4PEQB

Structure of bovine ribonuclease inhibitor complexed with bovine ribonuclease i
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
456
structure length
453
Chain Sequence
MKLDIQCEQLSDARWTELLPLIQQYEVVRLDDCGLTEVRCKDIGSALQANASLTELSLRTNELGDGGVLLVLQGLQSPTCKIQKLSLQNCCLTEAGCGVLPGVLRSLPTLRELHLSDNPLGDAGLRLLCEGLLDRLEKLQLEYCSLTAASCEPLAAVLRATRDLKELVVSNNDIGEAGVQALCRGLAESACQLETLKLENCGLTAANCKDLCGIVASQASLKDLDLGSNRLGDAGLAELCPGLLSPSSQLRTLWLWECDLTVSGCRELCRVLQAKEALKELSLAGNSLGDEGAQLLCESLLQPGCQLESLWVKSCGFTAACCQHFSSMLTQNKHLLELQLSSNPLGDAGVHVLCQALGQPGTVLRVLWVGDCELTNSSCGGLASLLLASPSLRELDLSNNGLGDPGVLQLLGSLEQPACSLEQLVLYDIYWTEAVDERLRAVEESKPGLRIIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional evolution of ribonuclease inhibitor: insights from birds and reptiles.
pubmed doi rcsb
molecule keywords Ribonuclease pancreatic
molecule tags Hydrolase/hydrolase inhibitor
source organism Bos taurus
total genus 184
structure length 453
sequence length 456
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13516 LRR_6 Leucine Rich repeat
B PF18779 LRR_RI_capping Capping Ribonuclease inhibitor Leucine Rich Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4peqB00
1OOKG 2RA8A 3DZEA 4U08A 3G3BA 3RGZA 4AY9X 4Z79A 1O6SA 5GS0A 4C2BB 4FHOA 3W3NA 2P1PB 4BSSA 4C2AB 3G3AA 1O6TA 2OMTA 4FMZA 4R0AA 4CC4C 4FDWA 1P9AG 5AWCA 1FO1A 3WPCA 5IJBA 3FXIA 3G39A 2OMZA 3WPBA 4CILA 4TZHA 3A79B 1H6TA 1XECA 3RJ0A 4R09A 4PEQB 4HQ1A 3E2JA 2R9UA 4ECNA 2OMXA 3ZYJA 3ZYIA 2Q4GW 4Q3GA 4NKHA 2RR6A 4BSUA 4J0MA 4B8CD 1Z7XW 3GOZA 4R6JA 5GMFA 4V2EA 3RW6A 2XWTC 3ULUA 4MN8B 4WP6A 4G8AA 4KXFB 2Z64A 3C6PB 3OGKB 1OGQA 3G06A 3TSRE 4ARNA 2O6QA 1A4YA 4R5DA 3RFSA 2Z82A 5AWBA 3UL8A 3OGLB 4Z94G 4NKGA 2IFGA 1O6VA 4FD0A 5GMGA 4R58A 2JE1A 4IM6A 1KOHA 2ELLA 3OJAA 2P1NB 4R6GA 1XCDA 1DFJI 3WPGA 4L3FA 4I6JB 3M19A 4U7LA 1XEUA 5LFNA 2BEXA 4U09A 2UZXA 1OTOA 3ZYNA 4Q3IA 5AWDA 4QC0A 1D0BA 1KOOA 4OQTA 3RIZA 2ID5A 2OMYA 1XKUA 2CA6A 1M0ZA 1IO0A 5IJDA 1FT8A 4LSAA 4WYKA 5HDHA 4PKIG 4V2CA 4RCAB 4QBZA 4ARRA 5IJCA 1SQ0B 4LXSA 1W8AA 2V9TB 1K5GC 1FQVA 5A5CA 5AWAA 2OMUA 4Z64C 5IYXC 1OTNA 1FS2A 4QXEA 4EZGA 2P1QB 2Z66A 1PGVA 3W3MA 3G04C 4BSRA 4M7EA 3OJAB 4UFRA 2Z81A 5GQRK 2WQXA 3UL7A 5FTTB 4BV4R 3ZYOA 3RFJA 4YEBB 3WPEA 1P8TA 4P8SA 2OMVA 3CVRA 4R08A 4CNMA 1ZIWA 5GS2B 2JQDA 3E3ZA 4LSXA 3UL9A 4PSJA 1DS9A 1K5DC 2Z63A 1H6UA 2BNHA 3RW7A 2ASSB 4KNGA 3O6NA 1WWLA 1OZNA 4P91A 3RFEA 5CMNA 3UN9A 5D3IA 1DCEA 1QYYA 1LTXA 3WPFA 1A9NA 4U06A 2WFHA 1YRGA 4R07A 4LI1A 3RGXA 4LI2A 2P1MB 2V9SA 4Z8GA 2OMWA 4MQWX 4XOSA 4Q62A 2Z62A 4RWTC 4ECOA 4RCWA 3ULVA 1M10B 4R6FA 3VQ2A 4GLPA 2WQVA 4Z61C 2Z65A 2P1OB 4Y61B 5B4PA 3M18A 4M7EC 1M9SA 1G9UA 4R6AA 2O6SA 3WN4A 3P72A 2ASTB 2JE0A 3E6JA 2WQUA 2Z7XA 3E4GA 4FS7A 2WQWA 4L3AA 2UZYA 3OGMB 3CIYA 4LSCA 3PMHG 4XSQA 4PERA 4H09A 4AW4A 3W3LA 4CC4A 2V70A 1M9LA 2O6RA 3WPHA 1GWBA 4LSXC 4CNCA 5AZ5A 3WPDA 2A0ZA 3W3JA 1OTMA 4GT6A 1U0ND 1XWDC 4PQ8A 1JL5A 3C6OB 3W3GA 4J4LA 3O53A 4KT1A 4V2DA 5CMPA 3ULAA 3KJ4A 4K17A 5GMHA 3REZA 2Z7XB 1P8VA 5B0NA 3VQ1A 4XGOA 5HZLB 3BZ5A 3W3KA 5B0TA 3CIGA 4FCGA 2Y5QA 3SB4A 3JB9j 2FT3A 3C6NB 4LXRA 4CP6A 3WPIA 4R5CA 2XOTA
chains in the Genus database with same CATH superfamily
1OOKG 2RA8A 3DZEA 4U08A 3G3BA 3RGZA 4AY9X 4Z79A 1O6SA 5GS0A 4C2BB 4FHOA 3W3NA 2P1PB 4BSSA 4C2AB 3G3AA 1O6TA 2OMTA 4FMZA 4R0AA 4CC4C 4FDWA 1P9AG 5AWCA 1FO1A 3WPCA 5IJBA 3FXIA 3G39A 2OMZA 3WPBA 4CILA 4TZHA 3A79B 1H6TA 1XECA 3RJ0A 4R09A 4PEQB 4HQ1A 3E2JA 2R9UA 4ECNA 2OMXA 3ZYJA 3ZYIA 2Q4GW 4Q3GA 4NKHA 2RR6A 4BSUA 4J0MA 4B8CD 1Z7XW 3GOZA 4R6JA 5GMFA 4V2EA 3RW6A 2XWTC 3ULUA 4MN8B 4WP6A 4G8AA 4KXFB 2Z64A 3C6PB 3OGKB 1OGQA 3G06A 3TSRE 4ARNA 2O6QA 1A4YA 4R5DA 3RFSA 2Z82A 5AWBA 3UL8A 3OGLB 4Z94G 4NKGA 2IFGA 1O6VA 4FD0A 4NZRM 5GMGA 4R58A 2JE1A 4IM6A 1KOHA 2ELLA 3OJAA 2P1NB 4R6GA 1XCDA 1DFJI 3WPGA 4L3FA 4I6JB 3M19A 4U7LA 1XEUA 5LFNA 2BEXA 4U09A 2UZXA 1OTOA 3ZYNA 4Q3IA 5AWDA 4QC0A 1D0BA 1KOOA 4OQTA 3RIZA 2ID5A 2OMYA 1XKUA 2CA6A 1M0ZA 1IO0A 5IJDA 1FT8A 4LSAA 5HDHA 4WYKA 4NZTM 4PKIG 4V2CA 4RCAB 4QBZA 4ARRA 5IJCA 1SQ0B 4LXSA 1W8AA 2V9TB 1K5GC 1FQVA 5A5CA 5AWAA 2OMUA 4Z64C 5IYXC 1OTNA 1FS2A 4QXEA 4EZGA 2P1QB 2Z66A 1PGVA 3W3MA 3G04C 4BSRA 4M7EA 3OJAB 4UFRA 2Z81A 5GQRK 2WQXA 3UL7A 5FTTB 4BV4R 3ZYOA 3RFJA 4YEBB 3WPEA 1P8TA 4P8SA 2OMVA 3CVRA 4R08A 4CNMA 1ZIWA 5GS2B 2JQDA 3E3ZA 4LSXA 3UL9A 4PSJA 1DS9A 1K5DC 2Z63A 1H6UA 2BNHA 3RW7A 2ASSB 4KNGA 3O6NA 1WWLA 1OZNA 4P91A 3RFEA 5CMNA 3UN9A 5D3IA 1DCEA 1QYYA 1LTXA 3WPFA 1A9NA 4U06A 2WFHA 1YRGA 4R07A 4LI1A 3RGXA 4LI2A 2P1MB 2V9SA 4Z8GA 2OMWA 4MQWX 4XOSA 4Q62A 2Z62A 4RWTC 4ECOA 4RCWA 3ULVA 1M10B 4R6FA 3VQ2A 4GLPA 2WQVA 4Z61C 2Z65A 2P1OB 4Y61B 5B4PA 3M18A 4M7EC 1M9SA 1G9UA 4R6AA 2O6SA 3WN4A 3P72A 2ASTB 2JE0A 3E6JA 2WQUA 2Z7XA 3E4GA 4FS7A 2WQWA 4L3AA 2UZYA 3OGMB 3CIYA 4LSCA 3PMHG 4XSQA 4PERA 4H09A 4AW4A 3W3LA 4CC4A 2V70A 1M9LA 2O6RA 3WPHA 1GWBA 4LSXC 4CNCA 5AZ5A 3WPDA 2A0ZA 3W3JA 1OTMA 4GT6A 1U0ND 1XWDC 4PQ8A 1JL5A 3C6OB 3W3GA 4J4LA 3O53A 4KT1A 4V2DA 5CMPA 3ULAA 3KJ4A 4K17A 5GMHA 3REZA 2Z7XB 1P8VA 5B0NA 3VQ1A 4XGOA 5HZLB 3BZ5A 3W3KA 5B0TA 3CIGA 4FCGA 2Y5QA 3SB4A 3JB9j 2FT3A 3C6NB 4LXRA 4CP6A 3WPIA 4R5CA 2XOTA
chains in the Genus database with same CATH topology
1OOKG 2RA8A 3DZEA 4U08A 3G3BA 3RGZA 4AY9X 4Z79A 1O6SA 5GS0A 4C2BB 4FHOA 3W3NA 2P1PB 4BSSA 4C2AB 3G3AA 1O6TA 2OMTA 4FMZA 4R0AA 4CC4C 4FDWA 1P9AG 5AWCA 1FO1A 3WPCA 5IJBA 3FXIA 3G39A 2OMZA 3WPBA 4CILA 4TZHA 3A79B 1H6TA 1XECA 3RJ0A 4R09A 4PEQB 4HQ1A 3E2JA 2R9UA 4ECNA 2OMXA 3ZYJA 3ZYIA 2Q4GW 4Q3GA 4NKHA 2RR6A 4BSUA 4J0MA 4B8CD 1Z7XW 3GOZA 4R6JA 5GMFA 4V2EA 3RW6A 2XWTC 3ULUA 4MN8B 4WP6A 4G8AA 4KXFB 2Z64A 3C6PB 3OGKB 1OGQA 3G06A 3TSRE 4ARNA 2O6QA 1A4YA 4R5DA 3RFSA 2Z82A 5AWBA 3UL8A 3OGLB 4Z94G 4NKGA 2IFGA 1O6VA 4FD0A 5GMGA 4R58A 2JE1A 4IM6A 1KOHA 2ELLA 3OJAA 2P1NB 4R6GA 1XCDA 1DFJI 3WPGA 4L3FA 4I6JB 3M19A 4U7LA 1XEUA 5LFNA 2BEXA 4U09A 2UZXA 1OTOA 3ZYNA 4Q3IA 5AWDA 4QC0A 1D0BA 1KOOA 4OQTA 3RIZA 2ID5A 2OMYA 1XKUA 2CA6A 1M0ZA 1IO0A 5IJDA 1FT8A 4LSAA 4WYKA 5HDHA 4PKIG 4V2CA 4RCAB 4QBZA 4ARRA 5IJCA 1SQ0B 4LXSA 1W8AA 2V9TB 1K5GC 1FQVA 5A5CA 5AWAA 2OMUA 4Z64C 5IYXC 1OTNA 1FS2A 4QXEA 4EZGA 2P1QB 2Z66A 1PGVA 3W3MA 3G04C 4BSRA 4M7EA 3OJAB 4UFRA 2Z81A 5GQRK 2WQXA 3UL7A 5FTTB 4BV4R 3ZYOA 3RFJA 4YEBB 3WPEA 1P8TA 4P8SA 2OMVA 3CVRA 4R08A 4CNMA 1ZIWA 5GS2B 2JQDA 3E3ZA 4LSXA 3UL9A 4PSJA 1DS9A 1K5DC 2Z63A 1H6UA 2BNHA 3RW7A 2ASSB 4KNGA 3O6NA 1WWLA 1OZNA 4P91A 3RFEA 5CMNA 3UN9A 5D3IA 1DCEA 1QYYA 1LTXA 3WPFA 1A9NA 4U06A 2WFHA 1YRGA 4R07A 4LI1A 3RGXA 4LI2A 2P1MB 2V9SA 4Z8GA 2OMWA 4MQWX 4XOSA 4Q62A 2Z62A 4RWTC 4ECOA 4RCWA 3ULVA 1M10B 4R6FA 3VQ2A 4GLPA 2WQVA 4Z61C 2Z65A 2P1OB 4Y61B 5B4PA 3M18A 4M7EC 1M9SA 1G9UA 4R6AA 2O6SA 3WN4A 3P72A 2ASTB 2JE0A 3E6JA 2WQUA 2Z7XA 3E4GA 4FS7A 2WQWA 4L3AA 2UZYA 3OGMB 3CIYA 4LSCA 3PMHG 4XSQA 4PERA 4H09A 4AW4A 3W3LA 4CC4A 2V70A 1M9LA 2O6RA 3WPHA 1GWBA 4LSXC 4CNCA 5AZ5A 3WPDA 2A0ZA 3W3JA 1OTMA 4GT6A 1U0ND 1XWDC 4PQ8A 1JL5A 3C6OB 3W3GA 4J4LA 3O53A 4KT1A 4V2DA 5CMPA 3ULAA 3KJ4A 4K17A 5GMHA 3REZA 2Z7XB 1P8VA 5B0NA 3VQ1A 4XGOA 5HZLB 3BZ5A 3W3KA 5B0TA 3CIGA 4FCGA 2Y5QA 3SB4A 3JB9j 2FT3A 3C6NB 4LXRA 4CP6A 3WPIA 4R5CA 2XOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOK G;  2RA8 A;  3DZE A;  4U08 A;  3G3B A;  3RGZ A;  4AY9 X;  4Z79 A;  1O6S A;  5GS0 A;  4C2B B;  4FHO A;  3W3N A;  2P1P B;  4BSS A;  4C2A B;  3G3A A;  1O6T A;  2OMT A;  4FMZ A;  4R0A A;  4CC4 C;  4FDW A;  1P9A G;  5AWC A;  1FO1 A;  3WPC A;  5IJB A;  3FXI A;  3G39 A;  2OMZ A;  3WPB A;  4CIL A;  4TZH A;  3A79 B;  1H6T A;  1XEC A;  3RJ0 A;  4R09 A;  4PEQ B;  4HQ1 A;  3E2J A;  2R9U A;  4ECN A;  2OMX A;  3ZYJ A;  3ZYI A;  2Q4G W;  4Q3G A;  4NKH A;  2RR6 A;  4BSU A;  4J0M A;  4B8C D;  1Z7X W;  3GOZ A;  4R6J A;  5GMF A;  4V2E A;  3RW6 A;  2XWT C;  3ULU A;  4MN8 B;  4WP6 A;  4G8A A;  4KXF B;  2Z64 A;  3C6P B;  3OGK B;  1OGQ A;  3G06 A;  3TSR E;  4ARN A;  2O6Q A;  1A4Y A;  4R5D A;  3RFS A;  2Z82 A;  5AWB A;  3UL8 A;  3OGL B;  4Z94 G;  4NKG A;  2IFG A;  1O6V A;  4FD0 A;  5GMG A;  4R58 A;  2JE1 A;  4IM6 A;  1KOH A;  2ELL A;  3OJA A;  2P1N B;  4R6G A;  1XCD A;  1DFJ I;  3WPG A;  4L3F A;  4I6J B;  3M19 A;  4U7L A;  1XEU A;  5LFN A;  2BEX A;  4U09 A;  2UZX A;  1OTO A;  3ZYN A;  4Q3I A;  5AWD A;  4QC0 A;  1D0B A;  1KOO A;  4OQT A;  3RIZ A;  2ID5 A;  2OMY A;  1XKU A;  2CA6 A;  1M0Z A;  1IO0 A;  5IJD A;  1FT8 A;  4LSA A;  4WYK A;  5HDH A;  4PKI G;  4V2C A;  4RCA B;  4QBZ A;  4ARR A;  5IJC A;  1SQ0 B;  4LXS A;  1W8A A;  2V9T B;  1K5G C;  1FQV A;  5A5C A;  5AWA A;  2OMU A;  4Z64 C;  5IYX C;  1OTN A;  1FS2 A;  4QXE A;  4EZG A;  2P1Q B;  2Z66 A;  1PGV A;  3W3M A;  3G04 C;  4BSR A;  4M7E A;  3OJA B;  4UFR A;  2Z81 A;  5GQR K;  2WQX A;  3UL7 A;  5FTT B;  4BV4 R;  3ZYO A;  3RFJ A;  4YEB B;  3WPE A;  1P8T A;  4P8S A;  2OMV A;  3CVR A;  4R08 A;  4CNM A;  1ZIW A;  5GS2 B;  2JQD A;  3E3Z A;  4LSX A;  3UL9 A;  4PSJ A;  1DS9 A;  1K5D C;  2Z63 A;  1H6U A;  2BNH A;  3RW7 A;  2ASS B;  4KNG A;  3O6N A;  1WWL A;  1OZN A;  4P91 A;  3RFE A;  5CMN A;  3UN9 A;  5D3I A;  1DCE A;  1QYY A;  1LTX A;  3WPF A;  1A9N A;  4U06 A;  2WFH A;  1YRG A;  4R07 A;  4LI1 A;  3RGX A;  4LI2 A;  2P1M B;  2V9S A;  4Z8G A;  2OMW A;  4MQW X;  4XOS A;  4Q62 A;  2Z62 A;  4RWT C;  4ECO A;  4RCW A;  3ULV A;  1M10 B;  4R6F A;  3VQ2 A;  4GLP A;  2WQV A;  4Z61 C;  2Z65 A;  2P1O B;  4Y61 B;  5B4P A;  3M18 A;  4M7E C;  1M9S A;  1G9U A;  4R6A A;  2O6S A;  3WN4 A;  3P72 A;  2AST B;  2JE0 A;  3E6J A;  2WQU A;  2Z7X A;  3E4G A;  4FS7 A;  2WQW A;  4L3A A;  2UZY A;  3OGM B;  3CIY A;  4LSC A;  3PMH G;  4XSQ A;  4PER A;  4H09 A;  4AW4 A;  3W3L A;  4CC4 A;  2V70 A;  1M9L A;  2O6R A;  3WPH A;  1GWB A;  4LSX C;  4CNC A;  5AZ5 A;  3WPD A;  2A0Z A;  3W3J A;  1OTM A;  4GT6 A;  1U0N D;  1XWD C;  4PQ8 A;  1JL5 A;  3C6O B;  3W3G A;  4J4L A;  3O53 A;  4KT1 A;  4V2D A;  5CMP A;  3ULA A;  3KJ4 A;  4K17 A;  5GMH A;  3REZ A;  2Z7X B;  1P8V A;  5B0N A;  3VQ1 A;  4XGO A;  5HZL B;  3BZ5 A;  3W3K A;  5B0T A;  3CIG A;  4FCG A;  2Y5Q A;  3SB4 A;  3JB9 j;  2FT3 A;  3C6N B;  4LXR A;  4CP6 A;  3WPI A;  4R5C A;  2XOT A; 
#chains in the Genus database with same CATH topology
 1OOK G;  2RA8 A;  3DZE A;  4U08 A;  3G3B A;  3RGZ A;  4AY9 X;  4Z79 A;  1O6S A;  5GS0 A;  4C2B B;  4FHO A;  3W3N A;  2P1P B;  4BSS A;  4C2A B;  3G3A A;  1O6T A;  2OMT A;  4FMZ A;  4R0A A;  4CC4 C;  4FDW A;  1P9A G;  5AWC A;  1FO1 A;  3WPC A;  5IJB A;  3FXI A;  3G39 A;  2OMZ A;  3WPB A;  4CIL A;  4TZH A;  3A79 B;  1H6T A;  1XEC A;  3RJ0 A;  4R09 A;  4PEQ B;  4HQ1 A;  3E2J A;  2R9U A;  4ECN A;  2OMX A;  3ZYJ A;  3ZYI A;  2Q4G W;  4Q3G A;  4NKH A;  2RR6 A;  4BSU A;  4J0M A;  4B8C D;  1Z7X W;  3GOZ A;  4R6J A;  5GMF A;  4V2E A;  3RW6 A;  2XWT C;  3ULU A;  4MN8 B;  4WP6 A;  4G8A A;  4KXF B;  2Z64 A;  3C6P B;  3OGK B;  1OGQ A;  3G06 A;  3TSR E;  4ARN A;  2O6Q A;  1A4Y A;  4R5D A;  3RFS A;  2Z82 A;  5AWB A;  3UL8 A;  3OGL B;  4Z94 G;  4NKG A;  2IFG A;  1O6V A;  4FD0 A;  4NZR M;  5GMG A;  4R58 A;  2JE1 A;  4IM6 A;  1KOH A;  2ELL A;  3OJA A;  2P1N B;  4R6G A;  1XCD A;  1DFJ I;  3WPG A;  4L3F A;  4I6J B;  3M19 A;  4U7L A;  1XEU A;  5LFN A;  2BEX A;  4U09 A;  2UZX A;  1OTO A;  3ZYN A;  4Q3I A;  5AWD A;  4QC0 A;  1D0B A;  1KOO A;  4OQT A;  3RIZ A;  2ID5 A;  2OMY A;  1XKU A;  2CA6 A;  1M0Z A;  1IO0 A;  5IJD A;  1FT8 A;  4LSA A;  5HDH A;  4WYK A;  4NZT M;  4PKI G;  4V2C A;  4RCA B;  4QBZ A;  4ARR A;  5IJC A;  1SQ0 B;  4LXS A;  1W8A A;  2V9T B;  1K5G C;  1FQV A;  5A5C A;  5AWA A;  2OMU A;  4Z64 C;  5IYX C;  1OTN A;  1FS2 A;  4QXE A;  4EZG A;  2P1Q B;  2Z66 A;  1PGV A;  3W3M A;  3G04 C;  4BSR A;  4M7E A;  3OJA B;  4UFR A;  2Z81 A;  5GQR K;  2WQX A;  3UL7 A;  5FTT B;  4BV4 R;  3ZYO A;  3RFJ A;  4YEB B;  3WPE A;  1P8T A;  4P8S A;  2OMV A;  3CVR A;  4R08 A;  4CNM A;  1ZIW A;  5GS2 B;  2JQD A;  3E3Z A;  4LSX A;  3UL9 A;  4PSJ A;  1DS9 A;  1K5D C;  2Z63 A;  1H6U A;  2BNH A;  3RW7 A;  2ASS B;  4KNG A;  3O6N A;  1WWL A;  1OZN A;  4P91 A;  3RFE A;  5CMN A;  3UN9 A;  5D3I A;  1DCE A;  1QYY A;  1LTX A;  3WPF A;  1A9N A;  4U06 A;  2WFH A;  1YRG A;  4R07 A;  4LI1 A;  3RGX A;  4LI2 A;  2P1M B;  2V9S A;  4Z8G A;  2OMW A;  4MQW X;  4XOS A;  4Q62 A;  2Z62 A;  4RWT C;  4ECO A;  4RCW A;  3ULV A;  1M10 B;  4R6F A;  3VQ2 A;  4GLP A;  2WQV A;  4Z61 C;  2Z65 A;  2P1O B;  4Y61 B;  5B4P A;  3M18 A;  4M7E C;  1M9S A;  1G9U A;  4R6A A;  2O6S A;  3WN4 A;  3P72 A;  2AST B;  2JE0 A;  3E6J A;  2WQU A;  2Z7X A;  3E4G A;  4FS7 A;  2WQW A;  4L3A A;  2UZY A;  3OGM B;  3CIY A;  4LSC A;  3PMH G;  4XSQ A;  4PER A;  4H09 A;  4AW4 A;  3W3L A;  4CC4 A;  2V70 A;  1M9L A;  2O6R A;  3WPH A;  1GWB A;  4LSX C;  4CNC A;  5AZ5 A;  3WPD A;  2A0Z A;  3W3J A;  1OTM A;  4GT6 A;  1U0N D;  1XWD C;  4PQ8 A;  1JL5 A;  3C6O B;  3W3G A;  4J4L A;  3O53 A;  4KT1 A;  4V2D A;  5CMP A;  3ULA A;  3KJ4 A;  4K17 A;  5GMH A;  3REZ A;  2Z7X B;  1P8V A;  5B0N A;  3VQ1 A;  4XGO A;  5HZL B;  3BZ5 A;  3W3K A;  5B0T A;  3CIG A;  4FCG A;  2Y5Q A;  3SB4 A;  3JB9 j;  2FT3 A;  3C6N B;  4LXR A;  4CP6 A;  3WPI A;  4R5C A;  2XOT A; 
#chains in the Genus database with same CATH homology
 1OOK G;  2RA8 A;  3DZE A;  4U08 A;  3G3B A;  3RGZ A;  4AY9 X;  4Z79 A;  1O6S A;  5GS0 A;  4C2B B;  4FHO A;  3W3N A;  2P1P B;  4BSS A;  4C2A B;  3G3A A;  1O6T A;  2OMT A;  4FMZ A;  4R0A A;  4CC4 C;  4FDW A;  1P9A G;  5AWC A;  1FO1 A;  3WPC A;  5IJB A;  3FXI A;  3G39 A;  2OMZ A;  3WPB A;  4CIL A;  4TZH A;  3A79 B;  1H6T A;  1XEC A;  3RJ0 A;  4R09 A;  4PEQ B;  4HQ1 A;  3E2J A;  2R9U A;  4ECN A;  2OMX A;  3ZYJ A;  3ZYI A;  2Q4G W;  4Q3G A;  4NKH A;  2RR6 A;  4BSU A;  4J0M A;  4B8C D;  1Z7X W;  3GOZ A;  4R6J A;  5GMF A;  4V2E A;  3RW6 A;  2XWT C;  3ULU A;  4MN8 B;  4WP6 A;  4G8A A;  4KXF B;  2Z64 A;  3C6P B;  3OGK B;  1OGQ A;  3G06 A;  3TSR E;  4ARN A;  2O6Q A;  1A4Y A;  4R5D A;  3RFS A;  2Z82 A;  5AWB A;  3UL8 A;  3OGL B;  4Z94 G;  4NKG A;  2IFG A;  1O6V A;  4FD0 A;  5GMG A;  4R58 A;  2JE1 A;  4IM6 A;  1KOH A;  2ELL A;  3OJA A;  2P1N B;  4R6G A;  1XCD A;  1DFJ I;  3WPG A;  4L3F A;  4I6J B;  3M19 A;  4U7L A;  1XEU A;  5LFN A;  2BEX A;  4U09 A;  2UZX A;  1OTO A;  3ZYN A;  4Q3I A;  5AWD A;  4QC0 A;  1D0B A;  1KOO A;  4OQT A;  3RIZ A;  2ID5 A;  2OMY A;  1XKU A;  2CA6 A;  1M0Z A;  1IO0 A;  5IJD A;  1FT8 A;  4LSA A;  4WYK A;  5HDH A;  4PKI G;  4V2C A;  4RCA B;  4QBZ A;  4ARR A;  5IJC A;  1SQ0 B;  4LXS A;  1W8A A;  2V9T B;  1K5G C;  1FQV A;  5A5C A;  5AWA A;  2OMU A;  4Z64 C;  5IYX C;  1OTN A;  1FS2 A;  4QXE A;  4EZG A;  2P1Q B;  2Z66 A;  1PGV A;  3W3M A;  3G04 C;  4BSR A;  4M7E A;  3OJA B;  4UFR A;  2Z81 A;  5GQR K;  2WQX A;  3UL7 A;  5FTT B;  4BV4 R;  3ZYO A;  3RFJ A;  4YEB B;  3WPE A;  1P8T A;  4P8S A;  2OMV A;  3CVR A;  4R08 A;  4CNM A;  1ZIW A;  5GS2 B;  2JQD A;  3E3Z A;  4LSX A;  3UL9 A;  4PSJ A;  1DS9 A;  1K5D C;  2Z63 A;  1H6U A;  2BNH A;  3RW7 A;  2ASS B;  4KNG A;  3O6N A;  1WWL A;  1OZN A;  4P91 A;  3RFE A;  5CMN A;  3UN9 A;  5D3I A;  1DCE A;  1QYY A;  1LTX A;  3WPF A;  1A9N A;  4U06 A;  2WFH A;  1YRG A;  4R07 A;  4LI1 A;  3RGX A;  4LI2 A;  2P1M B;  2V9S A;  4Z8G A;  2OMW A;  4MQW X;  4XOS A;  4Q62 A;  2Z62 A;  4RWT C;  4ECO A;  4RCW A;  3ULV A;  1M10 B;  4R6F A;  3VQ2 A;  4GLP A;  2WQV A;  4Z61 C;  2Z65 A;  2P1O B;  4Y61 B;  5B4P A;  3M18 A;  4M7E C;  1M9S A;  1G9U A;  4R6A A;  2O6S A;  3WN4 A;  3P72 A;  2AST B;  2JE0 A;  3E6J A;  2WQU A;  2Z7X A;  3E4G A;  4FS7 A;  2WQW A;  4L3A A;  2UZY A;  3OGM B;  3CIY A;  4LSC A;  3PMH G;  4XSQ A;  4PER A;  4H09 A;  4AW4 A;  3W3L A;  4CC4 A;  2V70 A;  1M9L A;  2O6R A;  3WPH A;  1GWB A;  4LSX C;  4CNC A;  5AZ5 A;  3WPD A;  2A0Z A;  3W3J A;  1OTM A;  4GT6 A;  1U0N D;  1XWD C;  4PQ8 A;  1JL5 A;  3C6O B;  3W3G A;  4J4L A;  3O53 A;  4KT1 A;  4V2D A;  5CMP A;  3ULA A;  3KJ4 A;  4K17 A;  5GMH A;  3REZ A;  2Z7X B;  1P8V A;  5B0N A;  3VQ1 A;  4XGO A;  5HZL B;  3BZ5 A;  3W3K A;  5B0T A;  3CIG A;  4FCG A;  2Y5Q A;  3SB4 A;  3JB9 j;  2FT3 A;  3C6N B;  4LXR A;  4CP6 A;  3WPI A;  4R5C A;  2XOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...