4PEQB

Structure of bovine ribonuclease inhibitor complexed with bovine ribonuclease i
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
456
structure length
453
Chain Sequence
MKLDIQCEQLSDARWTELLPLIQQYEVVRLDDCGLTEVRCKDIGSALQANASLTELSLRTNELGDGGVLLVLQGLQSPTCKIQKLSLQNCCLTEAGCGVLPGVLRSLPTLRELHLSDNPLGDAGLRLLCEGLLDRLEKLQLEYCSLTAASCEPLAAVLRATRDLKELVVSNNDIGEAGVQALCRGLAESACQLETLKLENCGLTAANCKDLCGIVASQASLKDLDLGSNRLGDAGLAELCPGLLSPSSQLRTLWLWECDLTVSGCRELCRVLQAKEALKELSLAGNSLGDEGAQLLCESLLQPGCQLESLWVKSCGFTAACCQHFSSMLTQNKHLLELQLSSNPLGDAGVHVLCQALGQPGTVLRVLWVGDCELTNSSCGGLASLLLASPSLRELDLSNNGLGDPGVLQLLGSLEQPACSLEQLVLYDIYWTEAVDERLRAVEESKPGLRIIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease pancreatic
publication title Functional evolution of ribonuclease inhibitor: insights from birds and reptiles.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 184
structure length 453
sequence length 456
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13516 LRR_6 Leucine Rich repeat
B PF18779 LRR_RI_capping Capping Ribonuclease inhibitor Leucine Rich Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4peqB00
2WFHA 2Z62A 1KOOA 1LTXA 2BEXA 2UZXA 2V9SA 3VQ2A 3W3JA 3ZYOA 5B0NA 5AWCA 4BSUA 2Z7XB 1WWLA 4LSCA 4UFRA 2V70A 4WP6A 5CMPA 3G3BA 4BV4R 4PERA 3RFEA 3C6OB 2ID5A 4AY9X 1XWDC 3W3GA 3C6PB 2Z64A 4FCGA 3KJ4A 4CNMA 2OMVA 4AW4A 4V2DA 2P1PB 4C2AB 2OMZA 4Z64C 3RJ0A 1H6UA 2JQDA 2P1QB 2WQVA 3GOZA 3G39A 4TZHA 2OMTA 4R07A 1P8VA 4CC4C 4XSQA 4Y61B 4CC4A 4ARNA 3FXIA 3REZA 4R6GA 4Z79A 3G3AA 3RGZA 4P91A 1DCEA 4FMZA 2Z81A 4MN8B 3ZYNA 3WPIA 3E3ZA 4Z94G 3UN9A 4KT1A 3VQ1A 3O6NA 3M18A 2P1OB 3RFSA 1O6TA 3W3MA 1OTOA 3O53A 1M10B 4ECOA 3W3NA 2Z65A 1KOHA 3G04C 5B0TA 4L3FA 2Z63A 5IJCA 5GS2B 4U06A 1YRGA 1XEUA 5AWBA 4CP6A 4ARRA 3E4GA 4LXRA 1P9AG 5AZ5A 4NKHA 4R58A 2Y5QA 2BNHA 1OTNA 4EZGA 4V2CA 3ULUA 3E6JA 1H6TA 4R08A 4K17A 4PSJA 3CVRA 1GWBA 2WQWA 4KXFB 4L3AA 3RIZA 1K5GC 4R0AA 1FT8A 3WN4A 3ULAA 3OGMB 4C2BB 2V9TB 3UL9A 1SQ0B 5GQRK 4XGOA 3JB9j 3WPHA 2WQXA 1QYYA 3W3KA 4Z8GA 5CMNA 2UZYA 1XCDA 2IFGA 3OGLB 1D0BA 4LI2A 3RW6A 3RGXA 1W8AA 2OMXA 1PGVA 4BSSA 4U7LA 1IO0A 2OMWA 5HZLB 1M9LA 3ZYJA 2Z82A 4LSAA 4FDWA 4R5CA 4R5DA 1M9SA 4FHOA 4PKIG 4J0MA 5IYXC 2JE1A 4QXEA 4Z61C 2O6SA 4U08A 5HDHA 3G06A 3OGKB 2RA8A 3WPGA 5D3IA 1XECA 4I6JB 1OGQA 1A9NA 4FD0A 2R9UA 2XWTC 4Q3IA 1OTMA 5IJBA 1FQVA 2Z66A 4P8SA 4XOSA 5LFNA 4RCAB 1P8TA 3SB4A 5GMGA 2WQUA 3WPEA 1DS9A 4KNGA 5A5CA 3WPBA 5IJDA 4LSXC 2FT3A 1M0ZA 3OJAA 1DFJI 4GT6A 2P1NB 4Q62A 4LSXA 5AWDA 4LXSA 4R6JA 1O6SA 3P72A 2OMUA 1FS2A 3UL7A 4IM6A 5GMFA 2ELLA 3TSRE 4G8AA 4LI1A 2CA6A 1G9UA 3CIGA 5GMHA 5AWAA 4U09A 3C6NB 2O6RA 4GLPA 4V2EA 4PEQB 4PQ8A 4QC0A 4CNCA 1OOKG 2ASTB 2JE0A 4OQTA 5GS0A 3E2JA 3WPFA 2Z7XA 3W3LA 4FS7A 4RWTC 4R6AA 1FO1A 5FTTB 2OMYA 2XOTA 4YEBB 4QBZA 3A79B 3ZYIA 3OJAB 3WPDA 2O6QA 4B8CD 4ECNA 4M7EC 3PMHG 4MQWX 5B4PA 3WPCA 1U0ND 4RCWA 3RFJA 4R09A 4M7EA 2ASSB 3BZ5A 4CILA 1A4YA 1K5DC 4BSRA 1Z7XW 3RW7A 4NKGA 4HQ1A 2P1MB 3DZEA 3ULVA 4H09A 1XKUA 3UL8A 2Q4GW 1OZNA 2A0ZA 3CIYA 2RR6A 1O6VA 4R6FA 1ZIWA 4J4LA 4Q3GA 1JL5A 3M19A 4WYKA
chains in the Genus database with same CATH superfamily
2WFHA 2Z62A 1KOOA 1LTXA 2BEXA 2UZXA 2V9SA 3VQ2A 3W3JA 3ZYOA 5B0NA 5AWCA 4BSUA 2Z7XB 1WWLA 4LSCA 4UFRA 2V70A 4WP6A 5CMPA 3G3BA 4BV4R 4PERA 3RFEA 3C6OB 2ID5A 4AY9X 1XWDC 3W3GA 3C6PB 2Z64A 4FCGA 3KJ4A 4CNMA 2OMVA 4AW4A 4V2DA 2P1PB 4C2AB 2OMZA 4Z64C 3RJ0A 1H6UA 2JQDA 2P1QB 2WQVA 3GOZA 3G39A 4TZHA 2OMTA 4R07A 1P8VA 4CC4C 4XSQA 4Y61B 4CC4A 4ARNA 3FXIA 3REZA 4R6GA 4Z79A 3G3AA 3RGZA 4P91A 1DCEA 4FMZA 2Z81A 4MN8B 3ZYNA 3WPIA 3E3ZA 4Z94G 3UN9A 4KT1A 3VQ1A 3O6NA 3M18A 2P1OB 3RFSA 1O6TA 3W3MA 1OTOA 3O53A 1M10B 4ECOA 3W3NA 2Z65A 1KOHA 3G04C 5B0TA 4L3FA 2Z63A 5IJCA 5GS2B 4U06A 1YRGA 1XEUA 5AWBA 4CP6A 4ARRA 3E4GA 4LXRA 1P9AG 5AZ5A 4NKHA 4R58A 2Y5QA 2BNHA 1OTNA 4EZGA 4V2CA 3ULUA 3E6JA 1H6TA 4R08A 4NZRM 4K17A 4PSJA 3CVRA 1GWBA 2WQWA 4KXFB 4L3AA 3RIZA 1K5GC 4R0AA 1FT8A 3WN4A 3ULAA 3OGMB 4C2BB 2V9TB 3UL9A 1SQ0B 5GQRK 4XGOA 3JB9j 3WPHA 2WQXA 1QYYA 3W3KA 4Z8GA 5CMNA 2UZYA 1XCDA 2IFGA 3OGLB 1D0BA 4LI2A 3RW6A 3RGXA 1W8AA 2OMXA 1PGVA 4BSSA 4U7LA 1IO0A 2OMWA 5HZLB 1M9LA 3ZYJA 2Z82A 4LSAA 4FDWA 4R5CA 4R5DA 1M9SA 4FHOA 4PKIG 4J0MA 5IYXC 2JE1A 4QXEA 4Z61C 2O6SA 4U08A 5HDHA 3G06A 3OGKB 2RA8A 3WPGA 5D3IA 1XECA 4I6JB 1OGQA 1A9NA 4FD0A 2R9UA 2XWTC 4Q3IA 1OTMA 5IJBA 1FQVA 2Z66A 4P8SA 4XOSA 5LFNA 4RCAB 1P8TA 3SB4A 5GMGA 2WQUA 3WPEA 1DS9A 4KNGA 5A5CA 3WPBA 5IJDA 4LSXC 2FT3A 1M0ZA 3OJAA 1DFJI 4GT6A 2P1NB 4Q62A 4LSXA 5AWDA 4LXSA 4R6JA 1O6SA 3P72A 4NZTM 2OMUA 1FS2A 3UL7A 4IM6A 5GMFA 2ELLA 3TSRE 4G8AA 4LI1A 2CA6A 1G9UA 3CIGA 5GMHA 5AWAA 4U09A 3C6NB 2O6RA 4GLPA 4V2EA 4PEQB 4PQ8A 4QC0A 4CNCA 1OOKG 2ASTB 2JE0A 4OQTA 5GS0A 3E2JA 3WPFA 2Z7XA 3W3LA 4FS7A 4RWTC 4R6AA 1FO1A 5FTTB 2OMYA 2XOTA 4YEBB 4QBZA 3A79B 3ZYIA 3OJAB 3WPDA 2O6QA 4B8CD 4ECNA 4M7EC 3PMHG 4MQWX 5B4PA 3WPCA 1U0ND 4RCWA 3RFJA 4R09A 4M7EA 2ASSB 3BZ5A 4CILA 1A4YA 1K5DC 4BSRA 1Z7XW 3RW7A 4NKGA 4HQ1A 2P1MB 3DZEA 3ULVA 4H09A 1XKUA 3UL8A 2Q4GW 1OZNA 2A0ZA 3CIYA 2RR6A 1O6VA 4R6FA 1ZIWA 4J4LA 4Q3GA 1JL5A 3M19A 4WYKA
chains in the Genus database with same CATH topology
2WFHA 2Z62A 1KOOA 1LTXA 2BEXA 2UZXA 2V9SA 3VQ2A 3W3JA 3ZYOA 5B0NA 5AWCA 4BSUA 2Z7XB 1WWLA 4LSCA 4UFRA 2V70A 4WP6A 5CMPA 3G3BA 4BV4R 4PERA 3RFEA 3C6OB 2ID5A 4AY9X 1XWDC 3W3GA 3C6PB 2Z64A 4FCGA 3KJ4A 4CNMA 2OMVA 4AW4A 4V2DA 2P1PB 4C2AB 2OMZA 4Z64C 3RJ0A 1H6UA 2JQDA 2P1QB 2WQVA 3GOZA 3G39A 4TZHA 2OMTA 4R07A 1P8VA 4CC4C 4XSQA 4Y61B 4CC4A 4ARNA 3FXIA 3REZA 4R6GA 4Z79A 3G3AA 3RGZA 4P91A 1DCEA 4FMZA 2Z81A 4MN8B 3ZYNA 3WPIA 3E3ZA 4Z94G 3UN9A 4KT1A 3VQ1A 3O6NA 3M18A 2P1OB 3RFSA 1O6TA 3W3MA 1OTOA 3O53A 1M10B 4ECOA 3W3NA 2Z65A 1KOHA 3G04C 5B0TA 4L3FA 2Z63A 5IJCA 5GS2B 4U06A 1YRGA 1XEUA 5AWBA 4CP6A 4ARRA 3E4GA 4LXRA 1P9AG 5AZ5A 4NKHA 4R58A 2Y5QA 2BNHA 1OTNA 4EZGA 4V2CA 3ULUA 3E6JA 1H6TA 4R08A 4K17A 4PSJA 3CVRA 1GWBA 2WQWA 4KXFB 4L3AA 3RIZA 1K5GC 4R0AA 1FT8A 3WN4A 3ULAA 3OGMB 4C2BB 2V9TB 3UL9A 1SQ0B 5GQRK 4XGOA 3JB9j 3WPHA 2WQXA 1QYYA 3W3KA 4Z8GA 5CMNA 2UZYA 1XCDA 2IFGA 3OGLB 1D0BA 4LI2A 3RW6A 3RGXA 1W8AA 2OMXA 1PGVA 4BSSA 4U7LA 1IO0A 2OMWA 5HZLB 1M9LA 3ZYJA 2Z82A 4LSAA 4FDWA 4R5CA 4R5DA 1M9SA 4FHOA 4PKIG 4J0MA 5IYXC 2JE1A 4QXEA 4Z61C 2O6SA 4U08A 5HDHA 3G06A 3OGKB 2RA8A 3WPGA 5D3IA 1XECA 4I6JB 1OGQA 1A9NA 4FD0A 2R9UA 2XWTC 4Q3IA 1OTMA 5IJBA 1FQVA 2Z66A 4P8SA 4XOSA 5LFNA 4RCAB 1P8TA 3SB4A 5GMGA 2WQUA 3WPEA 1DS9A 4KNGA 5A5CA 3WPBA 5IJDA 4LSXC 2FT3A 1M0ZA 3OJAA 1DFJI 4GT6A 2P1NB 4Q62A 4LSXA 5AWDA 4LXSA 4R6JA 1O6SA 3P72A 2OMUA 1FS2A 3UL7A 4IM6A 5GMFA 2ELLA 3TSRE 4G8AA 4LI1A 2CA6A 1G9UA 3CIGA 5GMHA 5AWAA 4U09A 3C6NB 2O6RA 4GLPA 4V2EA 4PEQB 4PQ8A 4QC0A 4CNCA 1OOKG 2ASTB 2JE0A 4OQTA 5GS0A 3E2JA 3WPFA 2Z7XA 3W3LA 4FS7A 4RWTC 4R6AA 1FO1A 5FTTB 2OMYA 2XOTA 4YEBB 4QBZA 3A79B 3ZYIA 3OJAB 3WPDA 2O6QA 4B8CD 4ECNA 4M7EC 3PMHG 4MQWX 5B4PA 3WPCA 1U0ND 4RCWA 3RFJA 4R09A 4M7EA 2ASSB 3BZ5A 4CILA 1A4YA 1K5DC 4BSRA 1Z7XW 3RW7A 4NKGA 4HQ1A 2P1MB 3DZEA 3ULVA 4H09A 1XKUA 3UL8A 2Q4GW 1OZNA 2A0ZA 3CIYA 2RR6A 1O6VA 4R6FA 1ZIWA 4J4LA 4Q3GA 1JL5A 3M19A 4WYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WFH A;  2Z62 A;  1KOO A;  1LTX A;  2BEX A;  2UZX A;  2V9S A;  3VQ2 A;  3W3J A;  3ZYO A;  5B0N A;  5AWC A;  4BSU A;  2Z7X B;  1WWL A;  4LSC A;  4UFR A;  2V70 A;  4WP6 A;  5CMP A;  3G3B A;  4BV4 R;  4PER A;  3RFE A;  3C6O B;  2ID5 A;  4AY9 X;  1XWD C;  3W3G A;  3C6P B;  2Z64 A;  4FCG A;  3KJ4 A;  4CNM A;  2OMV A;  4AW4 A;  4V2D A;  2P1P B;  4C2A B;  2OMZ A;  4Z64 C;  3RJ0 A;  1H6U A;  2JQD A;  2P1Q B;  2WQV A;  3GOZ A;  3G39 A;  4TZH A;  2OMT A;  4R07 A;  1P8V A;  4CC4 C;  4XSQ A;  4Y61 B;  4CC4 A;  4ARN A;  3FXI A;  3REZ A;  4R6G A;  4Z79 A;  3G3A A;  3RGZ A;  4P91 A;  1DCE A;  4FMZ A;  2Z81 A;  4MN8 B;  3ZYN A;  3WPI A;  3E3Z A;  4Z94 G;  3UN9 A;  4KT1 A;  3VQ1 A;  3O6N A;  3M18 A;  2P1O B;  3RFS A;  1O6T A;  3W3M A;  1OTO A;  3O53 A;  1M10 B;  4ECO A;  3W3N A;  2Z65 A;  1KOH A;  3G04 C;  5B0T A;  4L3F A;  2Z63 A;  5IJC A;  5GS2 B;  4U06 A;  1YRG A;  1XEU A;  5AWB A;  4CP6 A;  4ARR A;  3E4G A;  4LXR A;  1P9A G;  5AZ5 A;  4NKH A;  4R58 A;  2Y5Q A;  2BNH A;  1OTN A;  4EZG A;  4V2C A;  3ULU A;  3E6J A;  1H6T A;  4R08 A;  4K17 A;  4PSJ A;  3CVR A;  1GWB A;  2WQW A;  4KXF B;  4L3A A;  3RIZ A;  1K5G C;  4R0A A;  1FT8 A;  3WN4 A;  3ULA A;  3OGM B;  4C2B B;  2V9T B;  3UL9 A;  1SQ0 B;  5GQR K;  4XGO A;  3JB9 j;  3WPH A;  2WQX A;  1QYY A;  3W3K A;  4Z8G A;  5CMN A;  2UZY A;  1XCD A;  2IFG A;  3OGL B;  1D0B A;  4LI2 A;  3RW6 A;  3RGX A;  1W8A A;  2OMX A;  1PGV A;  4BSS A;  4U7L A;  1IO0 A;  2OMW A;  5HZL B;  1M9L A;  3ZYJ A;  2Z82 A;  4LSA A;  4FDW A;  4R5C A;  4R5D A;  1M9S A;  4FHO A;  4PKI G;  4J0M A;  5IYX C;  2JE1 A;  4QXE A;  4Z61 C;  2O6S A;  4U08 A;  5HDH A;  3G06 A;  3OGK B;  2RA8 A;  3WPG A;  5D3I A;  1XEC A;  4I6J B;  1OGQ A;  1A9N A;  4FD0 A;  2R9U A;  2XWT C;  4Q3I A;  1OTM A;  5IJB A;  1FQV A;  2Z66 A;  4P8S A;  4XOS A;  5LFN A;  4RCA B;  1P8T A;  3SB4 A;  5GMG A;  2WQU A;  3WPE A;  1DS9 A;  4KNG A;  5A5C A;  3WPB A;  5IJD A;  4LSX C;  2FT3 A;  1M0Z A;  3OJA A;  1DFJ I;  4GT6 A;  2P1N B;  4Q62 A;  4LSX A;  5AWD A;  4LXS A;  4R6J A;  1O6S A;  3P72 A;  2OMU A;  1FS2 A;  3UL7 A;  4IM6 A;  5GMF A;  2ELL A;  3TSR E;  4G8A A;  4LI1 A;  2CA6 A;  1G9U A;  3CIG A;  5GMH A;  5AWA A;  4U09 A;  3C6N B;  2O6R A;  4GLP A;  4V2E A;  4PEQ B;  4PQ8 A;  4QC0 A;  4CNC A;  1OOK G;  2AST B;  2JE0 A;  4OQT A;  5GS0 A;  3E2J A;  3WPF A;  2Z7X A;  3W3L A;  4FS7 A;  4RWT C;  4R6A A;  1FO1 A;  5FTT B;  2OMY A;  2XOT A;  4YEB B;  4QBZ A;  3A79 B;  3ZYI A;  3OJA B;  3WPD A;  2O6Q A;  4B8C D;  4ECN A;  4M7E C;  3PMH G;  4MQW X;  5B4P A;  3WPC A;  1U0N D;  4RCW A;  3RFJ A;  4R09 A;  4M7E A;  2ASS B;  3BZ5 A;  4CIL A;  1A4Y A;  1K5D C;  4BSR A;  1Z7X W;  3RW7 A;  4NKG A;  4HQ1 A;  2P1M B;  3DZE A;  3ULV A;  4H09 A;  1XKU A;  3UL8 A;  2Q4G W;  1OZN A;  2A0Z A;  3CIY A;  2RR6 A;  1O6V A;  4R6F A;  1ZIW A;  4J4L A;  4Q3G A;  1JL5 A;  3M19 A;  4WYK A; 
#chains in the Genus database with same CATH topology
 2WFH A;  2Z62 A;  1KOO A;  1LTX A;  2BEX A;  2UZX A;  2V9S A;  3VQ2 A;  3W3J A;  3ZYO A;  5B0N A;  5AWC A;  4BSU A;  2Z7X B;  1WWL A;  4LSC A;  4UFR A;  2V70 A;  4WP6 A;  5CMP A;  3G3B A;  4BV4 R;  4PER A;  3RFE A;  3C6O B;  2ID5 A;  4AY9 X;  1XWD C;  3W3G A;  3C6P B;  2Z64 A;  4FCG A;  3KJ4 A;  4CNM A;  2OMV A;  4AW4 A;  4V2D A;  2P1P B;  4C2A B;  2OMZ A;  4Z64 C;  3RJ0 A;  1H6U A;  2JQD A;  2P1Q B;  2WQV A;  3GOZ A;  3G39 A;  4TZH A;  2OMT A;  4R07 A;  1P8V A;  4CC4 C;  4XSQ A;  4Y61 B;  4CC4 A;  4ARN A;  3FXI A;  3REZ A;  4R6G A;  4Z79 A;  3G3A A;  3RGZ A;  4P91 A;  1DCE A;  4FMZ A;  2Z81 A;  4MN8 B;  3ZYN A;  3WPI A;  3E3Z A;  4Z94 G;  3UN9 A;  4KT1 A;  3VQ1 A;  3O6N A;  3M18 A;  2P1O B;  3RFS A;  1O6T A;  3W3M A;  1OTO A;  3O53 A;  1M10 B;  4ECO A;  3W3N A;  2Z65 A;  1KOH A;  3G04 C;  5B0T A;  4L3F A;  2Z63 A;  5IJC A;  5GS2 B;  4U06 A;  1YRG A;  1XEU A;  5AWB A;  4CP6 A;  4ARR A;  3E4G A;  4LXR A;  1P9A G;  5AZ5 A;  4NKH A;  4R58 A;  2Y5Q A;  2BNH A;  1OTN A;  4EZG A;  4V2C A;  3ULU A;  3E6J A;  1H6T A;  4R08 A;  4NZR M;  4K17 A;  4PSJ A;  3CVR A;  1GWB A;  2WQW A;  4KXF B;  4L3A A;  3RIZ A;  1K5G C;  4R0A A;  1FT8 A;  3WN4 A;  3ULA A;  3OGM B;  4C2B B;  2V9T B;  3UL9 A;  1SQ0 B;  5GQR K;  4XGO A;  3JB9 j;  3WPH A;  2WQX A;  1QYY A;  3W3K A;  4Z8G A;  5CMN A;  2UZY A;  1XCD A;  2IFG A;  3OGL B;  1D0B A;  4LI2 A;  3RW6 A;  3RGX A;  1W8A A;  2OMX A;  1PGV A;  4BSS A;  4U7L A;  1IO0 A;  2OMW A;  5HZL B;  1M9L A;  3ZYJ A;  2Z82 A;  4LSA A;  4FDW A;  4R5C A;  4R5D A;  1M9S A;  4FHO A;  4PKI G;  4J0M A;  5IYX C;  2JE1 A;  4QXE A;  4Z61 C;  2O6S A;  4U08 A;  5HDH A;  3G06 A;  3OGK B;  2RA8 A;  3WPG A;  5D3I A;  1XEC A;  4I6J B;  1OGQ A;  1A9N A;  4FD0 A;  2R9U A;  2XWT C;  4Q3I A;  1OTM A;  5IJB A;  1FQV A;  2Z66 A;  4P8S A;  4XOS A;  5LFN A;  4RCA B;  1P8T A;  3SB4 A;  5GMG A;  2WQU A;  3WPE A;  1DS9 A;  4KNG A;  5A5C A;  3WPB A;  5IJD A;  4LSX C;  2FT3 A;  1M0Z A;  3OJA A;  1DFJ I;  4GT6 A;  2P1N B;  4Q62 A;  4LSX A;  5AWD A;  4LXS A;  4R6J A;  1O6S A;  3P72 A;  4NZT M;  2OMU A;  1FS2 A;  3UL7 A;  4IM6 A;  5GMF A;  2ELL A;  3TSR E;  4G8A A;  4LI1 A;  2CA6 A;  1G9U A;  3CIG A;  5GMH A;  5AWA A;  4U09 A;  3C6N B;  2O6R A;  4GLP A;  4V2E A;  4PEQ B;  4PQ8 A;  4QC0 A;  4CNC A;  1OOK G;  2AST B;  2JE0 A;  4OQT A;  5GS0 A;  3E2J A;  3WPF A;  2Z7X A;  3W3L A;  4FS7 A;  4RWT C;  4R6A A;  1FO1 A;  5FTT B;  2OMY A;  2XOT A;  4YEB B;  4QBZ A;  3A79 B;  3ZYI A;  3OJA B;  3WPD A;  2O6Q A;  4B8C D;  4ECN A;  4M7E C;  3PMH G;  4MQW X;  5B4P A;  3WPC A;  1U0N D;  4RCW A;  3RFJ A;  4R09 A;  4M7E A;  2ASS B;  3BZ5 A;  4CIL A;  1A4Y A;  1K5D C;  4BSR A;  1Z7X W;  3RW7 A;  4NKG A;  4HQ1 A;  2P1M B;  3DZE A;  3ULV A;  4H09 A;  1XKU A;  3UL8 A;  2Q4G W;  1OZN A;  2A0Z A;  3CIY A;  2RR6 A;  1O6V A;  4R6F A;  1ZIW A;  4J4L A;  4Q3G A;  1JL5 A;  3M19 A;  4WYK A; 
#chains in the Genus database with same CATH homology
 2WFH A;  2Z62 A;  1KOO A;  1LTX A;  2BEX A;  2UZX A;  2V9S A;  3VQ2 A;  3W3J A;  3ZYO A;  5B0N A;  5AWC A;  4BSU A;  2Z7X B;  1WWL A;  4LSC A;  4UFR A;  2V70 A;  4WP6 A;  5CMP A;  3G3B A;  4BV4 R;  4PER A;  3RFE A;  3C6O B;  2ID5 A;  4AY9 X;  1XWD C;  3W3G A;  3C6P B;  2Z64 A;  4FCG A;  3KJ4 A;  4CNM A;  2OMV A;  4AW4 A;  4V2D A;  2P1P B;  4C2A B;  2OMZ A;  4Z64 C;  3RJ0 A;  1H6U A;  2JQD A;  2P1Q B;  2WQV A;  3GOZ A;  3G39 A;  4TZH A;  2OMT A;  4R07 A;  1P8V A;  4CC4 C;  4XSQ A;  4Y61 B;  4CC4 A;  4ARN A;  3FXI A;  3REZ A;  4R6G A;  4Z79 A;  3G3A A;  3RGZ A;  4P91 A;  1DCE A;  4FMZ A;  2Z81 A;  4MN8 B;  3ZYN A;  3WPI A;  3E3Z A;  4Z94 G;  3UN9 A;  4KT1 A;  3VQ1 A;  3O6N A;  3M18 A;  2P1O B;  3RFS A;  1O6T A;  3W3M A;  1OTO A;  3O53 A;  1M10 B;  4ECO A;  3W3N A;  2Z65 A;  1KOH A;  3G04 C;  5B0T A;  4L3F A;  2Z63 A;  5IJC A;  5GS2 B;  4U06 A;  1YRG A;  1XEU A;  5AWB A;  4CP6 A;  4ARR A;  3E4G A;  4LXR A;  1P9A G;  5AZ5 A;  4NKH A;  4R58 A;  2Y5Q A;  2BNH A;  1OTN A;  4EZG A;  4V2C A;  3ULU A;  3E6J A;  1H6T A;  4R08 A;  4K17 A;  4PSJ A;  3CVR A;  1GWB A;  2WQW A;  4KXF B;  4L3A A;  3RIZ A;  1K5G C;  4R0A A;  1FT8 A;  3WN4 A;  3ULA A;  3OGM B;  4C2B B;  2V9T B;  3UL9 A;  1SQ0 B;  5GQR K;  4XGO A;  3JB9 j;  3WPH A;  2WQX A;  1QYY A;  3W3K A;  4Z8G A;  5CMN A;  2UZY A;  1XCD A;  2IFG A;  3OGL B;  1D0B A;  4LI2 A;  3RW6 A;  3RGX A;  1W8A A;  2OMX A;  1PGV A;  4BSS A;  4U7L A;  1IO0 A;  2OMW A;  5HZL B;  1M9L A;  3ZYJ A;  2Z82 A;  4LSA A;  4FDW A;  4R5C A;  4R5D A;  1M9S A;  4FHO A;  4PKI G;  4J0M A;  5IYX C;  2JE1 A;  4QXE A;  4Z61 C;  2O6S A;  4U08 A;  5HDH A;  3G06 A;  3OGK B;  2RA8 A;  3WPG A;  5D3I A;  1XEC A;  4I6J B;  1OGQ A;  1A9N A;  4FD0 A;  2R9U A;  2XWT C;  4Q3I A;  1OTM A;  5IJB A;  1FQV A;  2Z66 A;  4P8S A;  4XOS A;  5LFN A;  4RCA B;  1P8T A;  3SB4 A;  5GMG A;  2WQU A;  3WPE A;  1DS9 A;  4KNG A;  5A5C A;  3WPB A;  5IJD A;  4LSX C;  2FT3 A;  1M0Z A;  3OJA A;  1DFJ I;  4GT6 A;  2P1N B;  4Q62 A;  4LSX A;  5AWD A;  4LXS A;  4R6J A;  1O6S A;  3P72 A;  2OMU A;  1FS2 A;  3UL7 A;  4IM6 A;  5GMF A;  2ELL A;  3TSR E;  4G8A A;  4LI1 A;  2CA6 A;  1G9U A;  3CIG A;  5GMH A;  5AWA A;  4U09 A;  3C6N B;  2O6R A;  4GLP A;  4V2E A;  4PEQ B;  4PQ8 A;  4QC0 A;  4CNC A;  1OOK G;  2AST B;  2JE0 A;  4OQT A;  5GS0 A;  3E2J A;  3WPF A;  2Z7X A;  3W3L A;  4FS7 A;  4RWT C;  4R6A A;  1FO1 A;  5FTT B;  2OMY A;  2XOT A;  4YEB B;  4QBZ A;  3A79 B;  3ZYI A;  3OJA B;  3WPD A;  2O6Q A;  4B8C D;  4ECN A;  4M7E C;  3PMH G;  4MQW X;  5B4P A;  3WPC A;  1U0N D;  4RCW A;  3RFJ A;  4R09 A;  4M7E A;  2ASS B;  3BZ5 A;  4CIL A;  1A4Y A;  1K5D C;  4BSR A;  1Z7X W;  3RW7 A;  4NKG A;  4HQ1 A;  2P1M B;  3DZE A;  3ULV A;  4H09 A;  1XKU A;  3UL8 A;  2Q4G W;  1OZN A;  2A0Z A;  3CIY A;  2RR6 A;  1O6V A;  4R6F A;  1ZIW A;  4J4L A;  4Q3G A;  1JL5 A;  3M19 A;  4WYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...