4PDWD

A benzonitrile analogue inhibits rhinovirus replication
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
41
structure length
41
Chain Sequence
b'VINYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title A novel benzonitrile analogue inhibits rhinovirus replication.
pubmed doi rcsb
molecule tags Virus
total genus 2
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4pdwD00
1PO14 2R064 1D4M4 1MQTD 1ASJ4 1COV4 1VBE4 4PDWD 1RVF4 1PVC4 1BEV4 3JBG4 3J8F4 1RUD4 1RMU4 1EAH4 1RUI4 2RM24 4Q4W4 1AR84 2RR14 1HRI4 2HWC4 2RS14 4GB34 4Q4V4 1VBD4 1VRH4 2R044 1EV14 1PO24 2RS34 1Z7S4 1RUE4 1R094 1RUF4 1OOPD 2RS54 3JD74 1HRV4 4Q4X4 1NA1D 1H8TD 1RUJ4 1NCQD 2R074 1AR94 1RHI4 1RUC4 1VBB4 2HWB4 2X5ID 1AR64 4RHV4 1POV0 1VBA4 1R084 4Q4Y4 1RUG4 1RUH4 1AL24 2PLV4 2RMU4 1AR74 1VBC4 1PIV4 1HXS4 1K5MD
chains in the Genus database with same CATH superfamily
3GQKA 3AEGA 4YXDA 4PDWD 3JBG4 4Q4X4 3AE7A 1RUI4 3VR9A 2RS14 1VBD4 2WQYA 2R044 2RS34 3CIRA 4YSYA 2RS54 1H8TD 1RUC4 2WDVA 3AE9A 3SFEA 2WU5A 1R084 4Q4Y4 1RUG4 1AL24 1XI1A 2WDRA 1D4M4 2H89A 1ASJ4 1COV4 2PZSA 2WS3A 1RVF4 1RMU4 2WDQA 1AR84 2HWC4 1KFYA 2EX3A 3ABVA 1L0VA 3SFDA 1NEKA 3P4RA 1XHXA 4YSZA 3AE2A 3AEDA 1Z7S4 2PY5A 4YSXA 1RUF4 4YTMA 1NA1D 3GQHA 1RUJ4 1RHI4 4RHV4 3VR8A 1ZP0A 3P4SA 3AE6A 2PLV4 2PW9A 1XHZA 2H88A 1PO14 1MQTD 1YQ3A 3AEFA 1RUD4 2RM24 1EAH4 4Q4W4 2PYJA 3AEBA 4YTPA 2WP9A 1YQ4A 1EV14 1PO24 3AE4A 3FI7A 4KX6A 4YT0A 3JD74 5C3JA 2ACZA 2PYLA 1NCQD 2R074 3AE8A 2HWB4 2B76A 3VRAA 4YTNA 1VBA4 3AEEA 3AE3A 1VBC4 1PIV4 1HXS4 2R064 1NENA 1VBE4 3AE1A 1PVC4 1BEV4 2FBWA 3J8F4 4Q4V4 1KF6A 2RR14 1HRI4 3AE5A 4GB34 1VRH4 5C2TA 1RUE4 1R094 3P4PA 1OOPD 1HRV4 2R7FA 3AECA 2X5ID 1AR94 1ZOYA 1VBB4 3AEAA 1AR64 2WU2A 3SUCA 3VRBA 1POV0 1RUH4 3P4QA 2RMU4 1AR74 1K5MD
chains in the Genus database with same CATH topology
1PO14 2R064 1D4M4 1MQTD 1ASJ4 1COV4 1VBE4 4PDWD 1RVF4 1PVC4 1BEV4 3JBG4 3J8F4 1RUD4 1RMU4 1EAH4 1RUI4 2RM24 4Q4W4 1AR84 2RR14 1HRI4 2HWC4 2RS14 4GB34 4Q4V4 1VBD4 1VRH4 2R044 1EV14 1PO24 2RS34 1Z7S4 1RUE4 1R094 1RUF4 1OOPD 2RS54 3JD74 1HRV4 4Q4X4 1NA1D 1H8TD 1RUJ4 1NCQD 2R074 1AR94 1RHI4 1RUC4 1VBB4 2HWB4 2X5ID 1AR64 4RHV4 1POV0 1VBA4 1R084 4Q4Y4 1RUG4 1RUH4 1AL24 2PLV4 2RMU4 1AR74 1VBC4 1PIV4 1HXS4 1K5MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PO1 4;  2R06 4;  1D4M 4;  1MQT D;  1ASJ 4;  1COV 4;  1VBE 4;  4PDW D;  1RVF 4;  1PVC 4;  1BEV 4;  3JBG 4;  3J8F 4;  1RUD 4;  1RMU 4;  1EAH 4;  1RUI 4;  2RM2 4;  4Q4W 4;  1AR8 4;  2RR1 4;  1HRI 4;  2HWC 4;  2RS1 4;  4GB3 4;  4Q4V 4;  1VBD 4;  1VRH 4;  2R04 4;  1EV1 4;  1PO2 4;  2RS3 4;  1Z7S 4;  1RUE 4;  1R09 4;  1RUF 4;  1OOP D;  2RS5 4;  3JD7 4;  1HRV 4;  4Q4X 4;  1NA1 D;  1H8T D;  1RUJ 4;  1NCQ D;  2R07 4;  1AR9 4;  1RHI 4;  1RUC 4;  1VBB 4;  2HWB 4;  2X5I D;  1AR6 4;  4RHV 4;  1POV 0;  1VBA 4;  1R08 4;  4Q4Y 4;  1RUG 4;  1RUH 4;  1AL2 4;  2PLV 4;  2RMU 4;  1AR7 4;  1VBC 4;  1PIV 4;  1HXS 4;  1K5M D; 
#chains in the Genus database with same CATH topology
 3GQK A;  3AEG A;  4YXD A;  4PDW D;  3JBG 4;  4Q4X 4;  3AE7 A;  1RUI 4;  3VR9 A;  2RS1 4;  1VBD 4;  2WQY A;  2R04 4;  2RS3 4;  3CIR A;  4YSY A;  2RS5 4;  1H8T D;  1RUC 4;  2WDV A;  3AE9 A;  3SFE A;  2WU5 A;  1R08 4;  4Q4Y 4;  1RUG 4;  1AL2 4;  1XI1 A;  2WDR A;  1D4M 4;  2H89 A;  1ASJ 4;  1COV 4;  2PZS A;  2WS3 A;  1RVF 4;  1RMU 4;  2WDQ A;  1AR8 4;  2HWC 4;  1KFY A;  2EX3 A;  3ABV A;  1L0V A;  3SFD A;  1NEK A;  3P4R A;  1XHX A;  4YSZ A;  3AE2 A;  3AED A;  1Z7S 4;  2PY5 A;  4YSX A;  1RUF 4;  4YTM A;  1NA1 D;  3GQH A;  1RUJ 4;  1RHI 4;  4RHV 4;  3VR8 A;  1ZP0 A;  3P4S A;  3AE6 A;  2PLV 4;  2PW9 A;  1XHZ A;  2H88 A;  1PO1 4;  1MQT D;  1YQ3 A;  3AEF A;  1RUD 4;  2RM2 4;  1EAH 4;  4Q4W 4;  2PYJ A;  3AEB A;  4YTP A;  2WP9 A;  1YQ4 A;  1EV1 4;  1PO2 4;  3AE4 A;  3FI7 A;  4KX6 A;  4YT0 A;  3JD7 4;  5C3J A;  2ACZ A;  2PYL A;  1NCQ D;  2R07 4;  3AE8 A;  2HWB 4;  2B76 A;  3VRA A;  4YTN A;  1VBA 4;  3AEE A;  3AE3 A;  1VBC 4;  1PIV 4;  1HXS 4;  2R06 4;  1NEN A;  1VBE 4;  3AE1 A;  1PVC 4;  1BEV 4;  2FBW A;  3J8F 4;  4Q4V 4;  1KF6 A;  2RR1 4;  1HRI 4;  3AE5 A;  4GB3 4;  1VRH 4;  5C2T A;  1RUE 4;  1R09 4;  3P4P A;  1OOP D;  1HRV 4;  2R7F A;  3AEC A;  2X5I D;  1AR9 4;  1ZOY A;  1VBB 4;  3AEA A;  1AR6 4;  2WU2 A;  3SUC A;  3VRB A;  1POV 0;  1RUH 4;  3P4Q A;  2RMU 4;  1AR7 4;  1K5M D; 
#chains in the Genus database with same CATH homology
 1PO1 4;  2R06 4;  1D4M 4;  1MQT D;  1ASJ 4;  1COV 4;  1VBE 4;  4PDW D;  1RVF 4;  1PVC 4;  1BEV 4;  3JBG 4;  3J8F 4;  1RUD 4;  1RMU 4;  1EAH 4;  1RUI 4;  2RM2 4;  4Q4W 4;  1AR8 4;  2RR1 4;  1HRI 4;  2HWC 4;  2RS1 4;  4GB3 4;  4Q4V 4;  1VBD 4;  1VRH 4;  2R04 4;  1EV1 4;  1PO2 4;  2RS3 4;  1Z7S 4;  1RUE 4;  1R09 4;  1RUF 4;  1OOP D;  2RS5 4;  3JD7 4;  1HRV 4;  4Q4X 4;  1NA1 D;  1H8T D;  1RUJ 4;  1NCQ D;  2R07 4;  1AR9 4;  1RHI 4;  1RUC 4;  1VBB 4;  2HWB 4;  2X5I D;  1AR6 4;  4RHV 4;  1POV 0;  1VBA 4;  1R08 4;  4Q4Y 4;  1RUG 4;  1RUH 4;  1AL2 4;  2PLV 4;  2RMU 4;  1AR7 4;  1VBC 4;  1PIV 4;  1HXS 4;  1K5M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...