGA 2ZIOA 2F4VB 2WLIB 2JRIA 4YHHB 1VQ5V 4LF9B 3HKEA 1NTKH 1PNKA 3K57A 3MD0A 4LBEC 2ZR3A 4P30A 5LMNB 4MW8A 2RMKB 1FD9A 4K8XA 1NI8A 3RVZA 1K5SA 4Z2WA 1AR1B 5KUMA 3UCSC 2W0XA 3B09A 3H9VA 2XHBA 2W6JG 3ZHUA 2M6YA 1PL0A 2QM4A 5KAIZ 1WPBA 3E83A 1NTMH
chains in the Genus database with same CATH topology
3UM7A 1QR9A 2WLNA 2PI5A 3ETEA 1QR8A 2GHYA 4RUFA 4JYBA 1R3JC 2Z5UA 3ASNC 4KP4A 2UXNA 4N23A 3GB7C 1UJWB 1F23A 1GM7A 1QLEC 1FXKC 1YIJV 3CCVV 4X8AA 3G4SV 4JAUA 3WFVA 1IXMA 1J95A 3SYOA 4PA7A 4FK5C 2Y69B 1CEZA 1SESA 5LHGA 4U7NA 3AEIA 1M1KW 2AHZA 1MOFA 1K92A 1NR1A 3OMNB 2LP7A 3JD4A 4KFMA 1JJ2U 1YTFB 1DTOA 1BHAA 1EZJA 1OCOC 4JASA 4MT8A 2EIMB 2P90A 4GCZA 1OZ0A 3LSSA 1N8RW 1RPOA 5H6QA 5LHIA 2IW5A 1JVMA 1SZTA 4XDLA 5EK0A 1VQPV 3VBBA 1VQ7V 4MS2A 1M57C 1H8HG 4ASUG 1F4MA 1S3JA 2JJ1G 4U7OA 2EIKC 1WPXA 3JD0A 2EIKB 2Z3YA 2HR3A 2WWWA 4J9YB 5HFLA 3ZRVA 3CYOA 4G28B 1AI4A 1WLEA 5IYBO 1R3LC 2YEVA 3GWOA 3F7YC 1P7BA 3G6EV 1VQ9V 3QO5A 3LDEA 1JX9A 2DQ0A 3ZRSA 3AG2B 2QA4V 4G2KA 1P4RA 1NH2B 2WSSG 3K03A 1MG1A 1ROPA 1NJIW 2QM8A 4MTGA 1G8MA 1E1RG 3DGEA 3K79A 3LSQA 5L3EA 4WFGA 2V1DA 4HZ3A 1THZA 3F7VC 2JJ2G 1ORQC 3ETGA 5B1OA 1R6NA 1JQ0A 2IH1C 4WF9V 1H8EG 1YJWV 1QBZA 2OTJV 2WLKA 2OCCB 1QVFU 5IY5B 2IU0A 2Y69C 4MVOA 3K3WA 1VQNV 3ABKC 3WG7B 2A0LA 2ZDIA 4MTXA 5C93A 1K8AW 3FKSG 3FYEB 4TSFG 4BAYA 3ASOB 1YHQV 1M57B 1QCEA 3ABUA 4JTCB 3G71V 2HKOA 2EJRA 3E35A 3ZCCA 4LCUC 3JD1A 3VOUA 1EFRG 5CBGA 1K97A 4H37A 3OR6C 4YXWG 5CA3A 1W0JG 4BW5A 4RQFA 3FB5C 3CC7V 3E8BA 3SPIA 2QTOA 1YJ9V 3CCUV 2A79B 3OW2U 2EZOA 5B3SC 2Q69A 3KG2A 2WLMA 3AG4C 4EKWA 1W0KG 3ZMVA 3ABLB 3SYAA 2WLHA 1PNLA 3ETDA 4WFFA 2LFSA 3T4DA 3ZRWB 2R9IA 3K08A 2EBOA 3AG3B 3AG1B 1OCRB 4UV9A 1FXKA 5KA5A 2DQ3A 2BOCC 2UXXA 1K4CC 5LGNA 1CPYA 3D3IA 3LDDA 3CCEV 3IGAC 4MVMA 3ZN0A 1FXVA 1NBMG 3T4ZA 2DWDC 2OT5A 5B1AC 2P7TC 1GM8A 1DF4A 2EIJB 3BY6A 2JK5C 3K9AA 5DN6G 3SJQC 1OHHG 1XL6A 2HFEC 4UUJC 1M56B 1V54C 2XAGA 2X0LA 3K0GA 3CCLV 2QE7G 2WPDG 3P30A 3R65A 3ZMZA 5HFMA 3ASNB 1JCHA 1EBOA 4R8CA 3CCJV 2XOKG 2WLLB 3P32A 4XBFA 5GW7A 1K7DA 2X6AA 1K34A 4JF3A 5EC1C 3E8HA 2KB1A 4WFHA 2V7QG 2ZDIC 1OCOB 2M7WA 4UVBA 2XASA 4QPJA 2IJJA 3CP1A 1XL4A 2WLJA 3OMIB 2P6JA 3E2EA 1KP2A 3WG7C 1PD3A 2JEUA 1PKXA 3BEHA 2EZPA 3OGCC 1VQKV 1VQLV 3ASOC 1OCRC 4PDVA 4X89A 2CK3G 2EILC 3CMEV 3OUSA 4J9ZB 4PA9A 3OUFA 2OTLV 2XAJA 2HG5C 2ZXWB 3I56V 2QEXV 4PA4A 2XNDG 4QIWF 3ZIAG 1KKDA 2AHYA 3DTUB 2WLLA 3PJSK 3OEHG 4G27B 4JTAB 4PA6A 3STLC 5EC2C 3STZC 1GKFA 3SYPA 4JPRA 3D36A 1YJNV 5E1AC 4ZBMA 2Q6AA 4JAVA 1Q86W 3UKMA 2DWEC 3AG1C 4F4LA 3CC2V 1K4DC 4P2ZA 2WLIA 2B5UA 3HPLC 2A9HA 5KA6A 5L3DA 3SPGA 1E79G 3OAAG 2IU3A 4JTDB 1VQMV 3K0DA 5B1BC 3OFNG 3ABMB 1BHBA 4PELA 4MSWC 1K5QA 2H94A 3OMAB 3LUTB 5CBFA 1TUEB 1NKDA 5EBLC 5CN0A 4RUEA 5LGTA 4RO2A 2YEVB 3W7SA 1S5HC 1CP9A 4XDJA 4WFBV 3CXCU 2IJHA 3K04A 2R9RB 2X6BA 2OCCC 3JYCA 3CPWU 2WAMA 4I5SA 1Q7YW 1AJNA 1SRYA 3JD3A 2EIMC 1JOYA 5IYDO 3I55V 1Q82W 3E8FA 1AI7A 4RAIA 3CD6V 1YSCA 3W7XA 3W7UA 3B8MA 1H38A 3M99B 3IFXA 4L87A 5BZBA 2QKSA 5IYCO 3ZMUA 4PDMA 2ITDC 3LDCA 3AG4B 3W7WA 3LNMB 3ZMSA 2Q68A 3FB7C 1DLBA 3ABLC 4P9PA 2IJKA 4MVQA 3SPHA 4QNHB 1K3EA 3CCRV 3EFFK 1E1QG 3A0RA 1GMGA 1FFTB 1GK9A 2W6IG 4GT1A 4H33A 3AG2C 4I9WA 4PDLA 3B8NA 2IH3C 1AI5A 3OE7G 1GTOA 4FJCC 4R50A 2Y48A 3ZRXA 5DM6V 1VQ6V 1GO3F 2BOBC 1K33A 3F5WC 4X88A 1S72V 1ZWIC 1S0VA 4LC1A 1K9MW 5CBHA 5IDJA 2JDIG 1BL8A 4TT3G 1QLNA 1Q81W 4XDKA 1V55C 4DXWA 2EIJC 4MTOA 1G4YB 3SPJA 3CMAV 1BMFG 2JEXA 5B1AB 4BIUA 1V55B 5KUKA 1FXKB 2C2AA 4GX1A 1ENVA 4MW3A 1I5YA 2DYSC 3B77A 5EBWC 3NXSA 2B1IA 1NH2D 4MVRA 5H6RA 1DF5A 1FXHA 3OM3B 3MHSC 4Q20A 1QVGU 3ABTA 1AI6A 2NNUA 4HYOA 4QJFB 5B1NA 4QE9A 1Y66A 2H8PC 4FMTA 1B6QA 1H2GA 1COWG 4R7CA 1K73W 4MVSA 2DYRC 1F51A 2PI4A 4GX0A 1NQTA 3E89A 1VQ8V 1SETA 4BIZA 4MVUA 3QO7A 1S76D 2XAFA 1KC8W 3JCZA 2HVKC 2GSMB 1RPRA 1OCZB 4JGSA 4GX2A 1R6KA 4GX5A 4KUMA 5LGUA 2ITCC 5L3BA 5LHHA 2D3OW 1M9NA 5EBMC 2IJIA 3OEEG 4DO2A 2EINC 3X2QC 4P9OA 1YITV 3H01A 1KP3A 3E86A 4WFAV 1NR7A 3CCQV 3QO8A 3FYIB 2Q67A 1M90W 3CCMV 3AG3C 1OCCC 1HWYA 4UVAA 4ZKIA 2DYSB 1AROP 2ZD9A 4UXNA 3HB3B 2W0FC 1VQ4V 4UV8A 2DW4A 2XAQA 2EINB 4WFEA 1S77D 2EILB 2HLDG 4UVCA 2ZQMA 1VQOV 2JIZG 3QNEA 3RVYA 1JPXA 3CC4V 1YI2V 4PA3A 5H9CA 3E8GA 3MHHC 1QLEB 3ML0A 4MTFA 3W7TA 5FL7G 1KECA 4HAMA 3ABMC 1KQSU 1MSWD 1R3KC 2B1GA 3OR7C 3TCUA 1AJQA 1SERA 4LP8A 3ZN1A 2QM7A 4WCEV 1OCZC 4CBCA 1YTFD 1R73A 1W2BU 2X6CA 4QPKA 2XAHA 3CCSV 3T2MA 5J9PC 2NLJC 2YSUB 1F4NA 4FIPC 1L1FA 5B1BB 2ZR2A 1FS0G 4RQEA 3RBZA 2ZXWC 3FB6C 4CZZA 3RW0A 4QE7A 5IY5C 3ABKB 4R6ZA 2WLIB 1OCCB 1VQ5V 3SYCA 2FTKA 4OXSA 3ZRWA 4Z1MG 1NVPB 5LBQA 2DYRB 2ATKC 1R3IC 2LFRA 1PNKA 3K06A 1LNQA 5L3CA 4TWKA 3T1CA 3TK1A 3MD0A 4LBEC 3JD2A 4MVZA 3IC7A 1KD1W 3SPCA 2ZR3A 3EHBB 1NVPD 4P30A 4MW8A 4JYCA 3FB8C 4FPPA 1Y4MA 1I5XA 3TETA 3RVZA 1K5SA 3X2QB 1AR1B 1GM9A 5KUMA 1PNMA 5B3SB 4N21A 5CMUA 2X7RB 2F43G 1AJPA 5L3GA 2W6JG 3SYQA 2P67A 4E2LA 2MK3A 1MABG 2HJFC 2HVJC 2K1EA 3ZJZA 1PL0A 5L3FA 3ZMTA 1M56C 1V54B 4PDRA 1RM1C 3E83A 1RM1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UM7 A;  4GX2 A;  4BW5 A;  4MSW C;  2WLN A;  4GX5 A;  5CBF A;  3FB5 C;  3LUT B;  2ITC C;  5EBM C;  5EBL C;  4RUF A;  3E8B A;  3SPI A;  2QTO A;  4RUE A;  1R3J C;  3ASN C;  2EIN C;  2A79 B;  4RO2 A;  3X2Q C;  4P9O A;  3GB7 C;  1S5H C;  4XDJ A;  5B3S C;  2Q69 A;  3E86 A;  3KG2 A;  1QLE C;  2WLM A;  3AG4 C;  4EKW A;  3K04 A;  3SYA A;  2R9R B;  2WLH A;  2X6B A;  4WFF A;  4X8A A;  2Q67 A;  2OCC C;  3JYC A;  3T4D A;  3AG3 C;  3K08 A;  1OCC C;  2ZD9 A;  2EIM C;  1J95 A;  3SYO A;  2W0F C;  4PA7 A;  3E8F A;  4WFE A;  2BOC C;  4RAI A;  1K4C C;  2AHZ A;  3RVY A;  3LDD A;  3IFX A;  3IGA C;  4MVM A;  5BZB A;  2QKS A;  3T4Z A;  4PA3 A;  2DWD C;  5B1A C;  2P7T C;  2ITD C;  3LDC A;  3E8G A;  4KFM A;  4PDM A;  4MTF A;  2JK5 C;  3LNM B;  2Q68 A;  3FB7 C;  3ABL C;  1OCO C;  3ABM C;  4P9P A;  1R3K C;  4MVQ A;  3SJQ C;  1XL6 A;  3SPH A;  2HFE C;  3OR7 C;  4QNH B;  4UUJ C;  1V54 C;  3TCU A;  3K0G A;  3EFF K;  4LP8 A;  1JVM A;  3R65 A;  4XDL A;  5EK0 A;  1OCZ C;  4MS2 A;  4H33 A;  1M57 C;  3AG2 C;  4CBC A;  4I9W A;  4PDL A;  2EIK C;  2X6C A;  2IH3 C;  4R8C A;  3T2M A;  5J9P C;  2NLJ C;  2WLL B;  4R50 A;  2X6A A;  4J9Y B;  5EC1 C;  3E8H A;  2BOB C;  2KB1 A;  4WFH A;  4G28 B;  3F5W C;  3RBZ A;  2ZXW C;  4X88 A;  3FB6 C;  1R3L C;  2YEV A;  3F7Y C;  1P7B A;  3RW0 A;  4QE7 A;  1ZWI C;  3LDE A;  5IY5 C;  3ZRS A;  1XL4 A;  4R6Z A;  2WLI B;  2WLJ A;  3WG7 C;  5CBH A;  3SYC A;  3BEH A;  4OXS A;  3OGC C;  3K03 A;  1BL8 A;  3ASO C;  1OCR C;  4PDV A;  2ATK C;  4X89 A;  4XDK A;  4MTG A;  1V55 C;  4DXW A;  2EIL C;  2EIJ C;  4MTO A;  1G4Y B;  3OUS A;  1R3I C;  4J9Z B;  4WFG A;  3SPJ A;  4HZ3 A;  3F7V C;  4PA9 A;  1ORQ C;  3K06 A;  5KUK A;  3OUF A;  4GX1 A;  1LNQ A;  2HG5 C;  2IH1 C;  4MW3 A;  4TWK A;  3T1C A;  4PA4 A;  2DYS C;  4LBE C;  1KKD A;  2AHY A;  5EBW C;  4MVZ A;  2WLL A;  3PJS K;  4MVR A;  4G27 B;  4JTA B;  4PA6 A;  3SPC A;  5EC2 C;  2WLK A;  3STL C;  3STZ C;  3SYP A;  4P30 A;  4HYO A;  2Y69 C;  4MW8 A;  4MVO A;  5E1A C;  3FB8 C;  4ZBM A;  2Q6A A;  4QE9 A;  2H8P C;  3ABK C;  3UKM A;  2A0L A;  3RVZ A;  2DWE C;  3AG1 C;  3TET A;  4F4L A;  1K4D C;  4P2Z A;  5KUM A;  2WLI A;  4R7C A;  3HPL C;  2A9H A;  4MVS A;  2DYR C;  4JTC B;  3SYQ A;  4GX0 A;  3E89 A;  3SPG A;  4LCU C;  2HJF C;  2HVJ C;  4MVU A;  3VOU A;  2K1E A;  3ZJZ A;  5CBG A;  1M56 C;  4H37 A;  4JTD B;  2HVK C;  4PDR A;  3K0D A;  3OR6 C;  5B1B C;  3E83 A; 
#chains in the Genus database with same CATH topology
 5LOV A;  2YID A;  1QR9 A;  5FPO A;  2PI5 A;  1IBM B;  1P49 A;  4HNA B;  1AR4 A;  2GHY A;  3ASN C;  5LL6 Y;  4UB6 Z;  1F23 A;  1QLE C;  3I5D A;  3S3W A;  4GKK O;  2WA3 A;  2O57 A;  1IXM A;  4FK5 C;  3HKE B;  5ITZ B;  5JVD A;  5EZY B;  3AK1 A;  3RWR D;  3AEI A;  2Q4P A;  4CH6 A;  4DK0 A;  3A0H Z;  2LP7 A;  1YTF B;  3C90 A;  3JAK B;  1SZX A;  4MT8 A;  1FAF A;  5IJ0 B;  4GKJ O;  1JR9 A;  1OZ0 A;  1N8R W;  2GTA A;  2QDO A;  2KQX A;  1JVM A;  1SZT A;  3CRC A;  5EK0 A;  4MS2 A;  1PP9 H;  5J2T A;  1F4M A;  4GKK B;  4U7O A;  2CE4 A;  1SQQ H;  2Z3Y A;  4PJ0 Z;  2UXC B;  2E3C A;  2YUA A;  5HFL A;  1WAZ A;  4K8Z A;  4G28 B;  1R3L C;  3F7Y C;  3LDE A;  2D2C B;  3SGI A;  3ZRS A;  1Q5O A;  3AG2 B;  2KSD A;  4JI5 O;  3ZHS A;  2DN9 A;  2GTS A;  5KHK A;  1XOU A;  5KHJ A;  5FNV A;  4WFG A;  4CS3 A;  5B1O A;  1VMG A;  1R6N A;  5CA0 A;  2IH1 C;  4TUY B;  1YJW V;  2QWN B;  2OTJ V;  2WLK A;  1GRJ A;  3A2F A;  2IU0 A;  4MVO A;  2UUB B;  1VQN V;  5BR8 O;  3WG7 B;  4JI2 O;  3OT7 A;  1ZX3 A;  3FKS G;  3FYE B;  3ASO B;  1M57 B;  1O9H A;  4ZHQ B;  2RJZ A;  4B7E A;  4LCU C;  2YI9 A;  5CBG A;  5CA0 B;  4YXW G;  4JI3 B;  5CA3 A;  1W0J G;  4BW5 A;  4RQF A;  5EYP B;  3FB5 C;  1JA8 A;  4F6E A;  4I7Z B;  3SPI A;  3DXR B;  2A79 B;  4Q6G A;  3OW2 U;  3JAK A;  1XHX A;  3O65 A;  1M4U A;  3ZMV A;  3ABL B;  2QKC A;  2LFS A;  4DV4 B;  5KHG A;  3N2K B;  1GAX A;  4UV9 A;  1FXK A;  2BOC C;  2FL4 A;  2NN4 A;  3RYI A;  1O9G A;  3IGA C;  1NBM G;  2DWD C;  4O4J B;  5B1A C;  1IBM O;  2EIJ B;  2ARH A;  4JI6 B;  4JYA O;  3SJQ C;  1WP8 A;  2HFE C;  1CXZ B;  1V54 C;  2KKW A;  2X0L A;  1N0J A;  3K0G A;  1TVK B;  4FLV A;  3P30 A;  2EUL A;  1Q6U A;  2ETN A;  1H2K A;  3WB1 A;  4UFZ A;  2XOK G;  2UUC B;  3P32 A;  4NXM B;  5CA1 B;  2CAZ C;  2ZDI C;  2ZT9 B;  4O2A A;  1PM9 A;  4WBN A;  1XL4 A;  2WLJ A;  3G67 A;  3OMI B;  1D2D A;  4DV6 B;  4GUN A;  3TXQ A;  4PDV A;  2EIL C;  4PA9 A;  4UCU A;  2YXY A;  2HG5 C;  3JAT A;  4NR1 A;  2F4V O;  1US6 A;  4B3M B;  4CH3 A;  3PJS K;  3OEH G;  3STL C;  4JTA B;  4JPR A;  2EJ7 A;  4ZBM A;  1HNX O;  2DWE C;  3AG1 C;  3CC2 V;  4P2Z A;  2WLI A;  1D5A A;  4H44 B;  5KA6 A;  5L3D A;  2P4K A;  2UXB B;  2QWR B;  2IU3 A;  4DV7 B;  5B1B C;  2LQT A;  3FFQ A;  1K5Q A;  1TUE B;  1NKD A;  5EBL C;  3BA8 A;  2NR5 A;  4RUE A;  4AQY O;  2UXB O;  1XEQ A;  4TQF A;  3H1J H;  4FM0 A;  1S5H C;  2IJH A;  3VQY A;  3JSN A;  1QNM A;  3G80 A;  1KKC A;  2X6B A;  4O4H B;  4YY3 B;  3CPW U;  1Q7Y W;  1SRY A;  1IBL O;  1XDC A;  2EIM C;  1JOY A;  3I55 V;  1Q82 W;  4FLY A;  2UXD O;  3E8F A;  3DSQ A;  5K1X A;  1YSC A;  1WB7 A;  3B8M A;  1H38 A;  5BZB A;  2QKS A;  4OGQ B;  4YIO A;  3W7W A;  1Y74 B;  4JZ2 A;  2GBO A;  3HKB A;  1VAR A;  4QNH B;  2E76 B;  2GV9 A;  4ZIB A;  2LJ2 A;  1P7G A;  3CJH A;  1IX9 A;  4PDL A;  3B8N A;  4L8J A;  4H13 B;  5CB4 A;  4I0X B;  3ZRX A;  5LA6 B;  3RT3 C;  4X88 A;  1UFI A;  3AK2 A;  1NS1 A;  1BL8 A;  4TT3 G;  4FFB B;  1Q81 W;  4XDK A;  3CWB H;  4DV2 B;  3ZBH A;  3N2K A;  1G4Y B;  4MTO A;  1V55 B;  4DUZ O;  3U11 A;  1FXK B;  2C2A A;  1I5Y A;  2DYS C;  4FLW A;  5JCO A;  1NH2 D;  4JI4 O;  1YCI A;  2IM9 A;  5H6R A;  1DF5 A;  5LMU O;  3JAS A;  4Q20 A;  4DUZ B;  4HYO A;  2GUZ B;  4QE9 A;  4H0L B;  1YVW A;  4O4I A;  4MVS A;  1N32 B;  1HNW O;  4DR5 B;  4GX0 A;  3E89 A;  3SJC C;  2XAF A;  4CC5 A;  1KC8 W;  4FLZ A;  4B3M O;  4GX5 A;  3U0Z A;  2D3O W;  4X64 B;  1M9N A;  3CRA A;  1YIT V;  2ZM6 O;  3VQW A;  4F6R A;  5H5N A;  3CCQ V;  3QO8 A;  5GON A;  3K5M A;  3CCM V;  3AG3 C;  4JI2 B;  5FNV B;  4ZKI A;  1KBH A;  1ARO P;  3HB3 B;  2DW4 A;  1EN6 A;  1TA8 A;  2EIL B;  4DR7 O;  4DV1 B;  2HLD G;  4DUY B;  2JIZ G;  2YIB A;  3RGB A;  3QNE A;  5KMG B;  1WP7 A;  3CC4 V;  1XIL A;  1YI2 V;  5H9C A;  3E8G A;  4K0K O;  1XNR O;  4MTF A;  1KEC A;  3ABM C;  1MSW D;  3H1H H;  2B1G A;  4DV3 B;  3RYH B;  1FJG B;  4LP8 A;  1MMM A;  2QM7 A;  1Q8I A;  4QPK A;  3D8C A;  2B9Z A;  4BW9 A;  2YXH A;  4FIP C;  2AZ0 A;  2ZR2 A;  2PZS A;  4DR2 O;  2YDE A;  1WA8 A;  4CZZ A;  3ABK B;  1N33 B;  1RP3 B;  3FD9 A;  4EFB A;  1OCC B;  2FTK A;  3OD4 A;  3SJA C;  4EB6 A;  4PV1 B;  2DE0 X;  2K9P A;  4PI2 A;  4YIP A;  1R3I C;  5L3C A;  5ITZ A;  4X65 O;  3T1C A;  2CTW A;  3JD2 A;  3IC7 A;  1KD1 W;  3SPC A;  1P84 F;  1GN6 A;  1B04 A;  1I5X A;  3VQV A;  3X2Q B;  3SDL A;  5B3S B;  1PNM A;  2X7R B;  2F43 G;  1AJP A;  5L3G A;  4B3T O;  3SYQ A;  4E2L A;  2MW2 B;  5L3F A;  1V54 B;  4PDR A;  5JJE B;  4NXM O;  1RM1 B;  3UM7 A;  3BFR A;  3ZHV A;  4I9Q A;  4IYI A;  3ETE A;  1NU1 H;  1QR8 A;  4JYB A;  1R3J C;  4CS2 A;  3GB7 C;  2JGU A;  4D6T H;  4X1Y B;  1Q6H A;  4ZOL B;  1FXK C;  1YIJ V;  3B4S A;  4B3R B;  4JAU A;  4LF7 O;  3WFV A;  4NTW A;  1J95 A;  4J10 A;  2F1M A;  1VP7 A;  4LWS B;  5LP6 A;  1ZL8 B;  3ZHQ A;  3CRM A;  2AHZ A;  1K92 A;  3HKD B;  1WA8 B;  3AK3 A;  3JD4 A;  1SQF A;  2PYL A;  1DTO A;  1OCO C;  4JI8 O;  4IHJ A;  3ZED A;  2UUA O;  2IW5 A;  2Q8V A;  3DC5 A;  3VBB A;  4DV2 O;  1VQ7 V;  2V4D A;  2JJ1 G;  1KB9 F;  4UCV A;  2R72 A;  1F7Y A;  1WPX A;  4KL1 A;  3K5L A;  3TGU H;  4IIJ A;  2HR3 A;  4J9Y B;  2HEP A;  1X59 A;  3CYO A;  1AI4 A;  5D5P A;  2F23 A;  1VQ9 V;  1JX9 A;  1NTZ H;  1MA1 A;  1SF9 A;  2QA4 V;  4G2K A;  4EFE A;  1Q6I A;  2WSS G;  3K03 A;  3C3T A;  1MG1 A;  3T1H B;  3CS5 A;  1G8M A;  1E1R G;  5BR8 B;  4O2B A;  2JJ2 G;  1ORQ C;  2CGO A;  3J80 N;  4TV8 B;  5J2U B;  2ZM6 B;  3BAB A;  5CB4 B;  1H2M A;  1QVF U;  1Y67 A;  1IBK B;  3ABK C;  2ZE5 A;  4TSF G;  4JTC B;  3G71 V;  3A0B Z;  2XT9 A;  4DV0 O;  2YIC A;  2LGQ A;  2E5L B;  1SQX H;  3JAT B;  4B3S B;  2PF4 E;  1EN4 A;  3FX7 A;  4DR2 B;  5LMU B;  2Q7H A;  4ZI7 A;  2EZO A;  3N2G B;  5B3S C;  3AG4 C;  5KHH A;  3SYA A;  1PNL A;  1VF6 C;  3T4D A;  3ZRW B;  2R9I A;  2FML A;  3AG3 B;  2KG7 B;  4O4L B;  1URF A;  1WN7 A;  2ODM A;  4JI3 O;  1CPY A;  3D3I A;  3LDD A;  3ZN0 A;  1FXV A;  2P7T C;  1DF4 A;  3K9A A;  2JK5 C;  5GTI Z;  4DUY O;  2OYQ A;  2Y0I A;  1M56 B;  2CDY A;  2RDC A;  2N04 A;  3ZMZ A;  4B3T B;  1JCH A;  1EBO A;  1IVS A;  4K3A A;  4LH6 A;  1J5E O;  1KMI Z;  1K7D A;  1SQB H;  1K34 A;  3E8H A;  3DXR A;  4WFH A;  1OCO B;  4UVB A;  1FFX B;  2PGG A;  1NT2 B;  4QPJ A;  2UUC O;  3CP1 A;  1TUB A;  4LNU B;  4ZOL A;  3E2E A;  1PD3 A;  2JEU A;  1PKX A;  3BEH A;  5GON B;  1XI1 A;  3WU2 Z;  5JCO C;  3RYH A;  5LYJ B;  1VQL V;  4LH7 A;  2CK3 G;  3P3P A;  1AIL A;  3OUS A;  2N74 A;  4J7Z A;  1OV9 A;  4Z1V A;  2XAJ A;  3I56 V;  2ZXW B;  4B08 A;  5KHI A;  2QEX V;  1N33 O;  2AHY A;  2UXC O;  5L3B A;  3STZ C;  4G27 B;  5EC2 C;  3JCU Z;  1GKF A;  4A5U B;  1YJN V;  1Q86 W;  3ZS8 C;  4X1I B;  4JI4 B;  2EX3 A;  4F4L A;  4TV9 A;  2LGW A;  2YIB D;  2HJD A;  3CHX A;  3SPG A;  5J2T B;  1ZAU A;  4DV3 O;  1ZSP A;  3OAA G;  1VQM V;  1N36 B;  3OFN G;  2ZE7 A;  1BQZ A;  3BRC A;  3ZX6 A;  3OMA B;  5LA6 A;  5CBF A;  1RFY A;  3JAR B;  4PHZ A;  2AW9 A;  4RO2 A;  3WB0 A;  1DGS A;  2YEV B;  1N4C A;  2XUM A;  1B06 A;  4DV1 O;  2CH7 B;  3CXH F;  3JYC A;  2VWJ A;  5D5Q A;  5EIB C;  4FFB A;  3MDS A;  5IYD O;  1JMK C;  4U3J A;  4RAI A;  1Y76 B;  4X20 B;  3W7X A;  5J2U A;  3BPZ A;  5IYZ A;  3M99 B;  4L87 A;  2BTO A;  2ITD C;  1FPO A;  3AG4 B;  4LFA B;  3FB7 C;  1DLB A;  3ABL C;  4MVQ A;  3SPH A;  3KKY A;  3CB2 A;  1K3E A;  3BVO A;  4EB6 B;  3APQ A;  1FFT B;  1GK9 A;  2PTM A;  4H33 A;  3AG2 C;  1XHZ A;  2IH3 C;  4TV8 A;  2ILM A;  1AI5 A;  3OE7 G;  1GTO A;  4FJC C;  1N34 O;  1GO3 F;  3RN4 A;  3JAR A;  1K33 A;  4ZI7 B;  3F5W C;  1S0V A;  4LC1 A;  4JI1 B;  5DED A;  2JDI G;  3JSL A;  1QLN A;  1V55 C;  2EIJ C;  1HW7 A;  1ENV A;  3GVM A;  3B77 A;  3NXS A;  1ZL8 A;  2QGN A;  2YI8 A;  4JI7 B;  3QTC A;  1FXH A;  3OM3 B;  5KMG A;  2NNU A;  4RWU A;  1Y66 A;  4FMT A;  3CRR A;  1DK1 A;  2Q73 A;  1H2G A;  4YJ2 A;  4FM1 A;  5JWP A;  3EXA A;  2DYR C;  1PV0 A;  2PI4 A;  2AZ2 A;  1PPJ H;  1SET A;  4BIZ A;  3QO7 A;  1S76 D;  2HVK C;  1RPR A;  2GSM B;  2Y4T A;  4GX2 A;  3HKD A;  5LGU A;  2P06 A;  2E5L O;  1GN3 A;  4DV0 B;  4DO2 A;  2EIN C;  3UO3 A;  4X66 B;  4WFA V;  3B2E E;  3NR7 A;  3FYI B;  4KHP B;  2Q67 A;  1M90 W;  4UCO A;  4X9Q A;  4UVA A;  2DYS B;  4UXN A;  2ZD9 A;  4JV5 B;  1MZF A;  2EIN B;  3RYF B;  4UVC A;  4X62 B;  1J5E B;  2ZQM A;  4HBN A;  5CA1 A;  5LOV B;  4CS4 A;  3RVY A;  1HNZ O;  3O9O A;  3K5O A;  1SQP H;  2RNB A;  3W7T A;  1SC5 B;  1UPG A;  3OR7 C;  4I50 B;  3H1K H;  1SER A;  2ZE6 A;  4ABM A;  1L0L H;  4I55 B;  4J80 A;  4CBC A;  1W2B U;  2XAH A;  4YHH O;  3CCS V;  2YSU B;  1Y76 A;  4X20 A;  2CGN A;  5B1B B;  3OGI B;  2GUZ A;  4RQE A;  2A3Q A;  2ADQ B;  4OX9 B;  4QE7 A;  2JS3 A;  2DJV A;  2N05 A;  3SYC A;  4OXS A;  3ZRW A;  4Z1M G;  2CH7 A;  1NVP B;  5LBQ A;  2BTQ B;  2LFR A;  4DV6 O;  1RSO B;  3TK1 A;  5EYP A;  3T1Y O;  1KYO F;  5JQG B;  1Y4M A;  4DR4 O;  4N21 A;  4X1K B;  4JV5 O;  3H1L H;  1FKA O;  2VRZ A;  1MAB G;  2PUS A;  2K1E A;  3ZJZ A;  3ZMT A;  1M56 C;  1RM1 C;  4IIJ B;  4X66 O;  2Q0O C;  1WJZ A;  4C7U A;  4ICG A;  4RUF A;  5LMN O;  2UXN A;  4N23 A;  3OTO O;  1I0H A;  1MNG A;  1UJW B;  3Q4H B;  1GM7 A;  2OCH A;  1I08 A;  4DYL A;  1IDS A;  1AR5 A;  2HP8 A;  2Q7G A;  4DR3 O;  3J81 N;  2Y69 B;  5LHG A;  1YZB A;  4U7N A;  1M1K W;  5DEC A;  3CSX A;  4NVP A;  1AB3 A;  2P4V A;  2XTA A;  1NR1 A;  1R6T A;  5JQG A;  3OMN B;  3L70 H;  4LFC O;  2RN9 A;  5LXT B;  1JJ2 U;  3QVN A;  2EIM B;  2P90 A;  4GCZ A;  2H3O A;  4YJ2 B;  3LSS A;  5H6Q A;  5LHI A;  3K59 A;  2VS0 A;  4XDL A;  3UT5 B;  3CEI A;  5F2V O;  3GWK C;  2F66 C;  3JD0 A;  2VQF O;  4FM2 A;  3B40 A;  3ZRV A;  2P5O A;  1WLE A;  3JAL B;  3GWO A;  1HNZ B;  1P7B A;  3CE2 A;  3BHP A;  3N2G A;  2ZNJ A;  4EEQ A;  4X62 O;  3SR2 C;  2L6L A;  1TVK A;  3IC9 A;  1Q90 D;  1NJI W;  2JS5 A;  4MTG A;  1AP5 A;  1IBK O;  3K79 A;  5L3E A;  2V1D A;  4HZ3 A;  3ETG A;  1S5J A;  4U3J B;  1JQ0 A;  2AGA A;  2PY5 A;  1QBZ A;  3RYI B;  2OCC B;  4J42 A;  5IY5 B;  1V9P A;  1BQ0 A;  2F95 B;  2VQF B;  1XNQ O;  2A0L A;  4MTX A;  1VF7 A;  1YHQ V;  2HKO A;  3E35 A;  3CJH B;  3M8A A;  3ZCC A;  3JAM N;  3VOU A;  3RYC B;  5JVD B;  4LF9 O;  1XMO O;  3OR6 C;  4LF5 O;  4TUY A;  1Z5W A;  4BWA A;  1H2S B;  4LFC B;  3S3X A;  3CC7 V;  3E8B A;  2QTO A;  3BAA A;  2BE3 A;  2Q69 A;  2WLM A;  1W0K G;  1N36 O;  2WLH A;  1FYJ A;  3ETD A;  4WFF A;  2QWQ B;  2QWP B;  1SS3 A;  1Z2G A;  5GTH Z;  2EBO A;  2ZKO A;  3LNN A;  4UCR A;  4K35 A;  4FVM A;  5KA5 A;  2F93 B;  1XMQ B;  2UXX A;  1KU9 A;  3AG7 A;  1K4C C;  5LGN A;  3CCE V;  4MVM A;  5JH7 A;  1X4T A;  1GM8 A;  5LP6 C;  4LF7 B;  3BY6 A;  3PN1 A;  1MZE A;  3J7A U;  1OHH G;  1XL6 A;  2FB5 A;  4UUJ C;  3CCL V;  3R65 A;  1XNR B;  3L72 H;  5HFM A;  3ASN B;  5E79 Z;  4KHP O;  2R70 A;  4FZ0 A;  3CCJ V;  5GW7 A;  4JYY A;  2KB1 A;  2V7Q G;  1IXB A;  2M7W A;  2XAS A;  2IJJ A;  3Q4H A;  4CH5 A;  3CX5 F;  4O4I B;  1KP2 A;  3WG7 C;  2EZP A;  3OGC C;  1VEW A;  1VQK V;  3ASO C;  4X89 A;  1HP8 A;  2RCV A;  2BCC H;  4J9Z B;  3CME V;  4DV5 O;  3A8T A;  4AHC A;  4PA4 A;  2XND G;  3ZIA G;  4FLX A;  3DTU B;  2WLL A;  2WA4 A;  4PA6 A;  1TAE A;  3SYP A;  3D36 A;  5E1A C;  4JI7 O;  4YY3 O;  3APO A;  1HNW B;  4IL6 Z;  1Y6X A;  1K4D C;  3HPL C;  3D36 C;  4JI8 B;  3KZI Z;  3L75 H;  4CC6 A;  1E79 G;  3ZHT A;  3QG5 A;  2BSK A;  4LF8 O;  1RSO A;  3ABM B;  4I0X A;  2H94 A;  4NXN O;  5B5E Z;  5CN0 A;  1QU7 A;  5LGT A;  1T5E A;  4XDJ A;  1CP9 A;  4B3S O;  3WB2 A;  4GYC B;  4I50 A;  3K04 A;  2VQE O;  2R9R B;  1XRE A;  1HDJ A;  5JJJ B;  1AJN A;  1YF2 A;  3JD3 A;  1EZV H;  1VF6 A;  1AI7 A;  2E75 B;  2Z0A A;  3HR0 A;  3CD6 V;  3W7U A;  4LFA O;  3IFX A;  1I94 B;  3K5N A;  4PDM A;  3HKC A;  1YXB A;  3LDC A;  1XUQ A;  1BS3 A;  4NYK A;  3CRQ A;  4P9P A;  4LR3 A;  4AIL C;  1E1Q G;  1GMG A;  1GH6 A;  4I4T A;  4I9W A;  3R66 A;  3N27 A;  2VWK A;  2Y48 A;  5DM6 V;  2BOB C;  4CH4 A;  1LUW A;  1ZWI C;  1K9M W;  2YXL A;  5CBH A;  5IDJ A;  1TGO A;  3MAQ A;  4DXW A;  3SPJ A;  5KUK A;  4UB8 Z;  4GX1 A;  4NXN B;  4MW3 A;  5LP6 B;  3L73 H;  2B1I A;  4FLU A;  2G38 A;  1QVG U;  1ZUQ A;  4JI0 O;  2HHH O;  3HKC B;  4DV4 O;  1FJG O;  4U3F H;  1COW G;  5IJ0 A;  1K73 W;  5FPR A;  5TIS Z;  1F51 A;  3THO A;  4I55 A;  1NQT A;  1VQ8 V;  4MVU A;  3JCZ A;  1OCZ B;  2Y0P A;  4NKG B;  1VIB A;  4KUM A;  4DV5 B;  5EBM C;  4J7K A;  2P22 C;  3JAL A;  3X2Q C;  3H01 A;  4J41 A;  1LUV A;  2JVD A;  1XNQ B;  3FAV B;  2ZNI A;  1HWY A;  2ZIM A;  4O2B B;  4UV8 A;  2XAQ A;  1S77 D;  1XQ8 A;  1VQO V;  1JPX A;  2UXD B;  1XBL A;  3JAS B;  4PA3 A;  3D3Q A;  1IBL B;  1W59 A;  3MHH C;  1QLE B;  2YIA A;  4HAM A;  5IT9 N;  1WNS A;  1R3K C;  3L74 H;  1N32 O;  4JI5 B;  2VQE B;  2Q0A A;  1B3Q A;  1EN5 A;  4DW1 A;  4WCE V;  1OCZ C;  3EVK A;  1YTF D;  2BSK B;  2NLJ C;  1FS0 G;  2QR4 A;  5BXZ A;  2Y4U A;  3RBZ A;  2ZXW C;  4J11 A;  3RW0 A;  5IY5 C;  4R6Z A;  5BMV A;  4GKJ B;  4ZHQ A;  4KXR A;  2DYR B;  2ATK C;  5KAF Z;  1HNX B;  1ZLZ A;  1YDX A;  4B3R O;  3K06 A;  1Z5V A;  1LNQ A;  4TWK A;  5C8Y B;  1SQV H;  4MVZ A;  3UO2 A;  4K0K B;  3EHB B;  1JFF B;  3OTF A;  1NVP D;  4BIO A;  4E4E A;  4AI8 A;  4JYC A;  3FB8 C;  5KX5 B;  4FPP A;  4LFB O;  5LXT A;  1FFX A;  3TET A;  3TJT A;  2CTQ A;  4WBN B;  1BZK A;  1GM9 A;  5CMU A;  2YC0 A;  3ETQ A;  4DW0 A;  4LF6 O;  3LSU A;  5IJ9 A;  1IUR A;  2P67 A;  3T1H O;  2MK3 A;  2HJF C;  2HVJ C;  3K58 A;  2UU9 B;  2E74 B;  5EZY A;  4DR1 B;  1I94 O;  4FZ1 A;  2IBZ H;  2WLN A;  1OJH A;  2Z5U A;  2OIG A;  4KP4 A;  1BGY H;  4DK1 A;  4OPA A;  5KX5 A;  4O2A B;  4TOI A;  4YJ3 A;  3CCV V;  4X8A A;  2LW1 A;  4DR4 B;  3G4S V;  2BTQ A;  5A9G A;  3SYO A;  4PA7 A;  1CEZ A;  3L9D A;  1H2N A;  1SES A;  3BCC H;  3KCY A;  3ZHR A;  1MOF A;  4DV7 O;  4TQD A;  2ZE8 A;  2FYU H;  2DOS A;  3JAW A;  4KFM A;  3UQ8 A;  1BHA A;  1EZJ A;  3K9S A;  4JAS A;  4LF4 O;  4GLX A;  1RPO A;  1VQP V;  1M57 C;  1H8H G;  4D7T A;  4ASU G;  1S3J A;  1QHT A;  2EIK C;  3IJ4 A;  1Q43 A;  4OPH A;  1GN4 A;  2EIK B;  1VF5 B;  2QKA A;  2WWW A;  3SJB C;  4HNA A;  5IYB O;  2YEV A;  4W4K A;  1D5N A;  3G6E V;  3QO5 A;  2DQ0 A;  3F5T A;  4PI0 A;  4DR1 O;  1P4R A;  4YJ3 B;  1NH2 B;  1ROP A;  2QM8 A;  3DGE A;  1LR1 A;  3LSQ A;  3UT5 A;  2UUB O;  1THZ A;  3F7V C;  2FKX A;  1G6U A;  4J7J A;  4WF9 V;  1H8E G;  1M5I A;  4LFB B;  4NTY A;  4QGP A;  2Y69 C;  1BE3 H;  4UCT A;  5JH7 B;  3K3W A;  4IT5 A;  4IHJ B;  2ZDI A;  5C93 A;  1K8A W;  4GZR B;  4O4H A;  4BAY A;  1QCE A;  4JYA B;  3ABU A;  5BMV B;  2EJR A;  3JD1 A;  2UUA B;  1EFR G;  1K97 A;  4H37 A;  3QF7 A;  2ZIN A;  4LF4 B;  4IYH A;  4IGG A;  1YJ9 V;  3CCU V;  4LNU A;  3KG2 A;  4EKW A;  4LF8 B;  4FLT A;  2A7W A;  3K08 A;  3BA9 A;  1BT8 A;  3AG1 B;  1OCR B;  2DQ3 A;  1I7F A;  3T4Z A;  2OT5 A;  4DR3 B;  5DN6 G;  1A32 A;  1SA0 A;  4DR7 B;  2A06 H;  2AXT Z;  4JI1 O;  2XAG A;  2UU9 O;  2QE7 G;  2WPD G;  2GDS A;  1BCC H;  2Q7E A;  3RYC A;  4LF6 B;  4O4L A;  1N34 B;  4R8C A;  3E22 B;  4LWS A;  1N0N A;  1U96 A;  2WLL B;  4XBF A;  2X6A A;  4NTX A;  1EM1 A;  4JF3 A;  5EC1 C;  1QQC A;  4X64 O;  2QTS A;  1WB8 A;  4X1Y A;  5IE9 A;  3P3N A;  2P6J A;  4X65 B;  2R9A A;  1HR0 B;  1MSD A;  1OCR C;  3U10 A;  2L35 A;  1PL4 A;  1S5L Z;  3OUF A;  2OTL V;  1ZTE A;  3TXS A;  1KKD A;  3E22 A;  4QIW F;  2CTP A;  2QWO B;  3M7M X;  1U97 A;  4UCS A;  2Q6A A;  3JAW B;  4JAV A;  3UKM A;  2YS8 A;  3HKB B;  1XMQ O;  1SA0 B;  2B5U A;  2A9H A;  4DR6 O;  2PYJ A;  3G6B A;  4JTD B;  1AP6 A;  3K0D A;  2ZCE A;  4DRX B;  1BHB A;  4PEL A;  4MSW C;  3DC6 A;  3LUT B;  5IWA B;  4B7K A;  3W7S A;  1GN2 A;  4WFB V;  3CXC U;  2Q5Z A;  2OCC C;  2WAM A;  4I5S A;  3OTO B;  5B66 Z;  5JJN B;  1H2L A;  1NZ6 A;  2JGD A;  5BY1 A;  5K1P A;  1R1B A;  5IYC O;  3ZMU A;  1AVM A;  2OIE A;  3ZMS A;  3LNM B;  2Q68 A;  1TUB B;  4D7S A;  2IJK A;  3L71 H;  3CCR V;  3EFF K;  3A0R A;  4JZG A;  2W6I G;  4DR5 O;  4GT1 A;  5EIB D;  5H2F Z;  5A2Q N;  4R50 A;  2HHH B;  4JI0 B;  1VQ6 V;  4AQY B;  5IYZ B;  1G1X B;  2Q9L A;  1S72 V;  4F6R B;  2LW7 A;  3FAV A;  2DMX A;  2KG7 A;  4BR6 A;  3CMA V;  1JJO A;  1BMF G;  1SKV A;  2JEX A;  5B1A B;  4BIU A;  4I4T B;  5IWA O;  1IZ3 A;  5EBW C;  4MVR A;  2LO1 A;  3MHS C;  3ABT A;  1AI6 A;  4QJF B;  2CTR A;  1L0N H;  5B1N A;  4O4J A;  2H8P C;  4DR6 B;  1Y74 A;  4PD4 F;  1B6Q A;  4LF5 B;  4R7C A;  5AG2 A;  1XMO B;  1BSM A;  1Q3E A;  4JGS A;  3VQX A;  3H1I H;  1R6K A;  2OWO A;  2ITC C;  5FLX N;  5LHH A;  2IJI A;  3OEE G;  4NB5 A;  3C3S A;  4P9O A;  2QJ1 A;  1KP3 A;  3E86 A;  1HR0 O;  1NR7 A;  4FFK A;  3RFR A;  5LYJ A;  2QSA A;  1OCC C;  3KCX A;  2W0F C;  1VQ4 V;  2ADP A;  4JAA A;  4WFE A;  5KLV H;  4JI6 O;  4W4L A;  1L8D A;  4X1I A;  3IAY A;  3T1Y B;  3ML0 A;  1KUQ A;  5FL7 G;  1KQS U;  4TV9 B;  2CUG A;  3TCU A;  1YEW A;  1AJQ A;  4X1K A;  1M93 A;  3ZN1 A;  5IJ9 B;  3ICX A;  1R73 A;  4DRX A;  2X6C A;  5C8Y A;  3T2M A;  5J9P C;  3RYF A;  1F4N A;  4OX9 O;  1JFF A;  2JGD B;  1L1F A;  2RQ6 A;  3FB6 C;  1SQG A;  2ZIO A;  2F4V B;  2WLI B;  2JRI A;  4YHH B;  1VQ5 V;  4LF9 B;  3HKE A;  1NTK H;  1PNK A;  3K57 A;  3MD0 A;  4LBE C;  2ZR3 A;  4P30 A;  5LMN B;  4MW8 A;  2RMK B;  1FD9 A;  4K8X A;  1NI8 A;  3RVZ A;  1K5S A;  4Z2W A;  1AR1 B;  5KUM A;  3UCS C;  2W0X A;  3B09 A;  3H9V A;  2XHB A;  2W6J G;  3ZHU A;  2M6Y A;  1PL0 A;  2QM4 A;  5KAI Z;  1WPB A;  3E83 A;  1NTM H; 
#chains in the Genus database with same CATH homology
 3UM7 A;  1QR9 A;  2WLN A;  2PI5 A;  3ETE A;  1QR8 A;  2GHY A;  4RUF A;  4JYB A;  1R3J C;  2Z5U A;  3ASN C;  4KP4 A;  2UXN A;  4N23 A;  3GB7 C;  1UJW B;  1F23 A;  1GM7 A;  1QLE C;  1FXK C;  1YIJ V;  3CCV V;  4X8A A;  3G4S V;  4JAU A;  3WFV A;  1IXM A;  1J95 A;  3SYO A;  4PA7 A;  4FK5 C;  2Y69 B;  1CEZ A;  1SES A;  5LHG A;  4U7N A;  3AEI A;  1M1K W;  2AHZ A;  1MOF A;  1K92 A;  1NR1 A;  3OMN B;  2LP7 A;  3JD4 A;  4KFM A;  1JJ2 U;  1YTF B;  1DTO A;  1BHA A;  1EZJ A;  1OCO C;  4JAS A;  4MT8 A;  2EIM B;  2P90 A;  4GCZ A;  1OZ0 A;  3LSS A;  1N8R W;  1RPO A;  5H6Q A;  5LHI A;  2IW5 A;  1JVM A;  1SZT A;  4XDL A;  5EK0 A;  1VQP V;  3VBB A;  1VQ7 V;  4MS2 A;  1M57 C;  1H8H G;  4ASU G;  1F4M A;  1S3J A;  2JJ1 G;  4U7O A;  2EIK C;  1WPX A;  3JD0 A;  2EIK B;  2Z3Y A;  2HR3 A;  2WWW A;  4J9Y B;  5HFL A;  3ZRV A;  3CYO A;  4G28 B;  1AI4 A;  1WLE A;  5IYB O;  1R3L C;  2YEV A;  3GWO A;  3F7Y C;  1P7B A;  3G6E V;  1VQ9 V;  3QO5 A;  3LDE A;  1JX9 A;  2DQ0 A;  3ZRS A;  3AG2 B;  2QA4 V;  4G2K A;  1P4R A;  1NH2 B;  2WSS G;  3K03 A;  1MG1 A;  1ROP A;  1NJI W;  2QM8 A;  4MTG A;  1G8M A;  1E1R G;  3DGE A;  3K79 A;  3LSQ A;  5L3E A;  4WFG A;  2V1D A;  4HZ3 A;  1THZ A;  3F7V C;  2JJ2 G;  1ORQ C;  3ETG A;  5B1O A;  1R6N A;  1JQ0 A;  2IH1 C;  4WF9 V;  1H8E G;  1YJW V;  1QBZ A;  2OTJ V;  2WLK A;  2OCC B;  1QVF U;  5IY5 B;  2IU0 A;  2Y69 C;  4MVO A;  3K3W A;  1VQN V;  3ABK C;  3WG7 B;  2A0L A;  2ZDI A;  4MTX A;  5C93 A;  1K8A W;  3FKS G;  3FYE B;  4TSF G;  4BAY A;  3ASO B;  1YHQ V;  1M57 B;  1QCE A;  3ABU A;  4JTC B;  3G71 V;  2HKO A;  2EJR A;  3E35 A;  3ZCC A;  4LCU C;  3JD1 A;  3VOU A;  1EFR G;  5CBG A;  1K97 A;  4H37 A;  3OR6 C;  4YXW G;  5CA3 A;  1W0J G;  4BW5 A;  4RQF A;  3FB5 C;  3CC7 V;  3E8B A;  3SPI A;  2QTO A;  1YJ9 V;  3CCU V;  2A79 B;  3OW2 U;  2EZO A;  5B3S C;  2Q69 A;  3KG2 A;  2WLM A;  3AG4 C;  4EKW A;  1W0K G;  3ZMV A;  3ABL B;  3SYA A;  2WLH A;  1PNL A;  3ETD A;  4WFF A;  2LFS A;  3T4D A;  3ZRW B;  2R9I A;  3K08 A;  2EBO A;  3AG3 B;  3AG1 B;  1OCR B;  4UV9 A;  1FXK A;  5KA5 A;  2DQ3 A;  2BOC C;  2UXX A;  1K4C C;  5LGN A;  1CPY A;  3D3I A;  3LDD A;  3CCE V;  3IGA C;  4MVM A;  3ZN0 A;  1FXV A;  1NBM G;  3T4Z A;  2DWD C;  2OT5 A;  5B1A C;  2P7T C;  1GM8 A;  1DF4 A;  2EIJ B;  3BY6 A;  2JK5 C;  3K9A A;  5DN6 G;  3SJQ C;  1OHH G;  1XL6 A;  2HFE C;  4UUJ C;  1M56 B;  1V54 C;  2XAG A;  2X0L A;  3K0G A;  3CCL V;  2QE7 G;  2WPD G;  3P30 A;  3R65 A;  3ZMZ A;  5HFM A;  3ASN B;  1JCH A;  1EBO A;  4R8C A;  3CCJ V;  2XOK G;  2WLL B;  3P32 A;  4XBF A;  5GW7 A;  1K7D A;  2X6A A;  1K34 A;  4JF3 A;  5EC1 C;  3E8H A;  2KB1 A;  4WFH A;  2V7Q G;  2ZDI C;  1OCO B;  2M7W A;  4UVB A;  2XAS A;  4QPJ A;  2IJJ A;  3CP1 A;  1XL4 A;  2WLJ A;  3OMI B;  2P6J A;  3E2E A;  1KP2 A;  3WG7 C;  1PD3 A;  2JEU A;  1PKX A;  3BEH A;  2EZP A;  3OGC C;  1VQK V;  1VQL V;  3ASO C;  1OCR C;  4PDV A;  4X89 A;  2CK3 G;  2EIL C;  3CME V;  3OUS A;  4J9Z B;  4PA9 A;  3OUF A;  2OTL V;  2XAJ A;  2HG5 C;  2ZXW B;  3I56 V;  2QEX V;  4PA4 A;  2XND G;  4QIW F;  3ZIA G;  1KKD A;  2AHY A;  3DTU B;  2WLL A;  3PJS K;  3OEH G;  4G27 B;  4JTA B;  4PA6 A;  3STL C;  5EC2 C;  3STZ C;  1GKF A;  3SYP A;  4JPR A;  3D36 A;  1YJN V;  5E1A C;  4ZBM A;  2Q6A A;  4JAV A;  1Q86 W;  3UKM A;  2DWE C;  3AG1 C;  4F4L A;  3CC2 V;  1K4D C;  4P2Z A;  2WLI A;  2B5U A;  3HPL C;  2A9H A;  5KA6 A;  5L3D A;  3SPG A;  1E79 G;  3OAA G;  2IU3 A;  4JTD B;  1VQM V;  3K0D A;  5B1B C;  3OFN G;  3ABM B;  1BHB A;  4PEL A;  4MSW C;  1K5Q A;  2H94 A;  3OMA B;  3LUT B;  5CBF A;  1TUE B;  1NKD A;  5EBL C;  5CN0 A;  4RUE A;  5LGT A;  4RO2 A;  2YEV B;  3W7S A;  1S5H C;  1CP9 A;  4XDJ A;  4WFB V;  3CXC U;  2IJH A;  3K04 A;  2R9R B;  2X6B A;  2OCC C;  3JYC A;  3CPW U;  2WAM A;  4I5S A;  1Q7Y W;  1AJN A;  1SRY A;  3JD3 A;  2EIM C;  1JOY A;  5IYD O;  3I55 V;  1Q82 W;  3E8F A;  1AI7 A;  4RAI A;  3CD6 V;  1YSC A;  3W7X A;  3W7U A;  3B8M A;  1H38 A;  3M99 B;  3IFX A;  4L87 A;  5BZB A;  2QKS A;  5IYC O;  3ZMU A;  4PDM A;  2ITD C;  3LDC A;  3AG4 B;  3W7W A;  3LNM B;  3ZMS A;  2Q68 A;  3FB7 C;  1DLB A;  3ABL C;  4P9P A;  2IJK A;  4MVQ A;  3SPH A;  4QNH B;  1K3E A;  3CCR V;  3EFF K;  1E1Q G;  3A0R A;  1GMG A;  1FFT B;  1GK9 A;  2W6I G;  4GT1 A;  4H33 A;  3AG2 C;  4I9W A;  4PDL A;  3B8N A;  2IH3 C;  1AI5 A;  3OE7 G;  1GTO A;  4FJC C;  4R50 A;  2Y48 A;  3ZRX A;  5DM6 V;  1VQ6 V;  1GO3 F;  2BOB C;  1K33 A;  3F5W C;  4X88 A;  1S72 V;  1ZWI C;  1S0V A;  4LC1 A;  1K9M W;  5CBH A;  5IDJ A;  2JDI G;  1BL8 A;  4TT3 G;  1QLN A;  1Q81 W;  4XDK A;  1V55 C;  4DXW A;  2EIJ C;  4MTO A;  1G4Y B;  3SPJ A;  3CMA V;  1BMF G;  2JEX A;  5B1A B;  4BIU A;  1V55 B;  5KUK A;  1FXK B;  2C2A A;  4GX1 A;  1ENV A;  4MW3 A;  1I5Y A;  2DYS C;  3B77 A;  5EBW C;  3NXS A;  2B1I A;  1NH2 D;  4MVR A;  5H6R A;  1DF5 A;  1FXH A;  3OM3 B;  3MHS C;  4Q20 A;  1QVG U;  3ABT A;  1AI6 A;  2NNU A;  4HYO A;  4QJF B;  5B1N A;  4QE9 A;  1Y66 A;  2H8P C;  4FMT A;  1B6Q A;  1H2G A;  1COW G;  4R7C A;  1K73 W;  4MVS A;  2DYR C;  1F51 A;  2PI4 A;  4GX0 A;  1NQT A;  3E89 A;  1VQ8 V;  1SET A;  4BIZ A;  4MVU A;  3QO7 A;  1S76 D;  2XAF A;  1KC8 W;  3JCZ A;  2HVK C;  2GSM B;  1RPR A;  1OCZ B;  4JGS A;  4GX2 A;  1R6K A;  4GX5 A;  4KUM A;  5LGU A;  2ITC C;  5L3B A;  5LHH A;  2D3O W;  1M9N A;  5EBM C;  2IJI A;  3OEE G;  4DO2 A;  2EIN C;  3X2Q C;  4P9O A;  1YIT V;  3H01 A;  1KP3 A;  3E86 A;  4WFA V;  1NR7 A;  3CCQ V;  3QO8 A;  3FYI B;  2Q67 A;  1M90 W;  3CCM V;  3AG3 C;  1OCC C;  1HWY A;  4UVA A;  4ZKI A;  2DYS B;  1ARO P;  2ZD9 A;  4UXN A;  3HB3 B;  2W0F C;  1VQ4 V;  4UV8 A;  2DW4 A;  2XAQ A;  2EIN B;  4WFE A;  1S77 D;  2EIL B;  2HLD G;  4UVC A;  2ZQM A;  1VQO V;  2JIZ G;  3QNE A;  3RVY A;  1JPX A;  3CC4 V;  1YI2 V;  4PA3 A;  5H9C A;  3E8G A;  3MHH C;  1QLE B;  3ML0 A;  4MTF A;  3W7T A;  5FL7 G;  1KEC A;  4HAM A;  3ABM C;  1KQS U;  1MSW D;  1R3K C;  2B1G A;  3OR7 C;  3TCU A;  1AJQ A;  1SER A;  4LP8 A;  3ZN1 A;  2QM7 A;  4WCE V;  1OCZ C;  4CBC A;  1YTF D;  1R73 A;  1W2B U;  2X6C A;  4QPK A;  2XAH A;  3CCS V;  3T2M A;  5J9P C;  2NLJ C;  2YSU B;  1F4N A;  4FIP C;  1L1F A;  5B1B B;  2ZR2 A;  1FS0 G;  4RQE A;  3RBZ A;  2ZXW C;  3FB6 C;  4CZZ A;  3RW0 A;  4QE7 A;  5IY5 C;  3ABK B;  4R6Z A;  2WLI B;  1OCC B;  1VQ5 V;  3SYC A;  2FTK A;  4OXS A;  3ZRW A;  4Z1M G;  1NVP B;  5LBQ A;  2DYR B;  2ATK C;  1R3I C;  2LFR A;  1PNK A;  3K06 A;  1LNQ A;  5L3C A;  4TWK A;  3T1C A;  3TK1 A;  3MD0 A;  4LBE C;  3JD2 A;  4MVZ A;  3IC7 A;  1KD1 W;  3SPC A;  2ZR3 A;  3EHB B;  1NVP D;  4P30 A;  4MW8 A;  4JYC A;  3FB8 C;  4FPP A;  1Y4M A;  1I5X A;  3TET A;  3RVZ A;  1K5S A;  3X2Q B;  1AR1 B;  1GM9 A;  5KUM A;  1PNM A;  5B3S B;  4N21 A;  5CMU A;  2X7R B;  2F43 G;  1AJP A;  5L3G A;  2W6J G;  3SYQ A;  2P67 A;  4E2L A;  2MK3 A;  1MAB G;  2HJF C;  2HVJ C;  2K1E A;  3ZJZ A;  1PL0 A;  5L3F A;  3ZMT A;  1M56 C;  1V54 B;  4PDR A;  1RM1 C;  3E83 A;  1RM1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...