4PE3A

Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
315
structure length
315
Chain Sequence
HHFRFQSSDPAGNPNFELQHVFADKVKELTNGEVTIELMPVGTIVDYKETPDAIQAGLIDGHITDTSYFAGRDPAFGLIANPVGAWADPAQMIDFVENGGGKELMNELINPYGLQFIGVSTPGLEAFVSKVPLDTVEDLKGVKVRSPEGLIANVFAAAGANPVNLPSSEVYTSLDKGVIDAADYSVFSVNQDTGMNDIAPHPVYPGFHSLPLVEVSMNKQKWDALTPELQAKITEAQKIFQQTQIDTLHQRDLEAVEAAKAGGKITVHDWSDEERAKFRGIARGEWEKVAGQSEMAQKVYDTLVTYLKDKGLMAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Solute-binding protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
total genus 113
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pe3A00
4P1EA 2HPGA 4PGNA 4NQ8A 5I5PA 4N4UA 2CEYA 2VPOA 5IM2A 2XWKA 4PC9A 2ZZWA 4NX1A 4PF6A 4MNCA 4P9KA 4PAKA 4PAIA 4NGUA 4PFRA 2HZLA 5IZZA 4OA4A 2HZKA 4PBQA 2V4CA 2PFYA 4PDDA 4XF5A 4OVPA 5I7IA 4PCDA 5IGAA 4OANA 4OVTA 4OVSA 4NHBA 4NF0A 3GYYA 4PFIA 4O7MA 4MX6A 4PE3A 4YICA 2ZZVA 4N17A 4UABA 2CEXA 2XWIA 4XFEA 4MAGA 4N91A 5CM6A 4PFBA 4MNIA 4MCOA 2VPNA 2WYKA 2ZZXA 2WYPA 3FXBA 4P1LA 4P56A 4NN3A 2XWVA 2PFZA 4OVRA 4OVQA 4PAFA 5LTCA 4N15A 4XEQA 3B50A 2XWOA 4PF8A 4PETA 4MMPA 4PDHA 4PGPA 4MNPA 2XA5A 2XXKA 4P3LA 4MHFA 4N8GA 4YZZA 4NAPA 4O94A 4DI4B 4PBHA 4MIJA 3U65A 2WX9A 4P47A 4X8RA 4LN5A 4P8BA 4DI3D 4N6DA 4N8YA 4MEVA 4O8MA 4N6KA 4X04A 4NG7A
chains in the Genus database with same CATH superfamily
1NUWA 2NOOA 3PUYE 3S9MC 1IUDA 5CBRA 3DELB 1LSTA 4RK9A 1QUKA 4O3CA 2HQ0A 3TQWA 3PPRA 2Q8MA 1FTAA 4PAKA 2DYXA 4ZE9A 5ET5A 5TU0A 3T66A 4IO5A 4LUBA 4P11A 5EQ9A 1TT1A 4XF5A 1MPDA 1NNKA 1ZTYA 1D9YA 1B52A 2XHDA 3DP8A 1Z7ME 3KN3A 2Y7WA 2QVVA 4ELPA 2DWHA 4G8NA 4EF1A 3TUSA 2O68A 4F2QA 2GFEA 5I56A 4N15A 1FPFA 4JBZA 4HE2A 1MG1A 4XEQA 1MXXA 5KDTB 3GBAA 1MY3A 1OLCA 3KN7A 1AIVA 4OVJA 3Q25A 4F29A 4M1VA 4JVIA 4R6HA 2UVGA 1ZIUA 4XTCQ 3OO7A 4OWDA 2ZYMA 4KD5A 1I6QA 2I49A 4LN5A 4QBAA 4WEPA 1B40A 5H8SA 2I4BA 3RY3A 3IL1B 2QFLA 2XXTA 2WBBA 1LGBC 5H8HB 4ZZEA 2FIXA 1ZJLA 3ZS6A 1SBPA 2ANJA 4I40A 3IOVA 2VPOA 2ZNUA 4GBVA 3CI8A 3EQ1A 1MPBA 2H25A 4OTEA 5DTBA 2FA7A 1TWYA 4F22A 5K2XA 4FORA 4TLMB 2V4CA 3TFLA 5FTIA 3QAXA 1HSLA 3D4GA 3FJMA 2RC9A 5B70A 3PPPA 1B32A 3MZ9A 4AS4A 2FVZA 1MQGA 4I8CA 3IJXB 4RA1A 4OQOA 5FBPA 3M3KA 1UTHB 1B5JA 1YXIA 3IJOB 3MSTA 3LSFB 1ZBMA 5LOMA 3HPIA 1Y9UA 3O6HA 4OHNA 4KYEA 1JEVA 3HHGA 1N76A 1MRPA 4MMPA 4H5GA 4NF5B 4G8HA 4Z7EA 4Q8RA 3PMWA 1A8FA 2F3DA 4MF3A 4GWXA 5H8FB 1OQHA 3K0VA 3KC0A 1URGA 3I5OA 4Q30B 3OELA 1LBVA 3PTYA 1ANFA 5CBSA 1NV1A 2Z8DA 4H5FA 3PMXA 5F7VA 4N6DA 2XX9A 3MVXA 1NI9A 3PGFA 1FJ6A 1SW5A 5DEXA 1B4HA 2O1LA 1FSAA 1S50A 2QRYA 4EQ9A 3T9UA 3U1OA 4G4PA 1XS5A 1N84A 4EQBA 4LA9A 4NF6A 4I62A 3A09A 5EQ8A 1JW1A 4OVPA 2Z8EA 3PUXE 3VVEA 3PUWE 2ONRA 1USYE 4NHBA 5I2NB 4DDDA 1D9QA 1EZ9A 4EF2A 4FE8A 3O2AA 3L6GA 1NH8A 4PE3A 1LB8A 3ZSFA 1B5IA 3C32A 3O6GA 5KZTA 3FZVA 5CI5A 4FBPA 1R6ZA 3OSRA 1FTMA 4QSDA 1M5FA 3V83A 3LR1A 2MKZA 3G3HA 3MJNA 4X1DA 1FBGA 4MLVA 1FPJA 3K1NA 5AE4A 3FVGA 1IMEA 1FQAA 4DIGA 3FVOA 2Q9TA 3VE1B 2THIA 1IMFA 2AIXA 2F7BA 2F7AA 3CRBA 3LUYA 4PP0A 4HE0A 3SETA 1KA0A 4U2RA 2PCRA 2L5VA 1FBDA 2ONKE 4MEVA 1IMBA 1MXVA 3H4ZA 1M5DA 2OWTA 1GV8A 2ZYNA 1PDAA 4POXA 5I5PA 4KI0E 4YU0A 3SEWA 4GXSB 2O7IA 2IA4A 1TXFA 4KXPA 4I1DA 5IKBA 1FJ9A 2Z22A 1QGXA 4NX1A 2QVRA 3QXMA 4HCYA 1O7TA 4R9GA 1FPDA 3LSWA 1B0LA 1BLFA 2O7UA 4RK2A 4FIMA 4OERA 2XXVA 3C9HA 4GFRA 1K9ZA 3N94A 5ET6A 4HS7A 3C31A 2JJKA 4KCDA 4F3GA 1LAXA 4RNSA 4F3PA 4FEDA 2HCAA 1WDNA 2FNCA 1VDWA 2XXWA 3TDJA 4RXLA 3U8QA 4GX6A 2V84A 4OVQA 4YAHX 1FPBA 2REJA 1Q35A 3OD7A 3PV0E 5ET7A 1KA1A 1IQ7A 4P3LA 4MH5A 4EXLA 5IAIA 1P1WA 4YMBA 2XXRA 4GLIA 5F1QA 5HPQA 4MIJA 3PPNA 2RC8A 4F19A 3IOWA 3CFZA 4P47A 4NF4B 3U94A 5IZ1A 3B6TA 4OFLA 4XXUA 1YAEA 1H43A 5I2KB 3MC2A 4O8MA 1MXUA 4FEBA 4NG7A 3RPLB 1G0HA 5I56B 2P0SA 3W9WA 3VLUA 1NV4A 3RGYA 1UIVA 1G0IA 4PC9A 3TTNA 1US5A 1TFAA 4QXDA 5IZZA 4IGTA 2H9BA 2AL5A 2VP1A 1OLAA 2Q2AA 1UQWA 3I6VA 1MQIA 2ABHA 4OVTA 3T93B 5DW8A 2VT5A 2DE3A 3GYYA 3IR1A 3Q28A 4R9FA 4DXUA 3K6UA 4PFIA 3T0JA 4MX6A 1NL5A 1IXCA 5CMMA 3TKDA 4PFTA 4AB6A 1INPA 1M5CA 2NUVA 3TAJA 4GWUA 4PE5B 1WVJA 4OFJA 3PD9A 5BUUA 2OBGA 3IB2A 4U21A 2DDKA 5I2NA 4RPNA 5H8NB 4GWYA 4LZ8A 3ONMA 4YKIA 3T9HB 4DE8A 2HEUA 4R2BA 1D4NA 5CMCA 3R7XA 4DCYA 1B5HA 2VOZA 3FBPA 4RY1A 3H6UA 4MBPA 5EYFA 1A54A 4LVQA 1BIYA 1FBHA 4F1UA 1NUZA 2QPQA 2XXYA 4OETA 3K4UA 1P1OA 1A99A 5AA2B 1B3GA 2V3UA 4U1ZA 2NXOA 5T3JA 1DOTA 3RNNA 3OO8A 3G3IA 3HSTA 4U22A 2HPGA 4EQ7A 4F2OA 2OX3A 4NQ8A 3FV2A 2X7QA 3TEPA 1Y1ZA 1FBCA 1LLSA 4N07A 4GWZA 2OK2A 4MNCA 4PFRA 5L9SA 1YZ0A 2XXIA 4OA4A 4EXKA 3MQ9A 3PPOA 2PFYA 5HBCA 5I7IA 3O28A 2R6GE 1ATGA 3RQTA 2F78A 1VSOA 3PPQA 1VE4A 4YICA 1US4A 2UYFA 4ZEDA 2P3VA 2PMSA 4OMBA 4R6KA 4YKPA 4XFEA 1MM6A 3QK6A 1B6HA 4NF4A 2PBWA 1B3EA 3UA8A 4UA8A 2B3BA 3UIFA 1KWHA 3QUJA 1IIWA 3LV0A 4QRZA 3QUFA 3N26A 1LFGA 1VFDA 3O29A 3HO7A 4PETA 3FXUA 4IY5A 3SZPA 2V25A 1KZ8A 3FJ7A 5EHSA 2E1SA 4GF8A 2QL3A 1EZOA 4H8IA 1S7YA 3UGWA 2Q74A 3KOTA 2G29A 3CR9A 4OESA 1B7HA 3WAFA 2E0SA 3KN8A 1MY1A 2DWIA 1YPNA 2YPNA 3WAEA 2IEEA 1H3DA 1QUIA 2O6AA 3HHFA 2F35A 1N7WA 1B9JA 5DVIA 2ESNA 4ZEBA 2ZMBA 5FHOA 5AA4A 3ISPA 2UVJA 3KBRA 1OMPA 3N6TA 2Q8JA 4AB5A 3GLBA 1SD3A 1IXHA 2F36A 4AQ4A 3P7IA 2KR0A 4P9KA 2B65A 3S9LC 5I59A 1DSNA 4OZ9A 3HFUA 1FQEA 5H8QB 3RT6B 2XXHA 4OXVA 4OANA 4R6YA 4RPOA 3FD3A 1JW5A 3CFXA 3MP1A 1OVTA 4ZEFA 2R71A 4O7MA 2XX8A 3SERA 4TQUQ 3DP4A 4GBWA 1B4ZA 3MBPA 1SDXA 2CEXA 4G61A 2DE4A 4PFBA 1PB7A 4POWA 2QMXA 4P56A 4JDFA 4NN3A 1T0KA 3BIGA 3VVDA 1WODA 2O1MA 3K6XA 3UK4A 3MAMA 1Z7NE 3D4CA 2PYYA 1SVXB 3ILTB 4M4GA 4NWDA 1FRPA 3BFUA 1MH4A 1UTBA 1BK4A 1NNPA 4LZ5A 4QSEA 1Y3NA 3W9VA 5DVJA 4YMAA 4R72A 2Z23A 1JNFA 1P99A 2XXXA 1MQHA 5F24A 3D1RA 2PT2A 4BDQA 2H4IA 5TP9A 3H7MA 4ELRA 3RN8A 2DWAA 2OCUA 2R8TA 2P3NA 5KCJA 4ZEIA 3KBZA 2HZKA 3BBRA 3M3FA 1K9YA 5A5XB 3K1PA 1LBWA 3MVWA 5IGAA 1MS7A 2FYIA 4OVSA 5TPAA 1FQFA 4Q0CA 4WXJA 2B4LA 1VR5A 4HTGA 5EQ7A 4ELQA 5IZ3A 2Z8FA 4MAGA 1QUJA 4NF8A 3MWBA 1N7XA 2VPNA 1FBPA 3TTKA 4L17A 3FXBA 4H6DA 5H8FA 2R9JA 1OVBA 1B7UA 4C1UA 5LTCA 3B6WA 2CZIA 4JWXA 5AA3A 5LDZA 1MY2A 1I69A 3K00A 3LUZA 1YTVA 4O3AA 3TZAA 1B3LA 1LBXA 2XXKA 4E0XA 3TELA 2O84X 1O63A 2I4CA 5ITOA 3HCQA 2ALUA 2PVUA 2FBPA 1GR2A 2UVIA 4F31B 4F3BA 2HFBA 4NMYA 2V3TA 3JYRA 4KYSA 3B7DA 3JV9A 4GQOA 2A5SA 3O66A 2CZKA 2VGQA 3T96B 5HM4B 2DXRA 3VDFA 3ECRA 3RPLA 3OEMA 4UACA 4XKQA 1SYIA 1MH3A 2YLNA 5I2KA 2XWKA 1GGGA 3B8BA 4KFQA 3K6VA 4JVDA 5CC2A 1FBFA 2D21A 1LEVA 3E3KA 2F6GA 3DM0A 2P1SA 4ZS9A 4PCDA 5I57A 4G68B 2RC7A 3PMVA 1B51A 5ITPA 3E78A 4X48A 2DS9A 4ZDMA 1UTBB 4X1BA 3C33A 4IO7A 1L5TA 3THIA 3MUQA 4UABA 1FPIA 5I57B 2QS3A 5EHMA 1Q9DA 1R9QA 4BLAA 2F34A 4OFOA 4NE4A 1AL3A 1SYHA 1RDYA 4GOTA 3H03A 1AWBA 1I6BA 1JVXA 1IITA 1URDA 1RYOA 2F3BA 1B58A 2V3QA 4NF6B 3O97A 4N6PA 4PFUA 5TPAB 3K2DA 4F18A 3KFMA 3RT8A 1NV3A 1SW2A 2Q88A 4FECA 4O94A 4IB2A 1SW1A 3A29A 3SEVA 3OOAA 3MZBA 3G3GA 1MQDA 4P8BA 2H5YA 1HSEA 2I0CA 2NVUB 2CMOA 3G3FA 3KJTA 5I59B 3K6WA 4N6KA 4AS5A 1ZU0A 3N6UA 3S9EA 3A3UA 4P1EA 4HCWA 1NV6A 1B3FA 4U4SA 1HSJA 4QFPA 3DLNA 4PF6A 1FQBA 3PUVE 4PAIA 4F3SA 1QJMA 1MQJA 2VHAA 4BDRA 1EU8A 1MY4A 1VFEA 2LAOA 2XD3A 3K01A 4RJZA 2ZXTA 3M8UA 1F9BA 1POY1 1LBBA 3KZGA 4N17A 1B0HA 4F1VA 2Y84A 1POTA 4XKPA 2XD2A 3H6VA 4O7IA 2NWJA 5BWJA 1MM7A 1IMAA 1N0TA 3TTMA 3ZKKA 4MJOA 3OSQA 4H46A 3FV1A 4BDNA 2XWVA 4ND9A 4H45A 3EKIA 4EUOA 1BP5A 2DE2A 1NH7A 2DWJA 3B50A 1QVSA 2DSFA 2DQVA 1R1NA 1AMFA 3OO6A 2Y5KA 4GWWA 2QS4A 2F97A 1B7ZA 3SEYA 3MVYA 2I6EA 2GRVA 1PB8A 3ZKLA 3VXBA 5H8HA 1OIBA 3BIHA 4JXIA 3HN0A 4G68A 2ZYKA 3Q29A 1MPCA 3IB1A 3LC8A 4X04A 5AA4B 1JVYA 4HE1A 1N3XA 2CEYA 4WEDA 3FVNA 4IGRA 2OWSA 3MP8A 5A5LA 1NMUA 3RYDA 4WKMA 2HZLA 4ESXA 4LATA 4BDOA 2HXRA 4F1YA 2XX7A 2A5TA 4N81A 2REGA 5I58A 3CFLA 2QS1A 4QFNA 1XVXA 3NOHA 4GL8A 5ISUA 1PEBA 2QS2A 5ESYA 1IXIA 2D3IA 3RUMA 3TTRA 2DOJA 4OYVA 4THIA 4I9DA 4IO3A 2A5TB 2XWIA 3K02A 2Y7PA 2I48A 5I3SA 2I3VA 1DPEA 4H1XA 4NWCA 4HXVA 4E0WA 3TCHA 3F11A 4P1LA 1P1NA 1UTHA 3DP6A 4GWOA 2CZHA 4PAFA 1CNQA 2G93A 5FTHA 3KJ7A 4KR5A 3FXQA 4PF8A 3FJGA 4RYAA 5J1DA 4I3EA 5JTYB 4PDHA 2UXAA 5JEIA 2BJJX 3VV5A 1Y3QA 1FQCA 2H99A 5K2YA 3TQLA 4LP2B 5L8DA 4DLDA 4JWYA 5IZ3B 4PBHA 1NV0A 5ELVA 3TCFA 2XXPA 5ET8A 4H65A 1IXGA 4G77A 3LBSA 4GVOA 3O6IA 2D5WA 2P2AA 2UVHA 3IORA 3LSLA 1MDP1 1B3HA 3T22A 1ZKBA 4LQ2A 4PGNA 1H45A 2YJPA 3T9XB 5TP9B 4OEVA 1NUYA 5AA2A 5CMKA 1FTOA 4DCXA 2ZZWA 3IB0A 1DTGA 3RTWB 3FUZA 4DXBA 2H98A 4PBQA 3H6WA 2F5XA 3KSJA 2I0BA 5ICTA 2KQZA 1XC1A 1MDQA 3OENA 3ROJA 4LQ5A 1LB9A 4GIZA 3UP9A 3S9NC 1SW4A 3A3CA 4FJPA 4R75A 4H0WA 2RCAA 5EYGA 1DPPA 1LAGE 3R6UA 2KLFA 4DXCA 1RDZA 3OMBA 3SDFA 3TYHA 2ZZXA 1XI6A 4IR8A 4YB7A 5JTYA 3U92A 3U72A 2GH9A 3H3GA 3I3VA 1CB6A 3KC1A 1LCFA 3RTFB 4GXAA 4NF8B 3E9XA 3QIMA 3PD8A 5DYHA 1NV7A 4H67A 1A55A 4GL0A 3IO6A 5M2VA 4JSDA 4NAPA 1N04A 3EHTA 4JSOA 2QMWA 4DI4B 1IMDA 3U65A 2OWZA 2WEFA 3CVGA 3MPLA 4JVCA 1FTLA 4ZEKA 1IEJA 1EZPA 3IFAA 4N8YA 4QSCA 4ZECA 5H8QA 3OEKA 4NEDA 2GHBA 3VLWA 3KSXA 1NNTA 3G3JA 1PBQA 4PTKA 2WBDA 4OENA 5IM2A 1PBPA 3L6HA 2RF1A 1Y4TA 1AH5A 1LBZA 5H8NA 3VXCA 2F6PA 2V93A 4I3YA 1MY0A 1UIUA 3PUZE 1YYZA 4NF0A 2VD2A 4R73A 5L9MA 1P1UA 2OJTA 1USYH 4Z0IA 2I58A 2VD3A 3MZ1A 2DVCA 3V8XB 2I3WA 3H6TA 3T9VA 1NNFA 1A8EA 4DZ1A 3RLFE 4H8JA 1JEUA 3JZJA 3TODA 1TFDA 3GXAA 3GZGA 4C0RA 1QKBA 2PX1A 5I58B 4XKRA 2XWOA 3VVFA 3LSXA 3Q26A 1BKAA 3SKPA 3CIJA 5FHNA 4R74A 1PB9A 4XIGQ 3V5AA 3MVZA 2X26A 5EQAA 3S2VA 1ZMGA 1II5A 5FHMA 1B2HA 4X9TA 4X8RA 1NV2A 1YCJA 2X7PA 3IFCA 3V89B 2W7YA 1MXZA 1Y4CA 4KPTA 1S9TA 5DT6A 3QMFA 1I6AA 4LONB 3EF7A 4HW8A 1H76A 3HV1A 2HHMA 3QYTA 3C35A 1LAFE 4PFWA 1ELJA 2B4MA 1FPGA 4P0IA 3IX1A 3K1MA 1P1QA 4MLQA 2RCBA 3BFTA 3UN6A 4K3FA 3MW0A 4YB5A 1URSA 4BDMA 4PDDA 1QKAA 3MYUA 4QFKA 4F39A 3FXRA 3VFJA 1SI1A 2O51A 2DVZA 4QF9A 4QHQA 4C1TA 4GD5A 2ZZVA 4JB7A 4QFOA 4Q5TA 1Y20A 1JW4A 2O69A 5CM6A 3PU5A 4NF5A 3TTLA 3RPWA 4MFIA 3EHUA 4P0GA 4R2FA 1CE2A 4IY6A 5L9OA 1IMCA 2WYKA 4OEUA 2WYPA 1SQYA 1DMBA 3C36A 2PFZA 1FPLA 1FCKA 3O9PA 3EHSA 5I84A 4PGPA 5AA2D 1NFTA 3CSGA 1JP4A 3E13X 5B7DA 1XOCA 2Y5LA 4N13A 4U1OA 3R26A 3GBBA 2M8CA 4GX4A 3SEUA 1FPKA 4ELOA 3OXNA 2ZYOA 1B46A 3SESA 3E79A 1JETA 3OO9A 3IAZA 4EDPA 2ONSA 3USDA 2XXQA 2ZNTA 5JK4A 1LFHA 1Y1MA 5DEXB 1D3KA 3CHGA 3CSBA 2HAUA 1ZLQA 4ECFA 1NV5A 1Q1KA 3EN3A 4YKKA 5A5XA 2UYEA 4N4UA 2PT1A 1GVCA 1SI0A 3IOTA 4NTLA 3CG1A 2B3FA 4NGUA 3T1BA 3IOUA 3TMGA 5CMBA 1PC3A 2DP8A 3G7WA 2FIEA 1A7LA 1LBYA 4FAJA 5AA1A 3E4RA 1BTJA 4GX3A 3KOSA 4YKJA 1M5EA 2GQ1A 4GWSA 2HXWA 3QSLA 2QJEA 1LBCA 2F7CA 4MNIA 1QULA 5KDTA 4IO6A 1DTZA 3IK6B 4TLLB 1RYXA 3KGCA 4OVRA 4IO2A 1N3WA 1NUXA 4KQPA 4PQJA 3AXFA 1B05A 2AL4A 4G68C 2XXUA 3G3KA 1EH3A 4PFYA 1RDXA 2Q89A 3W15C 4MHFA 4N8GA 4YZZA 3IO4A 5ICQA 3VLVA 3EPEA 1EYKA 2WX9A 1XHYA 4BDLA 2Y7IA 4IO4A 1FTJA 3CG3A 3ILUB 4DI3D 3S4UA 2F8DA 1FTKA 1DK4A 1QW0A 3B6QA 4GRKA 4FATA 2RKMA 1FW0A 1DBZA 2Q2CA 3C34A 1EYJA 4QFLA 2BJIA 2QSXA 1B1XA 1MXYA 3U93A 4YB6A 4ISUA 2AYSA 2CZLA 1LFIA 3TPAA 3H06B 1MXWA 5CRYA 4JWOA 3FGSA 1XT8A 1SPIA 1OQGA 1GTKA 1M5BA 2ZNSA 1LAHE 3Q27A 3UORA 1AOVA 1FQDA 1LCTA 3FATA 4KCCA 4ZE8A 2OLBA 1O64A 1FBEA 3KEIA 1IZ1A 1JQFA 2Y7KA 4N91A 3M3LA 2Y7RA 2FHYA 3FIRA 1D9VA 2GHAA 1B1HA 4MCOA 2OZZA 2QVUA 3ODBA 4ZZAA 3BKIB 3MPKA 4XKNA 4TOZA 4U4XA 3C4MA 2RINA 3FASA 1A40A 1DCUA 3N5LA 5KCJB 4O3BA 1R9LA 4LZ7A 4MNPA 5J16A 2XA5A 3SEXA 5DVFA 1J1NA 3FVKA 1FPEA 2DXYA 1EYIA 2WKYA 3KG2A 4KHZE 2HAVA 1RKMA 4ESWA 4ONYA 4KYDA 4U23A 1NKXA 4G8MA 1XVYA 4G2ZA 3TCGA 3MP6A 5EYHA 1Y3PA 1H44A
chains in the Genus database with same CATH topology
1DBZA 2WBBA 3RPLB 1NUWA 1EYJA 1G0HA 3CHGA 4HCWA 4P1EA 5F24A 3D1RA 1NV6A 3ISPA 3RPLA 2FIXA 2HPGA 2HHMA 2OX3A 4HE1A 4PGNA 2BJIA 1FSAA 4NQ8A 1NV5A 5I5PA 3W9WA 4PTKA 2WBDA 1NV4A 2B4MA 1FPGA 2CEYA 4N4UA 5A5LA 4I40A 1G0IA 2VPOA 1NUYA 1FBCA 4KXPA 2XWKA 4PC9A 5IM2A 4GBVA 3RYDA 3B8BA 4JVDA 1FJ9A 2Q8MA 4GWZA 2ZZWA 1FBFA 1QGXA 1FTAA 2KR0A 1LEVA 2R8TA 2P3NA 4MNCA 1LBZA 4NGUA 1YZ0A 2HZLA 4P9KA 4PAKA 4PAIA 4QXDA 3T1BA 2HXRA 2QVRA 4I3YA 3KBZA 4OA4A 5IZZA 2HZKA 4N81A 5EQ8A 4PBQA 5ET5A 2V4CA 4HCYA 2F5XA 1K9YA 2PFYA 2FIEA 3HFUA 1LBWA 2KQZA 4PDDA 4OVPA 4XF5A 5EQ9A 5I7IA 3MYUA 1SPIA 1LBYA 4PCDA 3ROJA 5IGAA 4OANA 4OVTA 1FPDA 4OVSA 1YYZA 3NOHA 4NHBA 5DW8A 2VT5A 2DE3A 4NF0A 3E78A 1D9QA 1K9ZA 3GYYA 4GX3A 2DVZA 4PFIA 2B4LA 3T0JA 4O7MA 4MX6A 4PE3A 4YICA 2GQ1A 5ESYA 4AS4A 2QVVA 2ZZVA 1FBEA 5ET6A 4GWSA 2FVZA 4N17A 4GBWA 2P3VA 4F1VA 1INPA 4NX1A 4UABA 2JJKA 1FPIA 5EYGA 5EQ7A 2CEXA 2XWIA 4XFEA 5IZ3A 4MAGA 4GWUA 4N91A 4O7IA 5CM6A 4G61A 2DE4A 4PFBA 1RDZA 5I3SA 1Q9DA 4MNIA 5FBPA 2FHYA 1YXIA 1IMAA 4MCOA 2VPNA 1FBPA 1IMCA 4HXVA 3MSTA 2WYKA 4PFRA 1VDWA 2DDKA 2ZZXA 4MJOA 2WYPA 1RDYA 3FXBA 4P1LA 1XI6A 4IR8A 4P56A 4NN3A 3LV0A 4H46A 2QVUA 3BIGA 4GX6A 2XWVA 4GWYA 2PFZA 3EKIA 2CZHA 4H45A 1FPLA 4OVRA 4FBPA 4OVQA 4PAFA 1CNQA 1AWBA 1NUXA 5LTCA 2DE2A 1FPBA 1FPFA 2CZIA 3KC1A 4N15A 4PF6A 1DCUA 4HE2A 2F3BA 4XEQA 2MKZA 2V3QA 3B50A 2XWOA 5LDZA 4PF8A 5J1DA 4I3EA 4PETA 1FBGA 3SZPA 4MMPA 4PDHA 1FPJA 4PGPA 3FBPA 3LUZA 2Y5KA 4GWWA 5ET7A 1KA1A 1KZ8A 4M1VA 1RDXA 4MNPA 5J16A 4JVIA 1JP4A 2XA5A 1NV7A 1LBXA 2XXKA 4P3LA 2Y5LA 4F18A 4MHFA 4N8GA 1IMEA 1FBHA 2F3DA 1NV3A 4NAPA 4YZZA 4GWXA 4O94A 5EQAA 5IZ3B 2Q74A 4F1UA 1NUZA 1FRPA 4DI4B 4GX4A 1FPKA 2Q9TA 1IMFA 4PBHA 3KC0A 1EYKA 1FPEA 1IMDA 1EYIA 3BIHA 2FBPA 1BK4A 2OWZA 4MIJA 3E79A 2WX9A 1NV0A 3U65A 4F19A 2WEFA 3A29A 2QPQA 5ET8A 1LBVA 4P47A 4X9TA 4X8RA 1NV2A 3PTYA 5IZ1A 4HE0A 1NV1A 4LN5A 1KA0A 4JVCA 4P8BA 3IFCA 4QBAA 2PCRA 3W9VA 2L5VA 3IFAA 4DI3D 4N6DA 4N8YA 2CZKA 5JK4A 1FBDA 3QMFA 1DK4A 4MEVA 4O8MA 5T3JA 1IMBA 1NI9A 4N6KA 5EYHA 4AS5A 1FJ6A 2QFLA 4X04A 4NG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1E A;  2HPG A;  4PGN A;  4NQ8 A;  5I5P A;  4N4U A;  2CEY A;  2VPO A;  5IM2 A;  2XWK A;  4PC9 A;  2ZZW A;  4NX1 A;  4PF6 A;  4MNC A;  4P9K A;  4PAK A;  4PAI A;  4NGU A;  4PFR A;  2HZL A;  5IZZ A;  4OA4 A;  2HZK A;  4PBQ A;  2V4C A;  2PFY A;  4PDD A;  4XF5 A;  4OVP A;  5I7I A;  4PCD A;  5IGA A;  4OAN A;  4OVT A;  4OVS A;  4NHB A;  4NF0 A;  3GYY A;  4PFI A;  4O7M A;  4MX6 A;  4PE3 A;  4YIC A;  2ZZV A;  4N17 A;  4UAB A;  2CEX A;  2XWI A;  4XFE A;  4MAG A;  4N91 A;  5CM6 A;  4PFB A;  4MNI A;  4MCO A;  2VPN A;  2WYK A;  2ZZX A;  2WYP A;  3FXB A;  4P1L A;  4P56 A;  4NN3 A;  2XWV A;  2PFZ A;  4OVR A;  4OVQ A;  4PAF A;  5LTC A;  4N15 A;  4XEQ A;  3B50 A;  2XWO A;  4PF8 A;  4PET A;  4MMP A;  4PDH A;  4PGP A;  4MNP A;  2XA5 A;  2XXK A;  4P3L A;  4MHF A;  4N8G A;  4YZZ A;  4NAP A;  4O94 A;  4DI4 B;  4PBH A;  4MIJ A;  3U65 A;  2WX9 A;  4P47 A;  4X8R A;  4LN5 A;  4P8B A;  4DI3 D;  4N6D A;  4N8Y A;  4MEV A;  4O8M A;  4N6K A;  4X04 A;  4NG7 A; 
#chains in the Genus database with same CATH topology
 1NUW A;  2NOO A;  3PUY E;  3S9M C;  1IUD A;  5CBR A;  3DEL B;  1LST A;  4RK9 A;  1QUK A;  4O3C A;  2HQ0 A;  3TQW A;  3PPR A;  2Q8M A;  1FTA A;  4PAK A;  2DYX A;  4ZE9 A;  5ET5 A;  5TU0 A;  3T66 A;  4IO5 A;  4LUB A;  4P11 A;  5EQ9 A;  1TT1 A;  4XF5 A;  1MPD A;  1NNK A;  1ZTY A;  1D9Y A;  1B52 A;  2XHD A;  3DP8 A;  1Z7M E;  3KN3 A;  2Y7W A;  2QVV A;  4ELP A;  2DWH A;  4G8N A;  4EF1 A;  3TUS A;  2O68 A;  4F2Q A;  2GFE A;  5I56 A;  4N15 A;  1FPF A;  4JBZ A;  4HE2 A;  1MG1 A;  4XEQ A;  1MXX A;  5KDT B;  3GBA A;  1MY3 A;  1OLC A;  3KN7 A;  1AIV A;  4OVJ A;  3Q25 A;  4F29 A;  4M1V A;  4JVI A;  4R6H A;  2UVG A;  1ZIU A;  4XTC Q;  3OO7 A;  4OWD A;  2ZYM A;  4KD5 A;  1I6Q A;  2I49 A;  4LN5 A;  4QBA A;  4WEP A;  1B40 A;  5H8S A;  2I4B A;  3RY3 A;  3IL1 B;  2QFL A;  2XXT A;  2WBB A;  1LGB C;  5H8H B;  4ZZE A;  2FIX A;  1ZJL A;  3ZS6 A;  1SBP A;  2ANJ A;  4I40 A;  3IOV A;  2VPO A;  2ZNU A;  4GBV A;  3CI8 A;  3EQ1 A;  1MPB A;  2H25 A;  4OTE A;  5DTB A;  2FA7 A;  1TWY A;  4F22 A;  5K2X A;  4FOR A;  4TLM B;  2V4C A;  3TFL A;  5FTI A;  3QAX A;  1HSL A;  3D4G A;  3FJM A;  2RC9 A;  5B70 A;  3PPP A;  1B32 A;  3MZ9 A;  4AS4 A;  2FVZ A;  1MQG A;  4I8C A;  3IJX B;  4RA1 A;  4OQO A;  5FBP A;  3M3K A;  1UTH B;  1B5J A;  1YXI A;  3IJO B;  3MST A;  3LSF B;  1ZBM A;  5LOM A;  3HPI A;  1Y9U A;  3O6H A;  4OHN A;  4KYE A;  1JEV A;  3HHG A;  1N76 A;  1MRP A;  4MMP A;  4H5G A;  4NF5 B;  4G8H A;  4Z7E A;  4Q8R A;  3PMW A;  1A8F A;  2F3D A;  4MF3 A;  4GWX A;  5H8F B;  1OQH A;  3K0V A;  3KC0 A;  1URG A;  3I5O A;  4Q30 B;  3OEL A;  1LBV A;  3PTY A;  1ANF A;  5CBS A;  1NV1 A;  2Z8D A;  4H5F A;  3PMX A;  5F7V A;  4N6D A;  2XX9 A;  3MVX A;  1NI9 A;  3PGF A;  1FJ6 A;  1SW5 A;  5DEX A;  1B4H A;  2O1L A;  1FSA A;  1S50 A;  2QRY A;  4EQ9 A;  3T9U A;  3U1O A;  4G4P A;  1XS5 A;  1N84 A;  4EQB A;  4LA9 A;  4NF6 A;  4I62 A;  3A09 A;  5EQ8 A;  1JW1 A;  4OVP A;  2Z8E A;  3PUX E;  3VVE A;  3PUW E;  2ONR A;  1USY E;  4NHB A;  5I2N B;  4DDD A;  1D9Q A;  1EZ9 A;  4EF2 A;  4FE8 A;  3O2A A;  3L6G A;  1NH8 A;  4PE3 A;  1LB8 A;  3ZSF A;  1B5I A;  3C32 A;  3O6G A;  5KZT A;  3FZV A;  5CI5 A;  4FBP A;  1R6Z A;  3OSR A;  1FTM A;  4QSD A;  1M5F A;  3V83 A;  3LR1 A;  2MKZ A;  3G3H A;  3MJN A;  4X1D A;  1FBG A;  4MLV A;  1FPJ A;  3K1N A;  5AE4 A;  3FVG A;  1IME A;  1FQA A;  4DIG A;  3FVO A;  2Q9T A;  3VE1 B;  2THI A;  1IMF A;  2AIX A;  2F7B A;  2F7A A;  3CRB A;  3LUY A;  4PP0 A;  4HE0 A;  3SET A;  1KA0 A;  4U2R A;  2PCR A;  2L5V A;  1FBD A;  2ONK E;  4MEV A;  1IMB A;  1MXV A;  3H4Z A;  1M5D A;  2OWT A;  1GV8 A;  2ZYN A;  1PDA A;  4POX A;  5I5P A;  4KI0 E;  4YU0 A;  3SEW A;  4GXS B;  2O7I A;  2IA4 A;  1TXF A;  4KXP A;  4I1D A;  5IKB A;  1FJ9 A;  2Z22 A;  1QGX A;  4NX1 A;  2QVR A;  3QXM A;  4HCY A;  1O7T A;  4R9G A;  1FPD A;  3LSW A;  1B0L A;  1BLF A;  2O7U A;  4RK2 A;  4FIM A;  4OER A;  2XXV A;  3C9H A;  4GFR A;  1K9Z A;  3N94 A;  5ET6 A;  4HS7 A;  3C31 A;  2JJK A;  4KCD A;  4F3G A;  1LAX A;  4RNS A;  4F3P A;  4FED A;  2HCA A;  1WDN A;  2FNC A;  1VDW A;  2XXW A;  3TDJ A;  4RXL A;  3U8Q A;  4GX6 A;  2V84 A;  4OVQ A;  4YAH X;  1FPB A;  2REJ A;  1Q35 A;  3OD7 A;  3PV0 E;  5ET7 A;  1KA1 A;  1IQ7 A;  4P3L A;  4MH5 A;  4EXL A;  5IAI A;  1P1W A;  4YMB A;  2XXR A;  4GLI A;  5F1Q A;  5HPQ A;  4MIJ A;  3PPN A;  2RC8 A;  4F19 A;  3IOW A;  3CFZ A;  4P47 A;  4NF4 B;  3U94 A;  5IZ1 A;  3B6T A;  4OFL A;  4XXU A;  1YAE A;  1H43 A;  5I2K B;  3MC2 A;  4O8M A;  1MXU A;  4FEB A;  4NG7 A;  3RPL B;  1G0H A;  5I56 B;  2P0S A;  3W9W A;  3VLU A;  1NV4 A;  3RGY A;  1UIV A;  1G0I A;  4PC9 A;  3TTN A;  1US5 A;  1TFA A;  4QXD A;  5IZZ A;  4IGT A;  2H9B A;  2AL5 A;  2VP1 A;  1OLA A;  2Q2A A;  1UQW A;  3I6V A;  1MQI A;  2ABH A;  4OVT A;  3T93 B;  5DW8 A;  2VT5 A;  2DE3 A;  3GYY A;  3IR1 A;  3Q28 A;  4R9F A;  4DXU A;  3K6U A;  4PFI A;  3T0J A;  4MX6 A;  1NL5 A;  1IXC A;  5CMM A;  3TKD A;  4PFT A;  4AB6 A;  1INP A;  1M5C A;  2NUV A;  3TAJ A;  4GWU A;  4PE5 B;  1WVJ A;  4OFJ A;  3PD9 A;  5BUU A;  2OBG A;  3IB2 A;  4U21 A;  2DDK A;  5I2N A;  4RPN A;  5H8N B;  4GWY A;  4LZ8 A;  3ONM A;  4YKI A;  3T9H B;  4DE8 A;  2HEU A;  4R2B A;  1D4N A;  5CMC A;  3R7X A;  4DCY A;  1B5H A;  2VOZ A;  3FBP A;  4RY1 A;  3H6U A;  4MBP A;  5EYF A;  1A54 A;  4LVQ A;  1BIY A;  1FBH A;  4F1U A;  1NUZ A;  2QPQ A;  2XXY A;  4OET A;  3K4U A;  1P1O A;  1A99 A;  5AA2 B;  1B3G A;  2V3U A;  4U1Z A;  2NXO A;  5T3J A;  1DOT A;  3RNN A;  3OO8 A;  3G3I A;  3HST A;  4U22 A;  2HPG A;  4EQ7 A;  4F2O A;  2OX3 A;  4NQ8 A;  3FV2 A;  2X7Q A;  3TEP A;  1Y1Z A;  1FBC A;  1LLS A;  4N07 A;  4GWZ A;  2OK2 A;  4MNC A;  4PFR A;  5L9S A;  1YZ0 A;  2XXI A;  4OA4 A;  4EXK A;  3MQ9 A;  3PPO A;  2PFY A;  5HBC A;  5I7I A;  3O28 A;  2R6G E;  1ATG A;  3RQT A;  2F78 A;  1VSO A;  3PPQ A;  1VE4 A;  4YIC A;  1US4 A;  2UYF A;  4ZED A;  2P3V A;  2PMS A;  4OMB A;  4R6K A;  4YKP A;  4XFE A;  1MM6 A;  3QK6 A;  1B6H A;  4NF4 A;  2PBW A;  1B3E A;  3UA8 A;  4UA8 A;  2B3B A;  3UIF A;  1KWH A;  3QUJ A;  1IIW A;  3LV0 A;  4QRZ A;  3QUF A;  3N26 A;  1LFG A;  1VFD A;  3O29 A;  3HO7 A;  4PET A;  3FXU A;  4IY5 A;  3SZP A;  2V25 A;  1KZ8 A;  3FJ7 A;  5EHS A;  2E1S A;  4GF8 A;  2QL3 A;  1EZO A;  4H8I A;  1S7Y A;  3UGW A;  2Q74 A;  3KOT A;  2G29 A;  3CR9 A;  4OES A;  1B7H A;  3WAF A;  2E0S A;  3KN8 A;  1MY1 A;  2DWI A;  1YPN A;  2YPN A;  3WAE A;  2IEE A;  1H3D A;  1QUI A;  2O6A A;  3HHF A;  2F35 A;  1N7W A;  1B9J A;  5DVI A;  2ESN A;  4ZEB A;  2ZMB A;  5FHO A;  5AA4 A;  3ISP A;  2UVJ A;  3KBR A;  1OMP A;  3N6T A;  2Q8J A;  4AB5 A;  3GLB A;  1SD3 A;  1IXH A;  2F36 A;  4AQ4 A;  3P7I A;  2KR0 A;  4P9K A;  2B65 A;  3S9L C;  5I59 A;  1DSN A;  4OZ9 A;  3HFU A;  1FQE A;  5H8Q B;  3RT6 B;  2XXH A;  4OXV A;  4OAN A;  4R6Y A;  4RPO A;  3FD3 A;  1JW5 A;  3CFX A;  3MP1 A;  1OVT A;  4ZEF A;  2R71 A;  4O7M A;  2XX8 A;  3SER A;  4TQU Q;  3DP4 A;  4GBW A;  1B4Z A;  3MBP A;  1SDX A;  2CEX A;  4G61 A;  2DE4 A;  4PFB A;  1PB7 A;  4POW A;  2QMX A;  4P56 A;  4JDF A;  4NN3 A;  1T0K A;  3BIG A;  3VVD A;  1WOD A;  2O1M A;  3K6X A;  3UK4 A;  3MAM A;  1Z7N E;  3D4C A;  2PYY A;  1SVX B;  3ILT B;  4M4G A;  4NWD A;  1FRP A;  3BFU A;  1MH4 A;  1UTB A;  1BK4 A;  1NNP A;  4LZ5 A;  4QSE A;  1Y3N A;  3W9V A;  5DVJ A;  4YMA A;  4R72 A;  2Z23 A;  1JNF A;  1P99 A;  2XXX A;  1MQH A;  5F24 A;  3D1R A;  2PT2 A;  4BDQ A;  2H4I A;  5TP9 A;  3H7M A;  4ELR A;  3RN8 A;  2DWA A;  2OCU A;  2R8T A;  2P3N A;  5KCJ A;  4ZEI A;  3KBZ A;  2HZK A;  3BBR A;  3M3F A;  1K9Y A;  5A5X B;  3K1P A;  1LBW A;  3MVW A;  5IGA A;  1MS7 A;  2FYI A;  4OVS A;  5TPA A;  1FQF A;  4Q0C A;  4WXJ A;  2B4L A;  1VR5 A;  4HTG A;  5EQ7 A;  4ELQ A;  5IZ3 A;  2Z8F A;  4MAG A;  1QUJ A;  4NF8 A;  3MWB A;  1N7X A;  2VPN A;  1FBP A;  3TTK A;  4L17 A;  3FXB A;  4H6D A;  5H8F A;  2R9J A;  1OVB A;  1B7U A;  4C1U A;  5LTC A;  3B6W A;  2CZI A;  4JWX A;  5AA3 A;  5LDZ A;  1MY2 A;  1I69 A;  3K00 A;  3LUZ A;  1YTV A;  4O3A A;  3TZA A;  1B3L A;  1LBX A;  2XXK A;  4E0X A;  3TEL A;  2O84 X;  1O63 A;  2I4C A;  5ITO A;  3HCQ A;  2ALU A;  2PVU A;  2FBP A;  1GR2 A;  2UVI A;  4F31 B;  4F3B A;  2HFB A;  4NMY A;  2V3T A;  3JYR A;  4KYS A;  3B7D A;  3JV9 A;  4GQO A;  2A5S A;  3O66 A;  2CZK A;  2VGQ A;  3T96 B;  5HM4 B;  2DXR A;  3VDF A;  3ECR A;  3RPL A;  3OEM A;  4UAC A;  4XKQ A;  1SYI A;  1MH3 A;  2YLN A;  5I2K A;  2XWK A;  1GGG A;  3B8B A;  4KFQ A;  3K6V A;  4JVD A;  5CC2 A;  1FBF A;  2D21 A;  1LEV A;  3E3K A;  2F6G A;  3DM0 A;  2P1S A;  4ZS9 A;  4PCD A;  5I57 A;  4G68 B;  2RC7 A;  3PMV A;  1B51 A;  5ITP A;  3E78 A;  4X48 A;  2DS9 A;  4ZDM A;  1UTB B;  4X1B A;  3C33 A;  4IO7 A;  1L5T A;  3THI A;  3MUQ A;  4UAB A;  1FPI A;  5I57 B;  2QS3 A;  5EHM A;  1Q9D A;  1R9Q A;  4BLA A;  2F34 A;  4OFO A;  4NE4 A;  1AL3 A;  1SYH A;  1RDY A;  4GOT A;  3H03 A;  1AWB A;  1I6B A;  1JVX A;  1IIT A;  1URD A;  1RYO A;  2F3B A;  1B58 A;  2V3Q A;  4NF6 B;  3O97 A;  4N6P A;  4PFU A;  5TPA B;  3K2D A;  4F18 A;  3KFM A;  3RT8 A;  1NV3 A;  1SW2 A;  2Q88 A;  4FEC A;  4O94 A;  4IB2 A;  1SW1 A;  3A29 A;  3SEV A;  3OOA A;  3MZB A;  3G3G A;  1MQD A;  4P8B A;  2H5Y A;  1HSE A;  2I0C A;  2NVU B;  2CMO A;  3G3F A;  3KJT A;  5I59 B;  3K6W A;  4N6K A;  4AS5 A;  1ZU0 A;  3N6U A;  3S9E A;  3A3U A;  4P1E A;  4HCW A;  1NV6 A;  1B3F A;  4U4S A;  1HSJ A;  4QFP A;  3DLN A;  4PF6 A;  1FQB A;  3PUV E;  4PAI A;  4F3S A;  1QJM A;  1MQJ A;  2VHA A;  4BDR A;  1EU8 A;  1MY4 A;  1VFE A;  2LAO A;  2XD3 A;  3K01 A;  4RJZ A;  2ZXT A;  3M8U A;  1F9B A;  1POY 1;  1LBB A;  3KZG A;  4N17 A;  1B0H A;  4F1V A;  2Y84 A;  1POT A;  4XKP A;  2XD2 A;  3H6V A;  4O7I A;  2NWJ A;  5BWJ A;  1MM7 A;  1IMA A;  1N0T A;  3TTM A;  3ZKK A;  4MJO A;  3OSQ A;  4H46 A;  3FV1 A;  4BDN A;  2XWV A;  4ND9 A;  4H45 A;  3EKI A;  4EUO A;  1BP5 A;  2DE2 A;  1NH7 A;  2DWJ A;  3B50 A;  1QVS A;  2DSF A;  2DQV A;  1R1N A;  1AMF A;  3OO6 A;  2Y5K A;  4GWW A;  2QS4 A;  2F97 A;  1B7Z A;  3SEY A;  3MVY A;  2I6E A;  2GRV A;  1PB8 A;  3ZKL A;  3VXB A;  5H8H A;  1OIB A;  3BIH A;  4JXI A;  3HN0 A;  4G68 A;  2ZYK A;  3Q29 A;  1MPC A;  3IB1 A;  3LC8 A;  4X04 A;  5AA4 B;  1JVY A;  4HE1 A;  1N3X A;  2CEY A;  4WED A;  3FVN A;  4IGR A;  2OWS A;  3MP8 A;  5A5L A;  1NMU A;  3RYD A;  4WKM A;  2HZL A;  4ESX A;  4LAT A;  4BDO A;  2HXR A;  4F1Y A;  2XX7 A;  2A5T A;  4N81 A;  2REG A;  5I58 A;  3CFL A;  2QS1 A;  4QFN A;  1XVX A;  3NOH A;  4GL8 A;  5ISU A;  1PEB A;  2QS2 A;  5ESY A;  1IXI A;  2D3I A;  3RUM A;  3TTR A;  2DOJ A;  4OYV A;  4THI A;  4I9D A;  4IO3 A;  2A5T B;  2XWI A;  3K02 A;  2Y7P A;  2I48 A;  5I3S A;  2I3V A;  1DPE A;  4H1X A;  4NWC A;  4HXV A;  4E0W A;  3TCH A;  3F11 A;  4P1L A;  1P1N A;  1UTH A;  3DP6 A;  4GWO A;  2CZH A;  4PAF A;  1CNQ A;  2G93 A;  5FTH A;  3KJ7 A;  4KR5 A;  3FXQ A;  4PF8 A;  3FJG A;  4RYA A;  5J1D A;  4I3E A;  5JTY B;  4PDH A;  2UXA A;  5JEI A;  2BJJ X;  3VV5 A;  1Y3Q A;  1FQC A;  2H99 A;  5K2Y A;  3TQL A;  4LP2 B;  5L8D A;  4DLD A;  4JWY A;  5IZ3 B;  4PBH A;  1NV0 A;  5ELV A;  3TCF A;  2XXP A;  5ET8 A;  4H65 A;  1IXG A;  4G77 A;  3LBS A;  4GVO A;  3O6I A;  2D5W A;  2P2A A;  2UVH A;  3IOR A;  3LSL A;  1MDP 1;  1B3H A;  3T22 A;  1ZKB A;  4LQ2 A;  4PGN A;  1H45 A;  2YJP A;  3T9X B;  5TP9 B;  4OEV A;  1NUY A;  5AA2 A;  5CMK A;  1FTO A;  4DCX A;  2ZZW A;  3IB0 A;  1DTG A;  3RTW B;  3FUZ A;  4DXB A;  2H98 A;  4PBQ A;  3H6W A;  2F5X A;  3KSJ A;  2I0B A;  5ICT A;  2KQZ A;  1XC1 A;  1MDQ A;  3OEN A;  3ROJ A;  4LQ5 A;  1LB9 A;  4GIZ A;  3UP9 A;  3S9N C;  1SW4 A;  3A3C A;  4FJP A;  4R75 A;  4H0W A;  2RCA A;  5EYG A;  1DPP A;  1LAG E;  3R6U A;  2KLF A;  4DXC A;  1RDZ A;  3OMB A;  3SDF A;  3TYH A;  2ZZX A;  1XI6 A;  4IR8 A;  4YB7 A;  5JTY A;  3U92 A;  3U72 A;  2GH9 A;  3H3G A;  3I3V A;  1CB6 A;  3KC1 A;  1LCF A;  3RTF B;  4GXA A;  4NF8 B;  3E9X A;  3QIM A;  3PD8 A;  5DYH A;  1NV7 A;  4H67 A;  1A55 A;  4GL0 A;  3IO6 A;  5M2V A;  4JSD A;  4NAP A;  1N04 A;  3EHT A;  4JSO A;  2QMW A;  4DI4 B;  1IMD A;  3U65 A;  2OWZ A;  2WEF A;  3CVG A;  3MPL A;  4JVC A;  1FTL A;  4ZEK A;  1IEJ A;  1EZP A;  3IFA A;  4N8Y A;  4QSC A;  4ZEC A;  5H8Q A;  3OEK A;  4NED A;  2GHB A;  3VLW A;  3KSX A;  1NNT A;  3G3J A;  1PBQ A;  4PTK A;  2WBD A;  4OEN A;  5IM2 A;  1PBP A;  3L6H A;  2RF1 A;  1Y4T A;  1AH5 A;  1LBZ A;  5H8N A;  3VXC A;  2F6P A;  2V93 A;  4I3Y A;  1MY0 A;  1UIU A;  3PUZ E;  1YYZ A;  4NF0 A;  2VD2 A;  4R73 A;  5L9M A;  1P1U A;  2OJT A;  1USY H;  4Z0I A;  2I58 A;  2VD3 A;  3MZ1 A;  2DVC A;  3V8X B;  2I3W A;  3H6T A;  3T9V A;  1NNF A;  1A8E A;  4DZ1 A;  3RLF E;  4H8J A;  1JEU A;  3JZJ A;  3TOD A;  1TFD A;  3GXA A;  3GZG A;  4C0R A;  1QKB A;  2PX1 A;  5I58 B;  4XKR A;  2XWO A;  3VVF A;  3LSX A;  3Q26 A;  1BKA A;  3SKP A;  3CIJ A;  5FHN A;  4R74 A;  1PB9 A;  4XIG Q;  3V5A A;  3MVZ A;  2X26 A;  5EQA A;  3S2V A;  1ZMG A;  1II5 A;  5FHM A;  1B2H A;  4X9T A;  4X8R A;  1NV2 A;  1YCJ A;  2X7P A;  3IFC A;  3V89 B;  2W7Y A;  1MXZ A;  1Y4C A;  4KPT A;  1S9T A;  5DT6 A;  3QMF A;  1I6A A;  4LON B;  3EF7 A;  4HW8 A;  1H76 A;  3HV1 A;  2HHM A;  3QYT A;  3C35 A;  1LAF E;  4PFW A;  1ELJ A;  2B4M A;  1FPG A;  4P0I A;  3IX1 A;  3K1M A;  1P1Q A;  4MLQ A;  2RCB A;  3BFT A;  3UN6 A;  4K3F A;  3MW0 A;  4YB5 A;  1URS A;  4BDM A;  4PDD A;  1QKA A;  3MYU A;  4QFK A;  4F39 A;  3FXR A;  3VFJ A;  1SI1 A;  2O51 A;  2DVZ A;  4QF9 A;  4QHQ A;  4C1T A;  4GD5 A;  2ZZV A;  4JB7 A;  4QFO A;  4Q5T A;  1Y20 A;  1JW4 A;  2O69 A;  5CM6 A;  3PU5 A;  4NF5 A;  3TTL A;  3RPW A;  4MFI A;  3EHU A;  4P0G A;  4R2F A;  1CE2 A;  4IY6 A;  5L9O A;  1IMC A;  2WYK A;  4OEU A;  2WYP A;  1SQY A;  1DMB A;  3C36 A;  2PFZ A;  1FPL A;  1FCK A;  3O9P A;  3EHS A;  5I84 A;  4PGP A;  5AA2 D;  1NFT A;  3CSG A;  1JP4 A;  3E13 X;  5B7D A;  1XOC A;  2Y5L A;  4N13 A;  4U1O A;  3R26 A;  3GBB A;  2M8C A;  4GX4 A;  3SEU A;  1FPK A;  4ELO A;  3OXN A;  2ZYO A;  1B46 A;  3SES A;  3E79 A;  1JET A;  3OO9 A;  3IAZ A;  4EDP A;  2ONS A;  3USD A;  2XXQ A;  2ZNT A;  5JK4 A;  1LFH A;  1Y1M A;  5DEX B;  1D3K A;  3CHG A;  3CSB A;  2HAU A;  1ZLQ A;  4ECF A;  1NV5 A;  1Q1K A;  3EN3 A;  4YKK A;  5A5X A;  2UYE A;  4N4U A;  2PT1 A;  1GVC A;  1SI0 A;  3IOT A;  4NTL A;  3CG1 A;  2B3F A;  4NGU A;  3T1B A;  3IOU A;  3TMG A;  5CMB A;  1PC3 A;  2DP8 A;  3G7W A;  2FIE A;  1A7L A;  1LBY A;  4FAJ A;  5AA1 A;  3E4R A;  1BTJ A;  4GX3 A;  3KOS A;  4YKJ A;  1M5E A;  2GQ1 A;  4GWS A;  2HXW A;  3QSL A;  2QJE A;  1LBC A;  2F7C A;  4MNI A;  1QUL A;  5KDT A;  4IO6 A;  1DTZ A;  3IK6 B;  4TLL B;  1RYX A;  3KGC A;  4OVR A;  4IO2 A;  1N3W A;  1NUX A;  4KQP A;  4PQJ A;  3AXF A;  1B05 A;  2AL4 A;  4G68 C;  2XXU A;  3G3K A;  1EH3 A;  4PFY A;  1RDX A;  2Q89 A;  3W15 C;  4MHF A;  4N8G A;  4YZZ A;  3IO4 A;  5ICQ A;  3VLV A;  3EPE A;  1EYK A;  2WX9 A;  1XHY A;  4BDL A;  2Y7I A;  4IO4 A;  1FTJ A;  3CG3 A;  3ILU B;  4DI3 D;  3S4U A;  2F8D A;  1FTK A;  1DK4 A;  1QW0 A;  3B6Q A;  4GRK A;  4FAT A;  2RKM A;  1FW0 A;  1DBZ A;  2Q2C A;  3C34 A;  1EYJ A;  4QFL A;  2BJI A;  2QSX A;  1B1X A;  1MXY A;  3U93 A;  4YB6 A;  4ISU A;  2AYS A;  2CZL A;  1LFI A;  3TPA A;  3H06 B;  1MXW A;  5CRY A;  4JWO A;  3FGS A;  1XT8 A;  1SPI A;  1OQG A;  1GTK A;  1M5B A;  2ZNS A;  1LAH E;  3Q27 A;  3UOR A;  1AOV A;  1FQD A;  1LCT A;  3FAT A;  4KCC A;  4ZE8 A;  2OLB A;  1O64 A;  1FBE A;  3KEI A;  1IZ1 A;  1JQF A;  2Y7K A;  4N91 A;  3M3L A;  2Y7R A;  2FHY A;  3FIR A;  1D9V A;  2GHA A;  1B1H A;  4MCO A;  2OZZ A;  2QVU A;  3ODB A;  4ZZA A;  3BKI B;  3MPK A;  4XKN A;  4TOZ A;  4U4X A;  3C4M A;  2RIN A;  3FAS A;  1A40 A;  1DCU A;  3N5L A;  5KCJ B;  4O3B A;  1R9L A;  4LZ7 A;  4MNP A;  5J16 A;  2XA5 A;  3SEX A;  5DVF A;  1J1N A;  3FVK A;  1FPE A;  2DXY A;  1EYI A;  2WKY A;  3KG2 A;  4KHZ E;  2HAV A;  1RKM A;  4ESW A;  4ONY A;  4KYD A;  4U23 A;  1NKX A;  4G8M A;  1XVY A;  4G2Z A;  3TCG A;  3MP6 A;  5EYH A;  1Y3P A;  1H44 A; 
#chains in the Genus database with same CATH homology
 1DBZ A;  2WBB A;  3RPL B;  1NUW A;  1EYJ A;  1G0H A;  3CHG A;  4HCW A;  4P1E A;  5F24 A;  3D1R A;  1NV6 A;  3ISP A;  3RPL A;  2FIX A;  2HPG A;  2HHM A;  2OX3 A;  4HE1 A;  4PGN A;  2BJI A;  1FSA A;  4NQ8 A;  1NV5 A;  5I5P A;  3W9W A;  4PTK A;  2WBD A;  1NV4 A;  2B4M A;  1FPG A;  2CEY A;  4N4U A;  5A5L A;  4I40 A;  1G0I A;  2VPO A;  1NUY A;  1FBC A;  4KXP A;  2XWK A;  4PC9 A;  5IM2 A;  4GBV A;  3RYD A;  3B8B A;  4JVD A;  1FJ9 A;  2Q8M A;  4GWZ A;  2ZZW A;  1FBF A;  1QGX A;  1FTA A;  2KR0 A;  1LEV A;  2R8T A;  2P3N A;  4MNC A;  1LBZ A;  4NGU A;  1YZ0 A;  2HZL A;  4P9K A;  4PAK A;  4PAI A;  4QXD A;  3T1B A;  2HXR A;  2QVR A;  4I3Y A;  3KBZ A;  4OA4 A;  5IZZ A;  2HZK A;  4N81 A;  5EQ8 A;  4PBQ A;  5ET5 A;  2V4C A;  4HCY A;  2F5X A;  1K9Y A;  2PFY A;  2FIE A;  3HFU A;  1LBW A;  2KQZ A;  4PDD A;  4OVP A;  4XF5 A;  5EQ9 A;  5I7I A;  3MYU A;  1SPI A;  1LBY A;  4PCD A;  3ROJ A;  5IGA A;  4OAN A;  4OVT A;  1FPD A;  4OVS A;  1YYZ A;  3NOH A;  4NHB A;  5DW8 A;  2VT5 A;  2DE3 A;  4NF0 A;  3E78 A;  1D9Q A;  1K9Z A;  3GYY A;  4GX3 A;  2DVZ A;  4PFI A;  2B4L A;  3T0J A;  4O7M A;  4MX6 A;  4PE3 A;  4YIC A;  2GQ1 A;  5ESY A;  4AS4 A;  2QVV A;  2ZZV A;  1FBE A;  5ET6 A;  4GWS A;  2FVZ A;  4N17 A;  4GBW A;  2P3V A;  4F1V A;  1INP A;  4NX1 A;  4UAB A;  2JJK A;  1FPI A;  5EYG A;  5EQ7 A;  2CEX A;  2XWI A;  4XFE A;  5IZ3 A;  4MAG A;  4GWU A;  4N91 A;  4O7I A;  5CM6 A;  4G61 A;  2DE4 A;  4PFB A;  1RDZ A;  5I3S A;  1Q9D A;  4MNI A;  5FBP A;  2FHY A;  1YXI A;  1IMA A;  4MCO A;  2VPN A;  1FBP A;  1IMC A;  4HXV A;  3MST A;  2WYK A;  4PFR A;  1VDW A;  2DDK A;  2ZZX A;  4MJO A;  2WYP A;  1RDY A;  3FXB A;  4P1L A;  1XI6 A;  4IR8 A;  4P56 A;  4NN3 A;  3LV0 A;  4H46 A;  2QVU A;  3BIG A;  4GX6 A;  2XWV A;  4GWY A;  2PFZ A;  3EKI A;  2CZH A;  4H45 A;  1FPL A;  4OVR A;  4FBP A;  4OVQ A;  4PAF A;  1CNQ A;  1AWB A;  1NUX A;  5LTC A;  2DE2 A;  1FPB A;  1FPF A;  2CZI A;  3KC1 A;  4N15 A;  4PF6 A;  1DCU A;  4HE2 A;  2F3B A;  4XEQ A;  2MKZ A;  2V3Q A;  3B50 A;  2XWO A;  5LDZ A;  4PF8 A;  5J1D A;  4I3E A;  4PET A;  1FBG A;  3SZP A;  4MMP A;  4PDH A;  1FPJ A;  4PGP A;  3FBP A;  3LUZ A;  2Y5K A;  4GWW A;  5ET7 A;  1KA1 A;  1KZ8 A;  4M1V A;  1RDX A;  4MNP A;  5J16 A;  4JVI A;  1JP4 A;  2XA5 A;  1NV7 A;  1LBX A;  2XXK A;  4P3L A;  2Y5L A;  4F18 A;  4MHF A;  4N8G A;  1IME A;  1FBH A;  2F3D A;  1NV3 A;  4NAP A;  4YZZ A;  4GWX A;  4O94 A;  5EQA A;  5IZ3 B;  2Q74 A;  4F1U A;  1NUZ A;  1FRP A;  4DI4 B;  4GX4 A;  1FPK A;  2Q9T A;  1IMF A;  4PBH A;  3KC0 A;  1EYK A;  1FPE A;  1IMD A;  1EYI A;  3BIH A;  2FBP A;  1BK4 A;  2OWZ A;  4MIJ A;  3E79 A;  2WX9 A;  1NV0 A;  3U65 A;  4F19 A;  2WEF A;  3A29 A;  2QPQ A;  5ET8 A;  1LBV A;  4P47 A;  4X9T A;  4X8R A;  1NV2 A;  3PTY A;  5IZ1 A;  4HE0 A;  1NV1 A;  4LN5 A;  1KA0 A;  4JVC A;  4P8B A;  3IFC A;  4QBA A;  2PCR A;  3W9V A;  2L5V A;  3IFA A;  4DI3 D;  4N6D A;  4N8Y A;  2CZK A;  5JK4 A;  1FBD A;  3QMF A;  1DK4 A;  4MEV A;  4O8M A;  5T3J A;  1IMB A;  1NI9 A;  4N6K A;  5EYH A;  4AS5 A;  1FJ6 A;  2QFL A;  4X04 A;  4NG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...