4PDVA

Structure of k+ selective nak mutant in barium and potassium
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
b'DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdvA00
2YEVA 4XDKA 1XL4A 3STZC 3SYPA 4OXSA 3GB7C 1R3JC 2Y69C 1ORQC 4G28B 4RUFA 1V55C 2AHYA 3OGCC 3SPHA 5J9PC 5E1AC 3SYAA 2WLIA 3R65A 4XDJA 2DYSC 2EINC 3LDDA 5B3SC 3K03A 2JK5C 4MVSA 3BEHA 3E83A 4HYOA 4J9YB 4XDLA 3E8FA 2WLKA 3LDEA 4R8CA 3OUSA 1P7BA 3OUFA 4H33A 3SPCA 3T1CA 3AG3C 2EILC 2HG5C 3HPLC 1R3IC 2NLJC 3SPJA 4MS2A 3SYQA 4GX5A 3ZRSA 3LUTB 1BL8A 2P7TC 2DYRC 2QTOA 3IGAC 5EC2C 5EBLC 5B1AC 3RVYA 4RUEA 3JYCA 3ZJZA 2WLMA 2Q69A 3E86A 4QE7A 1G4YB 4GX2A 4MVZA 2Q67A 4PA9A 2EIJC 5IY5C 1XL6A 4HZ3A 1JVMA 4RAIA 2KB1A 4X89A 4PA4A 4MSWC 4P2ZA 1OCRC 2AHZA 4PDLA 4RO2A 4BW5A 2A0LA 4I9WA 2Q6AA 4MVOA 3SPGA 2WLJA 3LDCA 2DWEC 4R7CA 3TETA 2HVJC 3F5WC 4P9PA 4H37A 3T4DA 2EIMC 2ATKC 2BOCC 1V54C 4ZBMA 5KUKA 3K0DA 5EBMC 4PDMA 3FB7C 4MTOA 3FB8C 3K04A 4PA3A 3ABKC 5BZBA 2K1EA 5KUMA 3EFFK 4EKWA 2EIKC 2OCCC 3K06A 4WFEA 2A79B 4PDVA 2IH1C 4PA6A 1ZWIC 1M57C 4F4LA 3RBZA 1OCOC 4MW8A 3OR7C 1J95A 2ITDC 2WLHA 4MVRA 4R6ZA 3ASNC 3FB5C 3LNMB 1LNQA 3SYCA 1KKDA 3AG2C 2A9HA 3SPIA 4WFGA 1M56C 4X88A 2HFEC 3STLC 1K4DC 4JTCB 3AG4C 3TCUA 4P9OA 3K0GA 2WLIB 2WLLB 3F7VC 5EK0A 3T4ZA 2QKSA 3PJSK 3E8HA 2X6CA 2DWDC 2ZXWC 4MVQA 4MVMA 4P30A 3RVZA 2HJFC 3ABLC 3AG1C 3X2QC 4WFHA 1R3LC 2Q68A 3E8GA 4GX0A 2R9RB 3KG2A 2ITCC 4J9ZB 5B1BC 4PA7A 4WFFA 3WG7C 5CBHA 2IH3C 3FB6C 4DXWA 3ABMC 3UKMA 2WLNA 1OCCC 4KFMA 2X6AA 3RW0A 4X8AA 3E89A 3ASOC 4GX1A 4LP8A 2WLLA 1S5HC 2ZD9A 3OR6C 3SYOA 4MTFA 2BOBC 1K4CC 4UUJC 5EBWC 4MW3A 1R3KC 4JTAB 1QLEC 3E8BA 4MTGA 3SJQC 3T2MA 5EC1C 4CBCA 4TWKA 4MVUA 4G27B 5CBGA 4QNHB 2H8PC 4R50A 2X6BA 4JTDB 2HVKC 4LBEC 3K08A 1OCZC 3UM7A 3VOUA 3F7YC 2W0FC 5CBFA 4LCUC 3IFXA 4PDRA 4QE9A
chains in the Genus database with same CATH superfamily
3QTCA 3U0ZA 4O4LA 4DV6O 2OTJV 1S5JA 4LFBO 2B5UA 2P4VA 4WFAV 3SGIA 3R65A 1K5SA 5FNVA 1FYJA 1NVPB 5KX5B 1YITV 3J80N 5H9CA 4GZRB 5JH7B 3C3SA 2YI8A 3BCCH 2PI5A 1GM9A 2DYRC 3H1KH 3S3XA 1VF7A 3ZMVA 4H13B 1FFXB 4IGGA 1LUVA 1PL0A 4PDLA 4MVOA 3LDCA 1SQVH 4DV5O 2EULA 2IJKA 3CEIA 3JD4A 2AW9A 3FB7C 3RYCA 1RFYA 2PY5A 4B08A 1MZFA 1DLBA 2FYUH 3EFFK 1M93A 5LHGA 2YUAA 1AP5A 5BMVB 2JEXA 3K5OA 4BW9A 4QPJA 2WLHA 3CHXA 3E35A 3RFRA 2EX3A 4P9OA 1PNLA 3UO3A 3F7VC 4DRXB 1HW7A 4WFHA 5LMNO 2ITCC 2CUGA 3FB6C 3UQ8A 5J2TA 1SERA 2DQ0A 1V9PA 3ASOC 4X65O 3A8TA 4TUYA 5EBWC 5CB4A 1FD9A 1VF5B 1XDCA 2Q8VA 3WB2A 1ENVA 1BGYH 2QR4A 4Z1MG 4QNHB 2QWQB 3UM7A 2PZSA 4LF5O 2UXDB 2R9IA 3ETDA 3ZN1A 4JV5O 4LCUC 3W7WA 3ZMUA 4UVAA 3HKCA 4YY3B 4CC6A 3O65A 4DV2O 1QNMA 1FXVA 2QKCA 1UPGA 1Q82W 1RSOA 1XREA 2DYSC 2IJIA 4AI8A 4DUZB 1BS3A 2VQEO 4IYHA 5DECA 4UCOA 1NH2D 1T5EA 1OCCB 3QVNA 4JI0B 1K92A 2BSKB 2GV9A 4MTXA 3JCUZ 3H9VA 3DTUB 4IIJB 1QLEB 2ZKOA 5C8YB 4LF8B 2YS8A 4JYAB 4BIOA 1PPJH 4RO2A 1HWYA 1K73W 4TUYB 1JFFB 1MG1A 5CB4B 3T4DA 1PP9H 2K9PA 4PA3A 2Q0OC 3FFQA 4GUNA 2IU3A 1WA8B 5KAIZ 2EINB 2M6YA 1JPXA 1PL4A 1J95A 4LF4B 4F6RA 3SYCA 5LGNA 1K4DC 1L1FA 3N27A 2W0XA 1RSOB 1KUQA 3E22A 5FL7G 4D7SA 1R1BA 1BHBA 2ZXWC 1FAFA 5LMUB 2CGNA 2ZNIA 2FL4A 3OD4A 2R9RB 1HNWB 1TA8A 5IDJA 4W4KA 3UKMA 2UUAO 3CRAA 5GW7A 3E89A 2QDOA 3OR6C 4DR2O 4DUYO 4EB6B 2HHHB 4I7ZB 3SR2C 4X62O 5EC1C 3AG7A 2LO1A 3OTOB 5BR8O 3H1IH 1K5QA 3HKEB 4I55A 3AK1A 5CBFA 4GYCB 4JYBA 2ZQMA 4HNAA 4JI7O 1R3JC 3OAAG 2Y4TA 3I56V 5EZYB 2OTLV 2AHYA 4YXWG 1W2BU 5IJ0B 4LFAB 4DV0B 1BE3H 4NR1A 3CC2V 4J9YB 4XDLA 3E2EA 1H8HG 3AG1B 3D8CA 1Y76B 4WBNA 3JAKB 4AILC 3SPJA 1YTFB 2EJRA 4DR3B 1SQXH 4RUEA 2GHYA 5JCOC 2F95B 2LP7A 3RYHA 3QO7A 4I50A 4TOIA 4X9QA 5DN6G 4YJ2B 4P2ZA 1I0HA 2N05A 4DR1B 4O4JA 2IM9A 3KCXA 2EIMC 2QA4V 4FM0A 1FPOA 1Z2GA 4TV8A 4X1KB 5BZBA 1JJOA 2N04A 3TK1A 1W59A 3ZRVA 2OT5A 1FXKA 3PN1A 2ZDIA 3MD0A 3JATA 3FAVB 3AG2C 4Q6GA 3HKBA 3P30A 2CTPA 4FLVA 1KD1W 4A5UB 1AR1B 2JJ2G 2CTWA 2DWDC 2FTKA 2E5LO 4MVMA 1L0LH 2ILMA 3I5DA 2IBZH 1EM1A 2GUZA 3ZMZA 4QPKA 3ABMC 1XHZA 1JOYA 1NQTA 4DV1B 2PYJA 4L8JA 3JALB 4B3SO 1SA0A 4GX1A 4LP8A 4I5SA 4ICGA 4MW3A 3RYHB 3C3TA 4JTAB 3CJHA 3AEIA 4MTGA 4H0LB 4TV9B 1FXKC 1SQPH 4FJCC 5CBGA 2UXCB 5BY1A 2ZDIC 3JARA 1QVGU 4I9QA 1XOUA 3T1HB 4LFCO 4BIZA 1XL4A 2P90A 3QF7A 2JJ1G 4CH4A 3L70H 3OGCC 1RPRA 4AQYO 3SYAA 4TQFA 5F2VO 1JQ0A 2CH7B 3LDDA 1N36O 4LF9O 1E1QG 3X2QB 3LDEA 1YI2V 2KQXA 1S72V 4JI2O 3OUSA 1P7BA 3WG7B 3BA9A 2HJDA 5J2UB 1BQZA 2XAJA 5KHJA 1NT2B 1VQ9V 1WLEA 2QTSA 1BSMA 5L3FA 1SA0B 3K79A 4P9PA 2NR5A 2Q4PA 3P3PA 3OM3B 3AK3A 2JGUA 4FK5C 3K06A 3M7MX 1IBLO 1Y4MA 1M9NA 3K57A 3CCUV 3LNMB 4U3JA 2RMKB 1NZ6A 4WCEV 1CXZB 4UCSA 4Z2WA 2EILB 5IJ9B 1SZTA 1HNXB 1HR0B 3OTFA 1VMGA 2QM7A 4B3RB 4DV4B 3G6EV 1P4RA 1NI8A 2Y0IA 1DF4A 2F66C 4P30A 3CMAV 3RYIB 4JI3B 3ZHRA 4O2AA 4ZHQB 3EXAA 4WFFA 2ETNA 4KP4A 3WB1A 3QO8A 2Q9LA 4FLTA 3K9SA 3RW0A 1IBKB 3FYIB 5LXTA 4FLUA 1S5HC 2EZOA 1R3KC 2PUSA 4DW1A 3SJQC 5A2QN 2OCCB 2W6IG 1D5AA 1OV9A 5LHIA 3VOUA 1FXHA 3CXCU 1TUBA 5IWAB 2Y0PA 2XT9A 1S5LZ 3STZC 2WA3A 4IT5A 2P22C 4NTWA 5CA1B 4GKKO 3DXRA 1SETA 3SJAC 3H1LH 3E83A 3KCYA 3JD0A 1ZL8B 2YXLA 4O2BB 5IYZA 1D5NA 1SF9A 4J80A 4IHJB 2UU9O 2Z0AA 2OWOA 5EC2C 2YXYA 3ZRWA 1VQMV 4CC5A 3JYCA 2WLMA 2EIJC 1XL6A 1Q6IA 2IU0A 1E79G 1R6TA 1YSCA 2LGQA 5LXTB 1FFTB 3CE2A 5LA6B 1GM8A 3IC9A 3N2GB 4H37A 4NVPA 4JZ2A 1KBHA 3FKSG 3SDLA 1EFRG 4OPHA 1NTMH 2IW5A 1Q81W 1ZLZA 4YIPA 1M57C 1OCOC 3H1JH 5B1NA 1GH6A 1GAXA 2KG7A 2E3CA 3RN4A 1LR1A 2LGWA 4B3MB 1KB9F 1YF2A 3ABLC 1XBLA 2Q68A 1Z5WA 4CZZA 1UJWB 2UXBO 1H2GA 2A06H 2UUCB 2IH3C 2X6AA 4HBNA 4JI4O 2F4VB 4X20B 1AI4A 5EYPA 1V54B 5ITZB 5L3DA 1S76D 1K9MW 5TISZ 5A9GA 4DR5O 2YIAA 2X6BA 3DC6A 2ZE5A 2BCCH 1H8EG 1YJWV 3BHPA 1XMOB 1QBZA 4LF7B 4JASA 1GO3F 3ETEA 1O9GA 1J5EB 2HLDG 2A3QA 2B1IA 2QEXV 3ZN0A 1XMQO 1R6NA 3JD1A 2CE4A 4DV3O 3BA8A 3ZBHA 1IZ3A 1N32O 1NU1H 4QE7A 3W7UA 4LH6A 3ETQA 1GN6A 1ZAUA 2DJVA 5IT9N 5CA0B 1MZEA 3CD6V 3WU2Z 4DW0A 1N33B 4UXNA 3FD9A 1OHHG 4JI5B 2Y4UA 1Q6UA 4I9WA 2BTQA 1VQLV 4JI6B 1XNRO 1I94B 2EJ7A 3UCSC 5KUKA 1M1KW 1XHXA 2ZE7A 2Q0AA 3G71V 4DV7O 4CS3A 4PV1B 4NXNO 1ZWIC 5B1OA 2B9ZA 3DC5A 1HNZB 1FJGB 3DGEA 3T1YB 2A9HA 1SRYA 1H2SB 2JVDA 4JTCB 1Y67A 2AZ2A 5KHGA 3OT7A 4JAAA 2XOKG 2DYRB 1N34O 1KP3A 1QLNA 4J7JA 3RYFA 4FZ1A 4GCZA 3CC4V 1BT8A 2LQTA 4GKJB 2NN4A 3K9AA 1QVFU 3G67A 1RP3B 2KSDA 4B3TB 1YCIA 1Q8IA 2P06A 2WLLA 1GRJA 2R9AA 4X1IA 1S3JA 2QWOB 4O4LB 5JJJB 2ZR3A 2VQFB 4Q20A 2FB5A 5FNVB 1NS1A 1MABG 4L87A 1RM1C 3VQYA 2PYLA 1TAEA 3J81N 1I7FA 5J9PC 3ZHTA 1X4TA 5B3SC 4DR4B 4IL6Z 1YHQV 1SZXA 4GT1A 2RNBA 4UCUA 2P5OA 2P7TC 2JRIA 3ASOB 4YHHB 3RYCB 1YIJV 3CCQV 1F4MA 3JCZA 2UUBB 1JA8A 1WPBA 4X89A 1OCRC 1P7GA 4CH5A 2YI9A 2ZIOA 4ZOLA 1PNMA 3G4SV 3LSSA 4PDMA 4MTOA 2ZM6B 4EKWA 4FFBA 5D5PA 4PDVA 1TVKA 2DYSB 5JQGA 5D5QA 1LNQA 3JASA 2EZPA 4YJ3A 3STLC 1AP6A 5J2TB 2YICA 1F7YA 2C2AA 2UXDO 2MW2B 1DTOA 5L3CA 3T4ZA 4JAUA 4YY3O 1VQKV 2XASA 2UXXA 5AG2A 3VBBA 1F51A 3S3WA 2RCVA 1PV0A 4PI2A 4DXWA 2D2CB 4DUZO 3HKCB 2V4DA 3CCMV 4LNUA 3JAMN 3K5NA 4JI0O 4FLYA 4MVUA 2QKAA 3OE7G 3EVKA 2HVKC 3JSLA 1K97A 1G1XB 4LF8O 3F5TA 1NJIW 4JYAO 1YJ9V 4PJ0Z 1DF5A 4LF6B 3K5MA 1VQNV 3IC7A 1TVKB 1QCEA 2ZXWB 1BQ0A 4FIPC 5JCOA 4K8ZA 1HP8A 3SPCA 5L3GA 3HPLC 5JVDA 1BCCH 2LFSA 1YJNV 2UXNA 4LF4O 3IGAC 1K7DA 5LGUA 3ZJZA 1AJQA 1KU9A 4I0XA 2HR3A 4X66B 1KYOF 1H2KA 2IJJA 4RAIA 3NR7A 3ZHUA 2QE7G 5KHHA 4F6RB 2JGDA 5LMUO 3C90A 4AHCA 1HNWO 1PNKA 5LYJA 2GBOA 3Q4HA 4JAVA 1Q43A 3K0DA 3JD2A 3B8NA 3E22B 1R6KA 1WPXA 3B4SA 2HHHO 1SQFA 3UT5A 1EN5A 4HAMA 1NR7A 2ZE6A 4ASUG 1YXBA 3CP1A 5B5EZ 1WP7A 3OTOO 2GTSA 3JSNA 1VARA 3L71H 1COWG 4UFZA 1VQ8V 4E4EA 1XEQA 3OGIB 4K8XA 2WPDG 1IVSA 4I55B 4LFAO 4DV0O 3A0BZ 2WLNA 4ZKIA 1IURA 1VQOV 4HNAB 4RQFA 2EIMB 1A32A 1TUEB 1NH2B 3RGBA 4FMTA 4CBCA 2E75B 4DR3O 3B77A 5LOVA 5GTHZ 1JX9A 4LBEC 1N0NA 1NR1A 4WBNB 3IFXA 3D3IA 3MAQA 5EBLC 2YEVA 1EN4A 3CYOA 4QE9A 3AG2B 2QWNB 3AK2A 2Y69C 1IXBA 4DR1O 1KKCA 1V55C 1AI7A 1AROP 1WP8A 1Y6XA 5E1AC 4UV9A 2LJ2A 2XTAA 4UCVA 2PTMA 2OIEA 3CCVV 3CCRV 4I50B 1GN3A 4TSFG 3GWKC 4DK1A 4W4LA 3SYQA 1ROPA 3ABMB 4O4JB 1JR9A 2XHBA 5B1AC 4TV8B 3L75H 1NTZH 1SESA 1ZSPA 1FXKB 2KB1A 1ZX3A 2HEPA 3ZRXA 3JATB 2A0LA 2R70A 4R7CA 3TETA 1XILA 3HKBB 1AVMA 1WB7A 4RWUA 2PF4E 2VRZA 4O4IA 4DV1O 5KUMA 5DEDA 2EIKC 4O4HA 1L8DA 3FYEB 3B8MA 4MW8A 4PD4F 3HKDA 1M5IA 3ASNC 2UXCO 2GUZB 3JD3A 3AG4C 3TCUA 1GMGA 3ZHVA 2XUMA 3PJSK 3T1HO 2X6CA 4J10A 5LP6A 3CJHB 4U7OA 1OJHA 1VQ6V 2Z5UA 3KG2A 2DMXA 2AZ0A 1SKVA 1AJPA 5FPRA 5B1BC 3JARB 4UV8A 1UFIA 1LUWA 3IJ4A 3A2FA 4UCTA 2LW7A 2YDEA 3JAWA 1K4CC 4ZI7A 3L74H 4DR7B 2QWRB 3ZEDA 3T2MA 2L35A 3D36A 4G27B 2Q7EA 2F93B 2DN9A 3LSQA 3CS5A 4BR6A 4PDRA 3CSXA 2XAGA 4ABMA 4WFBV 3M8AA 4OXSA 5GTIZ 4JI1B 4OX9B 2OIGA 5K1XA 3J7AU 3CRMA 2PI4A 5LP6C 4KXRA 4DR6B 3CMEV 2JK5C 4MVSA 3BEHA 1Y74A 3N2KA 2CTQA 3KZIZ 2D3OW 2Z3YA 3T1CA 3OUFA 3BFRA 3ZRSA 5CA3A 2RQ6A 2Q73A 4NTYA 1PKXA 5C93A 1Q3EA 1HNXO 1HR0O 3D36C 2Q67A 1KP2A 5IY5C 4B3RO 1D2DA 4DV4O 4KUMA 4PA4A 4JI3O 4U3JB 5H5NA 3L72H 1K8AW 4JI1O 4I4TA 3OEEG 3ABKC 1IBKO 2DOSA 2YXHA 4JYCA 3CCJV 1SQGA 5FPOA 2N74A 4O2AB 4MVRA 5GONA 2G38A 5IYCO 3ZX6A 3SPIA 2RDCA 4J42A 1M56C 3CXHF 1G8MA 3ABUA 4X64B 4NB5A 5IWAO 4JI8B 2QKSA 2DE0X 2CTRA 1AB3A 4N23A 3N2KB 1I5YA 5LGTA 4UVBA 2ADQB 1WJZA 2EIJB 3K5LA 4J9ZB 3U10A 4PA7A 2GDSA 1TUBB 4KL1A 3MHSC 3SYOA 2M7WA 2YIDA 3E8BA 2WSSG 3APQA 1O9HA 3DXRB 3ZMTA 2ZIMA 3CWBH 1M57B 4FFKA 1OCZC 1OCOB 4X1YA 3F7YC 2XNDG 5IYZB 1GM7A 1ORQC 2XAQA 1SQBH 4BWAA 3ZRWB 2WLIA 4PHZA 3VQXA 1P84F 4J41A 3A0HZ 3AG3C 1R3IC 2NLJC 5EIBC 3CCEV 4NXMB 3THOA 2QTOA 1XNQB 1B6QA 1SQQH 1ZTEA 4N21A 2GSMB 2KKWA 2JIZG 3ZMSA 2JEUA 4PELA 1IBMB 1Q90D 1ZUQA 4GX2A 4K0KB 1CPYA 4PA9A 4B3MO 3HR0A 5KX5A 4FM1A 4KHPB 1FKAO 1AI6A 1YVWA 4F6EA 2P4KA 5JH7A 4DV6B 4BIUA 2WLJA 4LFBB 1URFA 2KG7B 2UUCO 4JYYA 1RPOA 2R72A 4DYLA 1FFXA 2F4VO 3H01A 2DQ3A 4R6ZA 2ZT9B 2LFRA 3ICXA 1GK9A 3G80A 4JPRA 2Q7HA 4TT3G 2WLIB 1XMOO 5EK0A 5EYPB 3E8HA 1IX9A 4UCRA 4LF7O 4E2LA 5BMVA 3B40A 3BPZA 1N4CA 2XAHA 1P49A 4DV5B 3O9OA 5HFMA 2CGOA 4KFMA 1VIBA 2FMLA 1J5EO 2Q5ZA 1NBMG 3ABTA 1JCHA 2ZD9A 4RQEA 4DRXA 3W7SA 4FLXA 2JS3A 2CDYA 3CC7V 2YIBD 2W0FC 5IYBO 5KHIA 3TXQA 1N33O 1EN6A 5IE9A 3SYPA 4JI5O 5LMNB 1W0JG 4JI6O 1I94O 1U97A 4FM2A 3K03A 4U3FH 1Q86W 3E8FA 4PI0A 3VQVA 4X65B 3G6BA 1K3EA 2BTQB 1HNZO 1FJGO 3T1YO 1VF6A 1MOFA 2Q69A 4DO2A 3QO5A 1G4YB 4LF5B 4JV5B 4HZ3A 5CN0A 4DV2B 4UB6Z 4FLWA 1OZ0A 2DWEC 2HVJC 4GKJO 1RM1B 2BSKA 2ZINA 4ZBMA 3ML0A 3BAAA 1MMMA 2DW4A 4IIJA 2VQEB 4B3TO 1AILA 5C8YA 3RYFB 5B3SB 1YTFD 1BHAA 2ITDC 3FB5C 4MT8A 1JFFA 2VQFO 2HFEC 2E74B 1VF6C 3K0GA 1JJ2U 2WLLB 1GN4A 4X1IB 5LBQA 4QJFB 1WA8A 2ARHA 4B7KA 3CB2A 1R3LC 5H6QA 2RJZA 1B3QA 1CP9A 1I08A 1Q7YW 4DR4O 1OCCC 2Q7GA 1OCRB 5H2FZ 1VQ7V 4LH7A 2YIBA 1MNGA 1QLEC 5H6RA 3OMNB 1W0KG 2LW1A 4YHHO 3ETGA 1NTKH 2UUBO 4EEQA 3GVMA 1GKFA 4J7KA 3TXSA 1L0NH 3GB7C 4EB6A 5LL6Y 3A0RA 1H2NA 2EINC 1I5XA 2UUAB 2ZM6O 3HKEA 4R8CA 4DR2B 4DUYB 4MS2A 3ZHQA 1VEWA 3QG5A 4ZOLB 4X62B 3K59A 5EZYA 3TGUH 4WF9V 3OMAB 5IJ0A 1YZBA 5BR8B 1CEZA 3WB0A 1US6A 4FFBB 1QR9A 1WB8A 4J11A 1Y76A 1JVMA 4JI7B 3JAKA 2ADPA 2PGGA 3CPWU 4MSWC 5JQGB 2AHZA 2V1DA 4ZIBA 4BW5A 3JASB 4YJ3B 4FVMA 4QGPA 3F5WC 2VS0A 2WAMA 2A7WA 3SJCC 2K1EA 4LR3A 2A79B 2IH1C 5LHHA 2EBOA 4PA6A 4F4LA 5JJEB 2YC0A 4YJ2A 1KKDA 1JMKC 2X7RB 1QQCA 4QIWF 4D7TA 4X1KA 5JWPA 2QGNA 1XI1A 4LNUB 1PD3A 4MVQA 4LF6O 5KAFZ 1B06A 4UVCA 3AG1C 3FAVA 1TGOA 5KMGA 3OMIB 1R73A 3BABA 2B1GA 2H3OA 1DK1A 1KMIZ 2O57A 3BY6A 4D6TH 4TWKA 1Q5OA 2H8PC 3K08A 2QJ1A 4X66O 3L9DA 5JJNB 3JALA 2QSAA 5JVDB 3OFNG 5FLXN 2E5LB 1MSDA 4G28B 1F23A 2P6JA 3SPHA 4NYKA 1EZVH 4TV9A 4XDJA 4I0XB 2MK3A 4BAYA 4HYOA 2XAFA 4NTXA 4B3SB 5KLVH 1S77D 2F23A 4TQDA 3BVOA 2JGDB 3LUTB 4EFBA 5LYJB 3D3QA 3Q4HB 4OGQB 3WFVA 2CH7A 3E86A 4GLXA 1PM9A 5KMGB 1AI5A 4LFCB 2VWJA 1M4UA 3UT5B 2ZE8A 3MHHC 4FPPA 5J2UA 5DM6V 1AR4A 4AQYB 2BOCC 1N36B 4LF9B 1QR8A 1FS0G 2Y69B 5K1PA 3FB8C 3K04A 2AXTZ 3RWRD 1V55B 4JI2B 1G6UA 3QNEA 1N0JA 3OEHG 3B2EE 3OR7C 4K3AA 1Z5VA 2NNUA 5CMUA 2JS5A 1YDXA 4WFGA 3SJBC 4LC1A 3R66A 3I55V 4CS4A 4OPAA 4FZ0A 3GWOA 5B1AB 5KA5A 1VQ4V 2HJFC 3X2QC 2OCHA 3E8GA 5LOVB 3WG7C 5CBHA 2ZNJA 1H38A 2E76B 1S0VA 3CCLV 4C7UA 1EBOA 5IJ9A 1U96A 1KC8W 2YEVB 1F4NA 4UUJC 2BOBC 2F1MA 1M90W 1IBLB 3BRCA 3RYIA 1WNSA 3CRRA 1KECA 2BTOA 4JF3A 2EIKB 4ZHQA 2F43G 2ZCEA 4JTDB 4R50A 3ZCCA 1K33A 3ASNB 2L6LA 1DGSA 2VWKA 2WA4A 4EFEA 2FKXA 2BE3A 3AG4B 3EHBB 2RN9A 2Y48A 1WN7A 1Q6HA 3KKYA 2ODMA 1MA1A 1WAZA 2WLKA 4LWSA 4H33A 5E79Z 3K3WA 5EIBD 5B1BB 2EILC 5BXZA 2YSUB 1QHTA 5CA1A 4O4IB 2JDIG 2HKOA 3B09A 4MVZA 4O4HB 3FX7A 2CAZC 1ZL8A 4O2BA 2QWPB 5B66Z 4IHJA 3K58A 1BMFG 3HKDB 5L3EA 4DK0A 1SC5B 4GKKB 4CS2A 3LNNA 4JGSA 1B04A 2OCCC 4G2KA 5LP6B 4DR7O 4J7ZA 2UU9B 3RBZA 1AJNA 1HDJA 1E1RG 3UO2A 5LA6A 3N2GA 4X88A 3VQWA 4H44B 3IAYA 4UB8Z 1K34A 4CH6A 2W6JG 4CH3A 3JAWB 4ZI7B 3HB3B 4FLZA 1NVPD 4OX9O 4LWSB 2QM4A 4GX0A 5IY5B 4XBFA 3U11A 4DR6O 1KQSU 3RT3C 2OYQA 2HP8A 1BZKA 3P32A 3ZHSA 3ABKB 3CRQA 1XQ8A 5L3BA 3APOA 1Y74B 3ZS8C 4X20A 1VQ5V 4XDKA 1M56B 4RUFA 5ITZA 1XUQA 3LSUA 2UXBB 4YIOA 3OW2U 3CRCA 1N8RW 3DSQA 1YEWA 4JI4B 2HG5C 4IYIA 1AR5A 1GN2A 4GX5A 3NXSA 2X0LA 1BL8A 3RVYA 4B7EA 4DR5B 1VQPV 4I4TB 2IJHA 4X64O 4U7NA 4JI8O 3H1HH 4JZGA 2H94A 1Y66A 5GONB 1QU7A 1OCZB 2Q6AA 3SPGA 3ABLB 2ATKC 1V54C 3TJTA 2AGAA 2ZR2A 1X59A 2WWWA 1IDSA 1MSWD 3W7XA 5CA0A 3CCSV 4WFEA 1H2MA 1XMQB 1GTOA 3L73H 4K35A 1EZJA 1H2LA 4DV3B 1SS3A 1VP7A 2GTAA 5KA6A 1IXMA 1N32B 3AG3B 4NKGB 3W7TA 3MDSA 1THZA 5KHKA 3ZIAG 5HFLA 3P3NA 3RVZA 2V7QG 2P67A 3CX5F 1XNRB 1NKDA 4X1YB 4X8AA 4DV7B 2CK3G 4MTFA 4NXMO 5IYDO 4NXNB 2QM8A 1XNQO 4Z1VA 1IBMO 4K0KO 3M99B 5EBMC 4KHPO 1N34B
chains in the Genus database with same CATH topology
2YEVA 3STZC 3GB7C 2Y69C 2OTJV 3A0RA 1V55C 1AI7A 1AROP 1SETA 2B5UA 5E1AC 3R65A 4WFAV 1K5SA 2EINC 4UV9A 1I5XA 3CCVV 3E83A 4R8CA 1NVPB 3JD0A 3CCRV 4TSFG 1YITV 5H9CA 3SYQA 4MS2A 1ROPA 3ABMB 2PI5A 1GM9A 5EC2C 2DYRC 5EBLC 5B1AC 3ZRWA 1VQMV 4WF9V 3JYCA 3ZMVA 2WLMA 3OMAB 1SESA 1CEZA 2EIJC 1QR9A 1XL6A 1JVMA 1FXKB 2KB1A 2IU0A 1E79G 3CPWU 4MSWC 1PL0A 1YSCA 2AHZA 2V1DA 4PDLA 3ZRXA 4BW5A 2A0LA 4MVOA 1FFTB 3LDCA 4R7CA 3TETA 1GM8A 3F5WC 4H37A 2IJKA 3JD4A 3FKSG 2WAMA 3FB7C 1EFRG 2K1EA 1DLBA 3EFFK 5KUMA 5LHGA 2EIKC 2IW5A 1Q81W 2A79B 2IH1C 3FYEB 5LHHA 2EBOA 2JEXA 1M57C 3B8MA 4PA6A 4F4LA 1OCOC 4MW8A 5B1NA 4QPJA 2WLHA 3ASNC 1KKDA 3E35A 3JD3A 3AG4C 2X7RB 4QIWF 1GMGA 4P9OA 1PNLA 3TCUA 3F7VC 3PJSK 2X6CA 1PD3A 4MVQA 4U7OA 3ABLC 4UVCA 3AG1C 1VQ6V 4WFHA 2Q68A 2Z5UA 3KG2A 4CZZA 1AJPA 2ITCC 1UJWB 1H2GA 5B1BC 4UV8A 2IH3C 3FB6C 3OMIB 1R73A 1SERA 2X6AA 2DQ0A 2B1GA 3ASOC 1AI4A 3BY6A 5EBWC 1K4CC 1V54B 5L3DA 1S76D 1ENVA 3T2MA 1K9MW 3D36A 4TWKA 4G27B 4Z1MG 4QNHB 2H8PC 2X6BA 3K08A 3UM7A 3LSQA 1H8EG 2R9IA 3ETDA 1YJWV 3ZN1A 4LCUC 3W7WA 3ZMUA 4UVAA 4PDRA 4WFBV 2XAGA 1QBZA 3OFNG 4OXSA 4JASA 1FXVA 1GO3F 4G28B 1F23A 1Q82W 2P6JA 2PI4A 3SPHA 3ETEA 4XDJA 2DYSC 2MK3A 4BAYA 3CMEV 2IJIA 2JK5C 4MVSA 3BEHA 4HYOA 2XAFA 2HLDG 2B1IA 2D3OW 1S77D 2Z3YA 3T1CA 3ZN0A 3OUFA 2QEXV 1R6NA 1NH2D 3ZRSA 1OCCB 3JD1A 3LUTB 5CA3A 1K92A 1PKXA 3WFVA 5C93A 4MTXA 3E86A 4QE7A 3W7UA 3DTUB 2Q67A 1QLEB 1KP2A 5IY5C 3CD6V 1AI5A 4UXNA 4KUMA 4PA4A 1OHHG 4RO2A 1HWYA 3MHHC 4I9WA 1K73W 4FPPA 1K8AW 5DM6V 1VQLV 1MG1A 3T4DA 2BOCC 5KUKA 1M1KW 1QR8A 5EBMC 1FS0G 2Y69B 3OEEG 3FB8C 3K04A 4PA3A 3ABKC 4JYCA 3G71V 1V55B 3CCJV 3QNEA 3OEHG 2IU3A 1ZWIC 2EINB 1JPXA 5B1OA 3OR7C 1J95A 4MVRA 3SYCA 2NNUA 5IYCO 3DGEA 5CMUA 2A9HA 3SPIA 5LGNA 4WFGA 1M56C 1SRYA 1K4DC 4LC1A 1L1FA 4JTCB 1G8MA 3ABUA 3I55V 2XOKG 5FL7G 2DYRB 2QKSA 5B1AB 3GWOA 5KA5A 1KP3A 4N23A 1VQ4V 1QLNA 1I5YA 2ZXWC 5LGTA 1BHBA 3IFXA 4GCZA 3CC4V 2HJFC 3X2QC 4UVBA 3E8GA 2EIJB 2R9RB 3CYOA 4J9ZB 4PA7A 3WG7C 5CBHA 5IDJA 3K9AA 3UKMA 1H38A 1S0VA 1QVFU 3CCLV 5GW7A 1EBOA 3E89A 1KC8W 2YEVB 3MHSC 1F4NA 2WLLA 3OR6C 3SYOA 4UUJC 2BOBC 2M7WA 1S3JA 1M90W 3E8BA 2WSSG 2ZR3A 5EC1C 1KECA 4JF3A 2EIKB 3ZMTA 4Q20A 2F43G 4R50A 4JTDB 3ZCCA 1K33A 1K5QA 1M57B 1OCZC 1OCOB 3F7YC 2XNDG 5CBFA 1MABG 4L87A 3ASNB 4JYBA 2ZQMA 1RM1C 1GM7A 1R3JC 3OAAG 1ORQC 3AG4B 2XAQA 3I56V 3EHBB 2OTLV 2AHYA 2Y48A 3ZRWB 5J9PC 4YXWG 1W2BU 2WLIA 5B3SC 3CC2V 4J9YB 4XDLA 1YHQV 3E2EA 1H8HG 2WLKA 3AG1B 4GT1A 4H33A 3K3WA 3AG3C 5B1BB 2EILC 1R3IC 2NLJC 3SPJA 3CCEV 2YSUB 2P7TC 2QTOA 1YTFB 3ASOB 1B6QA 2EJRA 4N21A 2GSMB 4RUEA 2JIZG 3ZMSA 2GHYA 2JEUA 4PELA 2JDIG 2HKOA 1YIJV 4MVZA 4GX2A 3CCQV 1F4MA 1CPYA 2LP7A 4PA9A 3JCZA 3QO7A 1AI6A 4X89A 5DN6G 4P2ZA 1BMFG 1OCRC 5L3EA 4BIUA 2WLJA 3M99B 1PNMA 2EIMC 3G4SV 2QA4V 4JGSA 3LSSA 1RPOA 4PDMA 4MTOA 5BZBA 4EKWA 2OCCC 3TK1A 3H01A 3ZRVA 4G2KA 2OT5A 4PDVA 1FXKA 2DYSB 3RBZA 1AJNA 2ZDIA 2DQ3A 3MD0A 4R6ZA 1LNQA 1E1RG 2EZPA 3AG2C 2LFRA 3P30A 4X88A 3STLC 1GK9A 4JPRA 4TT3G 2C2AA 1KD1W 1DTOA 5L3CA 1K34A 2WLIB 3T4ZA 1AR1B 5EK0A 2W6JG 4JAUA 2JJ2G 3E8HA 1VQKV 2DWDC 2FTKA 2XASA 4E2LA 3HB3B 4MVMA 1NVPD 2UXXA 3VBBA 1F51A 4GX0A 5IY5B 2XAHA 4XBFA 3ZMZA 4QPKA 4DXWA 3ABMC 5HFMA 1JOYA 1KQSU 1NQTA 4KFMA 4GX1A 4LP8A 3ABTA 1NBMG 1JCHA 2ZD9A 4RQEA 4I5SA 4MW3A 3CCMV 4JTAB 3P32A 3AEIA 4MTGA 3ABKB 3W7SA 1FXKC 4MVUA 4FJCC 5CBGA 3OE7G 5L3BA 2ZDIC 2HVKC 1QVGU 1K97A 3CC7V 2W0FC 5IYBO 1VQ5V 4BIZA 4XDKA 1XL4A 2P90A 1M56B 3SYPA 1NJIW 1YJ9V 1DF5A 4RUFA 1VQNV 3IC7A 2JJ1G 3OGCC 1W0JG 1RPRA 3SYAA 1QCEA 1JQ0A 3LDDA 3OW2U 3K03A 2ZXWB 1E1QG 1N8RW 1Q86W 3E8FA 3X2QB 3LDEA 4FIPC 1YI2V 1S72V 3OUSA 1P7BA 3SPCA 5L3GA 2HG5C 3HPLC 3WG7B 4GX5A 2LFSA 1YJNV 3NXSA 1K3EA 2UXNA 2X0LA 1BL8A 3IGAC 2XAJA 3RVYA 1K7DA 5LGUA 1MOFA 3ZJZA 1AJQA 1VQPV 2Q69A 1VQ9V 2HR3A 1WLEA 4DO2A 3QO5A 1G4YB 2IJHA 4HZ3A 4U7NA 5L3FA 2IJJA 4RAIA 5CN0A 2QE7G 2H94A 1Y66A 1OCZB 3K79A 2Q6AA 3SPGA 1OZ0A 2DWEC 3ABLB 2HVJC 1PNKA 4P9PA 2ATKC 1RM1B 1V54C 3OM3B 2ZR2A 4JAVA 4ZBMA 2WWWA 3K0DA 1MSWD 3ML0A 3JD2A 3B8NA 2DW4A 1R6KA 3W7XA 4FK5C 3K06A 3CCSV 4WFEA 1WPXA 5B3SB 1YTFD 1GTOA 1Y4MA 1M9NA 1BHAA 2ITDC 1EZJA 3CCUV 3FB5C 3LNMB 4MT8A 4HAMA 4WCEV 1NR7A 4ASUG 5KA6A 1IXMA 2HFEC 3AG3B 3CP1A 2EILB 1SZTA 3W7TA 3K0GA 1JJ2U 2QM7A 2WLLB 1THZA 3G6EV 1P4RA 1COWG 5LBQA 4QJFB 1VQ8V 3ZIAG 5HFLA 1DF4A 4P30A 3RVZA 2V7QG 3CMAV 2P67A 1R3LC 2WPDG 4QE9A 5H6QA 1CP9A 4WFFA 1NKDA 4KP4A 1Q7YW 2WLNA 3QO8A 1OCCC 1OCRB 3RW0A 4X8AA 4ZKIA 1VQOV 1VQ7V 3FYIB 1S5HC 4RQFA 2CK3G 2EIMB 2EZOA 4MTFA 5IYDO 1R3KC 1TUEB 1QLEC 5H6RA 3OMNB 2QM8A 3SJQC 1NH2B 1W0KG 4FMTA 4CBCA 2OCCB 2W6IG 3B77A 3ETGA 1JX9A 4LBEC 5LHIA 3VOUA 1FXHA 1NR1A 3CXCU 1GKFA 3D3IA 3AG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEV A;  4XDK A;  1XL4 A;  3STZ C;  3SYP A;  4OXS A;  3GB7 C;  1R3J C;  2Y69 C;  1ORQ C;  4G28 B;  4RUF A;  1V55 C;  2AHY A;  3OGC C;  3SPH A;  5J9P C;  5E1A C;  3SYA A;  2WLI A;  3R65 A;  4XDJ A;  2DYS C;  2EIN C;  3LDD A;  5B3S C;  3K03 A;  2JK5 C;  4MVS A;  3BEH A;  3E83 A;  4HYO A;  4J9Y B;  4XDL A;  3E8F A;  2WLK A;  3LDE A;  4R8C A;  3OUS A;  1P7B A;  3OUF A;  4H33 A;  3SPC A;  3T1C A;  3AG3 C;  2EIL C;  2HG5 C;  3HPL C;  1R3I C;  2NLJ C;  3SPJ A;  4MS2 A;  3SYQ A;  4GX5 A;  3ZRS A;  3LUT B;  1BL8 A;  2P7T C;  2DYR C;  2QTO A;  3IGA C;  5EC2 C;  5EBL C;  5B1A C;  3RVY A;  4RUE A;  3JYC A;  3ZJZ A;  2WLM A;  2Q69 A;  3E86 A;  4QE7 A;  1G4Y B;  4GX2 A;  4MVZ A;  2Q67 A;  4PA9 A;  2EIJ C;  5IY5 C;  1XL6 A;  4HZ3 A;  1JVM A;  4RAI A;  2KB1 A;  4X89 A;  4PA4 A;  4MSW C;  4P2Z A;  1OCR C;  2AHZ A;  4PDL A;  4RO2 A;  4BW5 A;  2A0L A;  4I9W A;  2Q6A A;  4MVO A;  3SPG A;  2WLJ A;  3LDC A;  2DWE C;  4R7C A;  3TET A;  2HVJ C;  3F5W C;  4P9P A;  4H37 A;  3T4D A;  2EIM C;  2ATK C;  2BOC C;  1V54 C;  4ZBM A;  5KUK A;  3K0D A;  5EBM C;  4PDM A;  3FB7 C;  4MTO A;  3FB8 C;  3K04 A;  4PA3 A;  3ABK C;  5BZB A;  2K1E A;  5KUM A;  3EFF K;  4EKW A;  2EIK C;  2OCC C;  3K06 A;  4WFE A;  2A79 B;  4PDV A;  2IH1 C;  4PA6 A;  1ZWI C;  1M57 C;  4F4L A;  3RBZ A;  1OCO C;  4MW8 A;  3OR7 C;  1J95 A;  2ITD C;  2WLH A;  4MVR A;  4R6Z A;  3ASN C;  3FB5 C;  3LNM B;  1LNQ A;  3SYC A;  1KKD A;  3AG2 C;  2A9H A;  3SPI A;  4WFG A;  1M56 C;  4X88 A;  2HFE C;  3STL C;  1K4D C;  4JTC B;  3AG4 C;  3TCU A;  4P9O A;  3K0G A;  2WLI B;  2WLL B;  3F7V C;  5EK0 A;  3T4Z A;  2QKS A;  3PJS K;  3E8H A;  2X6C A;  2DWD C;  2ZXW C;  4MVQ A;  4MVM A;  4P30 A;  3RVZ A;  2HJF C;  3ABL C;  3AG1 C;  3X2Q C;  4WFH A;  1R3L C;  2Q68 A;  3E8G A;  4GX0 A;  2R9R B;  3KG2 A;  2ITC C;  4J9Z B;  5B1B C;  4PA7 A;  4WFF A;  3WG7 C;  5CBH A;  2IH3 C;  3FB6 C;  4DXW A;  3ABM C;  3UKM A;  2WLN A;  1OCC C;  4KFM A;  2X6A A;  3RW0 A;  4X8A A;  3E89 A;  3ASO C;  4GX1 A;  4LP8 A;  2WLL A;  1S5H C;  2ZD9 A;  3OR6 C;  3SYO A;  4MTF A;  2BOB C;  1K4C C;  4UUJ C;  5EBW C;  4MW3 A;  1R3K C;  4JTA B;  1QLE C;  3E8B A;  4MTG A;  3SJQ C;  3T2M A;  5EC1 C;  4CBC A;  4TWK A;  4MVU A;  4G27 B;  5CBG A;  4QNH B;  2H8P C;  4R50 A;  2X6B A;  4JTD B;  2HVK C;  4LBE C;  3K08 A;  1OCZ C;  3UM7 A;  3VOU A;  3F7Y C;  2W0F C;  5CBF A;  4LCU C;  3IFX A;  4PDR A;  4QE9 A; 
#chains in the Genus database with same CATH topology
 3QTC A;  3U0Z A;  4O4L A;  4DV6 O;  2OTJ V;  1S5J A;  4LFB O;  2B5U A;  2P4V A;  4WFA V;  3SGI A;  3R65 A;  1K5S A;  5FNV A;  1FYJ A;  1NVP B;  5KX5 B;  1YIT V;  3J80 N;  5H9C A;  4GZR B;  5JH7 B;  3C3S A;  2YI8 A;  3BCC H;  2PI5 A;  1GM9 A;  2DYR C;  3H1K H;  3S3X A;  1VF7 A;  3ZMV A;  4H13 B;  1FFX B;  4IGG A;  1LUV A;  1PL0 A;  4PDL A;  4MVO A;  3LDC A;  1SQV H;  4DV5 O;  2EUL A;  2IJK A;  3CEI A;  3JD4 A;  2AW9 A;  3FB7 C;  3RYC A;  1RFY A;  2PY5 A;  4B08 A;  1MZF A;  1DLB A;  2FYU H;  3EFF K;  1M93 A;  5LHG A;  2YUA A;  1AP5 A;  5BMV B;  2JEX A;  3K5O A;  4BW9 A;  4QPJ A;  2WLH A;  3CHX A;  3E35 A;  3RFR A;  2EX3 A;  4P9O A;  1PNL A;  3UO3 A;  3F7V C;  4DRX B;  1HW7 A;  4WFH A;  5LMN O;  2ITC C;  2CUG A;  3FB6 C;  3UQ8 A;  5J2T A;  1SER A;  2DQ0 A;  1V9P A;  3ASO C;  4X65 O;  3A8T A;  4TUY A;  5EBW C;  5CB4 A;  1FD9 A;  1VF5 B;  1XDC A;  2Q8V A;  3WB2 A;  1ENV A;  1BGY H;  2QR4 A;  4Z1M G;  4QNH B;  2QWQ B;  3UM7 A;  2PZS A;  4LF5 O;  2UXD B;  2R9I A;  3ETD A;  3ZN1 A;  4JV5 O;  4LCU C;  3W7W A;  3ZMU A;  4UVA A;  3HKC A;  4YY3 B;  4CC6 A;  3O65 A;  4DV2 O;  1QNM A;  1FXV A;  2QKC A;  1UPG A;  1Q82 W;  1RSO A;  1XRE A;  2DYS C;  2IJI A;  4AI8 A;  4DUZ B;  1BS3 A;  2VQE O;  4IYH A;  5DEC A;  4UCO A;  1NH2 D;  1T5E A;  1OCC B;  3QVN A;  4JI0 B;  1K92 A;  2BSK B;  2GV9 A;  4MTX A;  3JCU Z;  3H9V A;  3DTU B;  4IIJ B;  1QLE B;  2ZKO A;  5C8Y B;  4LF8 B;  2YS8 A;  4JYA B;  4BIO A;  1PPJ H;  4RO2 A;  1HWY A;  1K73 W;  4TUY B;  1JFF B;  1MG1 A;  5CB4 B;  3T4D A;  1PP9 H;  2K9P A;  4PA3 A;  2Q0O C;  3FFQ A;  4GUN A;  2IU3 A;  1WA8 B;  5KAI Z;  2EIN B;  2M6Y A;  1JPX A;  1PL4 A;  1J95 A;  4LF4 B;  4F6R A;  3SYC A;  5LGN A;  1K4D C;  1L1F A;  3N27 A;  2W0X A;  1RSO B;  1KUQ A;  3E22 A;  5FL7 G;  4D7S A;  1R1B A;  1BHB A;  2ZXW C;  1FAF A;  5LMU B;  2CGN A;  2ZNI A;  2FL4 A;  3OD4 A;  2R9R B;  1HNW B;  1TA8 A;  5IDJ A;  4W4K A;  3UKM A;  2UUA O;  3CRA A;  5GW7 A;  3E89 A;  2QDO A;  3OR6 C;  4DR2 O;  4DUY O;  4EB6 B;  2HHH B;  4I7Z B;  3SR2 C;  4X62 O;  5EC1 C;  3AG7 A;  2LO1 A;  3OTO B;  5BR8 O;  3H1I H;  1K5Q A;  3HKE B;  4I55 A;  3AK1 A;  5CBF A;  4GYC B;  4JYB A;  2ZQM A;  4HNA A;  4JI7 O;  1R3J C;  3OAA G;  2Y4T A;  3I56 V;  5EZY B;  2OTL V;  2AHY A;  4YXW G;  1W2B U;  5IJ0 B;  4LFA B;  4DV0 B;  1BE3 H;  4NR1 A;  3CC2 V;  4J9Y B;  4XDL A;  3E2E A;  1H8H G;  3AG1 B;  3D8C A;  1Y76 B;  4WBN A;  3JAK B;  4AIL C;  3SPJ A;  1YTF B;  2EJR A;  4DR3 B;  1SQX H;  4RUE A;  2GHY A;  5JCO C;  2F95 B;  2LP7 A;  3RYH A;  3QO7 A;  4I50 A;  4TOI A;  4X9Q A;  5DN6 G;  4YJ2 B;  4P2Z A;  1I0H A;  2N05 A;  4DR1 B;  4O4J A;  2IM9 A;  3KCX A;  2EIM C;  2QA4 V;  4FM0 A;  1FPO A;  1Z2G A;  4TV8 A;  4X1K B;  5BZB A;  1JJO A;  2N04 A;  3TK1 A;  1W59 A;  3ZRV A;  2OT5 A;  1FXK A;  3PN1 A;  2ZDI A;  3MD0 A;  3JAT A;  3FAV B;  3AG2 C;  4Q6G A;  3HKB A;  3P30 A;  2CTP A;  4FLV A;  1KD1 W;  4A5U B;  1AR1 B;  2JJ2 G;  2CTW A;  2DWD C;  2FTK A;  2E5L O;  4MVM A;  1L0L H;  2ILM A;  3I5D A;  2IBZ H;  1EM1 A;  2GUZ A;  3ZMZ A;  4QPK A;  3ABM C;  1XHZ A;  1JOY A;  1NQT A;  4DV1 B;  2PYJ A;  4L8J A;  3JAL B;  4B3S O;  1SA0 A;  4GX1 A;  4LP8 A;  4I5S A;  4ICG A;  4MW3 A;  3RYH B;  3C3T A;  4JTA B;  3CJH A;  3AEI A;  4MTG A;  4H0L B;  4TV9 B;  1FXK C;  1SQP H;  4FJC C;  5CBG A;  2UXC B;  5BY1 A;  2ZDI C;  3JAR A;  1QVG U;  4I9Q A;  1XOU A;  3T1H B;  4LFC O;  4BIZ A;  1XL4 A;  2P90 A;  3QF7 A;  2JJ1 G;  4CH4 A;  3L70 H;  3OGC C;  1RPR A;  4AQY O;  3SYA A;  4TQF A;  5F2V O;  1JQ0 A;  2CH7 B;  3LDD A;  1N36 O;  4LF9 O;  1E1Q G;  3X2Q B;  3LDE A;  1YI2 V;  2KQX A;  1S72 V;  4JI2 O;  3OUS A;  1P7B A;  3WG7 B;  3BA9 A;  2HJD A;  5J2U B;  1BQZ A;  2XAJ A;  5KHJ A;  1NT2 B;  1VQ9 V;  1WLE A;  2QTS A;  1BSM A;  5L3F A;  1SA0 B;  3K79 A;  4P9P A;  2NR5 A;  2Q4P A;  3P3P A;  3OM3 B;  3AK3 A;  2JGU A;  4FK5 C;  3K06 A;  3M7M X;  1IBL O;  1Y4M A;  1M9N A;  3K57 A;  3CCU V;  3LNM B;  4U3J A;  2RMK B;  1NZ6 A;  4WCE V;  1CXZ B;  4UCS A;  4Z2W A;  2EIL B;  5IJ9 B;  1SZT A;  1HNX B;  1HR0 B;  3OTF A;  1VMG A;  2QM7 A;  4B3R B;  4DV4 B;  3G6E V;  1P4R A;  1NI8 A;  2Y0I A;  1DF4 A;  2F66 C;  4P30 A;  3CMA V;  3RYI B;  4JI3 B;  3ZHR A;  4O2A A;  4ZHQ B;  3EXA A;  4WFF A;  2ETN A;  4KP4 A;  3WB1 A;  3QO8 A;  2Q9L A;  4FLT A;  3K9S A;  3RW0 A;  1IBK B;  3FYI B;  5LXT A;  4FLU A;  1S5H C;  2EZO A;  1R3K C;  2PUS A;  4DW1 A;  3SJQ C;  5A2Q N;  2OCC B;  2W6I G;  1D5A A;  1OV9 A;  5LHI A;  3VOU A;  1FXH A;  3CXC U;  1TUB A;  5IWA B;  2Y0P A;  2XT9 A;  1S5L Z;  3STZ C;  2WA3 A;  4IT5 A;  2P22 C;  4NTW A;  5CA1 B;  4GKK O;  3DXR A;  1SET A;  3SJA C;  3H1L H;  3E83 A;  3KCY A;  3JD0 A;  1ZL8 B;  2YXL A;  4O2B B;  5IYZ A;  1D5N A;  1SF9 A;  4J80 A;  4IHJ B;  2UU9 O;  2Z0A A;  2OWO A;  5EC2 C;  2YXY A;  3ZRW A;  1VQM V;  4CC5 A;  3JYC A;  2WLM A;  2EIJ C;  1XL6 A;  1Q6I A;  2IU0 A;  1E79 G;  1R6T A;  1YSC A;  2LGQ A;  5LXT B;  1FFT B;  3CE2 A;  5LA6 B;  1GM8 A;  3IC9 A;  3N2G B;  4H37 A;  4NVP A;  4JZ2 A;  1KBH A;  3FKS G;  3SDL A;  1EFR G;  4OPH A;  1NTM H;  2IW5 A;  1Q81 W;  1ZLZ A;  4YIP A;  1M57 C;  1OCO C;  3H1J H;  5B1N A;  1GH6 A;  1GAX A;  2KG7 A;  2E3C A;  3RN4 A;  1LR1 A;  2LGW A;  4B3M B;  1KB9 F;  1YF2 A;  3ABL C;  1XBL A;  2Q68 A;  1Z5W A;  4CZZ A;  1UJW B;  2UXB O;  1H2G A;  2A06 H;  2UUC B;  2IH3 C;  2X6A A;  4HBN A;  4JI4 O;  2F4V B;  4X20 B;  1AI4 A;  5EYP A;  1V54 B;  5ITZ B;  5L3D A;  1S76 D;  1K9M W;  5TIS Z;  5A9G A;  4DR5 O;  2YIA A;  2X6B A;  3DC6 A;  2ZE5 A;  2BCC H;  1H8E G;  1YJW V;  3BHP A;  1XMO B;  1QBZ A;  4LF7 B;  4JAS A;  1GO3 F;  3ETE A;  1O9G A;  1J5E B;  2HLD G;  2A3Q A;  2B1I A;  2QEX V;  3ZN0 A;  1XMQ O;  1R6N A;  3JD1 A;  2CE4 A;  4DV3 O;  3BA8 A;  3ZBH A;  1IZ3 A;  1N32 O;  1NU1 H;  4QE7 A;  3W7U A;  4LH6 A;  3ETQ A;  1GN6 A;  1ZAU A;  2DJV A;  5IT9 N;  5CA0 B;  1MZE A;  3CD6 V;  3WU2 Z;  4DW0 A;  1N33 B;  4UXN A;  3FD9 A;  1OHH G;  4JI5 B;  2Y4U A;  1Q6U A;  4I9W A;  2BTQ A;  1VQL V;  4JI6 B;  1XNR O;  1I94 B;  2EJ7 A;  3UCS C;  5KUK A;  1M1K W;  1XHX A;  2ZE7 A;  2Q0A A;  3G71 V;  4DV7 O;  4CS3 A;  4PV1 B;  4NXN O;  1ZWI C;  5B1O A;  2B9Z A;  3DC5 A;  1HNZ B;  1FJG B;  3DGE A;  3T1Y B;  2A9H A;  1SRY A;  1H2S B;  2JVD A;  4JTC B;  1Y67 A;  2AZ2 A;  5KHG A;  3OT7 A;  4JAA A;  2XOK G;  2DYR B;  1N34 O;  1KP3 A;  1QLN A;  4J7J A;  3RYF A;  4FZ1 A;  4GCZ A;  3CC4 V;  1BT8 A;  2LQT A;  4GKJ B;  2NN4 A;  3K9A A;  1QVF U;  3G67 A;  1RP3 B;  2KSD A;  4B3T B;  1YCI A;  1Q8I A;  2P06 A;  2WLL A;  1GRJ A;  2R9A A;  4X1I A;  1S3J A;  2QWO B;  4O4L B;  5JJJ B;  2ZR3 A;  2VQF B;  4Q20 A;  2FB5 A;  5FNV B;  1NS1 A;  1MAB G;  4L87 A;  1RM1 C;  3VQY A;  2PYL A;  1TAE A;  3J81 N;  1I7F A;  5J9P C;  3ZHT A;  1X4T A;  5B3S C;  4DR4 B;  4IL6 Z;  1YHQ V;  1SZX A;  4GT1 A;  2RNB A;  4UCU A;  2P5O A;  2P7T C;  2JRI A;  3ASO B;  4YHH B;  3RYC B;  1YIJ V;  3CCQ V;  1F4M A;  3JCZ A;  2UUB B;  1JA8 A;  1WPB A;  4X89 A;  1OCR C;  1P7G A;  4CH5 A;  2YI9 A;  2ZIO A;  4ZOL A;  1PNM A;  3G4S V;  3LSS A;  4PDM A;  4MTO A;  2ZM6 B;  4EKW A;  4FFB A;  5D5P A;  4PDV A;  1TVK A;  2DYS B;  5JQG A;  5D5Q A;  1LNQ A;  3JAS A;  2EZP A;  4YJ3 A;  3STL C;  1AP6 A;  5J2T B;  2YIC A;  1F7Y A;  2C2A A;  2UXD O;  2MW2 B;  1DTO A;  5L3C A;  3T4Z A;  4JAU A;  4YY3 O;  1VQK V;  2XAS A;  2UXX A;  5AG2 A;  3VBB A;  1F51 A;  3S3W A;  2RCV A;  1PV0 A;  4PI2 A;  4DXW A;  2D2C B;  4DUZ O;  3HKC B;  2V4D A;  3CCM V;  4LNU A;  3JAM N;  3K5N A;  4JI0 O;  4FLY A;  4MVU A;  2QKA A;  3OE7 G;  3EVK A;  2HVK C;  3JSL A;  1K97 A;  1G1X B;  4LF8 O;  3F5T A;  1NJI W;  4JYA O;  1YJ9 V;  4PJ0 Z;  1DF5 A;  4LF6 B;  3K5M A;  1VQN V;  3IC7 A;  1TVK B;  1QCE A;  2ZXW B;  1BQ0 A;  4FIP C;  5JCO A;  4K8Z A;  1HP8 A;  3SPC A;  5L3G A;  3HPL C;  5JVD A;  1BCC H;  2LFS A;  1YJN V;  2UXN A;  4LF4 O;  3IGA C;  1K7D A;  5LGU A;  3ZJZ A;  1AJQ A;  1KU9 A;  4I0X A;  2HR3 A;  4X66 B;  1KYO F;  1H2K A;  2IJJ A;  4RAI A;  3NR7 A;  3ZHU A;  2QE7 G;  5KHH A;  4F6R B;  2JGD A;  5LMU O;  3C90 A;  4AHC A;  1HNW O;  1PNK A;  5LYJ A;  2GBO A;  3Q4H A;  4JAV A;  1Q43 A;  3K0D A;  3JD2 A;  3B8N A;  3E22 B;  1R6K A;  1WPX A;  3B4S A;  2HHH O;  1SQF A;  3UT5 A;  1EN5 A;  4HAM A;  1NR7 A;  2ZE6 A;  4ASU G;  1YXB A;  3CP1 A;  5B5E Z;  1WP7 A;  3OTO O;  2GTS A;  3JSN A;  1VAR A;  3L71 H;  1COW G;  4UFZ A;  1VQ8 V;  4E4E A;  1XEQ A;  3OGI B;  4K8X A;  2WPD G;  1IVS A;  4I55 B;  4LFA O;  4DV0 O;  3A0B Z;  2WLN A;  4ZKI A;  1IUR A;  1VQO V;  4HNA B;  4RQF A;  2EIM B;  1A32 A;  1TUE B;  1NH2 B;  3RGB A;  4FMT A;  4CBC A;  2E75 B;  4DR3 O;  3B77 A;  5LOV A;  5GTH Z;  1JX9 A;  4LBE C;  1N0N A;  1NR1 A;  4WBN B;  3IFX A;  3D3I A;  3MAQ A;  5EBL C;  2YEV A;  1EN4 A;  3CYO A;  4QE9 A;  3AG2 B;  2QWN B;  3AK2 A;  2Y69 C;  1IXB A;  4DR1 O;  1KKC A;  1V55 C;  1AI7 A;  1ARO P;  1WP8 A;  1Y6X A;  5E1A C;  4UV9 A;  2LJ2 A;  2XTA A;  4UCV A;  2PTM A;  2OIE A;  3CCV V;  3CCR V;  4I50 B;  1GN3 A;  4TSF G;  3GWK C;  4DK1 A;  4W4L A;  3SYQ A;  1ROP A;  3ABM B;  4O4J B;  1JR9 A;  2XHB A;  5B1A C;  4TV8 B;  3L75 H;  1NTZ H;  1SES A;  1ZSP A;  1FXK B;  2KB1 A;  1ZX3 A;  2HEP A;  3ZRX A;  3JAT B;  2A0L A;  2R70 A;  4R7C A;  3TET A;  1XIL A;  3HKB B;  1AVM A;  1WB7 A;  4RWU A;  2PF4 E;  2VRZ A;  4O4I A;  4DV1 O;  5KUM A;  5DED A;  2EIK C;  4O4H A;  1L8D A;  3FYE B;  3B8M A;  4MW8 A;  4PD4 F;  3HKD A;  1M5I A;  3ASN C;  2UXC O;  2GUZ B;  3JD3 A;  3AG4 C;  3TCU A;  1GMG A;  3ZHV A;  2XUM A;  3PJS K;  3T1H O;  2X6C A;  4J10 A;  5LP6 A;  3CJH B;  4U7O A;  1OJH A;  1VQ6 V;  2Z5U A;  3KG2 A;  2DMX A;  2AZ0 A;  1SKV A;  1AJP A;  5FPR A;  5B1B C;  3JAR B;  4UV8 A;  1UFI A;  1LUW A;  3IJ4 A;  3A2F A;  4UCT A;  2LW7 A;  2YDE A;  3JAW A;  1K4C C;  4ZI7 A;  3L74 H;  4DR7 B;  2QWR B;  3ZED A;  3T2M A;  2L35 A;  3D36 A;  4G27 B;  2Q7E A;  2F93 B;  2DN9 A;  3LSQ A;  3CS5 A;  4BR6 A;  4PDR A;  3CSX A;  2XAG A;  4ABM A;  4WFB V;  3M8A A;  4OXS A;  5GTI Z;  4JI1 B;  4OX9 B;  2OIG A;  5K1X A;  3J7A U;  3CRM A;  2PI4 A;  5LP6 C;  4KXR A;  4DR6 B;  3CME V;  2JK5 C;  4MVS A;  3BEH A;  1Y74 A;  3N2K A;  2CTQ A;  3KZI Z;  2D3O W;  2Z3Y A;  3T1C A;  3OUF A;  3BFR A;  3ZRS A;  5CA3 A;  2RQ6 A;  2Q73 A;  4NTY A;  1PKX A;  5C93 A;  1Q3E A;  1HNX O;  1HR0 O;  3D36 C;  2Q67 A;  1KP2 A;  5IY5 C;  4B3R O;  1D2D A;  4DV4 O;  4KUM A;  4PA4 A;  4JI3 O;  4U3J B;  5H5N A;  3L72 H;  1K8A W;  4JI1 O;  4I4T A;  3OEE G;  3ABK C;  1IBK O;  2DOS A;  2YXH A;  4JYC A;  3CCJ V;  1SQG A;  5FPO A;  2N74 A;  4O2A B;  4MVR A;  5GON A;  2G38 A;  5IYC O;  3ZX6 A;  3SPI A;  2RDC A;  4J42 A;  1M56 C;  3CXH F;  1G8M A;  3ABU A;  4X64 B;  4NB5 A;  5IWA O;  4JI8 B;  2QKS A;  2DE0 X;  2CTR A;  1AB3 A;  4N23 A;  3N2K B;  1I5Y A;  5LGT A;  4UVB A;  2ADQ B;  1WJZ A;  2EIJ B;  3K5L A;  4J9Z B;  3U10 A;  4PA7 A;  2GDS A;  1TUB B;  4KL1 A;  3MHS C;  3SYO A;  2M7W A;  2YID A;  3E8B A;  2WSS G;  3APQ A;  1O9H A;  3DXR B;  3ZMT A;  2ZIM A;  3CWB H;  1M57 B;  4FFK A;  1OCZ C;  1OCO B;  4X1Y A;  3F7Y C;  2XND G;  5IYZ B;  1GM7 A;  1ORQ C;  2XAQ A;  1SQB H;  4BWA A;  3ZRW B;  2WLI A;  4PHZ A;  3VQX A;  1P84 F;  4J41 A;  3A0H Z;  3AG3 C;  1R3I C;  2NLJ C;  5EIB C;  3CCE V;  4NXM B;  3THO A;  2QTO A;  1XNQ B;  1B6Q A;  1SQQ H;  1ZTE A;  4N21 A;  2GSM B;  2KKW A;  2JIZ G;  3ZMS A;  2JEU A;  4PEL A;  1IBM B;  1Q90 D;  1ZUQ A;  4GX2 A;  4K0K B;  1CPY A;  4PA9 A;  4B3M O;  3HR0 A;  5KX5 A;  4FM1 A;  4KHP B;  1FKA O;  1AI6 A;  1YVW A;  4F6E A;  2P4K A;  5JH7 A;  4DV6 B;  4BIU A;  2WLJ A;  4LFB B;  1URF A;  2KG7 B;  2UUC O;  4JYY A;  1RPO A;  2R72 A;  4DYL A;  1FFX A;  2F4V O;  3H01 A;  2DQ3 A;  4R6Z A;  2ZT9 B;  2LFR A;  3ICX A;  1GK9 A;  3G80 A;  4JPR A;  2Q7H A;  4TT3 G;  2WLI B;  1XMO O;  5EK0 A;  5EYP B;  3E8H A;  1IX9 A;  4UCR A;  4LF7 O;  4E2L A;  5BMV A;  3B40 A;  3BPZ A;  1N4C A;  2XAH A;  1P49 A;  4DV5 B;  3O9O A;  5HFM A;  2CGO A;  4KFM A;  1VIB A;  2FML A;  1J5E O;  2Q5Z A;  1NBM G;  3ABT A;  1JCH A;  2ZD9 A;  4RQE A;  4DRX A;  3W7S A;  4FLX A;  2JS3 A;  2CDY A;  3CC7 V;  2YIB D;  2W0F C;  5IYB O;  5KHI A;  3TXQ A;  1N33 O;  1EN6 A;  5IE9 A;  3SYP A;  4JI5 O;  5LMN B;  1W0J G;  4JI6 O;  1I94 O;  1U97 A;  4FM2 A;  3K03 A;  4U3F H;  1Q86 W;  3E8F A;  4PI0 A;  3VQV A;  4X65 B;  3G6B A;  1K3E A;  2BTQ B;  1HNZ O;  1FJG O;  3T1Y O;  1VF6 A;  1MOF A;  2Q69 A;  4DO2 A;  3QO5 A;  1G4Y B;  4LF5 B;  4JV5 B;  4HZ3 A;  5CN0 A;  4DV2 B;  4UB6 Z;  4FLW A;  1OZ0 A;  2DWE C;  2HVJ C;  4GKJ O;  1RM1 B;  2BSK A;  2ZIN A;  4ZBM A;  3ML0 A;  3BAA A;  1MMM A;  2DW4 A;  4IIJ A;  2VQE B;  4B3T O;  1AIL A;  5C8Y A;  3RYF B;  5B3S B;  1YTF D;  1BHA A;  2ITD C;  3FB5 C;  4MT8 A;  1JFF A;  2VQF O;  2HFE C;  2E74 B;  1VF6 C;  3K0G A;  1JJ2 U;  2WLL B;  1GN4 A;  4X1I B;  5LBQ A;  4QJF B;  1WA8 A;  2ARH A;  4B7K A;  3CB2 A;  1R3L C;  5H6Q A;  2RJZ A;  1B3Q A;  1CP9 A;  1I08 A;  1Q7Y W;  4DR4 O;  1OCC C;  2Q7G A;  1OCR B;  5H2F Z;  1VQ7 V;  4LH7 A;  2YIB A;  1MNG A;  1QLE C;  5H6R A;  3OMN B;  1W0K G;  2LW1 A;  4YHH O;  3ETG A;  1NTK H;  2UUB O;  4EEQ A;  3GVM A;  1GKF A;  4J7K A;  3TXS A;  1L0N H;  3GB7 C;  4EB6 A;  5LL6 Y;  3A0R A;  1H2N A;  2EIN C;  1I5X A;  2UUA B;  2ZM6 O;  3HKE A;  4R8C A;  4DR2 B;  4DUY B;  4MS2 A;  3ZHQ A;  1VEW A;  3QG5 A;  4ZOL B;  4X62 B;  3K59 A;  5EZY A;  3TGU H;  4WF9 V;  3OMA B;  5IJ0 A;  1YZB A;  5BR8 B;  1CEZ A;  3WB0 A;  1US6 A;  4FFB B;  1QR9 A;  1WB8 A;  4J11 A;  1Y76 A;  1JVM A;  4JI7 B;  3JAK A;  2ADP A;  2PGG A;  3CPW U;  4MSW C;  5JQG B;  2AHZ A;  2V1D A;  4ZIB A;  4BW5 A;  3JAS B;  4YJ3 B;  4FVM A;  4QGP A;  3F5W C;  2VS0 A;  2WAM A;  2A7W A;  3SJC C;  2K1E A;  4LR3 A;  2A79 B;  2IH1 C;  5LHH A;  2EBO A;  4PA6 A;  4F4L A;  5JJE B;  2YC0 A;  4YJ2 A;  1KKD A;  1JMK C;  2X7R B;  1QQC A;  4QIW F;  4D7T A;  4X1K A;  5JWP A;  2QGN A;  1XI1 A;  4LNU B;  1PD3 A;  4MVQ A;  4LF6 O;  5KAF Z;  1B06 A;  4UVC A;  3AG1 C;  3FAV A;  1TGO A;  5KMG A;  3OMI B;  1R73 A;  3BAB A;  2B1G A;  2H3O A;  1DK1 A;  1KMI Z;  2O57 A;  3BY6 A;  4D6T H;  4TWK A;  1Q5O A;  2H8P C;  3K08 A;  2QJ1 A;  4X66 O;  3L9D A;  5JJN B;  3JAL A;  2QSA A;  5JVD B;  3OFN G;  5FLX N;  2E5L B;  1MSD A;  4G28 B;  1F23 A;  2P6J A;  3SPH A;  4NYK A;  1EZV H;  4TV9 A;  4XDJ A;  4I0X B;  2MK3 A;  4BAY A;  4HYO A;  2XAF A;  4NTX A;  4B3S B;  5KLV H;  1S77 D;  2F23 A;  4TQD A;  3BVO A;  2JGD B;  3LUT B;  4EFB A;  5LYJ B;  3D3Q A;  3Q4H B;  4OGQ B;  3WFV A;  2CH7 A;  3E86 A;  4GLX A;  1PM9 A;  5KMG B;  1AI5 A;  4LFC B;  2VWJ A;  1M4U A;  3UT5 B;  2ZE8 A;  3MHH C;  4FPP A;  5J2U A;  5DM6 V;  1AR4 A;  4AQY B;  2BOC C;  1N36 B;  4LF9 B;  1QR8 A;  1FS0 G;  2Y69 B;  5K1P A;  3FB8 C;  3K04 A;  2AXT Z;  3RWR D;  1V55 B;  4JI2 B;  1G6U A;  3QNE A;  1N0J A;  3OEH G;  3B2E E;  3OR7 C;  4K3A A;  1Z5V A;  2NNU A;  5CMU A;  2JS5 A;  1YDX A;  4WFG A;  3SJB C;  4LC1 A;  3R66 A;  3I55 V;  4CS4 A;  4OPA A;  4FZ0 A;  3GWO A;  5B1A B;  5KA5 A;  1VQ4 V;  2HJF C;  3X2Q C;  2OCH A;  3E8G A;  5LOV B;  3WG7 C;  5CBH A;  2ZNJ A;  1H38 A;  2E76 B;  1S0V A;  3CCL V;  4C7U A;  1EBO A;  5IJ9 A;  1U96 A;  1KC8 W;  2YEV B;  1F4N A;  4UUJ C;  2BOB C;  2F1M A;  1M90 W;  1IBL B;  3BRC A;  3RYI A;  1WNS A;  3CRR A;  1KEC A;  2BTO A;  4JF3 A;  2EIK B;  4ZHQ A;  2F43 G;  2ZCE A;  4JTD B;  4R50 A;  3ZCC A;  1K33 A;  3ASN B;  2L6L A;  1DGS A;  2VWK A;  2WA4 A;  4EFE A;  2FKX A;  2BE3 A;  3AG4 B;  3EHB B;  2RN9 A;  2Y48 A;  1WN7 A;  1Q6H A;  3KKY A;  2ODM A;  1MA1 A;  1WAZ A;  2WLK A;  4LWS A;  4H33 A;  5E79 Z;  3K3W A;  5EIB D;  5B1B B;  2EIL C;  5BXZ A;  2YSU B;  1QHT A;  5CA1 A;  4O4I B;  2JDI G;  2HKO A;  3B09 A;  4MVZ A;  4O4H B;  3FX7 A;  2CAZ C;  1ZL8 A;  4O2B A;  2QWP B;  5B66 Z;  4IHJ A;  3K58 A;  1BMF G;  3HKD B;  5L3E A;  4DK0 A;  1SC5 B;  4GKK B;  4CS2 A;  3LNN A;  4JGS A;  1B04 A;  2OCC C;  4G2K A;  5LP6 B;  4DR7 O;  4J7Z A;  2UU9 B;  3RBZ A;  1AJN A;  1HDJ A;  1E1R G;  3UO2 A;  5LA6 A;  3N2G A;  4X88 A;  3VQW A;  4H44 B;  3IAY A;  4UB8 Z;  1K34 A;  4CH6 A;  2W6J G;  4CH3 A;  3JAW B;  4ZI7 B;  3HB3 B;  4FLZ A;  1NVP D;  4OX9 O;  4LWS B;  2QM4 A;  4GX0 A;  5IY5 B;  4XBF A;  3U11 A;  4DR6 O;  1KQS U;  3RT3 C;  2OYQ A;  2HP8 A;  1BZK A;  3P32 A;  3ZHS A;  3ABK B;  3CRQ A;  1XQ8 A;  5L3B A;  3APO A;  1Y74 B;  3ZS8 C;  4X20 A;  1VQ5 V;  4XDK A;  1M56 B;  4RUF A;  5ITZ A;  1XUQ A;  3LSU A;  2UXB B;  4YIO A;  3OW2 U;  3CRC A;  1N8R W;  3DSQ A;  1YEW A;  4JI4 B;  2HG5 C;  4IYI A;  1AR5 A;  1GN2 A;  4GX5 A;  3NXS A;  2X0L A;  1BL8 A;  3RVY A;  4B7E A;  4DR5 B;  1VQP V;  4I4T B;  2IJH A;  4X64 O;  4U7N A;  4JI8 O;  3H1H H;  4JZG A;  2H94 A;  1Y66 A;  5GON B;  1QU7 A;  1OCZ B;  2Q6A A;  3SPG A;  3ABL B;  2ATK C;  1V54 C;  3TJT A;  2AGA A;  2ZR2 A;  1X59 A;  2WWW A;  1IDS A;  1MSW D;  3W7X A;  5CA0 A;  3CCS V;  4WFE A;  1H2M A;  1XMQ B;  1GTO A;  3L73 H;  4K35 A;  1EZJ A;  1H2L A;  4DV3 B;  1SS3 A;  1VP7 A;  2GTA A;  5KA6 A;  1IXM A;  1N32 B;  3AG3 B;  4NKG B;  3W7T A;  3MDS A;  1THZ A;  5KHK A;  3ZIA G;  5HFL A;  3P3N A;  3RVZ A;  2V7Q G;  2P67 A;  3CX5 F;  1XNR B;  1NKD A;  4X1Y B;  4X8A A;  4DV7 B;  2CK3 G;  4MTF A;  4NXM O;  5IYD O;  4NXN B;  2QM8 A;  1XNQ O;  4Z1V A;  1IBM O;  4K0K O;  3M99 B;  5EBM C;  4KHP O;  1N34 B; 
#chains in the Genus database with same CATH homology
 2YEV A;  3STZ C;  3GB7 C;  2Y69 C;  2OTJ V;  3A0R A;  1V55 C;  1AI7 A;  1ARO P;  1SET A;  2B5U A;  5E1A C;  3R65 A;  4WFA V;  1K5S A;  2EIN C;  4UV9 A;  1I5X A;  3CCV V;  3E83 A;  4R8C A;  1NVP B;  3JD0 A;  3CCR V;  4TSF G;  1YIT V;  5H9C A;  3SYQ A;  4MS2 A;  1ROP A;  3ABM B;  2PI5 A;  1GM9 A;  5EC2 C;  2DYR C;  5EBL C;  5B1A C;  3ZRW A;  1VQM V;  4WF9 V;  3JYC A;  3ZMV A;  2WLM A;  3OMA B;  1SES A;  1CEZ A;  2EIJ C;  1QR9 A;  1XL6 A;  1JVM A;  1FXK B;  2KB1 A;  2IU0 A;  1E79 G;  3CPW U;  4MSW C;  1PL0 A;  1YSC A;  2AHZ A;  2V1D A;  4PDL A;  3ZRX A;  4BW5 A;  2A0L A;  4MVO A;  1FFT B;  3LDC A;  4R7C A;  3TET A;  1GM8 A;  3F5W C;  4H37 A;  2IJK A;  3JD4 A;  3FKS G;  2WAM A;  3FB7 C;  1EFR G;  2K1E A;  1DLB A;  3EFF K;  5KUM A;  5LHG A;  2EIK C;  2IW5 A;  1Q81 W;  2A79 B;  2IH1 C;  3FYE B;  5LHH A;  2EBO A;  2JEX A;  1M57 C;  3B8M A;  4PA6 A;  4F4L A;  1OCO C;  4MW8 A;  5B1N A;  4QPJ A;  2WLH A;  3ASN C;  1KKD A;  3E35 A;  3JD3 A;  3AG4 C;  2X7R B;  4QIW F;  1GMG A;  4P9O A;  1PNL A;  3TCU A;  3F7V C;  3PJS K;  2X6C A;  1PD3 A;  4MVQ A;  4U7O A;  3ABL C;  4UVC A;  3AG1 C;  1VQ6 V;  4WFH A;  2Q68 A;  2Z5U A;  3KG2 A;  4CZZ A;  1AJP A;  2ITC C;  1UJW B;  1H2G A;  5B1B C;  4UV8 A;  2IH3 C;  3FB6 C;  3OMI B;  1R73 A;  1SER A;  2X6A A;  2DQ0 A;  2B1G A;  3ASO C;  1AI4 A;  3BY6 A;  5EBW C;  1K4C C;  1V54 B;  5L3D A;  1S76 D;  1ENV A;  3T2M A;  1K9M W;  3D36 A;  4TWK A;  4G27 B;  4Z1M G;  4QNH B;  2H8P C;  2X6B A;  3K08 A;  3UM7 A;  3LSQ A;  1H8E G;  2R9I A;  3ETD A;  1YJW V;  3ZN1 A;  4LCU C;  3W7W A;  3ZMU A;  4UVA A;  4PDR A;  4WFB V;  2XAG A;  1QBZ A;  3OFN G;  4OXS A;  4JAS A;  1FXV A;  1GO3 F;  4G28 B;  1F23 A;  1Q82 W;  2P6J A;  2PI4 A;  3SPH A;  3ETE A;  4XDJ A;  2DYS C;  2MK3 A;  4BAY A;  3CME V;  2IJI A;  2JK5 C;  4MVS A;  3BEH A;  4HYO A;  2XAF A;  2HLD G;  2B1I A;  2D3O W;  1S77 D;  2Z3Y A;  3T1C A;  3ZN0 A;  3OUF A;  2QEX V;  1R6N A;  1NH2 D;  3ZRS A;  1OCC B;  3JD1 A;  3LUT B;  5CA3 A;  1K92 A;  1PKX A;  3WFV A;  5C93 A;  4MTX A;  3E86 A;  4QE7 A;  3W7U A;  3DTU B;  2Q67 A;  1QLE B;  1KP2 A;  5IY5 C;  3CD6 V;  1AI5 A;  4UXN A;  4KUM A;  4PA4 A;  1OHH G;  4RO2 A;  1HWY A;  3MHH C;  4I9W A;  1K73 W;  4FPP A;  1K8A W;  5DM6 V;  1VQL V;  1MG1 A;  3T4D A;  2BOC C;  5KUK A;  1M1K W;  1QR8 A;  5EBM C;  1FS0 G;  2Y69 B;  3OEE G;  3FB8 C;  3K04 A;  4PA3 A;  3ABK C;  4JYC A;  3G71 V;  1V55 B;  3CCJ V;  3QNE A;  3OEH G;  2IU3 A;  1ZWI C;  2EIN B;  1JPX A;  5B1O A;  3OR7 C;  1J95 A;  4MVR A;  3SYC A;  2NNU A;  5IYC O;  3DGE A;  5CMU A;  2A9H A;  3SPI A;  5LGN A;  4WFG A;  1M56 C;  1SRY A;  1K4D C;  4LC1 A;  1L1F A;  4JTC B;  1G8M A;  3ABU A;  3I55 V;  2XOK G;  5FL7 G;  2DYR B;  2QKS A;  5B1A B;  3GWO A;  5KA5 A;  1KP3 A;  4N23 A;  1VQ4 V;  1QLN A;  1I5Y A;  2ZXW C;  5LGT A;  1BHB A;  3IFX A;  4GCZ A;  3CC4 V;  2HJF C;  3X2Q C;  4UVB A;  3E8G A;  2EIJ B;  2R9R B;  3CYO A;  4J9Z B;  4PA7 A;  3WG7 C;  5CBH A;  5IDJ A;  3K9A A;  3UKM A;  1H38 A;  1S0V A;  1QVF U;  3CCL V;  5GW7 A;  1EBO A;  3E89 A;  1KC8 W;  2YEV B;  3MHS C;  1F4N A;  2WLL A;  3OR6 C;  3SYO A;  4UUJ C;  2BOB C;  2M7W A;  1S3J A;  1M90 W;  3E8B A;  2WSS G;  2ZR3 A;  5EC1 C;  1KEC A;  4JF3 A;  2EIK B;  3ZMT A;  4Q20 A;  2F43 G;  4R50 A;  4JTD B;  3ZCC A;  1K33 A;  1K5Q A;  1M57 B;  1OCZ C;  1OCO B;  3F7Y C;  2XND G;  5CBF A;  1MAB G;  4L87 A;  3ASN B;  4JYB A;  2ZQM A;  1RM1 C;  1GM7 A;  1R3J C;  3OAA G;  1ORQ C;  3AG4 B;  2XAQ A;  3I56 V;  3EHB B;  2OTL V;  2AHY A;  2Y48 A;  3ZRW B;  5J9P C;  4YXW G;  1W2B U;  2WLI A;  5B3S C;  3CC2 V;  4J9Y B;  4XDL A;  1YHQ V;  3E2E A;  1H8H G;  2WLK A;  3AG1 B;  4GT1 A;  4H33 A;  3K3W A;  3AG3 C;  5B1B B;  2EIL C;  1R3I C;  2NLJ C;  3SPJ A;  3CCE V;  2YSU B;  2P7T C;  2QTO A;  1YTF B;  3ASO B;  1B6Q A;  2EJR A;  4N21 A;  2GSM B;  4RUE A;  2JIZ G;  3ZMS A;  2GHY A;  2JEU A;  4PEL A;  2JDI G;  2HKO A;  1YIJ V;  4MVZ A;  4GX2 A;  3CCQ V;  1F4M A;  1CPY A;  2LP7 A;  4PA9 A;  3JCZ A;  3QO7 A;  1AI6 A;  4X89 A;  5DN6 G;  4P2Z A;  1BMF G;  1OCR C;  5L3E A;  4BIU A;  2WLJ A;  3M99 B;  1PNM A;  2EIM C;  3G4S V;  2QA4 V;  4JGS A;  3LSS A;  1RPO A;  4PDM A;  4MTO A;  5BZB A;  4EKW A;  2OCC C;  3TK1 A;  3H01 A;  3ZRV A;  4G2K A;  2OT5 A;  4PDV A;  1FXK A;  2DYS B;  3RBZ A;  1AJN A;  2ZDI A;  2DQ3 A;  3MD0 A;  4R6Z A;  1LNQ A;  1E1R G;  2EZP A;  3AG2 C;  2LFR A;  3P30 A;  4X88 A;  3STL C;  1GK9 A;  4JPR A;  4TT3 G;  2C2A A;  1KD1 W;  1DTO A;  5L3C A;  1K34 A;  2WLI B;  3T4Z A;  1AR1 B;  5EK0 A;  2W6J G;  4JAU A;  2JJ2 G;  3E8H A;  1VQK V;  2DWD C;  2FTK A;  2XAS A;  4E2L A;  3HB3 B;  4MVM A;  1NVP D;  2UXX A;  3VBB A;  1F51 A;  4GX0 A;  5IY5 B;  2XAH A;  4XBF A;  3ZMZ A;  4QPK A;  4DXW A;  3ABM C;  5HFM A;  1JOY A;  1KQS U;  1NQT A;  4KFM A;  4GX1 A;  4LP8 A;  3ABT A;  1NBM G;  1JCH A;  2ZD9 A;  4RQE A;  4I5S A;  4MW3 A;  3CCM V;  4JTA B;  3P32 A;  3AEI A;  4MTG A;  3ABK B;  3W7S A;  1FXK C;  4MVU A;  4FJC C;  5CBG A;  3OE7 G;  5L3B A;  2ZDI C;  2HVK C;  1QVG U;  1K97 A;  3CC7 V;  2W0F C;  5IYB O;  1VQ5 V;  4BIZ A;  4XDK A;  1XL4 A;  2P90 A;  1M56 B;  3SYP A;  1NJI W;  1YJ9 V;  1DF5 A;  4RUF A;  1VQN V;  3IC7 A;  2JJ1 G;  3OGC C;  1W0J G;  1RPR A;  3SYA A;  1QCE A;  1JQ0 A;  3LDD A;  3OW2 U;  3K03 A;  2ZXW B;  1E1Q G;  1N8R W;  1Q86 W;  3E8F A;  3X2Q B;  3LDE A;  4FIP C;  1YI2 V;  1S72 V;  3OUS A;  1P7B A;  3SPC A;  5L3G A;  2HG5 C;  3HPL C;  3WG7 B;  4GX5 A;  2LFS A;  1YJN V;  3NXS A;  1K3E A;  2UXN A;  2X0L A;  1BL8 A;  3IGA C;  2XAJ A;  3RVY A;  1K7D A;  5LGU A;  1MOF A;  3ZJZ A;  1AJQ A;  1VQP V;  2Q69 A;  1VQ9 V;  2HR3 A;  1WLE A;  4DO2 A;  3QO5 A;  1G4Y B;  2IJH A;  4HZ3 A;  4U7N A;  5L3F A;  2IJJ A;  4RAI A;  5CN0 A;  2QE7 G;  2H94 A;  1Y66 A;  1OCZ B;  3K79 A;  2Q6A A;  3SPG A;  1OZ0 A;  2DWE C;  3ABL B;  2HVJ C;  1PNK A;  4P9P A;  2ATK C;  1RM1 B;  1V54 C;  3OM3 B;  2ZR2 A;  4JAV A;  4ZBM A;  2WWW A;  3K0D A;  1MSW D;  3ML0 A;  3JD2 A;  3B8N A;  2DW4 A;  1R6K A;  3W7X A;  4FK5 C;  3K06 A;  3CCS V;  4WFE A;  1WPX A;  5B3S B;  1YTF D;  1GTO A;  1Y4M A;  1M9N A;  1BHA A;  2ITD C;  1EZJ A;  3CCU V;  3FB5 C;  3LNM B;  4MT8 A;  4HAM A;  4WCE V;  1NR7 A;  4ASU G;  5KA6 A;  1IXM A;  2HFE C;  3AG3 B;  3CP1 A;  2EIL B;  1SZT A;  3W7T A;  3K0G A;  1JJ2 U;  2QM7 A;  2WLL B;  1THZ A;  3G6E V;  1P4R A;  1COW G;  5LBQ A;  4QJF B;  1VQ8 V;  3ZIA G;  5HFL A;  1DF4 A;  4P30 A;  3RVZ A;  2V7Q G;  3CMA V;  2P67 A;  1R3L C;  2WPD G;  4QE9 A;  5H6Q A;  1CP9 A;  4WFF A;  1NKD A;  4KP4 A;  1Q7Y W;  2WLN A;  3QO8 A;  1OCC C;  1OCR B;  3RW0 A;  4X8A A;  4ZKI A;  1VQO V;  1VQ7 V;  3FYI B;  1S5H C;  4RQF A;  2CK3 G;  2EIM B;  2EZO A;  4MTF A;  5IYD O;  1R3K C;  1TUE B;  1QLE C;  5H6R A;  3OMN B;  2QM8 A;  3SJQ C;  1NH2 B;  1W0K G;  4FMT A;  4CBC A;  2OCC B;  2W6I G;  3B77 A;  3ETG A;  1JX9 A;  4LBE C;  5LHI A;  3VOU A;  1FXH A;  1NR1 A;  3CXC U;  1GKF A;  3D3I A;  3AG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...