4PETA

Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
329
structure length
329
Chain Sequence
DKKYRWKLAETWGPNFPIFGDATKNMAKMVKEMSNGRLTIRIDSSNKHKSALGIFDFVKSGQYQMGHSASYYWKGKNFNTMFFTTVPFGMIASEQHAWFYYGGGMELMKKVYDQYGIMSFPGGNTGNQMGGWFKKEINSVEDLKGLKMRIPGFAGEVLAKLGAKPTNIPSGELYTALERNTIDALEWVGPSLDLRMGFHKIAPYYYTGWHEPGTELQFMVNQKAYNSLPKDLQKILTVAMKAAAYDMYSQSMHASGVNLASLKKDYPNVQMRSFPKPVMEAIVQANDELLEEFAAKDPMTAEILKSLNDYKHQIRAWTNLSDRAYLDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein, family 7
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Colwellia psychrerythraea
molecule tags Solute-binding protein
total genus 104
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4petA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4petA01
4IY5A 2H98A 3GZGA 3ZS6A 4C1UA 5I58B 3P7IA 4JSDA 1MY3A 1Y4CA 3OO8A 3W9WA 3MAMA 4FE8A 4R72A 5I7IA 2UYEA 4NQ8A 1B0LA 4PDDA 4OVJA 1AH5A 2NVUB 2DWIA 1DOTA 2NUVA 4DLDA 2XXKA 1GVCA 3DLNA 1LCTA 3T9UA 3QXMA 2F97A 3ZKKA 1EZPA 4PF6A 1VE4A 1T0KA 4O3CA 1QKAA 5I2NA 3S9EA 1B3FA 1MY1A 2ZNTA 3ONMA 2Y7KA 4NG7A 4RK9A 2VHAA 3IORA 1N7WA 2RKMA 3FASA 3KGCA 2BJJX 5A5XB 1H3DA 1XOCA 1LFHA 1BP5A 4DCXA 4NF6B 2OWSA 4YKJA 2Z8DA 2UXAA 5H8FB 1FTMA 4PE3A 3KN7A 5TU0A 2UYFA 1DMBA 2RINA 4YB5A 2Y7IA 3MP1A 2DVCA 4PC9A 4F3SA 1GTKA 4NWDA 1AOVA 3C33A 4XKQA 4U2RA 2ZYKA 4U23A 5DT6A 2Y7PA 2HZLA 2QL3A 4N4UA 2XD3A 1A8EA 2D3IA 5DYHA 3S9LC 2QJEA 4TOZA 1TWYA 5I56A 5L8DA 3FD3A 2M8CA 2ZYMA 3LSWA 3TCGA 1WVJA 2XWVA 1JVXA 1SQYA 3CR9A 3C4MA 4L17A 4IY6A 2HXWA 2A5TB 3ZKLA 3LSXA 3S9MC 2ZXTA 4WXJA 4KYSA 4H8IA 4OTEA 3MVWA 3SKPA 4PAKA 3TEPA 3V5AA 1Q1KA 4XTCQ 3C34A 4DXBA 3DP8A 3O6GA 4H65A 3SEUA 2HPGA 2P2AA 4LQ2A 2RCAA 1LB8A 1P1QA 1NMUA 2YPNA 2RCBA 4JWYA 1USYE 4DE8A 2XA5A 1MPCA 3USDA 5K2YA 1RYXA 4LVQA 4G77A 5AA4A 5CBSA 1UTHA 1B3LA 4KR5A 1MXWA 4OEVA 5DTBA 1IIWA 3RN8A 2Q88A 3PPPA 1B2HA 2VOZA 1A7LA 1NH7A 2DOJA 4R2FA 4N17A 3R7XA 1ZLQA 4MNCA 4R73A 1LAHE 1B52A 2E0SA 3EF7A 1S7YA 2GHBA 2FA7A 4X8RA 4EF2A 1ZTYA 3THIA 1BTJA 1CB6A 1SDXA 3K6XA 4BDOA 4R6HA 2ANJA 2O69A 4OVRA 4YKIA 3O28A 1B0HA 1S50A 2DE2A 5JTYA 3F11A 4EXLA 2Z8EA 4NE4A 3K6WA 1UIUA 3TKDA 3CG1A 4DI4B 4RJZA 1XHYA 2X7QA 4NTLA 1B40A 4OVSA 3BKIB 3PUVE 4KYEA 1B6HA 1B7ZA 5I84A 2UVIA 1Z7NE 4O7MA 2R9JA 3R6UA 1BIYA 3LUYA 4X1DA 1QKBA 4I1DA 2F5XA 4F18A 3FXUA 4YMAA 1VR5A 4ZEIA 4R75A 1QUIA 1Q35A 4DDDA 1N0TA 4PF8A 4MHFA 2GRVA 1MY2A 4GLIA 2O7IA 1Z7ME 3IB2A 4F3GA 3PV0E 3M8UA 4MLQA 3I6VA 2F6PA 3ODBA 5EYFA 2F35A 5CMCA 3CFZA 3U8QA 3KN8A 3IR1A 3FUZA 1WODA 3RUMA 2ZYOA 1XC1A 4OENA 1MDP1 2UVGA 4OETA 2LAOA 5CM6A 3FIRA 1M5DA 3H03A 2IEEA 3VVEA 4ZE9A 4IO4A 4U21A 4PCDA 3VXCA 2Q8JA 3IL1B 5AA4B 3PMVA 3M3LA 1YPNA 4IGRA 4YAHX 4ZZEA 2DE3A 2XWKA 3BBRA 3TTNA 1B46A 3TQLA 5L9MA 5TPAA 4POXA 1IZ1A 3DP4A 4F19A 1SYHA 5CI5A 5FHNA 3KG2A 4EF1A 4P1LA 2F78A 4O3AA 1OQGA 3EN3A 3U92A 4FJPA 3T66A 2F6GA 1VFEA 1Y20A 3A3CA 4POWA 3WAFA 5F7VA 4OVPA 3C9HA 2XHDA 4UACA 1I6BA 2OLBA 3D4CA 2AL4A 5JTYB 4AQ4A 1YCJA 2CZLA 3RQTA 1TT1A 1MS7A 3GXAA 2PMSA 4R9FA 2XD2A 2NOOA 4GRKA 2ONSA 3EQ1A 3FZVA 1NNFA 3H4ZA 4QSCA 2PFZA 1LLSA 2X7PA 4LATA 4PFUA 1MY4A 1A99A 2F7CA 2I0CA 1TFDA 5ELVA 2F36A 2HAVA 3FXRA 2DXRA 1RKMA 2H25A 3N6UA 3B6QA 2XXIA 2WYPA 4PQJA 4M4GA 3CFXA 4RY1A 3IO6A 1HSJA 3VLVA 4P8BA 1N7XA 2WX9A 3MBPA 3TODA 2FNCA 2O1LA 5FTIA 1IQ7A 3JV9A 3IAZA 2P0SA 1SVXB 4NMYA 3SEYA 2ZNSA 3T93B 3IOVA 3MJNA 4Q5TA 3M3KA 3RT8A 3R26A 1NNTA 3SEVA 3N5LA 1B9JA 3QIMA 3KSXA 4MIJA 4LZ5A 3ILTB 2PT2A 1IXCA 1NH8A 2RC8A 5HBCA 3IOWA 4X9TA 4XEQA 2Q9TA 4ECFA 2Q89A 4KI0E 4OHNA 4R6KA 4YB7A 1N3XA 3OELA 5I57A 1LB9A 1MXZA 1JW4A 4BDMA 3O66A 5I59A 3PPQA 2DWJA 2B65A 5TPAB 1B5IA 3QUFA 4LZ7A 3JZJA 4HTGA 2I4CA 3HCQA 3VVFA 1MPDA 1PC3A 4YU0A 5B7DA 3IOUA 3N26A 1AMFA 1FCKA 5CMBA 1B3GA 4MEVA 4ESXA 1VFDA 3EHUA 3UGWA 3SETA 4EXKA 3IJXB 1ZBMA 4PDHA 3UP9A 4Q30B 1FQBA 1H44A 3OSQA 1JEUA 2I4BA 1LCFA 4GD5A 4ELOA 2VD2A 2GHAA 3EHTA 4G4PA 2Z8FA 3H6WA 2G93A 3JYRA 2XXXA 2A5SA 4GL0A 3G7WA 4QSEA 3FJGA 4QFOA 4Q0CA 4DCYA 4G2ZA 2GFEA 3TTMA 5H8SA 3E4RA 4JSOA 4MBPA 1XS5A 3CG3A 4FECA 3E13X 2XX7A 2ZZXA 4FATA 4LN5A 1MG1A 4F22A 2ZNUA 2PYYA 2D21A 5DEXA 4KPTA 1SW1A 3UORA 2XXRA 3VE1B 4P0IA 5CMMA 3SEWA 3TTRA 4QFLA 4KYDA 1MQHA 1D9VA 4F29A 3V83A 2V3UA 4O3BA 4P3LA 4GOTA 3WAEA 3U1OA 1PBPA 4IO2A 3IO4A 4XKRA 4NGUA 1D9YA 4RYAA 1NFTA 4FIMA 3C36A 4G8MA 3CFLA 1FQFA 3RT6B 2XXUA 1SW2A 3QSLA 1US4A 1H45A 3OEKA 5BWJA 4OERA 3CRBA 3LC8A 2Y7RA 3PUXE 5I57B 4ZEBA 1P1UA 1WDNA 2Q2CA 2Y7WA 1OVBA 1XVXA 5I59B 4R2BA 2OZZA 2ZMBA 2DS9A 2O68A 1GGGA 4IO5A 5DVIA 3T9VA 1EH3A 3G3KA 1MXXA 4PFIA 2CMOA 1YTVA 4LUBA 4IO6A 2F8DA 1P1WA 3SESA 5AA3A 1II5A 4P56A 3PPOA 4X04A 3MPKA 3E9XA 2XX8A 1ZU0A 2REJA 2DP8A 2UVJA 2FYIA 4U1ZA 3OD7A 3KBRA 1Y9UA 4F3PA 4EDPA 5I2NB 2I48A 3H3GA 1FTKA 1Y3PA 4EQ7A 4YKPA 1N3WA 2OK2A 1MXVA 2OWTA 3DM0A 5IKBA 5ICQA 1QVSA 5TP9A 1A8FA 2XXWA 3HHGA 5FHOA 3KOTA 3U93A 4GQOA 4PGNA 4OFJA 3TTKA 3L6HA 3FVKA 3H6UA 4GFRA 3D4GA 3VXBA 1N04A 1B51A 5J1DA 4FEBA 3EPEA 3OSRA 3U72A 4DI3D 2DE4A 4OANA 2ZZWA 2HCAA 1DSNA 5EHMA 1MH3A 3RNNA 3CSBA 5L9SA 4JXIA 3PGFA 3UA8A 4P0GA 2ESNA 3IOTA 1LFIA 1POTA 3FV1A 5DEXB 4DXUA 2Q2AA 1BLFA 5I56B 1IITA 4P47A 1QJMA 3TCFA 2V3TA 3PD8A 4LQ5A 2WKYA 3IB0A 1R9LA 3O97A 2H99A 5CBRA 4NF8A 1CE2A 4GIZA 4G68C 2QMWA 1M5CA 1FTJA 3HHFA 2QS3A 3K2DA 3A3UA 2IA4A 4N15A 4OMBA 3LSFB 2DWHA 4MAGA 1I69A 5H8QA 3IB1A 3U94A 3FJMA 4XF5A 4MCOA 3MZBA 4N8YA 4GXSB 4XKNA 4PBHA 1LFGA 4YZZA 2B3FA 2O7UA 4ND9A 4GVOA 2R71A 4PETA 3HN0A 2VD3A 3OO6A 3PD9A 3O29A 4P1EA 3FVGA 2HEUA 4E0WA 1M5FA 5KCJA 2H4IA 1PEBA 4ZEDA 1UTHB 1B3EA 4OESA 1IXGA 1SD3A 3C32A 4ISUA 2NXOA 1PDAA 3K6UA 1MDQA 1NNKA 4AB5A 4G68A 5CMKA 4YMBA 1NL5A 4PP0A 3T9XB 1JQFA 3O6IA 1JW5A 2QSXA 2DQVA 2VGQA 4ZECA 4NF5A 3SEXA 1TXFA 3Q29A 3FXQA 1B5HA 4BDQA 5EHSA 4Q8RA 2PBWA 2G29A 5IZZA 5TP9B 3G3HA 1LAXA 3TAJA 5DVFA 1MM7A 4I8CA 3BFUA 1URSA 1SBPA 1FQAA 1OIBA 1S9TA 1M5BA 3KJ7A 1B1XA 4R74A 3MQ9A 4PBQA 3I5OA 3VVDA 4MH5A 1JNFA 2AIXA 2Z23A 4C1TA 2V4CA 4RA1A 2I6EA 4N6DA 3ECRA 2GH9A 2XXTA 4U4XA 1H43A 4QFKA 3FVNA 2Z22A 4KD5A 2QS2A 1ELJA 4LP2B 5AE4A 4PAFA 1P1OA 5FTHA 2RC9A 1LAFE 2OBGA 4F3BA 4THIA 4NF8B 3Q26A 2DSFA 1XVYA 2PT1A 3LBSA 1JVYA 4F39A 1B4ZA 1FW0A 1QUKA 1DPPA 2I0BA 1ANFA 5H8QB 3OO9A 5H8NA 1MRPA 3TZAA 3LSLA 1EZOA 4IO3A 1PB9A 2F7AA 5BUUA 2O6AA 3G3JA 4U4SA 3SERA 2ONKE 3C31A 4O94A 3G3FA 3MP6A 1UTBA 3K01A 2A5TA 4NN3A 4OQOA 3M3FA 1OMPA 4PGPA 3A09A 1J1NA 1O63A 2XXQA 2VP1A 1OQHA 2CEXA 4H5GA 5KCJB 4GF8A 3H6VA 3HO7A 4F1VA 4OFLA 1D3KA 3UN6A 3W9VA 4MFIA 3TTLA 1I6AA 4NF4A 1P99A 3V8XB 3DELB 3L6GA 4QSDA 2O1MA 3KSJA 4O8MA 4Z0IA 1B58A 5CRYA 2XXYA 3MP8A 4OZ9A 1Y3NA 3MZ1A 1MXUA 4DZ1A 4NF5B 2AYSA 5IGAA 1ATGA 3FVOA 3SDFA 4ELRA 4RNSA 3VLUA 2PFYA 1MQJA 4H0WA 4NAPA 3B7DA 4RXLA 3GBBA 1LAGE 4MX6A 3RY3A 1A55A 1DTZA 5HPQA 3MVXA 4FORA 3MWBA 3OENA 4JBZA 4LA9A 1O64A 1MPBA 1MXYA 2XXVA 4I9DA 2CEYA 1B5JA 3IX1A 3IJOB 1FQDA 2DYXA 4JDFA 5JK4A 2W7YA 5KDTA 4IGTA 3QK6A 2RF1A 5IAIA 3G3IA 1B7HA 1R6ZA 4EQ9A 1MQDA 3T22A 3LR1A 4QF9A 1MH4A 3O9PA 1B3HA 3PPRA 3KOSA 1DPEA 5I5PA 3K1NA 4H6DA 4F2QA 4QHQA 5HM4B 5DVJA 1LBBA 3FXBA 3QYTA 1UIVA 3N94A 3GLBA 5ISUA 3N6TA 3MW0A 2I3VA 3OXNA 4KCDA 1QULA 4MF3A 3TQWA 5AA2A 4RPNA 2ALUA 5H8NB 2RC7A 4EQBA 3V89B 3TMGA 4PFTA 3B50A 1FQEA 4MLVA 2YJPA 5B70A 3TYHA 3UIFA 1JEVA 5M2VA 1PB7A 4HCWA 3Q28A 1UTBB 5AA2D 1FTOA 3KFMA 4PE5B 3EHSA 4KHZE 2P1SA 5JEIA 4OXVA 1TFAA 1H76A 4U22A 4BDLA 4C0RA 2QS4A 3TPAA 1XT8A 2R6GE 4NF4B 2KLFA 4YKKA 1IXHA 3PUWE 4WEDA 4I62A 2ONRA 4R6YA 5L9OA 4N6PA 4N8GA 4G8HA 2XX9A 3K02A 1US5A 4FAJA 1UQWA 3PPNA 4QFPA 4U1OA 3S4UA 1IUDA 4KFQA 3MC2A 3TFLA 4Z7EA 5LOMA 1SW5A 4BDRA 5H8HA 1Y4TA 4BDNA 2V84A 3OO7A 3HV1A 4LONB 3QUJA 4LZ8A 3CVGA 3KN3A 4FEDA 1IEJA 1HSLA 3Q27A 4TLLB 3T96B 3T9HB 3PUZE 4XXUA 3PMXA 4P9KA 2F34A 3TCHA 2YLNA 4F2OA 1POY1 1OLAA 2PX1A 4JWOA 4M1VA 5AA1A 1YAEA 2DXYA 4OVQA 3DP6A 3U65A 1IXIA 3PMWA 4HW8A 3C35A 1ZMGA 1MQGA 1FQCA 1PBQA 1SI1A 3UK4A 4NEDA 5KDTB 4HCYA 3TUSA 1HSEA 4MMPA 4NX1A 4ZEKA 4H5FA 3W15C 4NHBA 4G8NA 4PFWA 4KCCA 1URDA 4OEUA 3RTFB 2I58A 1BKAA 2AL5A 4XIGQ 4ZDMA 1EU8A 4N07A 2WYKA 4DIGA 4JWXA 1NKXA 3FATA 3ILUB 3OMBA 1B7UA 1MQIA 4H67A 1FTLA 3BFTA 4YB6A 3CIJA 4X48A 1USYH 3MVZA 3RTWB 4QRZA 5AA2B 4IO7A 4ONYA 1N76A 2DVZA 4UA8A 2HAUA 3IK6B 4HS7A 2B3BA 3VLWA 1A40A 1JETA 1PB8A 3KJTA 2NWJA 4GWOA 4GXAA 5F1QA 4X1BA 1MM6A 2QPQA 3GBAA 3TDJA 3CSGA 1GR2A 3CI8A 3K4UA 1ZJLA 3OOAA 4ZZAA 4P11A 4PFBA 3K0VA 1ZKBA 3B6TA 2THIA 5I2KA 1RYOA 3OEMA 2XWIA 2F7BA 1LGBC 4RPOA 4ELPA 3RGYA 1SW4A 4IB2A 2V25A 2PVUA 5ITOA 1L5TA 4EUOA 3TELA 4N6KA 1NNPA 3MZ9A 2XXPA 4E0XA 4MNPA 1AIVA 3S2VA 2XXHA 4PFYA 3VFJA 5I58A 5FHMA 1B05A 4WEPA 3H7MA 5H8HB 2QRYA 2UVHA 1B4HA 3VDFA 3HSTA 1P1NA 1ZIUA 5CC2A 2HFBA 1DTGA 2H5YA 2ZZVA 1Y3QA 4PFRA 4TQUQ 1AL3A 4UABA 1LBCA 3MPLA 3S9NC 3GYYA 2OJTA 4ZE8A 4H8JA 3KEIA 4XKPA 2V3QA 1F9BA 3B6WA 3KZGA 2X26A 1LSTA 3RPWA 4N91A 4QFNA 4ZEFA 5ICTA 2H9BA 3FGSA 2I49A 4F1UA 4JB7A 4OFOA 3MVYA 3ZSFA 3H06B 4MNIA 2D5WA 2E1SA 1VSOA 4OA4A 5A5XA 4BLAA 4K3FA 1Y1MA 1GV8A 2HZKA 1SYIA 4NF6A 3G3GA 1MY0A 3VV5A 1R1NA 3FJ7A 5KZTA 2ABHA 1QUJA 5H8FA 2VPOA 3I3VA 4OWDA 4XFEA 5K2XA 3K00A 1JW1A 1N84A 2VPNA 2HQ0A 4PAIA 3FV2A 2OCUA 1O7TA 5LTCA 4ZS9A 4KQPA 3MUQA 4WKMA 1EZ9A 4N13A 1URGA 3PUYE 2XWOA 4DXCA 3HPIA 3PU5A 4YICA 4F31B 3H6TA 1QW0A 2DWAA 4ELQA 1D4NA 4H1XA 1R9QA 1KWHA 2QMXA 4OVTA 1A54A 4AB6A 1B32A 2ZYNA 3K1PA 3RLFE 3O6HA 1B1HA 5ITPA 4NF0A 4RK2A 2QS1A 1OLCA 4GL8A 2O84X 5I2KB 4OYVA 3QAXA 2O51A 2Y84A 4F1YA 2I3WA 3AXFA 5IM2A 1Y1ZA 1OVTA 2V93A 3E3KA 4TLMB 3Q25A 3K1MA 4ESWA 1M5EA 4R9GA 3O2AA 3K6VA 1I6QA 4NWCA 1SI0A 4G68B 2REGA
chains in the Genus database with same CATH superfamily
4IY5A 2H98A 3GZGA 1FBHA 3ZS6A 4C1UA 5I58B 3P7IA 4JSDA 1MY3A 1Y4CA 3OO8A 3W9WA 3MAMA 4FE8A 4R72A 5I7IA 2UYEA 4NQ8A 1B0LA 3QMFA 4PDDA 4OVJA 1AH5A 2NVUB 2DWIA 1DOTA 2NUVA 4DLDA 2XXKA 1GVCA 3DLNA 1LCTA 1FJ9A 3T9UA 5LDZA 2HHMA 1NV5A 3QXMA 2F97A 3ZKKA 1LEVA 3NOHA 1EZPA 4PF6A 1VE4A 1T0KA 4O3CA 1QKAA 1NV0A 5I2NA 3S9EA 1B3FA 1MY1A 2ZNTA 3ONMA 2Y7KA 4NG7A 4RK9A 2VHAA 3IORA 1N7WA 2RKMA 3FASA 3KGCA 2BJJX 1H3DA 5A5XB 1XOCA 1LFHA 1BP5A 4DCXA 4NF6B 2OWSA 4YKJA 2Z8DA 4I3EA 1SPIA 2UXAA 2Q74A 5H8FB 1FTMA 4HE0A 4PE3A 3KN7A 5TU0A 1NUZA 2UYFA 1DMBA 2RINA 4YB5A 1DCUA 2Y7IA 3MP1A 2DVCA 1K9YA 4PC9A 4F3SA 1GTKA 4NWDA 1AOVA 1FPJA 1KZ8A 3C33A 4XKQA 1BK4A 4U2RA 2ZYKA 4U23A 5DT6A 2Y7PA 5EQAA 2HZLA 2QL3A 4N4UA 2XD3A 1A8EA 2D3IA 5DYHA 3S9LC 2QJEA 4O7IA 4TOZA 1TWYA 5I56A 5L8DA 3FD3A 2M8CA 2ZYMA 3LSWA 3TCGA 1WVJA 2XWVA 1JVXA 1SQYA 4GBWA 3CR9A 3C4MA 4L17A 4IY6A 2HXWA 2A5TB 2Y5KA 3ZKLA 3LSXA 3S9MC 2ZXTA 4WXJA 4KYSA 4H8IA 4OTEA 3MVWA 3SKPA 4PAKA 3TEPA 3V5AA 1Q1KA 5ET5A 4XTCQ 4G61A 3C34A 4DXBA 3DP8A 1NV6A 3O6GA 4H65A 2HPGA 3SEUA 2P2AA 4LQ2A 2RCAA 1LB8A 1P1QA 1NMUA 2YPNA 2RCBA 4JWYA 1USYE 4DE8A 2XA5A 1MPCA 3USDA 5K2YA 1RYXA 4LVQA 4G77A 1NI9A 5AA4A 2FBPA 5CBSA 1UTHA 1B3LA 4KR5A 1MXWA 4OEVA 5DTBA 1IIWA 3RN8A 2Q88A 3PPPA 1B2HA 2VOZA 1A7LA 1NH7A 2DOJA 4R2FA 4N17A 3R7XA 1ZLQA 4MNCA 4R73A 1LAHE 1B52A 2E0SA 3EF7A 1FPDA 1S7YA 5DW8A 2GHBA 2FA7A 4X8RA 4EF2A 3SZPA 1ZTYA 3THIA 1NUWA 1BTJA 1CB6A 1SDXA 3K6XA 4BDOA 2FVZA 4R6HA 2ANJA 2O69A 4OVRA 1JP4A 4YKIA 3O28A 1B0HA 2FIXA 1S50A 2DE2A 5JTYA 3F11A 4EXLA 2Z8EA 4NE4A 3RPLA 3K6WA 1UIUA 3TKDA 3CG1A 4DI4B 4RJZA 1XHYA 1NV2A 1EYIA 1G0IA 2X7QA 4NTLA 1B40A 4OVSA 3BKIB 3PUVE 4KYEA 1B6HA 1B7ZA 5I84A 2UVIA 1Z7NE 4O7MA 2R9JA 3R6UA 1BIYA 3LUYA 4X1DA 1QKBA 4I1DA 2F5XA 4F18A 3FXUA 4YMAA 1VR5A 4ZEIA 1FPFA 4R75A 1QUIA 1Q35A 4DDDA 1N0TA 4PF8A 2B4MA 1LBXA 4MHFA 2GRVA 1MY2A 1RDZA 4GLIA 2O7IA 1Z7ME 5I3SA 3IB2A 4F3GA 3PV0E 3M8UA 4MLQA 3I6VA 2F6PA 3ODBA 5EYFA 2F35A 5CMCA 1FBDA 3CFZA 3U8QA 3KN8A 3IR1A 3FUZA 1CNQA 1WODA 3RUMA 2ZYOA 1XC1A 4OENA 1MDP1 2UVGA 4OETA 2LAOA 5CM6A 3FIRA 1M5DA 3H03A 2IEEA 3VVEA 1FBCA 4ZE9A 5ET8A 4IO4A 1FBGA 4U21A 4PCDA 3VXCA 2Q8JA 3IL1B 5AA4B 3PMVA 3M3LA 1YPNA 4IGRA 4YAHX 4ZZEA 2DE3A 3FBPA 2XWKA 3BBRA 3TTNA 1B46A 3TQLA 5L9MA 5TPAA 4POXA 1IZ1A 3DP4A 4F19A 1SYHA 5CI5A 5FHNA 3KG2A 4EF1A 4P1LA 2F78A 4O3AA 1OQGA 2GQ1A 3EN3A 3U92A 4FJPA 3T66A 2F6GA 1VFEA 1Y20A 3A3CA 4POWA 3WAFA 1DBZA 5F7VA 3MSTA 4OVPA 3C9HA 2XHDA 4UACA 1I6BA 2OLBA 3D4CA 2AL4A 1FRPA 5JTYB 4AQ4A 1YCJA 2CZLA 5IZ3A 3RPLB 3RQTA 1TT1A 1MS7A 3GXAA 1G0HA 2PMSA 4R9FA 2XD2A 2NOOA 4GRKA 2ONSA 1LBVA 1FPIA 3EQ1A 3FZVA 1NNFA 3H4ZA 4QSCA 2PFZA 2OX3A 1LLSA 2X7PA 4LATA 4PFUA 1MY4A 1A99A 1K9ZA 2F7CA 2I0CA 4HXVA 1TFDA 5ELVA 2F36A 2HAVA 2P3NA 3FXRA 2DXRA 1NV7A 1RKMA 2H25A 3N6UA 3B6QA 2XXIA 2WYPA 4PQJA 4M4GA 3CFXA 4RY1A 3IO6A 1HSJA 3VLVA 4P8BA 1N7XA 2WX9A 4HE1A 3MBPA 3TODA 2FNCA 2O1LA 5FTIA 1IQ7A 3JV9A 3IAZA 2P0SA 1SVXB 4NMYA 3SEYA 2ZNSA 5ET7A 3T93B 3IOVA 3MJNA 4Q5TA 3M3KA 3RT8A 3R26A 1NNTA 3SEVA 3N5LA 1B9JA 3QIMA 3KSXA 1QGXA 4MIJA 4LZ5A 3ILTB 2PT2A 1IXCA 1NH8A 2VT5A 2RC8A 2WBDA 5HBCA 3IOWA 4X9TA 4XEQA 2Q9TA 4ECFA 2Q89A 4KI0E 4OHNA 4R6KA 4YB7A 1N3XA 3OELA 5I57A 1YXIA 1LB9A 2P3VA 1MXZA 1JW4A 1DK4A 4BDMA 3O66A 5I59A 3PPQA 2DWJA 2B65A 5TPAB 1B5IA 3QUFA 4LZ7A 3JZJA 4HTGA 2I4CA 3HCQA 3VVFA 1MPDA 1FPGA 1PC3A 4YU0A 5B7DA 3IOUA 3N26A 1EYJA 1AMFA 1FCKA 4MEVA 1B3GA 5CMBA 4ESXA 2F3BA 1VFDA 4H46A 3EHUA 2CZKA 3UGWA 3SETA 4EXKA 3IJXB 1ZBMA 4PDHA 3UP9A 4Q30B 2PCRA 1FQBA 1H44A 3OSQA 1JEUA 2I4BA 1LCFA 4GD5A 4ELOA 2VD2A 5IZ3B 2GHAA 3EHTA 4G4PA 2Z8FA 3H6WA 2G93A 3JYRA 2XXXA 2A5SA 4GL0A 3G7WA 2QVRA 4QSEA 3FJGA 4QFOA 4Q0CA 4DCYA 4G2ZA 3BIGA 2QVUA 2GFEA 3TTMA 5H8SA 3E4RA 4JSOA 4MBPA 1XS5A 2FHYA 3CG3A 4FECA 3E13X 2XX7A 2ZZXA 4LN5A 1FJ6A 4FATA 1MG1A 4F22A 2ZNUA 2PYYA 2D21A 5DEXA 2Q8MA 4KPTA 1SW1A 3UORA 2XXRA 3VE1B 3IFAA 4P0IA 5CMMA 3SEWA 3TTRA 4QFLA 4KYDA 1MQHA 1D9VA 1FTAA 4F29A 3V83A 4KXPA 2V3UA 4O3BA 4P3LA 4GOTA 3WAEA 3U1OA 1PBPA 2JJKA 3IO4A 4IO2A 4NGUA 4XKRA 1D9YA 1FBFA 4RYAA 2KR0A 1NFTA 4FIMA 3C36A 4G8MA 3CFLA 1FQFA 3RT6B 2XXUA 1SW2A 3QSLA 2CZIA 1US4A 1H45A 3OEKA 5BWJA 4OERA 3CRBA 3LC8A 2Y7RA 3PUXE 1IMDA 5I57B 4ZEBA 1P1UA 1WDNA 2Q2CA 1KA1A 2Y7WA 5EYHA 1OVBA 1XVXA 5I59B 4R2BA 2OZZA 2ZMBA 3E78A 2DS9A 2O68A 1GGGA 4IO5A 5DVIA 3T9VA 1FPBA 1EH3A 3G3KA 1MXXA 5T3JA 3T1BA 4PFIA 4LUBA 2CMOA 1YTVA 4IO6A 2F8DA 1P1WA 3SESA 5AA3A 4QXDA 1II5A 4P56A 2L5VA 3PPOA 2Y5LA 4X04A 3MPKA 3E9XA 2XX8A 1ZU0A 2REJA 3HFUA 2DP8A 2UVJA 2FYIA 3KC0A 4U1ZA 3OD7A 3KBRA 1Y9UA 4F3PA 4EDPA 1IMFA 5I2NB 2I48A 3H3GA 1FTKA 1Y3PA 4EQ7A 3LUZA 4YKPA 1N3WA 2OK2A 1MXVA 2OWTA 3DM0A 5IKBA 5ICQA 1QVSA 5TP9A 1A8FA 2XXWA 3HHGA 5FHOA 3KOTA 3U93A 4GQOA 4PGNA 4OFJA 3TTKA 3L6HA 3KBZA 3FVKA 3H6UA 4GFRA 3D4GA 3ROJA 3VXBA 1N04A 1B51A 5J1DA 4FEBA 3EPEA 3OSRA 3U72A 4DI3D 2DE4A 4OANA 4GWXA 2ZZWA 2HCAA 1DSNA 5EHMA 1MH3A 3RNNA 3CSBA 5L9SA 4JXIA 3PGFA 3UA8A 4P0GA 2ESNA 3IOTA 1LFIA 1POTA 3FV1A 5DEXB 5EYGA 4DXUA 2Q2AA 1BLFA 2MKZA 5I56B 1IITA 4P47A 1QJMA 4GBVA 3TCFA 2V3TA 3PD8A 4LQ5A 2WKYA 3IB0A 3E79A 1R9LA 3O97A 2H99A 5CBRA 4NF8A 1CE2A 4GIZA 4G68C 2QMWA 1M5CA 1FTJA 3HHFA 2QS3A 3K2DA 3A3UA 2IA4A 4N15A 4OMBA 3LSFB 2B4LA 2DWHA 4MAGA 1I69A 5H8QA 3IB1A 3U94A 3FJMA 4XF5A 4MCOA 3MZBA 4N8YA 4GXSB 4PBHA 4XKNA 3D1RA 1LFGA 4YZZA 4GX6A 2B3FA 2O7UA 4ND9A 4GVOA 2R71A 4PETA 3HN0A 2VD3A 3OO6A 3PD9A 3O29A 4P1EA 3FVGA 2HEUA 4E0WA 1M5FA 2CZHA 5KCJA 2H4IA 1PEBA 4ZEDA 1UTHB 1B3EA 4OESA 1IXGA 4I3YA 1SD3A 3C32A 4ISUA 2NXOA 1PDAA 3K6UA 1MDQA 1NNKA 4AB5A 4G68A 1LBZA 5CMKA 4YMBA 1NL5A 4PP0A 3T9XB 1JQFA 4QBAA 3O6IA 1JW5A 2QSXA 2DQVA 2VGQA 4ZECA 4NF5A 3SEXA 3LV0A 1TXFA 3Q29A 3FXQA 1B5HA 4BDQA 5EHSA 4Q8RA 2PBWA 2G29A 5IZZA 5TP9B 3G3HA 1LAXA 3TAJA 5DVFA 1MM7A 4I8CA 3BFUA 1URSA 1SBPA 1FQAA 1OIBA 1S9TA 1M5BA 3KJ7A 1B1XA 4R74A 1RDXA 3MQ9A 4PBQA 3I5OA 3VVDA 4MH5A 1JNFA 2AIXA 2Z23A 4C1TA 2V4CA 3B8BA 4RA1A 2I6EA 4N6DA 3ECRA 2GH9A 2XXTA 4U4XA 1H43A 2WEFA 4QFKA 3FVNA 2Z22A 4KD5A 2QS2A 5IZ1A 4N81A 1ELJA 3T0JA 4LP2B 5AE4A 4PAFA 1P1OA 5FTHA 2RC9A 1LAFE 1AWBA 2OBGA 2WBBA 4F3BA 1VDWA 4THIA 4NF8B 3Q26A 2DSFA 1XVYA 2PT1A 3LBSA 1JVYA 4F39A 1B4ZA 1XI6A 1FW0A 1QUKA 1DPPA 2I0BA 1ANFA 5H8QB 3OO9A 5H8NA 1MRPA 3TZAA 3LSLA 1EZOA 3CHGA 4IO3A 1PB9A 2F7AA 5BUUA 2O6AA 3G3JA 1RDYA 4U4SA 3SERA 2ONKE 3C31A 4O94A 5ET6A 3G3FA 3MP6A 1UTBA 3K01A 2A5TA 4NN3A 4OQOA 3M3FA 1OMPA 4PGPA 3A09A 1J1NA 1O63A 2XXQA 2VP1A 1OQHA 2CEXA 4H5GA 5KCJB 4GF8A 3H6VA 3HO7A 4F1VA 4OFLA 1D3KA 3UN6A 3W9VA 4MFIA 3TTLA 4GWZA 1I6AA 4NF4A 1P99A 3V8XB 1YYZA 3DELB 3L6GA 4QSDA 2O1MA 3KSJA 4O8MA 4Z0IA 1B58A 5CRYA 2XXYA 1LBWA 3IFCA 3MP8A 4OZ9A 1Y3NA 3MZ1A 1MXUA 4DZ1A 4NF5B 2AYSA 1IMBA 5IGAA 1ATGA 3FVOA 3SDFA 4ELRA 4RNSA 3VLUA 2PFYA 1MQJA 4H0WA 4NAPA 3B7DA 4RXLA 3GBBA 1FSAA 4GWWA 2QFLA 1LAGE 4MX6A 3RY3A 1A55A 1DTZA 5HPQA 1KA0A 3MVXA 4FORA 4H45A 3MWBA 3OENA 4JBZA 1LBYA 4LA9A 1O64A 1IMCA 1MPBA 1MXYA 2XXVA 4I9DA 2CEYA 4JVCA 1FPLA 1B5JA 3IX1A 4GWSA 3IJOB 1FQDA 4I40A 2DYXA 4JDFA 5JK4A 2QVVA 2W7YA 5KDTA 1FBPA 4IGTA 3QK6A 2RF1A 5IAIA 3G3IA 1B7HA 1R6ZA 4EQ9A 1MQDA 3T22A 3LR1A 4QF9A 1MH4A 3O9PA 1B3HA 3PPRA 3KOSA 1IMAA 1DPEA 5I5PA 3K1NA 4H6DA 4F2QA 4QHQA 5HM4B 5DVJA 1LBBA 3FXBA 3QYTA 1UIVA 3N94A 3GLBA 5ISUA 3N6TA 3MW0A 2I3VA 3OXNA 4KCDA 1QULA 4MF3A 3TQWA 5AA2A 4RPNA 2ALUA 5H8NB 2RC7A 1EYKA 4EQBA 3V89B 3TMGA 4PFTA 3B50A 1FQEA 4MLVA 2YJPA 5B70A 3TYHA 3UIFA 1JEVA 5M2VA 1Q9DA 1PB7A 4HCWA 3Q28A 1UTBB 5AA2D 1FTOA 3KFMA 4PE5B 3EHSA 4KHZE 2P1SA 5JEIA 2HXRA 4OXVA 1TFAA 1H76A 4U22A 4BDLA 4C0RA 2QS4A 3TPAA 1YZ0A 1IMEA 1XT8A 2R6GE 4NF4B 2KLFA 4YKKA 1IXHA 3PUWE 4WEDA 1INPA 4I62A 2ONRA 4R6YA 5L9OA 4N6PA 4N8GA 4G8HA 2XX9A 3K02A 1US5A 4FAJA 1UQWA 3PPNA 4QFPA 4U1OA 3S4UA 1IUDA 4KFQA 3MC2A 3TFLA 4Z7EA 5LOMA 1SW5A 4BDRA 5H8HA 1Y4TA 4BDNA 2V84A 3OO7A 5A5LA 3HV1A 4LONB 3QUJA 4LZ8A 3CVGA 3KN3A 4FEDA 1IEJA 1HSLA 3Q27A 4TLLB 3T96B 3T9HB 3PUZE 4XXUA 5ESYA 3PMXA 4P9KA 2F34A 3TCHA 2YLNA 4F2OA 1POY1 1OLAA 2PX1A 1NV3A 4JWOA 4M1VA 5AA1A 1YAEA 5J16A 4AS4A 2DXYA 4OVQA 3DP6A 3U65A 1IXIA 3PMWA 1FPEA 4HW8A 3C35A 1ZMGA 1MQGA 1FQCA 1PBQA 4GWYA 1SI1A 3UK4A 4NEDA 5KDTB 4JVDA 4HCYA 3TUSA 5FBPA 1HSEA 4MMPA 4NX1A 4ZEKA 4H5FA 3W15C 4NHBA 4GX3A 4G8NA 4PFWA 4KCCA 1URDA 4OEUA 3KC1A 3RTFB 2I58A 1BKAA 2AL5A 4GWUA 4GX4A 4XIGQ 4ZDMA 1EU8A 4N07A 2WYKA 4DIGA 4JWXA 1NKXA 3FATA 3ILUB 3OMBA 1B7UA 1MQIA 4H67A 1FTLA 1FPKA 3A29A 3BFTA 4YB6A 3CIJA 4X48A 1USYH 3MVZA 3RTWB 4QRZA 5AA2B 4IO7A 4ONYA 1NV4A 1N76A 2DVZA 4UA8A 2BJIA 2HAUA 3IK6B 4HS7A 2B3BA 3VLWA 1A40A 1JETA 1PB8A 3KJTA 2NWJA 4GWOA 4GXAA 5F1QA 4X1BA 1MM6A 2QPQA 3GBAA 3TDJA 3CSGA 2OWZA 1GR2A 3CI8A 3K4UA 1ZJLA 3OOAA 5EQ9A 4ZZAA 4P11A 4PFBA 3K0VA 1ZKBA 3B6TA 2THIA 5I2KA 1RYOA 3OEMA 2XWIA 2F7BA 1LGBC 3BIHA 2DDKA 4RPOA 2F3DA 4ELPA 3RGYA 1SW4A 4IB2A 2V25A 2PVUA 5ITOA 1L5TA 4EUOA 3TELA 4N6KA 1NNPA 3MZ9A 2XXPA 4E0XA 4MNPA 1AIVA 3S2VA 4PTKA 2XXHA 3MYUA 4PFYA 3VFJA 5I58A 5FHMA 1B05A 4WEPA 3H7MA 5H8HB 2QRYA 2UVHA 1B4HA 4AS5A 3VDFA 3HSTA 1P1NA 1ZIUA 5CC2A 2HFBA 1DTGA 2H5YA 2ZZVA 1Y3QA 4PFRA 4TQUQ 1AL3A 4UABA 1LBCA 3MPLA 3S9NC 3GYYA 3ISPA 2OJTA 4ZE8A 4H8JA 3KEIA 4XKPA 3RYDA 2V3QA 1F9BA 3B6WA 3KZGA 1NUXA 1LSTA 2X26A 3RPWA 4N91A 1D9QA 4QFNA 4ZEFA 5ICTA 2H9BA 3PTYA 3FGSA 2I49A 4F1UA 4JB7A 4OFOA 3MVYA 3ZSFA 3H06B 4MNIA 2D5WA 2E1SA 1VSOA 2R8TA 4OA4A 5A5XA 4BLAA 4K3FA 1Y1MA 1GV8A 2HZKA 1SYIA 4NF6A 3G3GA 3EKIA 1MY0A 3VV5A 1R1NA 3FJ7A 5KZTA 2ABHA 1QUJA 1NUYA 5H8FA 2VPOA 3I3VA 4OWDA 4XFEA 4JVIA 5EQ7A 5K2XA 3K00A 1JW1A 1N84A 2VPNA 2HQ0A 4PAIA 2KQZA 3FV2A 2OCUA 1O7TA 5EQ8A 5LTCA 4ZS9A 4KQPA 3MUQA 4WKMA 5F24A 1EZ9A 4N13A 2XWOA 1URGA 3PUYE 4HE2A 4DXCA 1NV1A 3HPIA 3PU5A 4YICA 4F31B 4MJOA 3H6TA 1QW0A 2DWAA 4ELQA 1D4NA 4IR8A 4H1XA 2FIEA 1R9QA 1KWHA 2QMXA 4OVTA 1A54A 4AB6A 1B32A 2ZYNA 3K1PA 3RLFE 3O6HA 1B1HA 5ITPA 4NF0A 4RK2A 2QS1A 4FBPA 1OLCA 4GL8A 2O84X 5I2KB 4OYVA 3QAXA 2O51A 2Y84A 4F1YA 2I3WA 3AXFA 5IM2A 1Y1ZA 1OVTA 2V93A 3E3KA 4TLMB 3Q25A 1FBEA 3K1MA 4ESWA 1M5EA 4R9GA 3O2AA 3K6VA 1I6QA 4NWCA 1SI0A 4G68B 2REGA
chains in the Genus database with same CATH topology
4IY5A 2H98A 3GZGA 3ZS6A 1FBHA 4C1UA 5I58B 3P7IA 4JSDA 1MY3A 1Y4CA 3OO8A 3W9WA 3MAMA 4FE8A 4R72A 5I7IA 2UYEA 4NQ8A 1B0LA 3QMFA 4PDDA 4OVJA 1AH5A 2NVUB 2DWIA 1DOTA 2NUVA 4DLDA 2XXKA 1GVCA 3DLNA 1LCTA 1FJ9A 3T9UA 5LDZA 2HHMA 1NV5A 3QXMA 2F97A 3ZKKA 1LEVA 3NOHA 1EZPA 4PF6A 1VE4A 1T0KA 4O3CA 1QKAA 1NV0A 5I2NA 3S9EA 1B3FA 1MY1A 2ZNTA 3ONMA 2Y7KA 4NG7A 4RK9A 2VHAA 3IORA 1N7WA 2RKMA 3FASA 3KGCA 2BJJX 5A5XB 1H3DA 1XOCA 1LFHA 1BP5A 4DCXA 4NF6B 2OWSA 4YKJA 2Z8DA 4I3EA 1SPIA 2UXAA 2Q74A 5H8FB 1FTMA 4HE0A 4PE3A 3KN7A 5TU0A 1NUZA 2UYFA 1DMBA 2RINA 4YB5A 1DCUA 2Y7IA 3MP1A 2DVCA 1K9YA 4PC9A 4F3SA 1GTKA 4NWDA 1AOVA 1FPJA 1KZ8A 3C33A 4XKQA 4U2RA 1BK4A 2ZYKA 4U23A 5DT6A 2Y7PA 5EQAA 2HZLA 2QL3A 4N4UA 2XD3A 1A8EA 2D3IA 5DYHA 3S9LC 2QJEA 4O7IA 4TOZA 1TWYA 5I56A 5L8DA 3FD3A 2M8CA 2ZYMA 3LSWA 3TCGA 1WVJA 2XWVA 1JVXA 1SQYA 4GBWA 3CR9A 3C4MA 4L17A 4IY6A 2HXWA 2A5TB 2Y5KA 3ZKLA 3LSXA 3S9MC 2ZXTA 4WXJA 4KYSA 4H8IA 4OTEA 3MVWA 3SKPA 4PAKA 3TEPA 3V5AA 1Q1KA 5ET5A 4XTCQ 4G61A 3C34A 4DXBA 3DP8A 1NV6A 3O6GA 4H65A 3SEUA 2HPGA 2P2AA 4LQ2A 2RCAA 1LB8A 1P1QA 1NMUA 2YPNA 2RCBA 4JWYA 1USYE 4DE8A 2XA5A 1MPCA 3USDA 5K2YA 1RYXA 4LVQA 4G77A 1NI9A 5AA4A 2FBPA 5CBSA 1UTHA 1B3LA 4KR5A 1MXWA 4OEVA 5DTBA 1IIWA 3RN8A 2Q88A 3PPPA 1B2HA 2VOZA 1A7LA 1NH7A 2DOJA 4R2FA 4N17A 3R7XA 1ZLQA 4MNCA 4R73A 1LAHE 1B52A 2E0SA 3EF7A 1FPDA 1S7YA 5DW8A 2GHBA 2FA7A 4X8RA 4EF2A 3SZPA 1ZTYA 3THIA 1NUWA 1BTJA 1CB6A 1SDXA 3K6XA 4BDOA 4R6HA 2FVZA 2ANJA 2O69A 4OVRA 1JP4A 4YKIA 3O28A 1B0HA 2FIXA 1S50A 2DE2A 5JTYA 3F11A 4EXLA 2Z8EA 4NE4A 3RPLA 3K6WA 1UIUA 3TKDA 3CG1A 4DI4B 4RJZA 1XHYA 2X7QA 1EYIA 1G0IA 1NV2A 4NTLA 1B40A 4OVSA 3BKIB 3PUVE 4KYEA 1B6HA 1B7ZA 5I84A 2UVIA 1Z7NE 4O7MA 2R9JA 3R6UA 1BIYA 3LUYA 4X1DA 1QKBA 4I1DA 2F5XA 4F18A 3FXUA 4YMAA 1VR5A 4ZEIA 1FPFA 4R75A 1QUIA 1Q35A 4DDDA 1N0TA 4PF8A 2B4MA 1LBXA 4MHFA 2GRVA 1MY2A 1RDZA 4GLIA 2O7IA 1Z7ME 5I3SA 3IB2A 4F3GA 3PV0E 3M8UA 4MLQA 3I6VA 2F6PA 3ODBA 5EYFA 2F35A 5CMCA 3CFZA 1FBDA 3U8QA 3KN8A 3IR1A 3FUZA 1CNQA 1WODA 3RUMA 2ZYOA 1XC1A 4OENA 1MDP1 2UVGA 4OETA 2LAOA 5CM6A 3FIRA 1M5DA 3H03A 2IEEA 3VVEA 4ZE9A 1FBCA 5ET8A 4IO4A 1FBGA 4U21A 4PCDA 3VXCA 2Q8JA 3IL1B 5AA4B 3PMVA 3M3LA 1YPNA 4IGRA 4YAHX 4ZZEA 2DE3A 3FBPA 2XWKA 3BBRA 3TTNA 1B46A 3TQLA 5L9MA 5TPAA 4POXA 1IZ1A 3DP4A 4F19A 1SYHA 5CI5A 5FHNA 3KG2A 4EF1A 4P1LA 2F78A 4O3AA 1OQGA 2GQ1A 3EN3A 3U92A 4FJPA 3T66A 2F6GA 1VFEA 1Y20A 3A3CA 4POWA 3WAFA 1DBZA 5F7VA 3MSTA 4OVPA 3C9HA 2XHDA 4UACA 1I6BA 2OLBA 3D4CA 2AL4A 1FRPA 5JTYB 4AQ4A 1YCJA 2CZLA 5IZ3A 3RQTA 3RPLB 1TT1A 1MS7A 3GXAA 2PMSA 1G0HA 4R9FA 2XD2A 2NOOA 4GRKA 2ONSA 1LBVA 1FPIA 3EQ1A 3FZVA 1NNFA 3H4ZA 4QSCA 2PFZA 2OX3A 1LLSA 2X7PA 4LATA 4PFUA 1MY4A 1A99A 2F7CA 1K9ZA 2I0CA 4HXVA 1TFDA 5ELVA 2F36A 2HAVA 2P3NA 3FXRA 2DXRA 1NV7A 1RKMA 2H25A 3N6UA 3B6QA 2XXIA 2WYPA 4PQJA 4M4GA 3CFXA 4RY1A 3IO6A 1HSJA 3VLVA 4P8BA 1N7XA 2WX9A 4HE1A 3MBPA 3TODA 2FNCA 2O1LA 5FTIA 1IQ7A 3JV9A 3IAZA 2P0SA 1SVXB 4NMYA 3SEYA 2ZNSA 5ET7A 3T93B 3IOVA 3MJNA 4Q5TA 3M3KA 3RT8A 3R26A 1NNTA 3SEVA 3N5LA 1B9JA 3QIMA 3KSXA 1QGXA 4MIJA 4LZ5A 3ILTB 2PT2A 1IXCA 1NH8A 2VT5A 2RC8A 2WBDA 5HBCA 3IOWA 4X9TA 4XEQA 2Q9TA 4ECFA 2Q89A 4KI0E 4OHNA 4R6KA 4YB7A 1N3XA 3OELA 5I57A 1YXIA 1LB9A 2P3VA 1MXZA 1JW4A 1DK4A 4BDMA 3O66A 5I59A 3PPQA 2DWJA 2B65A 5TPAB 1B5IA 3QUFA 4LZ7A 3JZJA 4HTGA 2I4CA 3HCQA 3VVFA 1MPDA 1FPGA 1PC3A 4YU0A 5B7DA 3IOUA 3N26A 1EYJA 1AMFA 1FCKA 5CMBA 1B3GA 4MEVA 4ESXA 2F3BA 1VFDA 4H46A 3EHUA 3UGWA 2CZKA 3SETA 4EXKA 3IJXB 1ZBMA 4PDHA 3UP9A 4Q30B 2PCRA 1FQBA 1H44A 3OSQA 1JEUA 2I4BA 1LCFA 4GD5A 4ELOA 2VD2A 5IZ3B 2GHAA 3EHTA 4G4PA 2Z8FA 3H6WA 2G93A 3JYRA 2XXXA 2A5SA 4GL0A 3G7WA 2QVRA 4QSEA 3FJGA 4QFOA 4Q0CA 4DCYA 4G2ZA 3BIGA 2QVUA 2GFEA 3TTMA 5H8SA 3E4RA 4JSOA 4MBPA 1XS5A 2FHYA 3CG3A 4FECA 3E13X 2XX7A 2ZZXA 4FATA 1FJ6A 4LN5A 1MG1A 4F22A 2ZNUA 2PYYA 2D21A 5DEXA 2Q8MA 4KPTA 1SW1A 3UORA 2XXRA 3VE1B 3IFAA 4P0IA 5CMMA 3SEWA 3TTRA 4QFLA 4KYDA 1MQHA 1D9VA 1FTAA 4F29A 3V83A 4KXPA 2V3UA 4O3BA 4P3LA 4GOTA 3WAEA 3U1OA 1PBPA 4IO2A 3IO4A 4XKRA 2JJKA 4NGUA 1D9YA 1FBFA 4RYAA 2KR0A 1NFTA 4FIMA 3C36A 4G8MA 3CFLA 1FQFA 3RT6B 2XXUA 1SW2A 3QSLA 2CZIA 1US4A 1H45A 3OEKA 5BWJA 4OERA 3CRBA 3LC8A 2Y7RA 3PUXE 5I57B 1IMDA 4ZEBA 1P1UA 1WDNA 2Q2CA 2Y7WA 1KA1A 5EYHA 1OVBA 1XVXA 5I59B 4R2BA 2OZZA 2ZMBA 3E78A 2DS9A 2O68A 1GGGA 4IO5A 5DVIA 3T9VA 1FPBA 1EH3A 3G3KA 1MXXA 5T3JA 3T1BA 4PFIA 2CMOA 1YTVA 4LUBA 4IO6A 2F8DA 1P1WA 3SESA 5AA3A 4QXDA 1II5A 2L5VA 4P56A 3PPOA 2Y5LA 4X04A 3MPKA 3E9XA 2XX8A 1ZU0A 2REJA 3HFUA 2DP8A 2UVJA 2FYIA 3KC0A 4U1ZA 3OD7A 3KBRA 1Y9UA 4F3PA 4EDPA 1IMFA 5I2NB 2I48A 3H3GA 1FTKA 1Y3PA 4EQ7A 3LUZA 4YKPA 1N3WA 2OK2A 1MXVA 2OWTA 3DM0A 5IKBA 5ICQA 1QVSA 5TP9A 1A8FA 2XXWA 3HHGA 5FHOA 3KOTA 3U93A 4GQOA 4PGNA 4OFJA 3TTKA 3L6HA 3KBZA 3FVKA 3H6UA 4GFRA 3D4GA 3ROJA 3VXBA 1N04A 1B51A 5J1DA 4FEBA 3EPEA 3OSRA 3U72A 4DI3D 2DE4A 4OANA 4GWXA 2ZZWA 2HCAA 1DSNA 5EHMA 1MH3A 3RNNA 3CSBA 5L9SA 4JXIA 3PGFA 3UA8A 4P0GA 2ESNA 3IOTA 1LFIA 1POTA 3FV1A 5DEXB 5EYGA 4DXUA 2Q2AA 1BLFA 2MKZA 5I56B 1IITA 4P47A 1QJMA 4GBVA 3TCFA 2V3TA 3PD8A 4LQ5A 2WKYA 3IB0A 3E79A 1R9LA 3O97A 2H99A 5CBRA 4NF8A 1CE2A 4GIZA 4G68C 2QMWA 1M5CA 1FTJA 3HHFA 2QS3A 3K2DA 3A3UA 2IA4A 4N15A 4OMBA 3LSFB 2B4LA 2DWHA 4MAGA 1I69A 5H8QA 3IB1A 3U94A 3FJMA 4XF5A 4MCOA 3MZBA 4N8YA 4GXSB 4XKNA 4PBHA 3D1RA 1LFGA 4YZZA 4GX6A 2B3FA 2O7UA 4ND9A 4GVOA 2R71A 4PETA 3HN0A 2VD3A 3OO6A 3PD9A 3O29A 4P1EA 3FVGA 2HEUA 4E0WA 1M5FA 5KCJA 2CZHA 2H4IA 1PEBA 4ZEDA 1UTHB 1B3EA 4OESA 1IXGA 4I3YA 1SD3A 3C32A 4ISUA 2NXOA 1PDAA 3K6UA 1MDQA 1NNKA 4AB5A 4G68A 1LBZA 5CMKA 4YMBA 1NL5A 4PP0A 3T9XB 1JQFA 4QBAA 3O6IA 1JW5A 2QSXA 2DQVA 2VGQA 4ZECA 4NF5A 3SEXA 3LV0A 1TXFA 3Q29A 3FXQA 1B5HA 4BDQA 5EHSA 4Q8RA 2PBWA 2G29A 5IZZA 5TP9B 3G3HA 1LAXA 3TAJA 5DVFA 1MM7A 4I8CA 3BFUA 1URSA 1SBPA 1FQAA 1OIBA 1S9TA 1M5BA 3KJ7A 1B1XA 4R74A 1RDXA 3MQ9A 4PBQA 3I5OA 3VVDA 4MH5A 1JNFA 2AIXA 2Z23A 4C1TA 2V4CA 3B8BA 4RA1A 2I6EA 4N6DA 3ECRA 2GH9A 2XXTA 4U4XA 1H43A 2WEFA 4QFKA 3FVNA 2Z22A 4KD5A 2QS2A 5IZ1A 4N81A 1ELJA 3T0JA 4LP2B 5AE4A 4PAFA 1P1OA 5FTHA 2RC9A 1LAFE 1AWBA 2OBGA 4F3BA 2WBBA 1VDWA 4THIA 4NF8B 3Q26A 2DSFA 1XVYA 2PT1A 3LBSA 1JVYA 4F39A 1B4ZA 1XI6A 1FW0A 1QUKA 1DPPA 2I0BA 1ANFA 5H8QB 3OO9A 5H8NA 1MRPA 3TZAA 3LSLA 1EZOA 3CHGA 4IO3A 1PB9A 2F7AA 5BUUA 2O6AA 3G3JA 1RDYA 4U4SA 3SERA 2ONKE 3C31A 4O94A 5ET6A 3G3FA 3MP6A 1UTBA 3K01A 2A5TA 4NN3A 4OQOA 3M3FA 1OMPA 4PGPA 3A09A 1J1NA 1O63A 2XXQA 2VP1A 1OQHA 2CEXA 4H5GA 5KCJB 4GF8A 3H6VA 3HO7A 4F1VA 4OFLA 1D3KA 3UN6A 3W9VA 4MFIA 3TTLA 4GWZA 1I6AA 4NF4A 1P99A 3V8XB 1YYZA 3DELB 3L6GA 4QSDA 2O1MA 3KSJA 4O8MA 4Z0IA 1B58A 5CRYA 2XXYA 1LBWA 3MP8A 3IFCA 4OZ9A 1Y3NA 3MZ1A 1MXUA 4DZ1A 4NF5B 2AYSA 1IMBA 5IGAA 1ATGA 3FVOA 3SDFA 4ELRA 4RNSA 3VLUA 2PFYA 1MQJA 4H0WA 4NAPA 3B7DA 4RXLA 3GBBA 1FSAA 4GWWA 2QFLA 1LAGE 4MX6A 3RY3A 1A55A 1DTZA 5HPQA 1KA0A 3MVXA 4FORA 4H45A 3MWBA 3OENA 4JBZA 4LA9A 1LBYA 1O64A 1IMCA 1MPBA 1MXYA 2XXVA 4I9DA 2CEYA 4JVCA 1FPLA 1B5JA 3IX1A 4GWSA 3IJOB 1FQDA 4I40A 2DYXA 4JDFA 5JK4A 2W7YA 5KDTA 2QVVA 1FBPA 4IGTA 3QK6A 2RF1A 5IAIA 3G3IA 1B7HA 1R6ZA 4EQ9A 1MQDA 3T22A 3LR1A 4QF9A 1MH4A 3O9PA 1B3HA 3PPRA 3KOSA 1IMAA 1DPEA 5I5PA 3K1NA 4H6DA 4F2QA 4QHQA 5HM4B 5DVJA 1LBBA 3FXBA 3QYTA 1UIVA 3N94A 3GLBA 5ISUA 3N6TA 3MW0A 2I3VA 3OXNA 4KCDA 1QULA 4MF3A 3TQWA 5AA2A 4RPNA 2ALUA 5H8NB 2RC7A 1EYKA 4EQBA 3V89B 3TMGA 4PFTA 3B50A 1FQEA 4MLVA 2YJPA 5B70A 3TYHA 3UIFA 1JEVA 5M2VA 1Q9DA 1PB7A 4HCWA 3Q28A 1UTBB 5AA2D 1FTOA 3KFMA 4PE5B 3EHSA 4KHZE 2P1SA 5JEIA 2HXRA 4OXVA 1TFAA 1H76A 4U22A 4BDLA 4C0RA 2QS4A 3TPAA 1YZ0A 1IMEA 1XT8A 2R6GE 4NF4B 2KLFA 4YKKA 1IXHA 3PUWE 4WEDA 4I62A 1INPA 2ONRA 4R6YA 5L9OA 4N6PA 4N8GA 4G8HA 2XX9A 3K02A 1US5A 4FAJA 1UQWA 3PPNA 4QFPA 4U1OA 3S4UA 1IUDA 4KFQA 3MC2A 3TFLA 4Z7EA 5LOMA 1SW5A 4BDRA 5H8HA 1Y4TA 4BDNA 2V84A 3OO7A 5A5LA 3HV1A 4LONB 3QUJA 4LZ8A 3CVGA 3KN3A 4FEDA 1IEJA 1HSLA 3Q27A 4TLLB 3T96B 3T9HB 3PUZE 4XXUA 5ESYA 3PMXA 4P9KA 2F34A 3TCHA 2YLNA 4F2OA 1POY1 1OLAA 2PX1A 1NV3A 4JWOA 4M1VA 5AA1A 1YAEA 5J16A 4AS4A 2DXYA 4OVQA 3DP6A 3U65A 1IXIA 3PMWA 1FPEA 4HW8A 3C35A 1ZMGA 1MQGA 1FQCA 1PBQA 4GWYA 1SI1A 3UK4A 4NEDA 5KDTB 4JVDA 4HCYA 3TUSA 5FBPA 1HSEA 4MMPA 4NX1A 4ZEKA 4H5FA 3W15C 4NHBA 4GX3A 4G8NA 4PFWA 4KCCA 1URDA 4OEUA 3KC1A 3RTFB 2I58A 1BKAA 2AL5A 4GWUA 4GX4A 4XIGQ 4ZDMA 1EU8A 4N07A 2WYKA 4DIGA 4JWXA 1NKXA 3FATA 3ILUB 3OMBA 1B7UA 1MQIA 4H67A 1FTLA 1FPKA 3A29A 3BFTA 4YB6A 3CIJA 4X48A 1USYH 3MVZA 3RTWB 4QRZA 5AA2B 4IO7A 4ONYA 1NV4A 1N76A 2DVZA 4UA8A 2BJIA 2HAUA 3IK6B 4HS7A 2B3BA 3VLWA 1A40A 1JETA 1PB8A 3KJTA 2NWJA 4GWOA 4GXAA 5F1QA 4X1BA 1MM6A 2QPQA 3GBAA 3TDJA 3CSGA 2OWZA 1GR2A 3CI8A 3K4UA 1ZJLA 3OOAA 5EQ9A 4ZZAA 4P11A 4PFBA 3K0VA 1ZKBA 3B6TA 2THIA 5I2KA 1RYOA 3OEMA 2XWIA 2F7BA 1LGBC 3BIHA 2DDKA 4RPOA 2F3DA 4ELPA 3RGYA 1SW4A 4IB2A 2V25A 2PVUA 5ITOA 1L5TA 4EUOA 3TELA 4N6KA 1NNPA 3MZ9A 2XXPA 4E0XA 4MNPA 1AIVA 3S2VA 4PTKA 2XXHA 3MYUA 4PFYA 3VFJA 5I58A 5FHMA 1B05A 4WEPA 3H7MA 5H8HB 2QRYA 2UVHA 1B4HA 4AS5A 3VDFA 3HSTA 1P1NA 1ZIUA 5CC2A 2HFBA 1DTGA 2H5YA 2ZZVA 1Y3QA 4PFRA 4TQUQ 1AL3A 4UABA 1LBCA 3MPLA 3S9NC 3GYYA 3ISPA 2OJTA 4ZE8A 4H8JA 3KEIA 4XKPA 3RYDA 2V3QA 1F9BA 3B6WA 3KZGA 2X26A 1LSTA 1NUXA 3RPWA 4N91A 1D9QA 4QFNA 4ZEFA 5ICTA 2H9BA 3PTYA 3FGSA 2I49A 4F1UA 4JB7A 4OFOA 3MVYA 3ZSFA 3H06B 4MNIA 2D5WA 2E1SA 1VSOA 2R8TA 4OA4A 5A5XA 4BLAA 4K3FA 1Y1MA 1GV8A 2HZKA 1SYIA 4NF6A 3G3GA 3EKIA 1MY0A 3VV5A 1R1NA 3FJ7A 5KZTA 2ABHA 1QUJA 1NUYA 5H8FA 2VPOA 3I3VA 4OWDA 4XFEA 4JVIA 5EQ7A 5K2XA 3K00A 1JW1A 1N84A 2VPNA 2HQ0A 4PAIA 2KQZA 3FV2A 2OCUA 1O7TA 5EQ8A 5LTCA 4ZS9A 4KQPA 3MUQA 4WKMA 5F24A 1EZ9A 4N13A 1URGA 3PUYE 2XWOA 4HE2A 4DXCA 1NV1A 3HPIA 3PU5A 4YICA 4F31B 4MJOA 3H6TA 1QW0A 2DWAA 4ELQA 1D4NA 4IR8A 4H1XA 2FIEA 1R9QA 1KWHA 2QMXA 4OVTA 1A54A 4AB6A 1B32A 2ZYNA 3K1PA 3RLFE 3O6HA 1B1HA 5ITPA 4NF0A 4RK2A 2QS1A 4FBPA 1OLCA 4GL8A 2O84X 5I2KB 4OYVA 3QAXA 2O51A 2Y84A 4F1YA 2I3WA 3AXFA 5IM2A 1Y1ZA 1OVTA 2V93A 3E3KA 4TLMB 3Q25A 3K1MA 1FBEA 4ESWA 1M5EA 4R9GA 3O2AA 3K6VA 1I6QA 4NWCA 1SI0A 4G68B 2REGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IY5 A;  2H98 A;  3GZG A;  3ZS6 A;  4C1U A;  5I58 B;  3P7I A;  4JSD A;  1MY3 A;  1Y4C A;  3OO8 A;  3W9W A;  3MAM A;  4FE8 A;  4R72 A;  5I7I A;  2UYE A;  4NQ8 A;  1B0L A;  4PDD A;  4OVJ A;  1AH5 A;  2NVU B;  2DWI A;  1DOT A;  2NUV A;  4DLD A;  2XXK A;  1GVC A;  3DLN A;  1LCT A;  3T9U A;  3QXM A;  2F97 A;  3ZKK A;  1EZP A;  4PF6 A;  1VE4 A;  1T0K A;  4O3C A;  1QKA A;  5I2N A;  3S9E A;  1B3F A;  1MY1 A;  2ZNT A;  3ONM A;  2Y7K A;  4NG7 A;  4RK9 A;  2VHA A;  3IOR A;  1N7W A;  2RKM A;  3FAS A;  3KGC A;  2BJJ X;  5A5X B;  1H3D A;  1XOC A;  1LFH A;  1BP5 A;  4DCX A;  4NF6 B;  2OWS A;  4YKJ A;  2Z8D A;  2UXA A;  5H8F B;  1FTM A;  4PE3 A;  3KN7 A;  5TU0 A;  2UYF A;  1DMB A;  2RIN A;  4YB5 A;  2Y7I A;  3MP1 A;  2DVC A;  4PC9 A;  4F3S A;  1GTK A;  4NWD A;  1AOV A;  3C33 A;  4XKQ A;  4U2R A;  2ZYK A;  4U23 A;  5DT6 A;  2Y7P A;  2HZL A;  2QL3 A;  4N4U A;  2XD3 A;  1A8E A;  2D3I A;  5DYH A;  3S9L C;  2QJE A;  4TOZ A;  1TWY A;  5I56 A;  5L8D A;  3FD3 A;  2M8C A;  2ZYM A;  3LSW A;  3TCG A;  1WVJ A;  2XWV A;  1JVX A;  1SQY A;  3CR9 A;  3C4M A;  4L17 A;  4IY6 A;  2HXW A;  2A5T B;  3ZKL A;  3LSX A;  3S9M C;  2ZXT A;  4WXJ A;  4KYS A;  4H8I A;  4OTE A;  3MVW A;  3SKP A;  4PAK A;  3TEP A;  3V5A A;  1Q1K A;  4XTC Q;  3C34 A;  4DXB A;  3DP8 A;  3O6G A;  4H65 A;  3SEU A;  2HPG A;  2P2A A;  4LQ2 A;  2RCA A;  1LB8 A;  1P1Q A;  1NMU A;  2YPN A;  2RCB A;  4JWY A;  1USY E;  4DE8 A;  2XA5 A;  1MPC A;  3USD A;  5K2Y A;  1RYX A;  4LVQ A;  4G77 A;  5AA4 A;  5CBS A;  1UTH A;  1B3L A;  4KR5 A;  1MXW A;  4OEV A;  5DTB A;  1IIW A;  3RN8 A;  2Q88 A;  3PPP A;  1B2H A;  2VOZ A;  1A7L A;  1NH7 A;  2DOJ A;  4R2F A;  4N17 A;  3R7X A;  1ZLQ A;  4MNC A;  4R73 A;  1LAH E;  1B52 A;  2E0S A;  3EF7 A;  1S7Y A;  2GHB A;  2FA7 A;  4X8R A;  4EF2 A;  1ZTY A;  3THI A;  1BTJ A;  1CB6 A;  1SDX A;  3K6X A;  4BDO A;  4R6H A;  2ANJ A;  2O69 A;  4OVR A;  4YKI A;  3O28 A;  1B0H A;  1S50 A;  2DE2 A;  5JTY A;  3F11 A;  4EXL A;  2Z8E A;  4NE4 A;  3K6W A;  1UIU A;  3TKD A;  3CG1 A;  4DI4 B;  4RJZ A;  1XHY A;  2X7Q A;  4NTL A;  1B40 A;  4OVS A;  3BKI B;  3PUV E;  4KYE A;  1B6H A;  1B7Z A;  5I84 A;  2UVI A;  1Z7N E;  4O7M A;  2R9J A;  3R6U A;  1BIY A;  3LUY A;  4X1D A;  1QKB A;  4I1D A;  2F5X A;  4F18 A;  3FXU A;  4YMA A;  1VR5 A;  4ZEI A;  4R75 A;  1QUI A;  1Q35 A;  4DDD A;  1N0T A;  4PF8 A;  4MHF A;  2GRV A;  1MY2 A;  4GLI A;  2O7I A;  1Z7M E;  3IB2 A;  4F3G A;  3PV0 E;  3M8U A;  4MLQ A;  3I6V A;  2F6P A;  3ODB A;  5EYF A;  2F35 A;  5CMC A;  3CFZ A;  3U8Q A;  3KN8 A;  3IR1 A;  3FUZ A;  1WOD A;  3RUM A;  2ZYO A;  1XC1 A;  4OEN A;  1MDP 1;  2UVG A;  4OET A;  2LAO A;  5CM6 A;  3FIR A;  1M5D A;  3H03 A;  2IEE A;  3VVE A;  4ZE9 A;  4IO4 A;  4U21 A;  4PCD A;  3VXC A;  2Q8J A;  3IL1 B;  5AA4 B;  3PMV A;  3M3L A;  1YPN A;  4IGR A;  4YAH X;  4ZZE A;  2DE3 A;  2XWK A;  3BBR A;  3TTN A;  1B46 A;  3TQL A;  5L9M A;  5TPA A;  4POX A;  1IZ1 A;  3DP4 A;  4F19 A;  1SYH A;  5CI5 A;  5FHN A;  3KG2 A;  4EF1 A;  4P1L A;  2F78 A;  4O3A A;  1OQG A;  3EN3 A;  3U92 A;  4FJP A;  3T66 A;  2F6G A;  1VFE A;  1Y20 A;  3A3C A;  4POW A;  3WAF A;  5F7V A;  4OVP A;  3C9H A;  2XHD A;  4UAC A;  1I6B A;  2OLB A;  3D4C A;  2AL4 A;  5JTY B;  4AQ4 A;  1YCJ A;  2CZL A;  3RQT A;  1TT1 A;  1MS7 A;  3GXA A;  2PMS A;  4R9F A;  2XD2 A;  2NOO A;  4GRK A;  2ONS A;  3EQ1 A;  3FZV A;  1NNF A;  3H4Z A;  4QSC A;  2PFZ A;  1LLS A;  2X7P A;  4LAT A;  4PFU A;  1MY4 A;  1A99 A;  2F7C A;  2I0C A;  1TFD A;  5ELV A;  2F36 A;  2HAV A;  3FXR A;  2DXR A;  1RKM A;  2H25 A;  3N6U A;  3B6Q A;  2XXI A;  2WYP A;  4PQJ A;  4M4G A;  3CFX A;  4RY1 A;  3IO6 A;  1HSJ A;  3VLV A;  4P8B A;  1N7X A;  2WX9 A;  3MBP A;  3TOD A;  2FNC A;  2O1L A;  5FTI A;  1IQ7 A;  3JV9 A;  3IAZ A;  2P0S A;  1SVX B;  4NMY A;  3SEY A;  2ZNS A;  3T93 B;  3IOV A;  3MJN A;  4Q5T A;  3M3K A;  3RT8 A;  3R26 A;  1NNT A;  3SEV A;  3N5L A;  1B9J A;  3QIM A;  3KSX A;  4MIJ A;  4LZ5 A;  3ILT B;  2PT2 A;  1IXC A;  1NH8 A;  2RC8 A;  5HBC A;  3IOW A;  4X9T A;  4XEQ A;  2Q9T A;  4ECF A;  2Q89 A;  4KI0 E;  4OHN A;  4R6K A;  4YB7 A;  1N3X A;  3OEL A;  5I57 A;  1LB9 A;  1MXZ A;  1JW4 A;  4BDM A;  3O66 A;  5I59 A;  3PPQ A;  2DWJ A;  2B65 A;  5TPA B;  1B5I A;  3QUF A;  4LZ7 A;  3JZJ A;  4HTG A;  2I4C A;  3HCQ A;  3VVF A;  1MPD A;  1PC3 A;  4YU0 A;  5B7D A;  3IOU A;  3N26 A;  1AMF A;  1FCK A;  5CMB A;  1B3G A;  4MEV A;  4ESX A;  1VFD A;  3EHU A;  3UGW A;  3SET A;  4EXK A;  3IJX B;  1ZBM A;  4PDH A;  3UP9 A;  4Q30 B;  1FQB A;  1H44 A;  3OSQ A;  1JEU A;  2I4B A;  1LCF A;  4GD5 A;  4ELO A;  2VD2 A;  2GHA A;  3EHT A;  4G4P A;  2Z8F A;  3H6W A;  2G93 A;  3JYR A;  2XXX A;  2A5S A;  4GL0 A;  3G7W A;  4QSE A;  3FJG A;  4QFO A;  4Q0C A;  4DCY A;  4G2Z A;  2GFE A;  3TTM A;  5H8S A;  3E4R A;  4JSO A;  4MBP A;  1XS5 A;  3CG3 A;  4FEC A;  3E13 X;  2XX7 A;  2ZZX A;  4FAT A;  4LN5 A;  1MG1 A;  4F22 A;  2ZNU A;  2PYY A;  2D21 A;  5DEX A;  4KPT A;  1SW1 A;  3UOR A;  2XXR A;  3VE1 B;  4P0I A;  5CMM A;  3SEW A;  3TTR A;  4QFL A;  4KYD A;  1MQH A;  1D9V A;  4F29 A;  3V83 A;  2V3U A;  4O3B A;  4P3L A;  4GOT A;  3WAE A;  3U1O A;  1PBP A;  4IO2 A;  3IO4 A;  4XKR A;  4NGU A;  1D9Y A;  4RYA A;  1NFT A;  4FIM A;  3C36 A;  4G8M A;  3CFL A;  1FQF A;  3RT6 B;  2XXU A;  1SW2 A;  3QSL A;  1US4 A;  1H45 A;  3OEK A;  5BWJ A;  4OER A;  3CRB A;  3LC8 A;  2Y7R A;  3PUX E;  5I57 B;  4ZEB A;  1P1U A;  1WDN A;  2Q2C A;  2Y7W A;  1OVB A;  1XVX A;  5I59 B;  4R2B A;  2OZZ A;  2ZMB A;  2DS9 A;  2O68 A;  1GGG A;  4IO5 A;  5DVI A;  3T9V A;  1EH3 A;  3G3K A;  1MXX A;  4PFI A;  2CMO A;  1YTV A;  4LUB A;  4IO6 A;  2F8D A;  1P1W A;  3SES A;  5AA3 A;  1II5 A;  4P56 A;  3PPO A;  4X04 A;  3MPK A;  3E9X A;  2XX8 A;  1ZU0 A;  2REJ A;  2DP8 A;  2UVJ A;  2FYI A;  4U1Z A;  3OD7 A;  3KBR A;  1Y9U A;  4F3P A;  4EDP A;  5I2N B;  2I48 A;  3H3G A;  1FTK A;  1Y3P A;  4EQ7 A;  4YKP A;  1N3W A;  2OK2 A;  1MXV A;  2OWT A;  3DM0 A;  5IKB A;  5ICQ A;  1QVS A;  5TP9 A;  1A8F A;  2XXW A;  3HHG A;  5FHO A;  3KOT A;  3U93 A;  4GQO A;  4PGN A;  4OFJ A;  3TTK A;  3L6H A;  3FVK A;  3H6U A;  4GFR A;  3D4G A;  3VXB A;  1N04 A;  1B51 A;  5J1D A;  4FEB A;  3EPE A;  3OSR A;  3U72 A;  4DI3 D;  2DE4 A;  4OAN A;  2ZZW A;  2HCA A;  1DSN A;  5EHM A;  1MH3 A;  3RNN A;  3CSB A;  5L9S A;  4JXI A;  3PGF A;  3UA8 A;  4P0G A;  2ESN A;  3IOT A;  1LFI A;  1POT A;  3FV1 A;  5DEX B;  4DXU A;  2Q2A A;  1BLF A;  5I56 B;  1IIT A;  4P47 A;  1QJM A;  3TCF A;  2V3T A;  3PD8 A;  4LQ5 A;  2WKY A;  3IB0 A;  1R9L A;  3O97 A;  2H99 A;  5CBR A;  4NF8 A;  1CE2 A;  4GIZ A;  4G68 C;  2QMW A;  1M5C A;  1FTJ A;  3HHF A;  2QS3 A;  3K2D A;  3A3U A;  2IA4 A;  4N15 A;  4OMB A;  3LSF B;  2DWH A;  4MAG A;  1I69 A;  5H8Q A;  3IB1 A;  3U94 A;  3FJM A;  4XF5 A;  4MCO A;  3MZB A;  4N8Y A;  4GXS B;  4XKN A;  4PBH A;  1LFG A;  4YZZ A;  2B3F A;  2O7U A;  4ND9 A;  4GVO A;  2R71 A;  4PET A;  3HN0 A;  2VD3 A;  3OO6 A;  3PD9 A;  3O29 A;  4P1E A;  3FVG A;  2HEU A;  4E0W A;  1M5F A;  5KCJ A;  2H4I A;  1PEB A;  4ZED A;  1UTH B;  1B3E A;  4OES A;  1IXG A;  1SD3 A;  3C32 A;  4ISU A;  2NXO A;  1PDA A;  3K6U A;  1MDQ A;  1NNK A;  4AB5 A;  4G68 A;  5CMK A;  4YMB A;  1NL5 A;  4PP0 A;  3T9X B;  1JQF A;  3O6I A;  1JW5 A;  2QSX A;  2DQV A;  2VGQ A;  4ZEC A;  4NF5 A;  3SEX A;  1TXF A;  3Q29 A;  3FXQ A;  1B5H A;  4BDQ A;  5EHS A;  4Q8R A;  2PBW A;  2G29 A;  5IZZ A;  5TP9 B;  3G3H A;  1LAX A;  3TAJ A;  5DVF A;  1MM7 A;  4I8C A;  3BFU A;  1URS A;  1SBP A;  1FQA A;  1OIB A;  1S9T A;  1M5B A;  3KJ7 A;  1B1X A;  4R74 A;  3MQ9 A;  4PBQ A;  3I5O A;  3VVD A;  4MH5 A;  1JNF A;  2AIX A;  2Z23 A;  4C1T A;  2V4C A;  4RA1 A;  2I6E A;  4N6D A;  3ECR A;  2GH9 A;  2XXT A;  4U4X A;  1H43 A;  4QFK A;  3FVN A;  2Z22 A;  4KD5 A;  2QS2 A;  1ELJ A;  4LP2 B;  5AE4 A;  4PAF A;  1P1O A;  5FTH A;  2RC9 A;  1LAF E;  2OBG A;  4F3B A;  4THI A;  4NF8 B;  3Q26 A;  2DSF A;  1XVY A;  2PT1 A;  3LBS A;  1JVY A;  4F39 A;  1B4Z A;  1FW0 A;  1QUK A;  1DPP A;  2I0B A;  1ANF A;  5H8Q B;  3OO9 A;  5H8N A;  1MRP A;  3TZA A;  3LSL A;  1EZO A;  4IO3 A;  1PB9 A;  2F7A A;  5BUU A;  2O6A A;  3G3J A;  4U4S A;  3SER A;  2ONK E;  3C31 A;  4O94 A;  3G3F A;  3MP6 A;  1UTB A;  3K01 A;  2A5T A;  4NN3 A;  4OQO A;  3M3F A;  1OMP A;  4PGP A;  3A09 A;  1J1N A;  1O63 A;  2XXQ A;  2VP1 A;  1OQH A;  2CEX A;  4H5G A;  5KCJ B;  4GF8 A;  3H6V A;  3HO7 A;  4F1V A;  4OFL A;  1D3K A;  3UN6 A;  3W9V A;  4MFI A;  3TTL A;  1I6A A;  4NF4 A;  1P99 A;  3V8X B;  3DEL B;  3L6G A;  4QSD A;  2O1M A;  3KSJ A;  4O8M A;  4Z0I A;  1B58 A;  5CRY A;  2XXY A;  3MP8 A;  4OZ9 A;  1Y3N A;  3MZ1 A;  1MXU A;  4DZ1 A;  4NF5 B;  2AYS A;  5IGA A;  1ATG A;  3FVO A;  3SDF A;  4ELR A;  4RNS A;  3VLU A;  2PFY A;  1MQJ A;  4H0W A;  4NAP A;  3B7D A;  4RXL A;  3GBB A;  1LAG E;  4MX6 A;  3RY3 A;  1A55 A;  1DTZ A;  5HPQ A;  3MVX A;  4FOR A;  3MWB A;  3OEN A;  4JBZ A;  4LA9 A;  1O64 A;  1MPB A;  1MXY A;  2XXV A;  4I9D A;  2CEY A;  1B5J A;  3IX1 A;  3IJO B;  1FQD A;  2DYX A;  4JDF A;  5JK4 A;  2W7Y A;  5KDT A;  4IGT A;  3QK6 A;  2RF1 A;  5IAI A;  3G3I A;  1B7H A;  1R6Z A;  4EQ9 A;  1MQD A;  3T22 A;  3LR1 A;  4QF9 A;  1MH4 A;  3O9P A;  1B3H A;  3PPR A;  3KOS A;  1DPE A;  5I5P A;  3K1N A;  4H6D A;  4F2Q A;  4QHQ A;  5HM4 B;  5DVJ A;  1LBB A;  3FXB A;  3QYT A;  1UIV A;  3N94 A;  3GLB A;  5ISU A;  3N6T A;  3MW0 A;  2I3V A;  3OXN A;  4KCD A;  1QUL A;  4MF3 A;  3TQW A;  5AA2 A;  4RPN A;  2ALU A;  5H8N B;  2RC7 A;  4EQB A;  3V89 B;  3TMG A;  4PFT A;  3B50 A;  1FQE A;  4MLV A;  2YJP A;  5B70 A;  3TYH A;  3UIF A;  1JEV A;  5M2V A;  1PB7 A;  4HCW A;  3Q28 A;  1UTB B;  5AA2 D;  1FTO A;  3KFM A;  4PE5 B;  3EHS A;  4KHZ E;  2P1S A;  5JEI A;  4OXV A;  1TFA A;  1H76 A;  4U22 A;  4BDL A;  4C0R A;  2QS4 A;  3TPA A;  1XT8 A;  2R6G E;  4NF4 B;  2KLF A;  4YKK A;  1IXH A;  3PUW E;  4WED A;  4I62 A;  2ONR A;  4R6Y A;  5L9O A;  4N6P A;  4N8G A;  4G8H A;  2XX9 A;  3K02 A;  1US5 A;  4FAJ A;  1UQW A;  3PPN A;  4QFP A;  4U1O A;  3S4U A;  1IUD A;  4KFQ A;  3MC2 A;  3TFL A;  4Z7E A;  5LOM A;  1SW5 A;  4BDR A;  5H8H A;  1Y4T A;  4BDN A;  2V84 A;  3OO7 A;  3HV1 A;  4LON B;  3QUJ A;  4LZ8 A;  3CVG A;  3KN3 A;  4FED A;  1IEJ A;  1HSL A;  3Q27 A;  4TLL B;  3T96 B;  3T9H B;  3PUZ E;  4XXU A;  3PMX A;  4P9K A;  2F34 A;  3TCH A;  2YLN A;  4F2O A;  1POY 1;  1OLA A;  2PX1 A;  4JWO A;  4M1V A;  5AA1 A;  1YAE A;  2DXY A;  4OVQ A;  3DP6 A;  3U65 A;  1IXI A;  3PMW A;  4HW8 A;  3C35 A;  1ZMG A;  1MQG A;  1FQC A;  1PBQ A;  1SI1 A;  3UK4 A;  4NED A;  5KDT B;  4HCY A;  3TUS A;  1HSE A;  4MMP A;  4NX1 A;  4ZEK A;  4H5F A;  3W15 C;  4NHB A;  4G8N A;  4PFW A;  4KCC A;  1URD A;  4OEU A;  3RTF B;  2I58 A;  1BKA A;  2AL5 A;  4XIG Q;  4ZDM A;  1EU8 A;  4N07 A;  2WYK A;  4DIG A;  4JWX A;  1NKX A;  3FAT A;  3ILU B;  3OMB A;  1B7U A;  1MQI A;  4H67 A;  1FTL A;  3BFT A;  4YB6 A;  3CIJ A;  4X48 A;  1USY H;  3MVZ A;  3RTW B;  4QRZ A;  5AA2 B;  4IO7 A;  4ONY A;  1N76 A;  2DVZ A;  4UA8 A;  2HAU A;  3IK6 B;  4HS7 A;  2B3B A;  3VLW A;  1A40 A;  1JET A;  1PB8 A;  3KJT A;  2NWJ A;  4GWO A;  4GXA A;  5F1Q A;  4X1B A;  1MM6 A;  2QPQ A;  3GBA A;  3TDJ A;  3CSG A;  1GR2 A;  3CI8 A;  3K4U A;  1ZJL A;  3OOA A;  4ZZA A;  4P11 A;  4PFB A;  3K0V A;  1ZKB A;  3B6T A;  2THI A;  5I2K A;  1RYO A;  3OEM A;  2XWI A;  2F7B A;  1LGB C;  4RPO A;  4ELP A;  3RGY A;  1SW4 A;  4IB2 A;  2V25 A;  2PVU A;  5ITO A;  1L5T A;  4EUO A;  3TEL A;  4N6K A;  1NNP A;  3MZ9 A;  2XXP A;  4E0X A;  4MNP A;  1AIV A;  3S2V A;  2XXH A;  4PFY A;  3VFJ A;  5I58 A;  5FHM A;  1B05 A;  4WEP A;  3H7M A;  5H8H B;  2QRY A;  2UVH A;  1B4H A;  3VDF A;  3HST A;  1P1N A;  1ZIU A;  5CC2 A;  2HFB A;  1DTG A;  2H5Y A;  2ZZV A;  1Y3Q A;  4PFR A;  4TQU Q;  1AL3 A;  4UAB A;  1LBC A;  3MPL A;  3S9N C;  3GYY A;  2OJT A;  4ZE8 A;  4H8J A;  3KEI A;  4XKP A;  2V3Q A;  1F9B A;  3B6W A;  3KZG A;  2X26 A;  1LST A;  3RPW A;  4N91 A;  4QFN A;  4ZEF A;  5ICT A;  2H9B A;  3FGS A;  2I49 A;  4F1U A;  4JB7 A;  4OFO A;  3MVY A;  3ZSF A;  3H06 B;  4MNI A;  2D5W A;  2E1S A;  1VSO A;  4OA4 A;  5A5X A;  4BLA A;  4K3F A;  1Y1M A;  1GV8 A;  2HZK A;  1SYI A;  4NF6 A;  3G3G A;  1MY0 A;  3VV5 A;  1R1N A;  3FJ7 A;  5KZT A;  2ABH A;  1QUJ A;  5H8F A;  2VPO A;  3I3V A;  4OWD A;  4XFE A;  5K2X A;  3K00 A;  1JW1 A;  1N84 A;  2VPN A;  2HQ0 A;  4PAI A;  3FV2 A;  2OCU A;  1O7T A;  5LTC A;  4ZS9 A;  4KQP A;  3MUQ A;  4WKM A;  1EZ9 A;  4N13 A;  1URG A;  3PUY E;  2XWO A;  4DXC A;  3HPI A;  3PU5 A;  4YIC A;  4F31 B;  3H6T A;  1QW0 A;  2DWA A;  4ELQ A;  1D4N A;  4H1X A;  1R9Q A;  1KWH A;  2QMX A;  4OVT A;  1A54 A;  4AB6 A;  1B32 A;  2ZYN A;  3K1P A;  3RLF E;  3O6H A;  1B1H A;  5ITP A;  4NF0 A;  4RK2 A;  2QS1 A;  1OLC A;  4GL8 A;  2O84 X;  5I2K B;  4OYV A;  3QAX A;  2O51 A;  2Y84 A;  4F1Y A;  2I3W A;  3AXF A;  5IM2 A;  1Y1Z A;  1OVT A;  2V93 A;  3E3K A;  4TLM B;  3Q25 A;  3K1M A;  4ESW A;  1M5E A;  4R9G A;  3O2A A;  3K6V A;  1I6Q A;  4NWC A;  1SI0 A;  4G68 B;  2REG A; 
#chains in the Genus database with same CATH topology
 4IY5 A;  2H98 A;  3GZG A;  1FBH A;  3ZS6 A;  4C1U A;  5I58 B;  3P7I A;  4JSD A;  1MY3 A;  1Y4C A;  3OO8 A;  3W9W A;  3MAM A;  4FE8 A;  4R72 A;  5I7I A;  2UYE A;  4NQ8 A;  1B0L A;  3QMF A;  4PDD A;  4OVJ A;  1AH5 A;  2NVU B;  2DWI A;  1DOT A;  2NUV A;  4DLD A;  2XXK A;  1GVC A;  3DLN A;  1LCT A;  1FJ9 A;  3T9U A;  5LDZ A;  2HHM A;  1NV5 A;  3QXM A;  2F97 A;  3ZKK A;  1LEV A;  3NOH A;  1EZP A;  4PF6 A;  1VE4 A;  1T0K A;  4O3C A;  1QKA A;  1NV0 A;  5I2N A;  3S9E A;  1B3F A;  1MY1 A;  2ZNT A;  3ONM A;  2Y7K A;  4NG7 A;  4RK9 A;  2VHA A;  3IOR A;  1N7W A;  2RKM A;  3FAS A;  3KGC A;  2BJJ X;  1H3D A;  5A5X B;  1XOC A;  1LFH A;  1BP5 A;  4DCX A;  4NF6 B;  2OWS A;  4YKJ A;  2Z8D A;  4I3E A;  1SPI A;  2UXA A;  2Q74 A;  5H8F B;  1FTM A;  4HE0 A;  4PE3 A;  3KN7 A;  5TU0 A;  1NUZ A;  2UYF A;  1DMB A;  2RIN A;  4YB5 A;  1DCU A;  2Y7I A;  3MP1 A;  2DVC A;  1K9Y A;  4PC9 A;  4F3S A;  1GTK A;  4NWD A;  1AOV A;  1FPJ A;  1KZ8 A;  3C33 A;  4XKQ A;  1BK4 A;  4U2R A;  2ZYK A;  4U23 A;  5DT6 A;  2Y7P A;  5EQA A;  2HZL A;  2QL3 A;  4N4U A;  2XD3 A;  1A8E A;  2D3I A;  5DYH A;  3S9L C;  2QJE A;  4O7I A;  4TOZ A;  1TWY A;  5I56 A;  5L8D A;  3FD3 A;  2M8C A;  2ZYM A;  3LSW A;  3TCG A;  1WVJ A;  2XWV A;  1JVX A;  1SQY A;  4GBW A;  3CR9 A;  3C4M A;  4L17 A;  4IY6 A;  2HXW A;  2A5T B;  2Y5K A;  3ZKL A;  3LSX A;  3S9M C;  2ZXT A;  4WXJ A;  4KYS A;  4H8I A;  4OTE A;  3MVW A;  3SKP A;  4PAK A;  3TEP A;  3V5A A;  1Q1K A;  5ET5 A;  4XTC Q;  4G61 A;  3C34 A;  4DXB A;  3DP8 A;  1NV6 A;  3O6G A;  4H65 A;  2HPG A;  3SEU A;  2P2A A;  4LQ2 A;  2RCA A;  1LB8 A;  1P1Q A;  1NMU A;  2YPN A;  2RCB A;  4JWY A;  1USY E;  4DE8 A;  2XA5 A;  1MPC A;  3USD A;  5K2Y A;  1RYX A;  4LVQ A;  4G77 A;  1NI9 A;  5AA4 A;  2FBP A;  5CBS A;  1UTH A;  1B3L A;  4KR5 A;  1MXW A;  4OEV A;  5DTB A;  1IIW A;  3RN8 A;  2Q88 A;  3PPP A;  1B2H A;  2VOZ A;  1A7L A;  1NH7 A;  2DOJ A;  4R2F A;  4N17 A;  3R7X A;  1ZLQ A;  4MNC A;  4R73 A;  1LAH E;  1B52 A;  2E0S A;  3EF7 A;  1FPD A;  1S7Y A;  5DW8 A;  2GHB A;  2FA7 A;  4X8R A;  4EF2 A;  3SZP A;  1ZTY A;  3THI A;  1NUW A;  1BTJ A;  1CB6 A;  1SDX A;  3K6X A;  4BDO A;  2FVZ A;  4R6H A;  2ANJ A;  2O69 A;  4OVR A;  1JP4 A;  4YKI A;  3O28 A;  1B0H A;  2FIX A;  1S50 A;  2DE2 A;  5JTY A;  3F11 A;  4EXL A;  2Z8E A;  4NE4 A;  3RPL A;  3K6W A;  1UIU A;  3TKD A;  3CG1 A;  4DI4 B;  4RJZ A;  1XHY A;  1NV2 A;  1EYI A;  1G0I A;  2X7Q A;  4NTL A;  1B40 A;  4OVS A;  3BKI B;  3PUV E;  4KYE A;  1B6H A;  1B7Z A;  5I84 A;  2UVI A;  1Z7N E;  4O7M A;  2R9J A;  3R6U A;  1BIY A;  3LUY A;  4X1D A;  1QKB A;  4I1D A;  2F5X A;  4F18 A;  3FXU A;  4YMA A;  1VR5 A;  4ZEI A;  1FPF A;  4R75 A;  1QUI A;  1Q35 A;  4DDD A;  1N0T A;  4PF8 A;  2B4M A;  1LBX A;  4MHF A;  2GRV A;  1MY2 A;  1RDZ A;  4GLI A;  2O7I A;  1Z7M E;  5I3S A;  3IB2 A;  4F3G A;  3PV0 E;  3M8U A;  4MLQ A;  3I6V A;  2F6P A;  3ODB A;  5EYF A;  2F35 A;  5CMC A;  1FBD A;  3CFZ A;  3U8Q A;  3KN8 A;  3IR1 A;  3FUZ A;  1CNQ A;  1WOD A;  3RUM A;  2ZYO A;  1XC1 A;  4OEN A;  1MDP 1;  2UVG A;  4OET A;  2LAO A;  5CM6 A;  3FIR A;  1M5D A;  3H03 A;  2IEE A;  3VVE A;  1FBC A;  4ZE9 A;  5ET8 A;  4IO4 A;  1FBG A;  4U21 A;  4PCD A;  3VXC A;  2Q8J A;  3IL1 B;  5AA4 B;  3PMV A;  3M3L A;  1YPN A;  4IGR A;  4YAH X;  4ZZE A;  2DE3 A;  3FBP A;  2XWK A;  3BBR A;  3TTN A;  1B46 A;  3TQL A;  5L9M A;  5TPA A;  4POX A;  1IZ1 A;  3DP4 A;  4F19 A;  1SYH A;  5CI5 A;  5FHN A;  3KG2 A;  4EF1 A;  4P1L A;  2F78 A;  4O3A A;  1OQG A;  2GQ1 A;  3EN3 A;  3U92 A;  4FJP A;  3T66 A;  2F6G A;  1VFE A;  1Y20 A;  3A3C A;  4POW A;  3WAF A;  1DBZ A;  5F7V A;  3MST A;  4OVP A;  3C9H A;  2XHD A;  4UAC A;  1I6B A;  2OLB A;  3D4C A;  2AL4 A;  1FRP A;  5JTY B;  4AQ4 A;  1YCJ A;  2CZL A;  5IZ3 A;  3RPL B;  3RQT A;  1TT1 A;  1MS7 A;  3GXA A;  1G0H A;  2PMS A;  4R9F A;  2XD2 A;  2NOO A;  4GRK A;  2ONS A;  1LBV A;  1FPI A;  3EQ1 A;  3FZV A;  1NNF A;  3H4Z A;  4QSC A;  2PFZ A;  2OX3 A;  1LLS A;  2X7P A;  4LAT A;  4PFU A;  1MY4 A;  1A99 A;  1K9Z A;  2F7C A;  2I0C A;  4HXV A;  1TFD A;  5ELV A;  2F36 A;  2HAV A;  2P3N A;  3FXR A;  2DXR A;  1NV7 A;  1RKM A;  2H25 A;  3N6U A;  3B6Q A;  2XXI A;  2WYP A;  4PQJ A;  4M4G A;  3CFX A;  4RY1 A;  3IO6 A;  1HSJ A;  3VLV A;  4P8B A;  1N7X A;  2WX9 A;  4HE1 A;  3MBP A;  3TOD A;  2FNC A;  2O1L A;  5FTI A;  1IQ7 A;  3JV9 A;  3IAZ A;  2P0S A;  1SVX B;  4NMY A;  3SEY A;  2ZNS A;  5ET7 A;  3T93 B;  3IOV A;  3MJN A;  4Q5T A;  3M3K A;  3RT8 A;  3R26 A;  1NNT A;  3SEV A;  3N5L A;  1B9J A;  3QIM A;  3KSX A;  1QGX A;  4MIJ A;  4LZ5 A;  3ILT B;  2PT2 A;  1IXC A;  1NH8 A;  2VT5 A;  2RC8 A;  2WBD A;  5HBC A;  3IOW A;  4X9T A;  4XEQ A;  2Q9T A;  4ECF A;  2Q89 A;  4KI0 E;  4OHN A;  4R6K A;  4YB7 A;  1N3X A;  3OEL A;  5I57 A;  1YXI A;  1LB9 A;  2P3V A;  1MXZ A;  1JW4 A;  1DK4 A;  4BDM A;  3O66 A;  5I59 A;  3PPQ A;  2DWJ A;  2B65 A;  5TPA B;  1B5I A;  3QUF A;  4LZ7 A;  3JZJ A;  4HTG A;  2I4C A;  3HCQ A;  3VVF A;  1MPD A;  1FPG A;  1PC3 A;  4YU0 A;  5B7D A;  3IOU A;  3N26 A;  1EYJ A;  1AMF A;  1FCK A;  4MEV A;  1B3G A;  5CMB A;  4ESX A;  2F3B A;  1VFD A;  4H46 A;  3EHU A;  2CZK A;  3UGW A;  3SET A;  4EXK A;  3IJX B;  1ZBM A;  4PDH A;  3UP9 A;  4Q30 B;  2PCR A;  1FQB A;  1H44 A;  3OSQ A;  1JEU A;  2I4B A;  1LCF A;  4GD5 A;  4ELO A;  2VD2 A;  5IZ3 B;  2GHA A;  3EHT A;  4G4P A;  2Z8F A;  3H6W A;  2G93 A;  3JYR A;  2XXX A;  2A5S A;  4GL0 A;  3G7W A;  2QVR A;  4QSE A;  3FJG A;  4QFO A;  4Q0C A;  4DCY A;  4G2Z A;  3BIG A;  2QVU A;  2GFE A;  3TTM A;  5H8S A;  3E4R A;  4JSO A;  4MBP A;  1XS5 A;  2FHY A;  3CG3 A;  4FEC A;  3E13 X;  2XX7 A;  2ZZX A;  4LN5 A;  1FJ6 A;  4FAT A;  1MG1 A;  4F22 A;  2ZNU A;  2PYY A;  2D21 A;  5DEX A;  2Q8M A;  4KPT A;  1SW1 A;  3UOR A;  2XXR A;  3VE1 B;  3IFA A;  4P0I A;  5CMM A;  3SEW A;  3TTR A;  4QFL A;  4KYD A;  1MQH A;  1D9V A;  1FTA A;  4F29 A;  3V83 A;  4KXP A;  2V3U A;  4O3B A;  4P3L A;  4GOT A;  3WAE A;  3U1O A;  1PBP A;  2JJK A;  3IO4 A;  4IO2 A;  4NGU A;  4XKR A;  1D9Y A;  1FBF A;  4RYA A;  2KR0 A;  1NFT A;  4FIM A;  3C36 A;  4G8M A;  3CFL A;  1FQF A;  3RT6 B;  2XXU A;  1SW2 A;  3QSL A;  2CZI A;  1US4 A;  1H45 A;  3OEK A;  5BWJ A;  4OER A;  3CRB A;  3LC8 A;  2Y7R A;  3PUX E;  1IMD A;  5I57 B;  4ZEB A;  1P1U A;  1WDN A;  2Q2C A;  1KA1 A;  2Y7W A;  5EYH A;  1OVB A;  1XVX A;  5I59 B;  4R2B A;  2OZZ A;  2ZMB A;  3E78 A;  2DS9 A;  2O68 A;  1GGG A;  4IO5 A;  5DVI A;  3T9V A;  1FPB A;  1EH3 A;  3G3K A;  1MXX A;  5T3J A;  3T1B A;  4PFI A;  4LUB A;  2CMO A;  1YTV A;  4IO6 A;  2F8D A;  1P1W A;  3SES A;  5AA3 A;  4QXD A;  1II5 A;  4P56 A;  2L5V A;  3PPO A;  2Y5L A;  4X04 A;  3MPK A;  3E9X A;  2XX8 A;  1ZU0 A;  2REJ A;  3HFU A;  2DP8 A;  2UVJ A;  2FYI A;  3KC0 A;  4U1Z A;  3OD7 A;  3KBR A;  1Y9U A;  4F3P A;  4EDP A;  1IMF A;  5I2N B;  2I48 A;  3H3G A;  1FTK A;  1Y3P A;  4EQ7 A;  3LUZ A;  4YKP A;  1N3W A;  2OK2 A;  1MXV A;  2OWT A;  3DM0 A;  5IKB A;  5ICQ A;  1QVS A;  5TP9 A;  1A8F A;  2XXW A;  3HHG A;  5FHO A;  3KOT A;  3U93 A;  4GQO A;  4PGN A;  4OFJ A;  3TTK A;  3L6H A;  3KBZ A;  3FVK A;  3H6U A;  4GFR A;  3D4G A;  3ROJ A;  3VXB A;  1N04 A;  1B51 A;  5J1D A;  4FEB A;  3EPE A;  3OSR A;  3U72 A;  4DI3 D;  2DE4 A;  4OAN A;  4GWX A;  2ZZW A;  2HCA A;  1DSN A;  5EHM A;  1MH3 A;  3RNN A;  3CSB A;  5L9S A;  4JXI A;  3PGF A;  3UA8 A;  4P0G A;  2ESN A;  3IOT A;  1LFI A;  1POT A;  3FV1 A;  5DEX B;  5EYG A;  4DXU A;  2Q2A A;  1BLF A;  2MKZ A;  5I56 B;  1IIT A;  4P47 A;  1QJM A;  4GBV A;  3TCF A;  2V3T A;  3PD8 A;  4LQ5 A;  2WKY A;  3IB0 A;  3E79 A;  1R9L A;  3O97 A;  2H99 A;  5CBR A;  4NF8 A;  1CE2 A;  4GIZ A;  4G68 C;  2QMW A;  1M5C A;  1FTJ A;  3HHF A;  2QS3 A;  3K2D A;  3A3U A;  2IA4 A;  4N15 A;  4OMB A;  3LSF B;  2B4L A;  2DWH A;  4MAG A;  1I69 A;  5H8Q A;  3IB1 A;  3U94 A;  3FJM A;  4XF5 A;  4MCO A;  3MZB A;  4N8Y A;  4GXS B;  4PBH A;  4XKN A;  3D1R A;  1LFG A;  4YZZ A;  4GX6 A;  2B3F A;  2O7U A;  4ND9 A;  4GVO A;  2R71 A;  4PET A;  3HN0 A;  2VD3 A;  3OO6 A;  3PD9 A;  3O29 A;  4P1E A;  3FVG A;  2HEU A;  4E0W A;  1M5F A;  2CZH A;  5KCJ A;  2H4I A;  1PEB A;  4ZED A;  1UTH B;  1B3E A;  4OES A;  1IXG A;  4I3Y A;  1SD3 A;  3C32 A;  4ISU A;  2NXO A;  1PDA A;  3K6U A;  1MDQ A;  1NNK A;  4AB5 A;  4G68 A;  1LBZ A;  5CMK A;  4YMB A;  1NL5 A;  4PP0 A;  3T9X B;  1JQF A;  4QBA A;  3O6I A;  1JW5 A;  2QSX A;  2DQV A;  2VGQ A;  4ZEC A;  4NF5 A;  3SEX A;  3LV0 A;  1TXF A;  3Q29 A;  3FXQ A;  1B5H A;  4BDQ A;  5EHS A;  4Q8R A;  2PBW A;  2G29 A;  5IZZ A;  5TP9 B;  3G3H A;  1LAX A;  3TAJ A;  5DVF A;  1MM7 A;  4I8C A;  3BFU A;  1URS A;  1SBP A;  1FQA A;  1OIB A;  1S9T A;  1M5B A;  3KJ7 A;  1B1X A;  4R74 A;  1RDX A;  3MQ9 A;  4PBQ A;  3I5O A;  3VVD A;  4MH5 A;  1JNF A;  2AIX A;  2Z23 A;  4C1T A;  2V4C A;  3B8B A;  4RA1 A;  2I6E A;  4N6D A;  3ECR A;  2GH9 A;  2XXT A;  4U4X A;  1H43 A;  2WEF A;  4QFK A;  3FVN A;  2Z22 A;  4KD5 A;  2QS2 A;  5IZ1 A;  4N81 A;  1ELJ A;  3T0J A;  4LP2 B;  5AE4 A;  4PAF A;  1P1O A;  5FTH A;  2RC9 A;  1LAF E;  1AWB A;  2OBG A;  2WBB A;  4F3B A;  1VDW A;  4THI A;  4NF8 B;  3Q26 A;  2DSF A;  1XVY A;  2PT1 A;  3LBS A;  1JVY A;  4F39 A;  1B4Z A;  1XI6 A;  1FW0 A;  1QUK A;  1DPP A;  2I0B A;  1ANF A;  5H8Q B;  3OO9 A;  5H8N A;  1MRP A;  3TZA A;  3LSL A;  1EZO A;  3CHG A;  4IO3 A;  1PB9 A;  2F7A A;  5BUU A;  2O6A A;  3G3J A;  1RDY A;  4U4S A;  3SER A;  2ONK E;  3C31 A;  4O94 A;  5ET6 A;  3G3F A;  3MP6 A;  1UTB A;  3K01 A;  2A5T A;  4NN3 A;  4OQO A;  3M3F A;  1OMP A;  4PGP A;  3A09 A;  1J1N A;  1O63 A;  2XXQ A;  2VP1 A;  1OQH A;  2CEX A;  4H5G A;  5KCJ B;  4GF8 A;  3H6V A;  3HO7 A;  4F1V A;  4OFL A;  1D3K A;  3UN6 A;  3W9V A;  4MFI A;  3TTL A;  4GWZ A;  1I6A A;  4NF4 A;  1P99 A;  3V8X B;  1YYZ A;  3DEL B;  3L6G A;  4QSD A;  2O1M A;  3KSJ A;  4O8M A;  4Z0I A;  1B58 A;  5CRY A;  2XXY A;  1LBW A;  3IFC A;  3MP8 A;  4OZ9 A;  1Y3N A;  3MZ1 A;  1MXU A;  4DZ1 A;  4NF5 B;  2AYS A;  1IMB A;  5IGA A;  1ATG A;  3FVO A;  3SDF A;  4ELR A;  4RNS A;  3VLU A;  2PFY A;  1MQJ A;  4H0W A;  4NAP A;  3B7D A;  4RXL A;  3GBB A;  1FSA A;  4GWW A;  2QFL A;  1LAG E;  4MX6 A;  3RY3 A;  1A55 A;  1DTZ A;  5HPQ A;  1KA0 A;  3MVX A;  4FOR A;  4H45 A;  3MWB A;  3OEN A;  4JBZ A;  1LBY A;  4LA9 A;  1O64 A;  1IMC A;  1MPB A;  1MXY A;  2XXV A;  4I9D A;  2CEY A;  4JVC A;  1FPL A;  1B5J A;  3IX1 A;  4GWS A;  3IJO B;  1FQD A;  4I40 A;  2DYX A;  4JDF A;  5JK4 A;  2QVV A;  2W7Y A;  5KDT A;  1FBP A;  4IGT A;  3QK6 A;  2RF1 A;  5IAI A;  3G3I A;  1B7H A;  1R6Z A;  4EQ9 A;  1MQD A;  3T22 A;  3LR1 A;  4QF9 A;  1MH4 A;  3O9P A;  1B3H A;  3PPR A;  3KOS A;  1IMA A;  1DPE A;  5I5P A;  3K1N A;  4H6D A;  4F2Q A;  4QHQ A;  5HM4 B;  5DVJ A;  1LBB A;  3FXB A;  3QYT A;  1UIV A;  3N94 A;  3GLB A;  5ISU A;  3N6T A;  3MW0 A;  2I3V A;  3OXN A;  4KCD A;  1QUL A;  4MF3 A;  3TQW A;  5AA2 A;  4RPN A;  2ALU A;  5H8N B;  2RC7 A;  1EYK A;  4EQB A;  3V89 B;  3TMG A;  4PFT A;  3B50 A;  1FQE A;  4MLV A;  2YJP A;  5B70 A;  3TYH A;  3UIF A;  1JEV A;  5M2V A;  1Q9D A;  1PB7 A;  4HCW A;  3Q28 A;  1UTB B;  5AA2 D;  1FTO A;  3KFM A;  4PE5 B;  3EHS A;  4KHZ E;  2P1S A;  5JEI A;  2HXR A;  4OXV A;  1TFA A;  1H76 A;  4U22 A;  4BDL A;  4C0R A;  2QS4 A;  3TPA A;  1YZ0 A;  1IME A;  1XT8 A;  2R6G E;  4NF4 B;  2KLF A;  4YKK A;  1IXH A;  3PUW E;  4WED A;  1INP A;  4I62 A;  2ONR A;  4R6Y A;  5L9O A;  4N6P A;  4N8G A;  4G8H A;  2XX9 A;  3K02 A;  1US5 A;  4FAJ A;  1UQW A;  3PPN A;  4QFP A;  4U1O A;  3S4U A;  1IUD A;  4KFQ A;  3MC2 A;  3TFL A;  4Z7E A;  5LOM A;  1SW5 A;  4BDR A;  5H8H A;  1Y4T A;  4BDN A;  2V84 A;  3OO7 A;  5A5L A;  3HV1 A;  4LON B;  3QUJ A;  4LZ8 A;  3CVG A;  3KN3 A;  4FED A;  1IEJ A;  1HSL A;  3Q27 A;  4TLL B;  3T96 B;  3T9H B;  3PUZ E;  4XXU A;  5ESY A;  3PMX A;  4P9K A;  2F34 A;  3TCH A;  2YLN A;  4F2O A;  1POY 1;  1OLA A;  2PX1 A;  1NV3 A;  4JWO A;  4M1V A;  5AA1 A;  1YAE A;  5J16 A;  4AS4 A;  2DXY A;  4OVQ A;  3DP6 A;  3U65 A;  1IXI A;  3PMW A;  1FPE A;  4HW8 A;  3C35 A;  1ZMG A;  1MQG A;  1FQC A;  1PBQ A;  4GWY A;  1SI1 A;  3UK4 A;  4NED A;  5KDT B;  4JVD A;  4HCY A;  3TUS A;  5FBP A;  1HSE A;  4MMP A;  4NX1 A;  4ZEK A;  4H5F A;  3W15 C;  4NHB A;  4GX3 A;  4G8N A;  4PFW A;  4KCC A;  1URD A;  4OEU A;  3KC1 A;  3RTF B;  2I58 A;  1BKA A;  2AL5 A;  4GWU A;  4GX4 A;  4XIG Q;  4ZDM A;  1EU8 A;  4N07 A;  2WYK A;  4DIG A;  4JWX A;  1NKX A;  3FAT A;  3ILU B;  3OMB A;  1B7U A;  1MQI A;  4H67 A;  1FTL A;  1FPK A;  3A29 A;  3BFT A;  4YB6 A;  3CIJ A;  4X48 A;  1USY H;  3MVZ A;  3RTW B;  4QRZ A;  5AA2 B;  4IO7 A;  4ONY A;  1NV4 A;  1N76 A;  2DVZ A;  4UA8 A;  2BJI A;  2HAU A;  3IK6 B;  4HS7 A;  2B3B A;  3VLW A;  1A40 A;  1JET A;  1PB8 A;  3KJT A;  2NWJ A;  4GWO A;  4GXA A;  5F1Q A;  4X1B A;  1MM6 A;  2QPQ A;  3GBA A;  3TDJ A;  3CSG A;  2OWZ A;  1GR2 A;  3CI8 A;  3K4U A;  1ZJL A;  3OOA A;  5EQ9 A;  4ZZA A;  4P11 A;  4PFB A;  3K0V A;  1ZKB A;  3B6T A;  2THI A;  5I2K A;  1RYO A;  3OEM A;  2XWI A;  2F7B A;  1LGB C;  3BIH A;  2DDK A;  4RPO A;  2F3D A;  4ELP A;  3RGY A;  1SW4 A;  4IB2 A;  2V25 A;  2PVU A;  5ITO A;  1L5T A;  4EUO A;  3TEL A;  4N6K A;  1NNP A;  3MZ9 A;  2XXP A;  4E0X A;  4MNP A;  1AIV A;  3S2V A;  4PTK A;  2XXH A;  3MYU A;  4PFY A;  3VFJ A;  5I58 A;  5FHM A;  1B05 A;  4WEP A;  3H7M A;  5H8H B;  2QRY A;  2UVH A;  1B4H A;  4AS5 A;  3VDF A;  3HST A;  1P1N A;  1ZIU A;  5CC2 A;  2HFB A;  1DTG A;  2H5Y A;  2ZZV A;  1Y3Q A;  4PFR A;  4TQU Q;  1AL3 A;  4UAB A;  1LBC A;  3MPL A;  3S9N C;  3GYY A;  3ISP A;  2OJT A;  4ZE8 A;  4H8J A;  3KEI A;  4XKP A;  3RYD A;  2V3Q A;  1F9B A;  3B6W A;  3KZG A;  1NUX A;  1LST A;  2X26 A;  3RPW A;  4N91 A;  1D9Q A;  4QFN A;  4ZEF A;  5ICT A;  2H9B A;  3PTY A;  3FGS A;  2I49 A;  4F1U A;  4JB7 A;  4OFO A;  3MVY A;  3ZSF A;  3H06 B;  4MNI A;  2D5W A;  2E1S A;  1VSO A;  2R8T A;  4OA4 A;  5A5X A;  4BLA A;  4K3F A;  1Y1M A;  1GV8 A;  2HZK A;  1SYI A;  4NF6 A;  3G3G A;  3EKI A;  1MY0 A;  3VV5 A;  1R1N A;  3FJ7 A;  5KZT A;  2ABH A;  1QUJ A;  1NUY A;  5H8F A;  2VPO A;  3I3V A;  4OWD A;  4XFE A;  4JVI A;  5EQ7 A;  5K2X A;  3K00 A;  1JW1 A;  1N84 A;  2VPN A;  2HQ0 A;  4PAI A;  2KQZ A;  3FV2 A;  2OCU A;  1O7T A;  5EQ8 A;  5LTC A;  4ZS9 A;  4KQP A;  3MUQ A;  4WKM A;  5F24 A;  1EZ9 A;  4N13 A;  2XWO A;  1URG A;  3PUY E;  4HE2 A;  4DXC A;  1NV1 A;  3HPI A;  3PU5 A;  4YIC A;  4F31 B;  4MJO A;  3H6T A;  1QW0 A;  2DWA A;  4ELQ A;  1D4N A;  4IR8 A;  4H1X A;  2FIE A;  1R9Q A;  1KWH A;  2QMX A;  4OVT A;  1A54 A;  4AB6 A;  1B32 A;  2ZYN A;  3K1P A;  3RLF E;  3O6H A;  1B1H A;  5ITP A;  4NF0 A;  4RK2 A;  2QS1 A;  4FBP A;  1OLC A;  4GL8 A;  2O84 X;  5I2K B;  4OYV A;  3QAX A;  2O51 A;  2Y84 A;  4F1Y A;  2I3W A;  3AXF A;  5IM2 A;  1Y1Z A;  1OVT A;  2V93 A;  3E3K A;  4TLM B;  3Q25 A;  1FBE A;  3K1M A;  4ESW A;  1M5E A;  4R9G A;  3O2A A;  3K6V A;  1I6Q A;  4NWC A;  1SI0 A;  4G68 B;  2REG A; 
#chains in the Genus database with same CATH homology
 4IY5 A;  2H98 A;  3GZG A;  3ZS6 A;  1FBH A;  4C1U A;  5I58 B;  3P7I A;  4JSD A;  1MY3 A;  1Y4C A;  3OO8 A;  3W9W A;  3MAM A;  4FE8 A;  4R72 A;  5I7I A;  2UYE A;  4NQ8 A;  1B0L A;  3QMF A;  4PDD A;  4OVJ A;  1AH5 A;  2NVU B;  2DWI A;  1DOT A;  2NUV A;  4DLD A;  2XXK A;  1GVC A;  3DLN A;  1LCT A;  1FJ9 A;  3T9U A;  5LDZ A;  2HHM A;  1NV5 A;  3QXM A;  2F97 A;  3ZKK A;  1LEV A;  3NOH A;  1EZP A;  4PF6 A;  1VE4 A;  1T0K A;  4O3C A;  1QKA A;  1NV0 A;  5I2N A;  3S9E A;  1B3F A;  1MY1 A;  2ZNT A;  3ONM A;  2Y7K A;  4NG7 A;  4RK9 A;  2VHA A;  3IOR A;  1N7W A;  2RKM A;  3FAS A;  3KGC A;  2BJJ X;  5A5X B;  1H3D A;  1XOC A;  1LFH A;  1BP5 A;  4DCX A;  4NF6 B;  2OWS A;  4YKJ A;  2Z8D A;  4I3E A;  1SPI A;  2UXA A;  2Q74 A;  5H8F B;  1FTM A;  4HE0 A;  4PE3 A;  3KN7 A;  5TU0 A;  1NUZ A;  2UYF A;  1DMB A;  2RIN A;  4YB5 A;  1DCU A;  2Y7I A;  3MP1 A;  2DVC A;  1K9Y A;  4PC9 A;  4F3S A;  1GTK A;  4NWD A;  1AOV A;  1FPJ A;  1KZ8 A;  3C33 A;  4XKQ A;  4U2R A;  1BK4 A;  2ZYK A;  4U23 A;  5DT6 A;  2Y7P A;  5EQA A;  2HZL A;  2QL3 A;  4N4U A;  2XD3 A;  1A8E A;  2D3I A;  5DYH A;  3S9L C;  2QJE A;  4O7I A;  4TOZ A;  1TWY A;  5I56 A;  5L8D A;  3FD3 A;  2M8C A;  2ZYM A;  3LSW A;  3TCG A;  1WVJ A;  2XWV A;  1JVX A;  1SQY A;  4GBW A;  3CR9 A;  3C4M A;  4L17 A;  4IY6 A;  2HXW A;  2A5T B;  2Y5K A;  3ZKL A;  3LSX A;  3S9M C;  2ZXT A;  4WXJ A;  4KYS A;  4H8I A;  4OTE A;  3MVW A;  3SKP A;  4PAK A;  3TEP A;  3V5A A;  1Q1K A;  5ET5 A;  4XTC Q;  4G61 A;  3C34 A;  4DXB A;  3DP8 A;  1NV6 A;  3O6G A;  4H65 A;  3SEU A;  2HPG A;  2P2A A;  4LQ2 A;  2RCA A;  1LB8 A;  1P1Q A;  1NMU A;  2YPN A;  2RCB A;  4JWY A;  1USY E;  4DE8 A;  2XA5 A;  1MPC A;  3USD A;  5K2Y A;  1RYX A;  4LVQ A;  4G77 A;  1NI9 A;  5AA4 A;  2FBP A;  5CBS A;  1UTH A;  1B3L A;  4KR5 A;  1MXW A;  4OEV A;  5DTB A;  1IIW A;  3RN8 A;  2Q88 A;  3PPP A;  1B2H A;  2VOZ A;  1A7L A;  1NH7 A;  2DOJ A;  4R2F A;  4N17 A;  3R7X A;  1ZLQ A;  4MNC A;  4R73 A;  1LAH E;  1B52 A;  2E0S A;  3EF7 A;  1FPD A;  1S7Y A;  5DW8 A;  2GHB A;  2FA7 A;  4X8R A;  4EF2 A;  3SZP A;  1ZTY A;  3THI A;  1NUW A;  1BTJ A;  1CB6 A;  1SDX A;  3K6X A;  4BDO A;  4R6H A;  2FVZ A;  2ANJ A;  2O69 A;  4OVR A;  1JP4 A;  4YKI A;  3O28 A;  1B0H A;  2FIX A;  1S50 A;  2DE2 A;  5JTY A;  3F11 A;  4EXL A;  2Z8E A;  4NE4 A;  3RPL A;  3K6W A;  1UIU A;  3TKD A;  3CG1 A;  4DI4 B;  4RJZ A;  1XHY A;  2X7Q A;  1EYI A;  1G0I A;  1NV2 A;  4NTL A;  1B40 A;  4OVS A;  3BKI B;  3PUV E;  4KYE A;  1B6H A;  1B7Z A;  5I84 A;  2UVI A;  1Z7N E;  4O7M A;  2R9J A;  3R6U A;  1BIY A;  3LUY A;  4X1D A;  1QKB A;  4I1D A;  2F5X A;  4F18 A;  3FXU A;  4YMA A;  1VR5 A;  4ZEI A;  1FPF A;  4R75 A;  1QUI A;  1Q35 A;  4DDD A;  1N0T A;  4PF8 A;  2B4M A;  1LBX A;  4MHF A;  2GRV A;  1MY2 A;  1RDZ A;  4GLI A;  2O7I A;  1Z7M E;  5I3S A;  3IB2 A;  4F3G A;  3PV0 E;  3M8U A;  4MLQ A;  3I6V A;  2F6P A;  3ODB A;  5EYF A;  2F35 A;  5CMC A;  3CFZ A;  1FBD A;  3U8Q A;  3KN8 A;  3IR1 A;  3FUZ A;  1CNQ A;  1WOD A;  3RUM A;  2ZYO A;  1XC1 A;  4OEN A;  1MDP 1;  2UVG A;  4OET A;  2LAO A;  5CM6 A;  3FIR A;  1M5D A;  3H03 A;  2IEE A;  3VVE A;  4ZE9 A;  1FBC A;  5ET8 A;  4IO4 A;  1FBG A;  4U21 A;  4PCD A;  3VXC A;  2Q8J A;  3IL1 B;  5AA4 B;  3PMV A;  3M3L A;  1YPN A;  4IGR A;  4YAH X;  4ZZE A;  2DE3 A;  3FBP A;  2XWK A;  3BBR A;  3TTN A;  1B46 A;  3TQL A;  5L9M A;  5TPA A;  4POX A;  1IZ1 A;  3DP4 A;  4F19 A;  1SYH A;  5CI5 A;  5FHN A;  3KG2 A;  4EF1 A;  4P1L A;  2F78 A;  4O3A A;  1OQG A;  2GQ1 A;  3EN3 A;  3U92 A;  4FJP A;  3T66 A;  2F6G A;  1VFE A;  1Y20 A;  3A3C A;  4POW A;  3WAF A;  1DBZ A;  5F7V A;  3MST A;  4OVP A;  3C9H A;  2XHD A;  4UAC A;  1I6B A;  2OLB A;  3D4C A;  2AL4 A;  1FRP A;  5JTY B;  4AQ4 A;  1YCJ A;  2CZL A;  5IZ3 A;  3RQT A;  3RPL B;  1TT1 A;  1MS7 A;  3GXA A;  2PMS A;  1G0H A;  4R9F A;  2XD2 A;  2NOO A;  4GRK A;  2ONS A;  1LBV A;  1FPI A;  3EQ1 A;  3FZV A;  1NNF A;  3H4Z A;  4QSC A;  2PFZ A;  2OX3 A;  1LLS A;  2X7P A;  4LAT A;  4PFU A;  1MY4 A;  1A99 A;  2F7C A;  1K9Z A;  2I0C A;  4HXV A;  1TFD A;  5ELV A;  2F36 A;  2HAV A;  2P3N A;  3FXR A;  2DXR A;  1NV7 A;  1RKM A;  2H25 A;  3N6U A;  3B6Q A;  2XXI A;  2WYP A;  4PQJ A;  4M4G A;  3CFX A;  4RY1 A;  3IO6 A;  1HSJ A;  3VLV A;  4P8B A;  1N7X A;  2WX9 A;  4HE1 A;  3MBP A;  3TOD A;  2FNC A;  2O1L A;  5FTI A;  1IQ7 A;  3JV9 A;  3IAZ A;  2P0S A;  1SVX B;  4NMY A;  3SEY A;  2ZNS A;  5ET7 A;  3T93 B;  3IOV A;  3MJN A;  4Q5T A;  3M3K A;  3RT8 A;  3R26 A;  1NNT A;  3SEV A;  3N5L A;  1B9J A;  3QIM A;  3KSX A;  1QGX A;  4MIJ A;  4LZ5 A;  3ILT B;  2PT2 A;  1IXC A;  1NH8 A;  2VT5 A;  2RC8 A;  2WBD A;  5HBC A;  3IOW A;  4X9T A;  4XEQ A;  2Q9T A;  4ECF A;  2Q89 A;  4KI0 E;  4OHN A;  4R6K A;  4YB7 A;  1N3X A;  3OEL A;  5I57 A;  1YXI A;  1LB9 A;  2P3V A;  1MXZ A;  1JW4 A;  1DK4 A;  4BDM A;  3O66 A;  5I59 A;  3PPQ A;  2DWJ A;  2B65 A;  5TPA B;  1B5I A;  3QUF A;  4LZ7 A;  3JZJ A;  4HTG A;  2I4C A;  3HCQ A;  3VVF A;  1MPD A;  1FPG A;  1PC3 A;  4YU0 A;  5B7D A;  3IOU A;  3N26 A;  1EYJ A;  1AMF A;  1FCK A;  5CMB A;  1B3G A;  4MEV A;  4ESX A;  2F3B A;  1VFD A;  4H46 A;  3EHU A;  3UGW A;  2CZK A;  3SET A;  4EXK A;  3IJX B;  1ZBM A;  4PDH A;  3UP9 A;  4Q30 B;  2PCR A;  1FQB A;  1H44 A;  3OSQ A;  1JEU A;  2I4B A;  1LCF A;  4GD5 A;  4ELO A;  2VD2 A;  5IZ3 B;  2GHA A;  3EHT A;  4G4P A;  2Z8F A;  3H6W A;  2G93 A;  3JYR A;  2XXX A;  2A5S A;  4GL0 A;  3G7W A;  2QVR A;  4QSE A;  3FJG A;  4QFO A;  4Q0C A;  4DCY A;  4G2Z A;  3BIG A;  2QVU A;  2GFE A;  3TTM A;  5H8S A;  3E4R A;  4JSO A;  4MBP A;  1XS5 A;  2FHY A;  3CG3 A;  4FEC A;  3E13 X;  2XX7 A;  2ZZX A;  4FAT A;  1FJ6 A;  4LN5 A;  1MG1 A;  4F22 A;  2ZNU A;  2PYY A;  2D21 A;  5DEX A;  2Q8M A;  4KPT A;  1SW1 A;  3UOR A;  2XXR A;  3VE1 B;  3IFA A;  4P0I A;  5CMM A;  3SEW A;  3TTR A;  4QFL A;  4KYD A;  1MQH A;  1D9V A;  1FTA A;  4F29 A;  3V83 A;  4KXP A;  2V3U A;  4O3B A;  4P3L A;  4GOT A;  3WAE A;  3U1O A;  1PBP A;  4IO2 A;  3IO4 A;  4XKR A;  2JJK A;  4NGU A;  1D9Y A;  1FBF A;  4RYA A;  2KR0 A;  1NFT A;  4FIM A;  3C36 A;  4G8M A;  3CFL A;  1FQF A;  3RT6 B;  2XXU A;  1SW2 A;  3QSL A;  2CZI A;  1US4 A;  1H45 A;  3OEK A;  5BWJ A;  4OER A;  3CRB A;  3LC8 A;  2Y7R A;  3PUX E;  5I57 B;  1IMD A;  4ZEB A;  1P1U A;  1WDN A;  2Q2C A;  2Y7W A;  1KA1 A;  5EYH A;  1OVB A;  1XVX A;  5I59 B;  4R2B A;  2OZZ A;  2ZMB A;  3E78 A;  2DS9 A;  2O68 A;  1GGG A;  4IO5 A;  5DVI A;  3T9V A;  1FPB A;  1EH3 A;  3G3K A;  1MXX A;  5T3J A;  3T1B A;  4PFI A;  2CMO A;  1YTV A;  4LUB A;  4IO6 A;  2F8D A;  1P1W A;  3SES A;  5AA3 A;  4QXD A;  1II5 A;  2L5V A;  4P56 A;  3PPO A;  2Y5L A;  4X04 A;  3MPK A;  3E9X A;  2XX8 A;  1ZU0 A;  2REJ A;  3HFU A;  2DP8 A;  2UVJ A;  2FYI A;  3KC0 A;  4U1Z A;  3OD7 A;  3KBR A;  1Y9U A;  4F3P A;  4EDP A;  1IMF A;  5I2N B;  2I48 A;  3H3G A;  1FTK A;  1Y3P A;  4EQ7 A;  3LUZ A;  4YKP A;  1N3W A;  2OK2 A;  1MXV A;  2OWT A;  3DM0 A;  5IKB A;  5ICQ A;  1QVS A;  5TP9 A;  1A8F A;  2XXW A;  3HHG A;  5FHO A;  3KOT A;  3U93 A;  4GQO A;  4PGN A;  4OFJ A;  3TTK A;  3L6H A;  3KBZ A;  3FVK A;  3H6U A;  4GFR A;  3D4G A;  3ROJ A;  3VXB A;  1N04 A;  1B51 A;  5J1D A;  4FEB A;  3EPE A;  3OSR A;  3U72 A;  4DI3 D;  2DE4 A;  4OAN A;  4GWX A;  2ZZW A;  2HCA A;  1DSN A;  5EHM A;  1MH3 A;  3RNN A;  3CSB A;  5L9S A;  4JXI A;  3PGF A;  3UA8 A;  4P0G A;  2ESN A;  3IOT A;  1LFI A;  1POT A;  3FV1 A;  5DEX B;  5EYG A;  4DXU A;  2Q2A A;  1BLF A;  2MKZ A;  5I56 B;  1IIT A;  4P47 A;  1QJM A;  4GBV A;  3TCF A;  2V3T A;  3PD8 A;  4LQ5 A;  2WKY A;  3IB0 A;  3E79 A;  1R9L A;  3O97 A;  2H99 A;  5CBR A;  4NF8 A;  1CE2 A;  4GIZ A;  4G68 C;  2QMW A;  1M5C A;  1FTJ A;  3HHF A;  2QS3 A;  3K2D A;  3A3U A;  2IA4 A;  4N15 A;  4OMB A;  3LSF B;  2B4L A;  2DWH A;  4MAG A;  1I69 A;  5H8Q A;  3IB1 A;  3U94 A;  3FJM A;  4XF5 A;  4MCO A;  3MZB A;  4N8Y A;  4GXS B;  4XKN A;  4PBH A;  3D1R A;  1LFG A;  4YZZ A;  4GX6 A;  2B3F A;  2O7U A;  4ND9 A;  4GVO A;  2R71 A;  4PET A;  3HN0 A;  2VD3 A;  3OO6 A;  3PD9 A;  3O29 A;  4P1E A;  3FVG A;  2HEU A;  4E0W A;  1M5F A;  5KCJ A;  2CZH A;  2H4I A;  1PEB A;  4ZED A;  1UTH B;  1B3E A;  4OES A;  1IXG A;  4I3Y A;  1SD3 A;  3C32 A;  4ISU A;  2NXO A;  1PDA A;  3K6U A;  1MDQ A;  1NNK A;  4AB5 A;  4G68 A;  1LBZ A;  5CMK A;  4YMB A;  1NL5 A;  4PP0 A;  3T9X B;  1JQF A;  4QBA A;  3O6I A;  1JW5 A;  2QSX A;  2DQV A;  2VGQ A;  4ZEC A;  4NF5 A;  3SEX A;  3LV0 A;  1TXF A;  3Q29 A;  3FXQ A;  1B5H A;  4BDQ A;  5EHS A;  4Q8R A;  2PBW A;  2G29 A;  5IZZ A;  5TP9 B;  3G3H A;  1LAX A;  3TAJ A;  5DVF A;  1MM7 A;  4I8C A;  3BFU A;  1URS A;  1SBP A;  1FQA A;  1OIB A;  1S9T A;  1M5B A;  3KJ7 A;  1B1X A;  4R74 A;  1RDX A;  3MQ9 A;  4PBQ A;  3I5O A;  3VVD A;  4MH5 A;  1JNF A;  2AIX A;  2Z23 A;  4C1T A;  2V4C A;  3B8B A;  4RA1 A;  2I6E A;  4N6D A;  3ECR A;  2GH9 A;  2XXT A;  4U4X A;  1H43 A;  2WEF A;  4QFK A;  3FVN A;  2Z22 A;  4KD5 A;  2QS2 A;  5IZ1 A;  4N81 A;  1ELJ A;  3T0J A;  4LP2 B;  5AE4 A;  4PAF A;  1P1O A;  5FTH A;  2RC9 A;  1LAF E;  1AWB A;  2OBG A;  4F3B A;  2WBB A;  1VDW A;  4THI A;  4NF8 B;  3Q26 A;  2DSF A;  1XVY A;  2PT1 A;  3LBS A;  1JVY A;  4F39 A;  1B4Z A;  1XI6 A;  1FW0 A;  1QUK A;  1DPP A;  2I0B A;  1ANF A;  5H8Q B;  3OO9 A;  5H8N A;  1MRP A;  3TZA A;  3LSL A;  1EZO A;  3CHG A;  4IO3 A;  1PB9 A;  2F7A A;  5BUU A;  2O6A A;  3G3J A;  1RDY A;  4U4S A;  3SER A;  2ONK E;  3C31 A;  4O94 A;  5ET6 A;  3G3F A;  3MP6 A;  1UTB A;  3K01 A;  2A5T A;  4NN3 A;  4OQO A;  3M3F A;  1OMP A;  4PGP A;  3A09 A;  1J1N A;  1O63 A;  2XXQ A;  2VP1 A;  1OQH A;  2CEX A;  4H5G A;  5KCJ B;  4GF8 A;  3H6V A;  3HO7 A;  4F1V A;  4OFL A;  1D3K A;  3UN6 A;  3W9V A;  4MFI A;  3TTL A;  4GWZ A;  1I6A A;  4NF4 A;  1P99 A;  3V8X B;  1YYZ A;  3DEL B;  3L6G A;  4QSD A;  2O1M A;  3KSJ A;  4O8M A;  4Z0I A;  1B58 A;  5CRY A;  2XXY A;  1LBW A;  3MP8 A;  3IFC A;  4OZ9 A;  1Y3N A;  3MZ1 A;  1MXU A;  4DZ1 A;  4NF5 B;  2AYS A;  1IMB A;  5IGA A;  1ATG A;  3FVO A;  3SDF A;  4ELR A;  4RNS A;  3VLU A;  2PFY A;  1MQJ A;  4H0W A;  4NAP A;  3B7D A;  4RXL A;  3GBB A;  1FSA A;  4GWW A;  2QFL A;  1LAG E;  4MX6 A;  3RY3 A;  1A55 A;  1DTZ A;  5HPQ A;  1KA0 A;  3MVX A;  4FOR A;  4H45 A;  3MWB A;  3OEN A;  4JBZ A;  4LA9 A;  1LBY A;  1O64 A;  1IMC A;  1MPB A;  1MXY A;  2XXV A;  4I9D A;  2CEY A;  4JVC A;  1FPL A;  1B5J A;  3IX1 A;  4GWS A;  3IJO B;  1FQD A;  4I40 A;  2DYX A;  4JDF A;  5JK4 A;  2W7Y A;  5KDT A;  2QVV A;  1FBP A;  4IGT A;  3QK6 A;  2RF1 A;  5IAI A;  3G3I A;  1B7H A;  1R6Z A;  4EQ9 A;  1MQD A;  3T22 A;  3LR1 A;  4QF9 A;  1MH4 A;  3O9P A;  1B3H A;  3PPR A;  3KOS A;  1IMA A;  1DPE A;  5I5P A;  3K1N A;  4H6D A;  4F2Q A;  4QHQ A;  5HM4 B;  5DVJ A;  1LBB A;  3FXB A;  3QYT A;  1UIV A;  3N94 A;  3GLB A;  5ISU A;  3N6T A;  3MW0 A;  2I3V A;  3OXN A;  4KCD A;  1QUL A;  4MF3 A;  3TQW A;  5AA2 A;  4RPN A;  2ALU A;  5H8N B;  2RC7 A;  1EYK A;  4EQB A;  3V89 B;  3TMG A;  4PFT A;  3B50 A;  1FQE A;  4MLV A;  2YJP A;  5B70 A;  3TYH A;  3UIF A;  1JEV A;  5M2V A;  1Q9D A;  1PB7 A;  4HCW A;  3Q28 A;  1UTB B;  5AA2 D;  1FTO A;  3KFM A;  4PE5 B;  3EHS A;  4KHZ E;  2P1S A;  5JEI A;  2HXR A;  4OXV A;  1TFA A;  1H76 A;  4U22 A;  4BDL A;  4C0R A;  2QS4 A;  3TPA A;  1YZ0 A;  1IME A;  1XT8 A;  2R6G E;  4NF4 B;  2KLF A;  4YKK A;  1IXH A;  3PUW E;  4WED A;  4I62 A;  1INP A;  2ONR A;  4R6Y A;  5L9O A;  4N6P A;  4N8G A;  4G8H A;  2XX9 A;  3K02 A;  1US5 A;  4FAJ A;  1UQW A;  3PPN A;  4QFP A;  4U1O A;  3S4U A;  1IUD A;  4KFQ A;  3MC2 A;  3TFL A;  4Z7E A;  5LOM A;  1SW5 A;  4BDR A;  5H8H A;  1Y4T A;  4BDN A;  2V84 A;  3OO7 A;  5A5L A;  3HV1 A;  4LON B;  3QUJ A;  4LZ8 A;  3CVG A;  3KN3 A;  4FED A;  1IEJ A;  1HSL A;  3Q27 A;  4TLL B;  3T96 B;  3T9H B;  3PUZ E;  4XXU A;  5ESY A;  3PMX A;  4P9K A;  2F34 A;  3TCH A;  2YLN A;  4F2O A;  1POY 1;  1OLA A;  2PX1 A;  1NV3 A;  4JWO A;  4M1V A;  5AA1 A;  1YAE A;  5J16 A;  4AS4 A;  2DXY A;  4OVQ A;  3DP6 A;  3U65 A;  1IXI A;  3PMW A;  1FPE A;  4HW8 A;  3C35 A;  1ZMG A;  1MQG A;  1FQC A;  1PBQ A;  4GWY A;  1SI1 A;  3UK4 A;  4NED A;  5KDT B;  4JVD A;  4HCY A;  3TUS A;  5FBP A;  1HSE A;  4MMP A;  4NX1 A;  4ZEK A;  4H5F A;  3W15 C;  4NHB A;  4GX3 A;  4G8N A;  4PFW A;  4KCC A;  1URD A;  4OEU A;  3KC1 A;  3RTF B;  2I58 A;  1BKA A;  2AL5 A;  4GWU A;  4GX4 A;  4XIG Q;  4ZDM A;  1EU8 A;  4N07 A;  2WYK A;  4DIG A;  4JWX A;  1NKX A;  3FAT A;  3ILU B;  3OMB A;  1B7U A;  1MQI A;  4H67 A;  1FTL A;  1FPK A;  3A29 A;  3BFT A;  4YB6 A;  3CIJ A;  4X48 A;  1USY H;  3MVZ A;  3RTW B;  4QRZ A;  5AA2 B;  4IO7 A;  4ONY A;  1NV4 A;  1N76 A;  2DVZ A;  4UA8 A;  2BJI A;  2HAU A;  3IK6 B;  4HS7 A;  2B3B A;  3VLW A;  1A40 A;  1JET A;  1PB8 A;  3KJT A;  2NWJ A;  4GWO A;  4GXA A;  5F1Q A;  4X1B A;  1MM6 A;  2QPQ A;  3GBA A;  3TDJ A;  3CSG A;  2OWZ A;  1GR2 A;  3CI8 A;  3K4U A;  1ZJL A;  3OOA A;  5EQ9 A;  4ZZA A;  4P11 A;  4PFB A;  3K0V A;  1ZKB A;  3B6T A;  2THI A;  5I2K A;  1RYO A;  3OEM A;  2XWI A;  2F7B A;  1LGB C;  3BIH A;  2DDK A;  4RPO A;  2F3D A;  4ELP A;  3RGY A;  1SW4 A;  4IB2 A;  2V25 A;  2PVU A;  5ITO A;  1L5T A;  4EUO A;  3TEL A;  4N6K A;  1NNP A;  3MZ9 A;  2XXP A;  4E0X A;  4MNP A;  1AIV A;  3S2V A;  4PTK A;  2XXH A;  3MYU A;  4PFY A;  3VFJ A;  5I58 A;  5FHM A;  1B05 A;  4WEP A;  3H7M A;  5H8H B;  2QRY A;  2UVH A;  1B4H A;  4AS5 A;  3VDF A;  3HST A;  1P1N A;  1ZIU A;  5CC2 A;  2HFB A;  1DTG A;  2H5Y A;  2ZZV A;  1Y3Q A;  4PFR A;  4TQU Q;  1AL3 A;  4UAB A;  1LBC A;  3MPL A;  3S9N C;  3GYY A;  3ISP A;  2OJT A;  4ZE8 A;  4H8J A;  3KEI A;  4XKP A;  3RYD A;  2V3Q A;  1F9B A;  3B6W A;  3KZG A;  2X26 A;  1LST A;  1NUX A;  3RPW A;  4N91 A;  1D9Q A;  4QFN A;  4ZEF A;  5ICT A;  2H9B A;  3PTY A;  3FGS A;  2I49 A;  4F1U A;  4JB7 A;  4OFO A;  3MVY A;  3ZSF A;  3H06 B;  4MNI A;  2D5W A;  2E1S A;  1VSO A;  2R8T A;  4OA4 A;  5A5X A;  4BLA A;  4K3F A;  1Y1M A;  1GV8 A;  2HZK A;  1SYI A;  4NF6 A;  3G3G A;  3EKI A;  1MY0 A;  3VV5 A;  1R1N A;  3FJ7 A;  5KZT A;  2ABH A;  1QUJ A;  1NUY A;  5H8F A;  2VPO A;  3I3V A;  4OWD A;  4XFE A;  4JVI A;  5EQ7 A;  5K2X A;  3K00 A;  1JW1 A;  1N84 A;  2VPN A;  2HQ0 A;  4PAI A;  2KQZ A;  3FV2 A;  2OCU A;  1O7T A;  5EQ8 A;  5LTC A;  4ZS9 A;  4KQP A;  3MUQ A;  4WKM A;  5F24 A;  1EZ9 A;  4N13 A;  1URG A;  3PUY E;  2XWO A;  4HE2 A;  4DXC A;  1NV1 A;  3HPI A;  3PU5 A;  4YIC A;  4F31 B;  4MJO A;  3H6T A;  1QW0 A;  2DWA A;  4ELQ A;  1D4N A;  4IR8 A;  4H1X A;  2FIE A;  1R9Q A;  1KWH A;  2QMX A;  4OVT A;  1A54 A;  4AB6 A;  1B32 A;  2ZYN A;  3K1P A;  3RLF E;  3O6H A;  1B1H A;  5ITP A;  4NF0 A;  4RK2 A;  2QS1 A;  4FBP A;  1OLC A;  4GL8 A;  2O84 X;  5I2K B;  4OYV A;  3QAX A;  2O51 A;  2Y84 A;  4F1Y A;  2I3W A;  3AXF A;  5IM2 A;  1Y1Z A;  1OVT A;  2V93 A;  3E3K A;  4TLM B;  3Q25 A;  3K1M A;  1FBE A;  4ESW A;  1M5E A;  4R9G A;  3O2A A;  3K6V A;  1I6Q A;  4NWC A;  1SI0 A;  4G68 B;  2REG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...