4PEVA

Crystal structure of abc transporter system solute-binding proteins from aeropyrum pernix k1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
370
structure length
370
Chain Sequence
PISVLVLFDVGGRGDLSFNDMAALGADRAAEELGVDVVFQTPQSLAVMESVLDAASRSGEYDLIVLVGFLWQEPLEKVAPRYPEQKYALIDAATRERYDNVASYLFREQEVASLVGIIAADIANNISKATGEEAKAGAVAGMDIPPLWRFHIGYLYGVQYYNQAMGTDVEMVWTYTGRFDDPTLGKTTAEQMLQQGVRVFYGVAGLTHVGMFNAVKEAAARGVIAFSIGQDASQEWYDPQTIIISGLKRVDVAVYTAIKDVVEGRFRGGIVSLGLKEGGLGLSDEEIIRYFAEIAAETGQLPEGLTPEKVVEIVMSQREKWISNDGWRLVEELKQKIISGEIKFVTPQDHDTYDSIIEELKAGNLEAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ABC transporter system solute-binding proteins from Aeropyrum pernix K1
rcsb
source organism Aeropyrum pernix
molecule tags Solute-binding protein
molecule keywords Membrane lipoprotein family protein
total genus 138
structure length 370
sequence length 370
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02608 Bmp ABC transporter substrate-binding protein PnrA-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pevA01
5ED4A 2RJOA 2WWVD 4Z4CA 1DC8A 1NXWA 3EULA 3F7NA 3IP6A 3L49A 2PL1A 5IUJC 2PUFA 3DGFC 7ABPA 1ISRA 4RV5A 4MR8B 2JVIA 1JFVA 5IC5A 2W42A 4XARA 2QSJA 2JVKA 2PE5A 3M9XA 4P1ZA 4EYKA 1R8JA 1XHEA 1VLZA 1CHNA 1PNTA 3O1HB 3MA0A 3HUUA 1CYEA 4UHJA 1BDHA 4CBVA 3JPYA 3UKJA 5JNTA 3OLYA 3HM9A 1BDIA 3VNBA 5BRAA 1H9CA 3JY6A 2CHFA 3LUGA 4HYEA 3A0RB 1AB6A 2IPAB 1Z2EA 3SNKA 3T38A 2CHEA 4DN6A 4S05A 4Z4GA 3O2QB 1NXTA 3BILA 3C3WA 2JB9A 2QVCA 5KQGA 1UDRA 2MSKA 1F51E 3OLXA 3QEMB 3GA5A 1RXIA 3HEBA 2LBPA 5TQ0B 2F8SA 1BVHA 3Q7TA 1JFSA 5TQ2A 3MIZA 1FQWA 1ZVVA 1MB0A 1EWTA 3RQIA 4RY8A 2B1JA 3HSYA 3OMWA 1DZ3A 3HVRA 1RNLA 5HSGA 5KC9A 4H60A 4O1HA 5TPWA 4MR9B 1A04A 1QMPA 1JFTA 1DRJA 1SD5A 3IPCA 4LDAA 3LKBA 4FE4A 3RVSA 4MPTA 4NCAA 3KLNA 5KQLA 3CG0A 4IMIB 1NATA 1ABFA 3CFYA 4PEVA 3EQZA 5DGCA 3CS3A 1Z13A 5F64A 5TPZD 3EDCA 1Z16A 3C3KA 2H3HA 3HUTA 1YK0A 1M5UA 3GBVA 1JDPA 4RY0A 1EWVA 1NXOA 2JK1A 4KVFA 5I4CA 3CU5A 5B3JC 1IIBA 4XLTA 2IKSA 1RZRD 2FQXA 4JP1A 2GBPA 2XDYA 4QPJC 3Q7RA 3NHMA 2NT4A 4F06A 2VUHB 4ETMA 1M2EA 3QLVC 1FFWA 4F8JA 3QK7A 2WMYA 3LFTA 1YS7A 1QO0D 2R4QA 1PEYA 1LBHA 4MR7B 1ZDMA 4ZJPA 3BRSA 1M2FA 2QVGA 1LJUA 2NZUG 4RZSA 3N8IA 3L6UA 3LUKA 4WWHA 1DC7A 4WT7A 3URMA 4Z0NA 2R47A 3I45A 2VYCA 1M5TA 4QYMA 1YIOA 1EWKA 2B4AA 3H5LA 4MS4B 4QYWA 3KJXA 1APBA 5FBHA 4MYRA 1PNRA 1W9HA 1Z25A 4N47A 3QLVA 5DKFA 3GYBA 4N03A 2QXYA 1BDJA 2OQRA 3I42A 3CNBA 4RKQA 4RK5A 3BREA 3UK0A 5BR1A 2FMFA 5EWJB 2R25B 3H5IA 1YMVA 3LUDA 2FN8A 4KNYA 3RVNA 4TLMB 2A9OA 5BQ3A 1USGA 1S8NA 3KHTA 2X7XA 3H6GA 2FEWB 2HQRA 4QICA 1MB3A 2CWDA 3M9WA 2PLNA 3OLWA 1U2QA 4MQEA 2RJNA 4MS1B 3DLBA 4LE2A 4MRMA 1W25A 1QQBA 2WY2D 3I5AA 4KRFA 1FFGA 3Q9SA 1SXGA 4RK1A 2HQBA 4OATA 4W5OA 4KK3A 2YHAA 4RK7A 5KQMA 2HPHA 3EGCA 2RGYA 3KYJB 3F6CA 5CNKA 2E4ZA 1U0SY 2FTKE 4PZ0A 2AYXA 4OLBA 1DRKA 3TB6A 4D74A 1LJLA 4OG2A 1ZY2A 2L17A 5JNUA 1E6LA 3RVRA 3HXMA 4MAAA 3ROTA 5JNSA 3F6PA 1U2PA 2MSWA 3FDFA 3MYYA 4KQ9A 1YS6A 2KYRA 3HZHA 1ZESA 2LP4Y 1JYEA 3P9YA 5TQ2B 3HCWA 4MRMB 3RH0A 1Z15A 1Z2DA 1XWWA 2FLKA 4TLLB 4JB0A 1KRXA 4MS1A 4D6YA 4ZMRA 5KC8A 5CNIA 3RVMA 3T6KA 4YCSA 2HJ9A 4HNQA 1MIHA 4FB4A 2E4UA 3NHZA 3SQNA 1LBIA 3MF4A 3CKMA 5KI6A 4OBBA 5IBQA 1C4WA 3QELB 4EVSA 3JVIA 4MQFA 3OLZA 2PUBA 4LZLA 1DBPA 3T95A 3Q15C 4G0QA 1QNLA 2FMIA 1NXSA 1WETA 5E3JA 2PKXA 3C6QA 4ETNA 3H1GA 3NNDA 1QP7A 3OQNA 4YLEA 1U04A 1P2FA 3ILHA 2IPNA 1PHRA 4LDZA 1KRWA 4ETIA 1DP4A 2O20A 4MS4A 1Z26A 2WB4A 5CHYA 4LE1A 3TMYA 3OQOA 1P6QA 3M6MD 2E4VA 4ML3A 1URPA 3LUFA 4JA2A 4LRQA 1TVMA 2VUIB 3W9SA 3CHYA 1LK0A 2NUBA 3JPWA 1ZH4A 4RDCA 2GWRA 4MR7A 1I3CA 1U8TA 2FMKA 2MYPA 3SY8A 1EHCA 4NQRA 3DLHA 3RVLA 1SXIA 3FGZA 3O75A 4RWEA 3IP7A 4GNRA 3NNNA 4XAQA 5FWYB 1USKA 2QV0A 1MVOA 3LUHA 4M88A 2ZWMA 4IRXA 4MS3A 1DG9A 3FFXA 1DCKA 1K68A 2BGGA 2FMHA 4W5QA 1JF8A 3H5VA 4E7OA 5BRJA 3KKEA 3O1JC 4G97A 1DBWA 1GUBA 4LX8A 3CZ5A 4PE5B 5KQPA 3ILYA 4RSMA 1AB5A 1Z18A 3RVPA 4XXHA 3H5WA 1YTUA 4O5AA 1D5WA 5FBKA 4Z4IA 2VK2A 3IPAA 1ZAYA 2LPMA 4GPAA 3OO1A 4L85A 4MQFB 3ROFA 1DBQA 4ZPJA 3QELA 2L19A 2Q5CA 3BRQA 1FFSA 3LUJA 4MLCA 5JNWA 4WUTA 4H3HB 3OMXA 5CNJA 4MR9A 4RKRA 1ZGZA 5TPWB 1PEAA 4S04A 2JCGA 4O1IA 6ABPA 4W5NA 2MYTA 1C0EA 2H0AA 2NT3A 4Z99A 1RZRA 4Y9TA 5PNTA 1Y1LA 3H6HA 3T8YA 2ID7A 4G0XA 4EUKA 5IUNC 5IEJA 1OXKB 2QW1A 3QLUA 4MGEA 1USIA 3HV2A 1T34A 2L2QA 3LOPA 4W5RA 3HO1A 5IULC 3FMVA 4KMRA 3R0JA 4NV3A 2JRLA 1QO0A 1SXHA 2PMCA 4DADA 1BAPA 3MQ4A 5ABPA 3HDGA 2LUOA 2LIVA 3A3KA 4YS6A 3IP5A 3EJWA 3O21A 3LUCA 3O2JA 3IP9A 4YR7A 4HNSA 4KV7A 3FFWA 1JL3A 2MSLA 4D6XA 4OTZA 5TQJA 4RK0A 4HNRA 2IOYA 4G0PA 3B2NA 3HDVA 5IUKC 1VKRA 2FVYA 1DJMA 1DCMA 5JS1A 1GCGA 1A2OA 3EAFA 2FEPA 3G1WA 3MMNA 4MQEB 2M1ZA 3OO0A 4YV7A 1FSPA 3TD9A 5JNRA 4KFCA 3EQ2A 1Z17A 5TPZA 8ABPA 1NY5A 4RK6A 4EVQA 4G0MA 1KGSA 3H75A 5DCLA 4N41A 4G0OA 3QLTA 4Q7EA 3KLOA 2IYNA 5HM6A 3NNSA 3QEKA 4P98A 1XHFA 5EWJA 2MYNA 2J48A 3Q7SA 5CNMA 3OM0A 2V0NA 5IEBA 3OM1A 3RVOA 4RXUA 5T7BA 2A9PA 1NXVA 4G0YA 4RXMA 5DLEA 4RXTA 2F8TA 3CTPA 1ZHHA 3HJFA 1VRVA 3CZCA 2L18A 3MM4A 1YK1A 5IX8A 4PICA 1ISSA 4KQCA 2ZAYA 4H3KB 3KTOA 4MR8A 4WXMA 1E6KA 4RY9A 1RPJA 4Z4FA 2PL9A 3S99A 2JBAB 5EWLB 1CEYA 1NXPA 2DRIA 3KCNA 3LTEA 3H1EA 1GUDA 3E61A 3HS3A 4N0PA 2PUCA 4YWHA 1K66A 3D8UA 3N0WA 4IF4A 4NICA 4EGSA 2PUAA 3N53A 1TLFA 2FQWA 2WRZA 4Q6WA 3HK2A 4KZKA 1PUXA 4RK4A 1JYFA 1JHZA 3VNAA 2FXIA 1E2BA 1BA2A 2E4WA 2QR3A 4JB2A 3IDOA 3CRNA 3SG0A 1QP4A 2FLWA 2N9UA 3K9CA 3SAJA 3O1IC 1SRRA 3QX9A 3N6VA 5JS2A 1QPZA 3BBLA 4WXEA 2R48A 1ABEA 4F12A 3O2SB 2A9RA 1GCAA 1OXBB 4EYQA 9ABPA 2PUGA 1E6MA 3DZDA 2I6FA 1QKKA 4N0QA 1KMIY 3GWGA 1ZN2A 2GX6A 1A0OA 2RDMA 4LE0A 5EWMB 2GI4A 3C97A 2OENG 4YGXB 1QQAA 2P4UA 3RVJA 5KWSA 1P8AA 3LMKA 2IPLA 4YO7A 5TQ0A 2IPMA 3K4HA 1JH9A 4W5TA 3F73A 3G85A 3KSMA 3QEMA 3Q41A 4KREA 2HSGA 3GT7A 1DCFA 1JDNA 3TX6A 3FFTA 2PJUA 3H5OA 1JX6A 4G86A 4IMJB 1NXXA 3JTEA 4JOQA 1RXEA 3DBIA 2GKGA 2WJWA 1EAYA 4YRZA 4KPYA 5HQJA 1YMUA 2TMYA 2FSPA 5HKOA 3N75A 1D1QA 3H5TA 3SM9A 2A9QA 3RVQA 4EYGA 4EYOA 3N0RA 3GL9A 5T3YA 2PUEA 1TM2A 3A10A 3H1FA 4B09A 1P6UA 4XASA 4Z9BA 3JS5A 5FWXB 2AYZA 5FWXA 4XFKA 4IGAA 1ZGGA 1ZH2A 1D4ZA 4OLAA 4TMYA 2P9HA 1GLGA 2E4YA 1TJYA 1NTRA 4NCBA 2QU7A 4Z4HA 1D1PA 5GOTA 5B3JA 3UUGA 3N0XA 1L5ZA 4RS3A 4KK4A 1ZITA 1D2AA 3DGEC 3OQMA 4TN5A 1YVUA 1EFAA 4IILA 3C3MA 3D02A 1JLKA 3QX8A 4F3TA 4PYRA 3LKVA 4JAVC 2CD7A 4N76A 4F11A 3KS9A 2PUDA 1VPWA 3GV0A 5GQSA 4E7PA 2HQOA 3JVDA 2FW0A 2WJAA 4ZYLA 1J56A 5EWMA 3OLVA 2FQYA 2FKAA 3GBPA 4RU1A 1B00A 3CLKA 5TE9A 1L5YA 1HEYA 3TO5A 3QLUC 5JNVA 5D2CA 6CHYA 3A0UA 1JBEA 2M98A 1JWLA 3KYIB 4UHKA 3I09A 2FEKA 2QZJA 4L4UA 2JVJA 3RVKA 2JBAA 5EWLA 5DTEA 1MAVA 1Z12A 4Z4EA 4G0ZA 4EY3A 4ZMSA 2IDMA 2PAFA 2ID9A 4DQDA 2E4XA 1F4VA 3GRCA 3LUAA 4Q6BA 2MYUA 3O74A 2YHBA 3NBMA 3CG4A 2NZVG 4MLDA 5C5CA 4MS3B 3EODA 1QP0A 3KG2A 4WZZA 5C5EA 4JASB 4YP9A 4EVRA 2FN9A 3E3MA 4FE7A 4Z9AA 5FWYA 1TMYA
chains in the Genus database with same CATH superfamily
1V1MB 1TPYA 5K51A 1I51A 1PUIA 1Z29A 2BKAA 2ZWPA 2SKEA 4PTZA 4YP6A 2ZAGA 3TG8A 2BF4A 3KT8A 1M1YA 1ESCA 3L49A 3PXGA 3SDZA 1VSQA 2JH8A 2PUFA 3O4HA 1WKBA 2VC2B 3X1YA 2QP3A 4LRYA 4X66B 4DA8A 2XXBA 1A2QA 3M9XA 2BSAA 3DFZA 3JQCA 4KPGA 2CL0X 1PNTA 2PVSA 2XVMA 3O1HB 4YTEA 4MGZR 4Y6QA 3H4TA 2V3CC 3S7ZA 2ZUUA 3LSYA 1BDBA 1P2TA 3VOBA 1LA2A 5IT0A 3DL4A 1DMSA 2HI0A 3ANXA 4QL3A 3U6BA 3F5SA 3LUGA 1M34A 1UH5A 4C3UA 1XD9A 8ATCA 2G9QA 2OCYC 1S4MA 2A5FA 1L4HA 3IAAA 4WINA 5BT9A 4BB6A 4U5QA 2TMGA 1RPZA 2UVDA 4OBEA 1D6MA 1UOEA 5NLLA 3RANA 4WN9A 1R7RA 1PJ3A 2QTAA 2UVQA 4M1QA 1U4SA 1H42A 4XCXA 3ZUPA 3QEMB 5IG2A 4JLJA 5EHQA 2PZLA 1G8SA 3UMMA 3WHLA 3DE3X 3IT3A 3STHA 1U0GA 2LBPA 3C14C 3VHLB 3EA0A 3PX3A 1QH8B 1ES9A 5HKLA 1U8CB 3WRYC 4BDTA 2QU8A 2UZ4A 1JP7A 4M8NE 4L75A 1XWIA 1BH6A 1RNLA 2C5GA 5FUYA 1TTTA 1BCRB 5FAKA 4LNHA 1TQ8A 1A04A 1UL1X 5BV0A 1SD5A 4WN3A 2WYUA 1R37A 3AXTA 1LC3A 3LUPA 3SJ7A 5HJEA 3RJMA 2PBFA 3F4BA 1MB2A 1I1OA 4YX9A 3YASA 1RRVA 5ETJA 2IOFA 1KMNA 4D57A 1Z13A 2AZ4A 4R2JA 3EIEA 4EW6A 1X8KA 1JH8A 2P68A 5CA1F 3ABZA 1NJ1A 3C3KA 5E4TA 5AW2A 4HKTA 1US8B 1M54A 1UOQA 2I7DA 5B3JC 1Z2PX 2BZ0A 1IIBA 3WFIA 4MWOA 2XI4A 3R8CA 5JV5A 1G66A 2HRQA 4TOIA 3X43A 1CU1A 2D00A 1IQRA 1WMDA 4W8GA 2YYSA 3ENKA 5JO0A 3KR0A 3QLEA 1MW8X 2AEEA 1ZIDA 2CBXA 3TQQA 3RIYA 1AHNA 3GGCA 3NHMA 2VSFA 1NG9A 2N46A 3PRJA 4PX5A 2CXRA 2PCJA 1YS7A 3D0RA 2QRQA 3HCEA 2CXUA 2BSXA 3NTVA 1XHLA 4G5QA 5ARDA 1EEHA 2G9NA 3HEAA 3E2IA 4AN1A 1MQ9A 2O7VA 2VPTA 3JQBA 2O8EA 3ROKA 4UEOA 4Z86A 4EHFA 1JXMA 1WBDA 5DK4A 4G5XA 1M5TA 4BWYA 5K0GA 2BH2A 2B4AA 2WFAA 1RJDA 4PIMA 5DM1A 1K0UA 5K3OA 5IWAB 3JQAB 3OZBA 4JODA 1GTSA 1P1RA 3GYBA 4MB2A 4D80A 3UC5A 2MU1A 4RKQA 1NPYA 1OB2A 3ETNA 3BULA 4INOA 4D26A 1IOZA 1JHPA 1P2SA 4X1OA 3RHTA 4Q9HA 1L1FA 3VZPA 4RTKA 3UGJA 2RKWA 2P2YA 1CUIA 1WHSB 4LZAA 3TQSA 1P1HA 1S8NA 2WDPA 3H13A 4KO3S 2W4QA 1JQLB 2DZDA 1NPDA 1CULC 1VTKA 3VZSA 3PWSA 5J4YA 4OX9B 5ECYA 2H8GA 4ZKDA 2HQSA 1IB0A 5JROA 3AUJB 3ZWQA 1OR8A 2V8BA 5AW5A 4L4YA 1YNOA 3DTVA 4PC3A 2Z9BA 2NSDA 3IURA 2L0XA 3AVPA 2FSVC 2HJHA 3HCFA 2HQBA 3CM0A 5DK6A 5EYPA 3JRWA 4QATA 5HE9A 4FCVA 4D3YA 1BE1A 3DMGA 1KEUA 3BAFA 1GPYA 3ISTA 4UNRA 1MX3A 2C8JA 1K6IA 1OVMA 4GM4A 2VJAA 4UUMA 5A5FA 1EFPA 3G82C 2QYOA 2HFKA 3LT2A 4KO4S 4IGFA 4LYEA 4IOKA 2PJZA 4OG2A 4ARZA 1T2FA 4EG0A 3GPLA 4TSKA 2CB9A 2NOAA 2EWMA 4JQSA 3ORSA 3PE3A 3SBEA 5JNSA 4E11A 1FTSA 1MPTA 1CR1A 5CJJA 2B36A 5E0KB 4K03A 4Y30A 3WBBA 4JBWA 3ZCVA 1NLZA 2A1UA 2A1UB 4UQPA 5GONF 4EF4A 3I23A 3K9GA 3IQGX 4LWOA 2WWTA 3Q7PA 2QX9A 1AK2A 3GGJA 1XAJA 2HY7A 3FLAA 4ZQGA 1CZLA 3JAKB 3TLZA 4C7OA 1K8QA 2EGHA 2G82A 1HT3A 1P2VA 5AVTA 1D0IA 1PL7A 2OEPA 1KMMA 3IHKA 4MWSA 2QTHA 1IJBA 3EQ8A 2V7QD 4UTZA 5AO9A 4AJ9A 4GMFA 2ON6A 4ARZB 1CLEA 3RBZA 1GPAA 3A4LA 1WDWB 4L3WA 4BAGA 2NYRA 5B57C 3NOXA 4Y8VA 1QTRA 2WOOA 3A4MA 1K6XA 2HDOA 3EPLA 1I4LD 2NUPB 4D5GA 3TNYA 4GX1A 1DJLA 1AQYA 2P75A 4PAGA 3MN1A 1Q50A 1E3WA 5JCJA 2P9TA 3EVTA 1X7YA 2WE8A 3GJQA 2DETA 3ZJTA 2XA1A 3LM8A 2CZQA 3NGMA 2FF7A 3OICA 1AKTA 4IGEA 3VDXA 3G68A 5FX2A 2R11A 1S2DA 2C96A 3DTVB 1CZRA 2JHAA 5IARA 2BIFA 1JI3A 2FPGA 2NU9A 3MRSA 5CM9C 1R8XA 1KEZA 1G8HA 3RTAA 1FFBA 2UZ3A 4A16A 3AG6A 4KLNA 1UOOA 2ISSD 2CK3A 1ZNWA 2ZJ5A 2Y27A 2FR1A 1KBQA 4LJ9A 3W0LB 4NBVA 1Y9JA 2ZWOA 3KJGA 4PAOA 3EWIA 1A8QA 4ZOLA 4ZOLB 4LHZA 5D3MA 1Z0AA 2OHIA 1A9TA 1CIJA 3E22A 1SXIA 3FJOA 5F1KA 3FGZA 1UC8A 2ZROA 4P84A 3OTIA 1JMVA 2VJNA 1E2QA 3THXA 4QPPA 3FF4A 3WK4A 3OIDA 3KUCA 3B6ZA 2BGKA 4KR7A 2ZBEA 2VIIA 5B55A 3HNPA 2LKDA 1VQ1A 1QV6A 4JBXA 4ERXA 1T8TA 1F6DA 4JXZA 4HWPA 1LB1B 4W5QA 3MOSA 1QFYA 1DUIA 4QSHA 1PSZA 1CP2A 3Q8WA 4BKQA 1EK1A 2ZRFA 3VAYA 2H9YA 3B1WA 2WAOA 5HQTA 1G64A 3VVMA 2GVNA 5IT4A 1IOLA 4V0KA 3M3PA 1DQNA 1VMIA 4GGPA 2IHJA 4NE9A 4NI5A 1F4LA 3DAYA 4MQFB 2N1MA 4ZZ2A 4KR3A 3I9KA 4HJXA 5DZSA 1NBWB 1LV8A 3A1UA 1XROA 1XGKA 4GVXA 3A9UA 2ZJYA 3W5VA 2VVTA 3BD9A 3H0CA 2CKMA 2DHDA 4KN8A 1DWUA 2VO1A 2E4AA 3FSGA 3WL8A 5GZ6A 1Q7GA 2F3QA 4DM7A 2O0LA 1Q14A 2C0CA 3KHSA 1E0SA 2PWBA 1VHWA 4AMZA 1RZRA 3AM4A 1EZ1A 1GILA 2BLNA 2JAXA 1FY2A 5DEIA 5EPOA 5CD9A 5AKEA 3KFVA 1NQAO 5BWCA 5CFQA 1L2TA 2VWGA 2YXDA 1XO1A 4MGEA 1J7JA 5AOVA 2VTBA 3COPA 1PFQA 3VPDA 5A5VA 5F52A 2I2DA 3O90A 1MTZA 4BQNA 1QB7A 2P69A 3GN1A 4TTRA 3ZJ4A 1HRDA 3VVLA 4A9AA 4DDWA 2D6FA 3HVHA 1YHYA 4YS6A 3M33A 3R76A 1IOVA 1PNQA 1Z75A 5L4NA 1SXJC 4YR7A 5F2EA 4PZPA 2VPYA 3G88A 2WU8A 1Q84A 2YVUA 2R1VB 2Z3ZA 1EDEA 1DV1A 3FB4A 4V0ME 1Z4OA 1SB9A 3RSQA 1S4QA 4ILKA 5BSFA 4N5MA 2WSYB 4LNUB 5E6UB 3WIOA 4EA8A 4DV6B 3LY8A 1ACMA 4CM3A 2DFVA 3H0EA 2FN3A 3BMQB 2IS1A 3VV2A 1K9SA 3N3BC 1Y7HA 4FP9A 1A2OA 2OSVA 1S5PA 2JLSA 4ZEXA 4P5DA 2FWAA 1ZD3A 4M60A 2FR8C 4BO8A 1IN7A 1QZZA 2WFZA 2B5OA 1WPRA 3EIFA 4OY3A 3NR2A 1QLWA 3G8YA 3OE7D 1QIFA 4NDZA 5K09A 1RI4A 3ZWCA 1NKVA 5JS6A 1JKFA 2G1PA 3PEWA 3KXPA 2IEIA 3T9FA 4GRAA 2A3NA 3H8SA 4GW3A 4M1EA 5JDIA 4X00A 3RVOA 4Q4JB 1ZXLA 4YJ2A 1G5FA 1N92A 1TK9A 5BN5B 3DLTA 1E2GA 4FC7A 2JLXA 4UMVA 3R5TA 3VU1A 4CCAA 4M0EA 3C41J 1A8HA 3ADPA 1P62B 4QOGA 3E9EA 4YJHB 5BNTA 4DZZA 4PPNA 3RS2A 3GDWA 3BBPA 2JW5A 2J3MA 4XM2A 3MERA 3I05A 3MM4A 3OT1B 4LGVA 3UATA 3WGKA 3BN3A 3DUWA 4CXMA 2B82A 1ZQ9A 2Q0QA 4JVMA 4D79A 1UANA 2QIPA 3ZG6A 4XQ9A 3I8SA 1Q5PA 3LVQE 3QUQA 3FWHA 3LBNA 3H1EA 1JAZA 2RH5A 3CZRA 3WSWA 1G5IA 2RFLA 5EMNA 4CKCA 3KVVA 3N0WA 2WKQA 1RP1A 4WLOA 1G19A 3O3OB 2DULA 4EA6A 3HFJA 4O4HB 5J9FA 5JYBA 2BCJQ 2WJVA 4AMGA 4BZXA 3LOUA 5H1YA 1BE0A 1CUEA 3RAJA 1ICEA 1H2YA 1QPGA 1V6AA 2OCDA 4R3WA 3IO5A 3W06A 3WL5A 4BX9A 1Q2XA 2PR2A 1MV5A 4FGSA 4ZK6A 1YC2A 1M0WA 4CKXA 4KIUA 2C9ZA 2E4WA 4NCXA 2BMAA 2DFTA 4MW5A 1JS1X 3RTCA 2UZ1A 2WJYA 3HJCA 4JC5A 3G9TA 2IP2A 3NTOA 4ND1A 4QHSA 3JATA 1XEWY 2HSWA 3EZ6A 4FUQA 2YRXA 4NENB 3P0RA 4AZWA 4F38A 2HWUA 1BMFD 3BJMA 4EG7A 4YEDA 1VCHA 4GI3A 1VRCA 1GCAA 3EOBI 5AJUA 4ZRDA 5K0CA 5K0FA 1E6MA 3UPTA 2OO5A 3UJHA 5BOSA 4DLXA 2I6FA 2QDKA 1KMIY 3MT8A 4H7HA 4B6SA 3ZOZA 1UAGA 2XAUA 1P3Y1 2K2QB 1IJKA 1NOJA 1FMCA 2PSFA 2WM8A 4RKEA 1P2DA 4H27A 2NTNA 2BZGA 1BE6A 2JIZD 2H8KA 2ODBA 3PUKA 3A3YA 4NOMA 4ZT7A 3U3JA 5K3FB 3DMRA 3ZC3A 4C0XA 1C0KA 2HSGA 1U9IA 2EFYA 2FJ0A 4FZVA 1ST3A 1TIPA 1Y4UA 1DL5A 2C94A 1OIXA 1ZSVA 5B3LA 2C04A 1ZRNA 1SULA 2H07A 2MSNA 4UU8A 4V0NA 3UW1A 3FROA 2EFCB 3BXFA 5GJVC 3C3BA 4RZHA 1Z7EA 5ELLA 1DQRA 4WFIA 1ZMXA 2ECKA 1QSGA 2WD8A 4LHWA 5F21A 2AMYA 2A9QA 3COJA 2QL9A 1X0XA 4C0BA 2BKVA 1XC7A 4K9PA 4G01B 2ZS7A 2AVNA 3WLNA 4C4YA 4DIEA 1WXEA 2FUEA 3ZDXB 4AL4A 1OFTA 4MMXB 3LD9A 4EJSC 3EQ7A 1L7NA 4F6RA 5I9IA 1E4OA 1ETUA 4Y6GB 4IDAA 2G1JA 2ZYRA 5AI6A 1LF5A 1KJIA 4EY8A 1L5ZA 4MRVA 5HP4A 1JUDA 4WIAA 5EUQB 1SU7A 1DIBA 3IESA 3CF6R 3OF3A 3RBXA 3RRJA 3NVAA 3NZEA 4EPTA 2AG5A 2AQIA 1XQ1A 2FZ5A 4CODB 4FFLA 3PF9A 4ZYZA 2C29D 2A4KA 2R0QC 3W4IA 1X77A 4I36A 4WLUA 5K8JB 4RIFA 4WCFB 3K9NA 2ONZA 1RCTE 3VH4A 3AP2A 3ZXXA 3ZXIA 2RGAA 2IOHA 4A27A 3HN6A 4JJKA 3KVNA 1E9AA 4GLBA 2OV2A 3CUEF 5FCDA 2K5UA 3LCMA 2XOXA 3OJEA 4M9ZA 4AFNA 4BFVA 2E6UX 5JY1A 1ZNZA 3MELA 2NVUB 4PHFA 1NVMB 2ZFUA 5DNEA 4A92A 3K2BA 5AK3A 3C1AA 4PSCA 1G2OA 3AI7A 3EXEB 2D0OB 5IVPA 3WGHA 1WNFA 5HJ2A 1OZ0A 5IU6A 1W73A 3KYIB 5LSAA 5LP6F 1R8YA 3B70A 3O3CA 2EFHB 3ILVA 4PHGA 2JBAA 4GICA 2PVPA 2XODA 1JHOA 4MQUA 4NBNA 5EWLA 5HS6A 1NC3A 5CFOA 2GSWA 3LHSA 3A37A 2XDQA 1J0BA 2RHCA 2BY4A 2PAFA 2DE0X 2YYZA 3BE5A 3G8AA 5ALSA 5C8VA 4BL5A 2QAGC 3W90A 4O3FA 2PPLA 5T41A 2QG9A 1G6OA 1N4AA 5FL3A 1OAAA 4FFBA 1KE2A 3N2IA 4FU0A 4KJZA 4KPUA 1EJ2A 3LQYA 4UVDA 3ZQUA 1SPBS 4ZYXA 1QZTA 3PC6A 4D46A 4UOEA 1SVWA 3EFBA 1D3AA 4HDCA 4M8LA 4XGQA 2ZT8A 5BVGB 4ENTA 5CBPB 3FPEA 1YI8A 5ED4A 2PUJA 2XWSA 1F2UA 1RPTA 1KNXA 2IIQA 2JASA 4MGYR 1CQPA 4UNPA 2O3QA 4UBOA 2GJ9A 4Z9YA 1EFDN 1V6CA 5EZYB 1K89A 2VXBA 4P93A 1E3IA 3BDAA 3VC7A 5EG5A 2JJQA 2WHQA 4XARA 1J8MF 3TTTA 3DMYA 2V4MA 2ODTX 3IJRA 1CHNA 1E7YA 2GF0A 4BVAA 4EKYA 1V9SA 4RACA 4GL4A 3L7JA 4EELA 1M2HA 2B5WA 5H02A 4DXHA 1M2OB 1PK8A 4H0CA 3WNDA 1XSEA 1P9NA 5IDWA 3OLYA 3HM9A 5EJ9A 2N75A 5TARA 3VISA 4ARIA 2OQ2A 3M8KA 2YZGA 4KDRA 1XZJA 4B47A 1ZKDA 5K03A 2W83A 2C54A 4R6WA 4XDGA 4KCGA 4CM6A 1JFFB 4ZANA 4BJ1A 2GYYA 5ES3A 3VU8A 1E1CA 1JJBA 2XJ4A 3QKIA 3UMSA 5HR5A 4GI5A 2M6LA 1SQ0A 2FRVA 2PMFA 3OHMA 3EDQA 1ZUNB 1PT6A 1VPDA 1LZKA 2VT6A 4TMXA 5FL7D 2ZTUA 5E1MA 1KDOA 2BR5A 3WGVA 4TKVA 7REQA 2IOQA 3KSUA 4I14A 3NW9A 3KO8A 3VJLA 1GADO 2B20A 4IQ0A 4HAWA 2GNAA 1NX9A 2JDIA 2WVGA 4MR9B 3WGGA 4DMLA 3INRA 5CX1A 2VJOA 1C4KA 1PU2A 2BHLA 3CYFA 1DX4A 2XWPA 3V1KA 5BPHA 5ITVA 3DM5A 4GPEA 5K05A 3FCSB 1JEAA 5KQLA 5KYYB 1W52X 1WTAA 2O2IA 2X3YA 1YOBA 3GLUA 1PWYE 4FFRA 4TKZA 4XGIA 4EG5A 2D13A 1LDYA 3DH0A 1OXVA 4CIXA 2IYTA 1RM5A 1Z5PA 1GTMA 2XMZA 3GBVA 4JZKA 4CIDA 3FCXA 1B15A 3CF0A 4CLRB 1WLYA 4KVFA 4QOSA 5G1OA 2JGDB 4DABA 3PWZA 4QOJA 1OXUA 1NX6A 1UT6A 4LVOA 3EA4A 4D9MA 4QPJC 1C80A 4MAMA 1VL0A 3BL6A 5EXSA 3EXHA 5LR6A 5ILGA 4DA0A 5AVQA 4J94A 1ECLA 2RIPA 421PA 3QLVC 2WMYA 1QFSA 2ZE6A 1LBHA 1ZSYA 2VYVD 1XZAA 1X42A 4F91B 3CRRA 2GOYA 5DTJA 1WZEA 1P5ZB 1ZG3A 3N6XA 2ZTVA 2AFIE 4XKJA 3WNQA 1V9LA 1WIWA 4ZHSA 5F2NA 5JYDA 5LD2B 1OU4A 1EIWA 1OH8A 4E09A 1DC7A 2GB4A 3SE7A 4IIYA 4DRXB 5C8DA 1WXWA 5ALHA 3LFUA 1QRSA 5EIHA 3TBKA 4WGGA 1GM5A 1FUYB 1G16A 3FYHA 2D1SA 4V0LA 1NI4A 1KVSA 5AXBA 2DWUA 2RHOA 1Z25A 4V0SA 5LA6A 5EJ6A 1YRYE 1JMKC 2OOKA 2OZEA 5F3WB 2QXUA 2HJWA 3KEFA 5K9ZA 1MC8A 1G8FA 2H2FA 3L05A 1UPFA 3B3JA 2X40A 1ZGBA 4Y2PA 3PGXA 1RYFA 3INGA 3MFYA 4HZIA 4XM0A 3THOA 3D4IA 1Z4LA 3EXIA 3IUBA 3K0HA 3OSZA 1CY7A 2QPAA 4QXRA 5EWJB 4J2HA 4KB5A 5JANA 3SWWA 3BJRA 5FWDA 2JLBA 2JGLA 2QRGA 1RKXA 3F5DA 1FVFA 1T4DA 3AVVA 4OLFA 3FPLA 4I55F 3PEVA 4B2IA 3DWIA 1NMSA 2BEVB 3GRAA 2EV9A 1SZJG 2HADA 3GNTA 3INNA 1CUYA 4ZTBA 3THXB 1YS1X 3EXHB 3M9WA 4JR0A 1NBEA 2NO0A 4OM8A 2JD1A 3JYQA 4MS1B 5I7VA 2NM0A 1SCDA 4QUKA 3IEPA 4P0TA 1W76A 3K7EA 1W25A 3LT4A 1JKMA 3QVKA 2WY2D 4FEGA 4MQMA 7AT1A 3Q9SA 3GLFE 4RK1A 3R9WA 3SX2A 3C70A 1NDUA 5C7IO 2H4HA 1RYBA 1KIAA 4NCJA 1DV2A 1LNZA 3AF1A 4JHXA 2O8DB 2AN3A 4P5EA 1NBAA 1H8HA 4KXWA 1PZFA 2C3PA 3VPFA 3AILA 1YCGA 3FTPA 1UBCA 4XD7A 1JLRA 4M1KA 2OXIA 3ZQKA 3H86A 3HN2A 5D5QA 2GZ1A 1F20A 3NC0C 3NYIA 1NZJA 4B3HA 1JZTA 4JX9A 1V5IA 4RPKA 3C8DA 2CXNA 2O3TA 3OQHA 3R3HA 3GRZA 3I58A 5H3LA 3KHUA 1T2NA 3WKAA 4E2XA 1G21A 4ZI7B 1RLMA 3MYYA 4JB3A 2PU7A 1NJ8A 3U48A 1ZGJA 3HH8A 4DG5A 5JY6A 121PA 4AZ3A 3WICA 4ESEA 2IE8A 3BCRA 2Z9CA 4W82A 5F77A 5H83A 4B80A 1DBIA 2D2XA 3SR0A 1LPMA 3E3AA 3FHLA 1C1XB 1RU3A 2NXCA 4FNOA 4MUXA 4PZUA 2EJVA 4C6TB 1F4PA 3PQ5A 5IAEA 3VC3A 3ZHSA 1MIHA 4DNPA 4YQFA 3BHMA 4DIKA 5K2OA 1JU4A 3DQPA 4BASA 3R1IA 4QYIA 5T6MA 4B2PA 4XVUA 3ENZA 3DV0B 2PUDA 4OBBA 4RHYA 1RIFA 2GD2A 1PIWA 1Z6TA 4PQYA 3NAMA 4XB2A 1CZUA 1JSXA 2KHZA 4H3SA 1MENA 1WWKA 1G5HA 3EXIB 4ZVNA 2ZRLA 1XJCA 4HUJA 4Y6PA 3LT5A 1K6MA 3L06A 3QBJA 3H8VA 3ZJYA 1GCUA 4UUPA 4BIMA 1COWD 1S1MA 2WLTA 3AQ4A 4BVHA 1KEKA 5F98A 4JGGA 1ZRMA 4P6VF 3DB2A 4D9BA 3X3HA 5H4GA 1IY9A 3D3JA 1XVLA 4DLZA 4PZLA 1C7FA 3UMYA 1E4EA 1S2OA 2R7NA 3NOVA 1T0BA 2C92A 4MEAA 5E0OA 4J2OA 2HL6A 4UASA 1Q0QA 3F71A 1YB5A 3QFFA 5G4KB 3KJNA 1ADJA 2ACKA 3BRCA 2LD4A 1NJFA 3DZHA 1ZH4A 1M3SA 1ZJYA 2GWRA 1DI0A 3JPWA 3ND9A 1G3QA 1IEXA 3PHIA 4G25A 4MR7A 1VJGA 3I39X 4LG1A 4NQRA 2YOFA 1PFKA 5EIAA 4GG1A 4CMIB 5JC8A 4CEJA 2Q9CA 2PGDA 2O5EA 1W2WB 5CJ2A 3N76A 5FUMA 1CJMA 3GMDA 2GAOA 2GZ3A 3LX8A 4FT2A 2RHJA 1OXXK 3L46A 3PFCA 1HYBA 4MNTA 1QHYA 3N8NA 3H5RA 3IKVA 3WRXC 4MWCA 4AUEA 4N54A 4B9AA 1Q1NA 1POWA 3B6EA 4NTZA 4G97A 4I9NA 3VR5D 4JL6A 3GFFA 1GCOA 4MKHA 3GP5A 1WD5A 4F92B 3DE5X 3HBLA 1KAOA 2IDJA 4PZEA 3MAJA 3UK1A 2F8MA 3WL7A 1FPQA 4NOJA 4E32A 5K45A 2RCNA 1LTQA 1XVTA 3EVCA 4PLVA 4YXWA 5JAPA 3L9WA 3EC7A 4CF4A 5MN5A 2UKDA 2ILTA 1R8SA 1QIKA 4OXNA 3THWB 3ELDA 5KU1A 2B98A 4B45A 5LQUA 1V3UA 1TOAA 1P81A 4PXSA 4KUGA 2FB9A 2Q0XA 3UC9A 4PLFA 1JZQA 1SCUB 1SG0A 3FLBA 4UW9A 3WWDA 4Z99A 3FF1A 3K1TA 3VX4A 1QR6A 3QYPA 2Y9PB 4UBLA 4YRNA 2OSBA 3VJRA 3CEPB 3MTQA 1QCDA 4M36A 2QBYA 2DH5A 1YE8A 4CCYB 3FPCA 3H7AA 3HO1A 3DHEA 4JELA 2AA3A 3F2IA 4JBHA 4FJ1A 3V1TC 1E63A 3WLQA 1QYCA 2WHYA 2F2TA 2XEXA 2Q4TA 1Z07A 3IAHA 5KTKA 1S8OA 3MWEB 4TTVA 1XKLA 1Z83A 1JDVA 2OT3B 1Y1RA 4MYHA 4E03A 1AZWA 3DOIA 1KEWA 1LLQA 2G4LA 3GF4A 3SEQA 4M53A 3M6AA 4FUTA 4NP6A 1CDZA 3N0VA 1E0AA 3C3JA 3ADCA 2LTAA 3FTCA 4F3KA 4UTRA 2MSLA 2NNWB 3E5MA 1EUCB 3FCUB 1XD2A 3VR6H 1MJNA 2QM8A 3FOAA 3QFSA 7MHTA 5DX1A 1FSPA 2M1ZA 1L7BA 1OLUA 2OECA 3L6BA 3OIGA 1Z17A 3TLAA 3ML1A 8ABPA 3GRKA 1KHTA 2I6SA 4UZSA 5J5AA 5DN6D 3STYA 3K9HA 1JVNA 1MA0A 2EJWA 2FK8A 3I5MA 2OCGA 5EQJB 3U5TA 5H3CA 1O0SA 5SY6A 3KLOA 3A1EA 1TM4E 3OIVA 5KNCA 1K97A 2DCMA 4O8ZA 1R2QA 3PFKA 2OAEA 4NYJQ 4KQ2A 1UIRA 3IKTA 4I4NA 2F64A 1T8PA 2B0CA 3W2IA 3FHTA 3S5JA 4NU6A 4CHGA 5IZCA 4C0SA 3GR6A 3NMUF 1KY2A 3VPBA 1G5QA 2OG2A 3PLNA 1XRJA 1CRLA 2PRZA 1R0XA 3CZCA 3IVXA 1QVVA 4QEDA 4ZA2A 3RU9A 1K1EA 5G0WA 1UPTA 1PJ2A 4KQCA 3W5CA 2DPYA 2CLCX 3LC0A 1OH6A 1I32A 1JHYA 1BSVA 4OQMA 1C9DB 4IKPA 2JBAB 1P0QA 2W2KA 5EWLB 1BEZA 2BFBA 1Q7EA 5A1JA 2D3WA 2O5CA 1NSYA 1RI5A 3M4ZA 3HBAA 4FYKA 4IVNA 4NBUA 5EGNA 4KX5A 4ZRNA 3FOCA 5EESA 4XDHA 5JFGA 1JEYB 3QFCA 5CA0F 2J6IA 5JMOA 3WKCA 1Z22A 1OLOA 4RIIA 2GSDA 1A69A 1ZM7A 1G8KA 3WJ2A 1RHKA 4YC7A 2XF2A 2AT1A 3AI2A 3U9SA 3LY7A 3TEMA 4KAAA 3GFTA 3P9QA 1LF0A 2ZUTA 4BV9A 1YA6A 3GRRA 1OBOA 1VJDA 3GJSA 3GJTA 5I5GA 1DAGA 4KI0A 1OX4A 2O8BA 1IN8A 1KKUA 2C99A 1XZKA 4PANA 1CY6A 1WCIB 1XL1A 3BBLA 2QRNA 3PGKA 1XRQA 4IJQA 5A4FS 4UTVA 5AH0A 4JCCA 3BC1A 5FBLB 1L5KA 4REQB 4XPZA 3CLTD 3NT4A 2F48A 3OY7A 4GP7A 4M0LA 1SOUA 4EYQA 3OQ6A 4RVDA 5FNVF 2BFBB 1XRLA 1HTTA 3LVRE 4LF4B 3PI6A 1F9AA 4AZ0A 3BGSA 3CUKA 2WM9B 1UZAA 1ZI8A 3IUEA 2FUCA 2RDMA 1ZGCA 3JSAA 3FNFA 4YGXB 5LYJB 1NU8A 4TROA 3PNYA 3DOFA 3PDHA 2BGLA 2UDPA 1KQFA 5BNWA 4F0JA 4MUIA 3TOCA 4KXVA 2B0JA 5LDHA 5KHOC 2D06A 1DOAA 4OHKA 4RA6A 5IK2D 3UXYA 1QK5A 1YRWA 1HE5A 4BKRA 3WISA 4YJGB 1XB2A 5AM5A 1HR0B 3T3OA 3FMGA 3PFFA 3VGPA 2RGWA 1CF4A 1HDCA 1RQLA 2WJWA 3KPWA 2VNKA 1KU6A 4P7KA 5CW1A 2NXWA 2O8NA 1T9AA 4R68A 4FT4A 3ZWWA 5HKOA 4C03A 3IAFA 1NF9A 2RMKA 1LU9A 4FK8A 3Q2OA 5HOEA 1M2VA 4HS4A 2B8JA 4W1QA 5JCOA 1C30B 3N2GB 5DMXA 4YIKA 3K1JA 1VG8A 1QGAA 4M1SA 5EPUA 3TK1A 2A59A 4FW9A 4IGAA 2PA0A 4W9NC 1TW2A 1KQ3A 4NCBA 3IBGA 1YA4A 2FW9A 4P34A 4B74A 4F96A 4KH0A 4F86A 5F4ZA 4URXR 1JLMA 2XCIA 3UJ8A 3WB9A 4B2LA 2IYLD 3OQMA 4K81B 1UODA 1KO5A 2AW3A 1ND5A 5B1IA 2A14A 2FGKA 4ZT5A 4DC9A 3I01A 3WMEA 3IT2A 4IEIA 3DWFA 4REMA 5ARBA 1QMGA 1WZIA 1JLKA 1AGYA 3H2HA 3NHFA 3OETA 4JT2A 4OKSA 3PIDA 2P3LA 3CCCA 4KQGA 4Z1MA 5EE1A 4DDVA 2CVHA 4Q4HA 5AKKA 5F7OA 5EEHA 1NLMA 1DBSA 4FIDA 4E1VA 2FHSA 2Z0MA 2I6TA 4GX2A 3NKLA 1BQEA 2DUWA 4RD3A 1PL6A 3ZK9A 1ZZGA 3CVUA 3CLSC 1GUFA 3RBAA 5EWMA 3IA2A 3LXXA 1Y33E 2FQYA 3UTDA 1KMCA 2RGNA 4AWXA 3RJZA 1A76A 3UHOA 1N5IA 4W1RA 1ZH0A 4RNDB 3BE4A 1JR3A 2CGEA 2FEOA 3OA0A 1BN6A 3GFQA 4K2AA 4NBRA 1Q92A 4RD4A 5K20A 1TA0A 2VXCA 5IDVA 4GGMX 4MIEA 2H29A 2PSJA 1QO7A 1II0A 1YVRA 4WKBA 4FBGA 3EZNA 3OEHA 4LUCA 3ZVKA 3W05A 2HH9A 3AB3A 3OT1A 3WGOA 2NXJA 3RODA 2AHRA 2XH8A 1EHIA 2ZBPA 1PGPA 4ZQBA 3UWMA 1YR1A 2W22A 3KZXA 4AURA 3RLIA 2VBIA 4RORA 4CF6A 3D5EA 4AY2A 1QHXA 4XJXA 2G67A 3TSYA 1ABBA 3KR2A 5A02A 1GZHB 1GGFA 5BY2A 1U0BB 3T52A 2HIHA 4HQLA 3QVUA 3R5XA 2YOGA 1UBSB 3U0BA 1FK8A 1R1DA 2VBCA 3PHHA 1GAJA 3LLMA 1G20E 4FEAA 2LVBA 4CM8A 1A5TA 4Y1RA 3BMQA 4AS2A 1B3RA 1T0UA 4FTWA 3H1AA 3AHHA 4XCQA 4P7GA 1K27A 5BSGA 4Q1CA 1VL1A 2IQ5A 5L3SB 1Y5IA 2I1WA 3DAOA 3VNVA 1WNTA 4D8XA 3FPKA 1OJLA 5B7PA 1NZFA 4TVSA 3A1SA 4ZCIA 2ESRA 4N5NA 5K4HA 1VRWA 3Q8MA 3QVGB 1B16A 4AP9A 1TTQB 1H6DA 3G2HA 5JZSA 5HUQA 3CUSA 4KVZA 4FYHA 1J00A 1SJ9A 1GPWB 5E7IA 1ESZA 2GZ2A 2JI7A 5P8WA 1OWOA 5EXDA 3JAKA 3O9ZA 4J0IA 1PGOA 4MKFA 2QUIA 1C1XA 3QVOA 2BTEA 4LXTA 3CEAA 1IN6A 1G63A 1TAGA 4Y98A 1H4SA 3KOOA 4R40A 5EVCA 3T3MB 1MA3A 2PPVA 2AW5A 3AKCA 2NW6A 3OOYA 4H6VA 5BYAA 3P2JA 1A9XB 5CVCA 3IPCA 1F2DA 3OIWA 3BB1A 3G0BA 1DTSA 1GPNA 3D5TA 4JQYA 1QKJA 4L78A 2P2LA 4PX3A 1KFEB 1TM5E 5AM2A 1ZA2A 2CFTA 1HKUA 3RYIB 1FX1A 4Z3DA 2JFQA 3PZRA 3ND8A 2FEXA 1L4UA 3TQCA 3T3NA 1BMQA 5IASA 2WM2A 3QTTA 4M98A 5AXCA 2BMFA 2FWJA 2J5RA 4YY3B 1VB3A 3NU1A 4Q21A 4Y2RA 1KZGB 1AQUA 1RM0A 4JP1A 4CDGA 5DYTA 5WRFA 2XCQA 4IDFA 1MAAA 3QF7A 3DS8A 4IIEA 1U2GA 4PSDA 1KZYC 3PD7A 5E8JA 2QZ4A 3H16A 4FKBA 2QVLA 4QOFA 2I3DA 1G5PA 3WOHA 4K8OA 4DA4A 3RT1A 2PWYA 1A3CA 1LW7A 4M8KA 3QGMA 4ZVMA 4CIWA 2QMYA 2Z83A 1N6PA 3CGGA 1RAFA 4OP2A 1XV5A 3MSCA 4UNNA 2XQJA 1H93A 4OI0A 4MUGA 2IUUA 2G1AA 1GNPA 4QUDA 1T5TA 2CMGA 2ZT5A 3LX6A 4IX1A 3OKAA 5GJCA 2AF3C 3RFTA 4CMEA 2R7LA 4AS3A 1U7WA 1QOPB 3UJDA 5A4MS 3NQ41 3RTEA 3TXXA 1Z5ZA 2OQRA 1JYSA 4R2LA 4OB6A 5FFMA 2AZMA 3CMMA 3IQWA 3SSOA 3CRW1 1SUSA 2IXDA 2QDXA 5FTKA 4ZCTA 3NHUA 5JSZB 1FMLA 3N6RA 3TWOA 4A91A 4FFWA 3SF8A 5B2EA 3FTFA 1YMVA 2H1FA 3LUDA 2QG4A 4MQ4A 3UAVA 4DC0A 3Q8XB 1OB5A 1TAQA 5JLJA 3WWEA 3VNUA 1GZVA 5CJPA 4JIGA 4GOMD 3I8XA 2OLKA 4NZNA 2YIDA 5TMBA 1R3UA 1N2ZA 4FYIA 4LK3A 2X15A 3I92A 1YL6A 2QSYA 3F1LA 2CHGA 1U7DA 4AG6A 1PGJA 4A0QA 1THTA 5M04A 3PRKE 1SXGA 3E3NA 4IQFA 5KREA 5DNYB 1N6RA 3KXIA 2XQVA 4TKMA 3T4PA 5HJ7A 1FW8A 3K32A 3KKNA 4M3NA 4UTOA 3E2PA 1OVGA 1BCSB 1PE0A 1ZVQA 2EF1A 2NU6A 2RGYA 4U2EA 5CPFA 3THSA 3ZH9B 3LI2A 2E4ZA 1IZYA 3HFRA 3TTWA 3W5SA 2DERA 1OPRA 3A06A 2IGTA 3GPIA 1XRMA 3IJEB 1I3MA 1U3FA 3UH1A 2H11A 4NH4A 3HGTA 4NMLA 1JLLA 1LJLA 1P0FA 1U0NA 2O3JA 2G0AA 1DE0A 2MTBA 2X5NA 2FW6A 1ZICA 2ZUCA 3DDSA 3HPRA 2BT4A 3EXFA 2H1WA 3H3FA 4Z0HO 5B1YA 1Y7LA 5JNWA 4MO2A 5IM4A 4HEQA 1U2PA 1VIYA 4KQ9A 4CCYA 4F4DA 5KYNA 1VZ2A 2WPDA 3OT4A 2FFBA 1GKLA 5DGDA 2KYRA 2R6GA 3E9CA 1RC0A 2PLWA 3NIDB 3KE8A 3P9YA 1NPTO 5G0UA 1UC4B 4PW0A 1ZPDA 1Y3AA 3VU3A 1XEXA 1HYGA 4JT8A 4MS1A 1SXPA 4BFZA 1DAKA 4PZCA 1Y3DE 5AXDA 5BN4B 3T15A 1O8BA 2AI1A 4HN4B 1CDDA 1X8JA 5EQTA 4LFCB 4EY4A 3R24A 4NE7A 5AVWA 2LCIA 4J7CA 2C98A 1FTNA 2ZRNA 3JV7A 4AP5A 1C4WA 1OE0A 1FXUA 4UEWA 5JTTA 1P31A 1XTJA 4DYVA 4N12A 4P8RA 3BGWA 4QBTA 3H04A 4CLEA 3L79A 3SQOA 2YV5A 3Q15C 1NBMA 4AC9A 2NU6B 4U7DA 2O8DA 2QV7A 1VE3A 1P3DA 4X20A 1IQUA 2IQIA 4L72A 1RBZA 1VI5A 3AF2A 3FW1A 2D5BA 2FVXA 3FNEA 2JGJA 4LJKA 4PGHA 5DTMA 2GO1A 3FUTA 1JQKA 2HEIA 2WK1A 1J4AA 2AS0A 2YJ6A 5EZSA 3EVZA 1P5RA 1YL5A 4PO8A 4EY6A 4N4AA 1E94E 1UBOS 5EXTA 1DEKA 5LYYA 3KKOA 4HNHA 2OCIA 3AR8A 5JEEA 1KY3A 1TTPB 2O2SA 3X2FA 4D3ZA 5AKXA 1IBKB 2ZCJA 4UXJA 4XTRA 1N0UA 1VYUA 2VUIB 3EWAA 2ZTHA 1YKFA 1FU7A 4D92A 3OT5A 1IJEA 4YXFA 1U8TA 4ZI3A 1NHWA 2GLXA 3AEYA 3V8MA 1DC5A 1D2EA 1HZJA 1E66A 1V45E 3WRVA 1WKVA 2G83A 3N8GA 3AZPA 3EZFA 1QK3A 2C3YA 2BZ1A 5BNFA 4I2NA 3RF7A 4QGGA 4BP8A 1ADBA 3W1WA 4C0HA 5KOJB 2F17A 4ND4A 3QEOA 3HACA 3JXEA 1I5EA 2OO5C 5CVEA 3ZI0A 4CFZA 2AL7A 2Q7XA 4FQ5A 3AR6A 1EJ0A 1JWBB 1TMKA 1T4CB 1VE9A 1XYVA 1U31A 2OXFA 1A9ZA 3WNCA 3U7QA 2XGGA 3ZW9A 3RYFA 2DPGA 4KFTA 2QNRA 4G1MB 5B2FA 3AVXA 1P0IA 4LY6A 1Z0FA 4M89A 3LHDA 5TQVA 2AHOA 2CT8A 5CYGA 3HXOA 2WTMA 4B3JA 3O3MB 3RASA 1JDBB 3IB6A 4BNFA 4YUWA 2X0JA 3N2KB 3C7DB 2COKA 4PSKA 4QO7A 1QV7A 3BRQA 5DSTA 4EY5A 3OCYA 3A6ZA 1HMPA 3PXEA 3E48A 3ZWMA 1D2GA 3BUSA 2G25A 2P6OA 3PV0A 2C7BA 4JZYA 5TPWB 1JTFA 3GGSA 3TB4A 3K70B 2R751 4IFTA 4OHUA 3FSJX 2H5LA 5DW0A 2ONKA 2UXCB 2G8LA 1WABA 4R6XA 3T8YA 5IUNC 1XNQB 3QBTA 3ZW8A 5HRAA 1LLDA 4GZLA 1A2KC 3LOPA 1Y5LA 3K0EA 1KJNA 1V3VA 1XPJA 2R6R1 2E48A 1CUUA 1HH4A 1SBQA 3TQOA 3Q87B 5MDHA 4B3TB 1EX6A 4FOLA 1G1MA 1NN0A 1UWVA 3IELA 2JRLA 2VH5R 1ONBA 4P7BA 1G9XA 4O59O 3JAWB 1MT3A 4EA9A 1NBME 1EGQA 1XLUA 1SURA 2OL4A 1AMNA 2C4KA 3TR6A 3LUCA 1DPFA 5ALVA 1XDBA 1GNQA 2YASA 2JPDA 3O8LA 1JL3A 3IUNA 2RI6A 4MUEA 1GGNA 1ECCA 4ENSA 3ZHOA 3JVVA 3O0TA 1ZHFA 1CBUA 1DWOA 2FA9A 2YHSA 4G0PA 2IXAA 4N3CA 2OXEA 4XD2A 3KYCB 1OI7A 2OAQ1 4DBLE 2VXYA 4U7TB 3D7KA 3N8KA 1V5WA 5A4KA 3X1ZA 1N2XA 1E2DA 3EQ2A 3UA3A 4IL5A 5EQFA 4DV4B 3V4FA 1V7QA 3S2IA 3TPZA 4C0KA 1SNYA 1R4MB 1SVIA 2VHXA 2HEGA 2HMTA 3H75A 1OC4A 3PC7A 4Y1GA 1TNDA 3TPFA 3ZHTA 2IX3A 2P7IA 1XZGA 3AF4A 1SEVA 1ZYUA 3ITDA 5EWJA 3OCVA 1UM9A 1K3FA 5CNMA 2V0NA 5BYBA 3RUAA 4AO8A 1UBRS 2VYND 2PXAA 3OIUA 3U4AA 2JLYA 5IAKA 3KKMA 2EFDB 3WDSA 4B3BA 3SQDA 3KB1A 3AFIA 3R20A 3HVJA 1KDRA 4IIBA 3SYRA 1IMJA 3A7EA 2C8VA 4W7HA 5CM2Z 3VTZA 2VF8A 2R8EA 1P4SA 5KX5A 1W4BA 2O05A 3I9OA 4M49A 1IHOA 3ELUA 2FSSA 1J2EA 1E3QA 2J33A 2IYQA 2WYIA 4ICIA 4X45A 3UHAA 2OCBA 3CT6A 3OE5A 1IHXA 2AOVA 3QTBA 3SXPA 2WT9A 2OOSA 2X22A 4DOMA 1GYPA 1Q3KA 5ADUS 2GVZC 2YUTA 3HS3A 3T1OA 4MW6A 3H9JA 1J8YF 3N2LA 2EBUA 4MAFA 4NL4H 4G0WA 4AIRA 4LHEA 4QU8A 4EGSA 4R71A 4NV1A 4K40A 5D3KA 4RTNA 1RFLA 1N78A 2GYWA 3CO0S 4EEXA 1GDTA 1KDPA 1SMKA 2PJRA 2CEAA 8GPBA 1T5IA 2VZEA 2E7ZA 1XVIA 3KK0A 2QGFA 3Q3CA 2IPXA 2QD4A 4NYMR 2DTDA 5BQPA 3WHKA 2B1QA 3CUVA 4F04A 1IZZA 3MLEA 3IHLA 5DULA 2KX7A 5IXYA 3ST7A 1EI9A 2HLNA 3QMMA 3DYIA 2GA9A 3QX9A 3AI1A 3IEKA 1QPZA 4E5YA 3TIGA 3UCEA 2CL6X 2AFIB 4MOWA 2P2GA 4O33A 4DUGA 3MJDA 5D1NA 3ZCRA 4N5DA 4MYCA 2J1LA 3ZXUB 5LKAA 1Z7YA 2P9CA 2ZIXB 2VHEA 1L9KA 2G5CA 2YBEA 2PR7A 2Z2KA 1I6KA 3JAMA 3QJ5A 4BWFB 3RS5A 3UG6A 1P29A 2EBWA 3BDIA 3P5BA 5L3VA 3QWFA 5IFKA 2ENUA 5KKCA 4YO7A 2J3DA 4YHHB 2P9YA 3IQXA 3UV3A 4YCLA 2GHTA 2W6ZA 2XZTA 3DOUA 1Z9BA 1OZGA 4KQWA 3D6FA 3KOYA 3L0IB 2QYTA 1DCFA 3AEUA 3TQHA 3UJAA 1J09A 5ALLA 2PX6A 3DC7A 4Q4AA 4Q4AB 5LL6P 5CTAA 1IWBB 1QG2A 4KPEC 3HG7A 1XFDA 1GZ5A 3G5TA 4XSVA 1SKMA 2YMMA 4URHA 1D2RA 3UBTA 4OUDB 1D1QA 3CF4A 3HU5A 3I1YA 2QLNA 3E84A 4QXMA 4ENQA 1SQSA 1O97C 1RI3A 2IW1A 1NVBA 3HY3A 3H2YA 2V59A 3L7KA 4HOYA 1CQWA 2EYUA 3H99A 1A9YA 2Q5OA 3VMMA 2R6CA 3IDSA 3N8DA 4LBVA 4LX0A 1GLGA 2FWIA 4TUYA 4EO9A 4NK4A 4L5BA 1VLQA 4NBLA 1ISFA 1JXAA 5JD4A 1D1PA 4QG3A 3IVGA 1QH1A 2FFJA 3A70A 3ED5A 3KJHA 5FADA 4EENA 3SS9X 4UDNA 2R5FA 4WNAA 5D85A 3S28A 3BH6A 3NEJA 1JG2A 3V2IA 1JSLA 2OBFA 3GRYA 4C1NA 4ZODA 5KJFA 5AW6A 1NHGA 3PYMA 2X19A 2FN4A 3G5MA 1XDSA 4IILA 4MKRA 1C7RA 3LPDA 4AIIA 4E07A 4UNSA 1VECA 5LQSA 5LMUB 1JTEA 3I1FA 4FHEA 4HB4A 4F3TA 4P32A 4E12A 1W0JA 2CD7A 2WICA 1GN9A 2HFJA 2VP0A 4DSOA 3WAJA 5KOHA 5KYUA 4S2EA 3KPJA 1I1HA 1N2CB 4TVOA 2GZMA 1HC7A 1DO2A 1KIMA 4BUCA 4IO1A 4JYMA 1JHAA 2OFPA 3HBFA 1JKJB 4NMXB 3UHFA 3Q3EA 2DQYA 1SBNE 4QQKA 1M76A 2OZPA 1LDBA 1NJGA 3KT0A 5KYXA 1FYXA 4A6PA 1HZZA 2DHCA 2XHZA 1DKLA 4V2UA 1NF3A 2PT7A 4Y7DA 5D7BA 5BOSB 4IMRA 3C3XA 1J8DA 4D9KA 3KPVA 2C4UA 1KWKA 4P4TA 1DKMA 1MAVA 1QLJA 2BRUC 5AI4A 3QUSA 3HZRA 1CF9A 1N5LA 2R1UA 2ZYTX 2ZBVA 4G0ZA 1OGJA 2ET6A 1TM1E 4LWQA 4XSHA 4LW8A 2INGX 3N87A 1VHJA 2ZIAA 4HYTA 4UE3S 4A10A 2NZVG 4E6EA 3GDHA 4JQCA 5DBGA 4YMTA 5F7JA 5AI8A 4JASB 2Q2NA 4BEVA 1RZ3A 1H2FA 1RWPA 4X1YA 4R9NA 3IVAA 3T61A 3Q6MA 3ZU5A 3L1VA 4Z4CA 1DC8A 3WY9A 1MB9A 1U7PA 4AY5A 2XRMA 3U7JA 5IUJC 1XI2A 3MGAA 3B38A 3ITNA 1U63A 2VJBA 3UJCA 5T4EA 4UVIA 3FI0A 1D2MA 2RI0A 3L0BA 4JUCA 4RH0A 4WQMA 3WMGA 3UV7A 1FP6A 4EYKA 1JE1A 2GLUA 4OM7A 4UHCA 4Q01A 5GY7A 2VT2A 4RTQA 4CF3A 1TK3A 2J41A 1ZUHA 3O3NB 4MWEA 5AW7A 4JUBA 2ALJA 1EG2A 2A1TS 4YP7A 1DB3A 4YJ2B 4L28A 4A6XA 2L42A 4HLCA 4P35A 4ZCQA 1B93A 4TMWA 1G98A 2OXCA 2ECFA 3LX4A 2BBTA 4RDIA 4TL9A 3RHSA 5JAOA 3LDUA 4BB9A 2Z5VA 5FA6A 4C78A 3M6XA 4PYKA 2C5AA 4B46A 1ECFA 1EVLA 2Q3EA 2V5VA 4WY5A 5ALJA 4CIYA 2O48X 5G0VA 3L7AA 1EYZA 3PL5A 3HU1A 4L76A 1S2LA 3ELWA 3OVMA 4IHQA 5JSHA 1F51E 3COYA 4M37A 1FFXB 2Z4SA 4O8CA 4QOHA 3WFZA 1UADA 2VH1A 3VRHA 3ZY3A 4YNBA 1E2JA 2HA3A 3L6OO 1S3SA 1X7XA 2O50A 4FYJA 5JE8A 1CIVA 3L8ZA 5A3QA 2OPHA 1E4YA 5KYUB 1WV1A 1W0CA 5A3SA 5J2UF 2O2EA 4QGHA 2C7QA 1GSIA 1X74A 4IOJA 4B40A 3RVSA 2ZZMA 2PH5A 5INTA 4E5DA 4PNEA 4PXYA 1OC2A 2GPYA 1HTBA 3KLNA 3CG0A 3CLHA 4KXUA 4S1VA 4YAJA 1VE7A 1M75A 2DTEA 1JZSA 3OJCA 3PJGA 4II3A 3K1YA 1PWXA 1Y7IA 4TVBA 1T35A 4Q9JA 4DV1B 4AJJA 2QTBA 4RY0A 1DC4A 2CNBA 3KELA 5BV1A 2ZRDA 5I4CA 2DFDA 3TFWA 5DRTA 4MW1A 2HMWA 2RG1A 3PZBA 3VI4B 1ZRHA 1FP4B 1ITZA 5B7QA 5LMNB 4BHTA 1W4AA 3VJKA 3ZW7A 5BQXA 1B8OA 1CG6A 1J9EA 2DHRA 2AUNA 4X64B 2P30A 4XSGA 4U63A 3THWA 1BJTA 1XK6A 2NO1A 2NNLD 5CH5A 3V1UA 1IN1A 1A95A 1A88A 3I3OA 3QK7A 3QMWA 5A7HA 4D42A 1L3CA 1FDTA 1NUUA 1PEYA 1RZVA 3TS1A 2QRZA 2DBYA 4FLFA 1X86B 1VFNA 1HMYA 2CJXA 2PZFA 3P2KA 4YGYA 3ENQA 2I91A 3LXUX 2NZUG 5FBQB 2H65A 3V7WA 4QREA 1ZSNA 4CYMA 1Q0ZA 3RRNA 3W5DA 1Y8ZA 5K0LA 5FPQA 2MJLA 1TO2E 1YIOA 3VDQA 5C8YB 5A71A 4CMBA 4FFVA 2W00A 2SICE 1SD2A 1P1FA 3LU1A 1A7AA 4GI2A 4N03A 4DEVA 3PI7A 2Q8QA 3PJFA 4JXKA 2D0IA 2XE7A 1AGXA 3CH5A 3HA2A 3BGDA 1QQTA 3EGDB 5ANRB 4MIKA 2FMFA 2Z3WA 2IP1A 2R25B 1JQJC 3WGNA 3DP7A 1U7TA 4W9RA 5CLLA 1ANKA 4YMUA 1XPRA 4LTDA 4TPKA 4DY6A 1UFRA 1WEKA 1UEIA 1TT7A 1ML4A 1CR0A 3LGXA 5GIOE 2BPOA 3NJRA 3FFAA 4R1QA 2NV2B 8OHMA 2UXDB 3L4EA 1JHQA 2XB9A 4R8MA 1JQ5A 5AESA 3BVPA 1EXVA 2CLSA 3PKJA 4DV0B 1JR6A 2C2HA 1SELA 1X7YB 5EUBA 1UKBA 3MUFA 4HBZA 3NCHA 1UMDB 3WGLA 4KHZA 3E82A 3ID6C 5CNKA 3T06B 2QLJA 2OHFA 3GAAA 4WW0A 3ENNA 5HIAA 3RJ9A 1U5BA 4WFJA 1IL0A 1KTIA 2ZBDA 4WK4B 1C7QA 2EZ8A 2ODWA 2YWBA 4UZEA 2QG6A 2GEJA 4DIBA 2RJ3A 1G8PA 2H18A 2KE5A 3GZ4A 3QI7A 2C9CA 3EZLA 4LJSA 4Y0AA 5I9NA 4IEFB 4DJDC 3DZCA 1RMTA 3MD9A 1G4UR 1RLJA 2O2XA 4J7UA 1WPXA 5J23A 2NZJA 4TLLB 4ZHQB 2B3TA 4FNAA 4H0FA 1DXQA 2FEAA 2VHVA 3HRHA 3ROEA 4EKNB 1HG1A 4MHTA 2PH3A 3W04A 4J4TA 4K9QA 3RS8A 2H2AA 2P2CA 5I7WA 5E1OA 2R79A 1MH9A 1LBIA 2ATEA 2OILA 2PQMA 3I01M 4FE3A 3OJXA 4JYPA 5FLYA 2QN1A 4UAGA 3QUBA 4MCJA 3RSCA 2IY8A 3NHKA 2I62A 1JEOA 2AR9A 1KQGA 3K6KA 1ESEA 3C8ZA 4JP3A 1DKOA 5E3JA 4Y2YA 5AKJA 4LQ4A 4IDCA 4MKZA 3IUPA 3AQIA 1O77A 4GKAA 4BNVA 3QHQA 1T8RA 4KWCA 4DLAA 4KYVA 2YQ5A 4MEJA 4NIMA 4ENWA 1LQUA 2O1XA 1GT6A 5H4HA 3O4RA 2B83A 1YOVA 4FMDB 2XUPA 4IVPA 4I1PA 2AOXA 4G41A 5C8YA 3SIXA 2V4UA 4K1LA 4UJ3A 3RSSA 1T9ZA 5CP8A 1YDFA 2VQ3A 2XGMA 4JJZA 4BKUA 1QWSA 1PG2A 3QWHA 2XMPA 4KACA 4OXRA 3FCAA 3RABA 4FMBB 521PA 3TSOA 5I01A 4DR5B 3GG9A 2F1HA 2FPPB 4RDCA 3WAKA 2XBMA 1KZ6A 2QTMA 2G08A 4Z8XA 3ZZUA 4B81A 4L4ZA 4LZOA 1SC9A 2KLBA 5L6LB 1XXHB 3QUCA 4QODA 1V8BA 3LUHA 5CLHA 4DHWA 1DUSA 1TKAA 1R6UA 2I9KA 1T4BA 3CEJA 3HKDA 1DG9A 2ZJ1A 4XDYA 2AG1A 2XBLA 1VA5A 3VYSB 4AQDA 5ALTA 1JF8A 2OY0A 1A98A 1M5RA 3T99A 3TW8A 1U2SA 2IHYA 2I8AA 3GUCA 3I2KA 1KNQA 1R64A 5IYZF 3RVPA 4V2IA 2C7PA 1M0TA 3SEAA 3RYIA 4URUR 5LUBA 1N5DA 4JQZA 4KQHA 3NEAA 5A2GA 3ZGLA 5F2OA 2R84A 2ZBUA 3E5HA 3GEMA 4JLKA 2EXXA 4WPGA 2G4CA 2IY7A 2D2EA 3QG5A 4R05A 4XFDA 1ZGHA 4QZVA 4PO3X 3RYCB 3AYZB 3O38A 5LLSA 3W34A 5CNJA 4NYIR 4ZJUA 4X63A 2E5LB 1JXOA 4D4JA 4H4DA 1DO0A 3JWPA 5E3HA 2JCGA 4IKEA 4K5QA 4O1IA 4N8EA 4W5NA 1Z6QA 3I5YA 2H0AA 1W75A 1PJQA 2B2NA 3BTVA 4QHYA 3O8CA 2WIJA 3PSHA 2CCGA 3T12A 3FAZA 2P2NA 3KQPA 5E6RA 3CVVA 4EX7A 1T1RA 1US8A 3LHIA 4N7RA 4J6FA 3V42A 1BKDR 5IF9A 3E18A 5KWEA 4XJSA 4JYZA 1ZMBA 2VNIA 4JJ4A 4K0KB 2WZDA 3PVSA 5G3ZA 4QUEA 1SKBA 1DLIA 4U5XA 4NV3A 4DFDA 1CERA 1YULA 3K96A 3ZV7A 4UBMA 1Z5GA 5BUQA 2YNMA 2C0PA 1PWEA 4YCJA 2AKAB 4BNWA 4XFJA 2NWQA 3WK8A 2FYTA 4LJ4A 3TRJA 2Q5HA 3P5SA 3R09A 3T9DA 5HTKA 2BM8A 3NGLA 1GPDG 2CE7A 2RHRA 3WXMA 3CC8A 4Z8YA 1FXWF 4YMLA 3OE1A 2MCFA 2Q3HA 3A3NA 3SYLA 3T41A 3T3DA 3EAFA 3MMNA 2O59A 2NSHA 3HB4X 3DJFA 1AKEA 1BFKA 1ORIA 4AROA 4WN9B 1L7EA 3IQDB 4BX8A 3NFYA 4G56A 4EX6A 4KN9S 1UIMA 1WHSA 3D0KA 1E5DA 2IJGX 2AF4C 1TFRA 2C7GA 2W8BB 1LLCA 3BMCB 2BR4A 3GCXA 4W5TA 5LXTA 2EGGA 1MD9A 3AM3A 3AHIA 4FGZA 1KP2A 4MHSA 4HDSB 1Y98A 2R8ZA 3LC7O 2AJBA 1UFVA 3QE3A 2R66A 4RXUA 1QHGA 3G9QA 2A92A 3NHPA 2JI9A 4TRNA 4UDOA 3RG2A 3T4UA 1M6YA 3M5DA 4ARUA 1I94B 1ZN7A 3WYAA 3UMCA 3HKBA 5T4FA 1G3IA 3M1LA 4C2TA 5REQB 2MR5A 2MOKA 1XOIA 1YB6A 4EW3A 3FKQA 4WXMA 1E6KA 2XMSA 1MNAA 1HSZA 1MOSA 2CJFA 1KQPA 1NF8A 2ASEA 4N48A 1N2IA 4E14A 2CNOA 5IKOA 5BPFA 2PFSA 1M1YB 1RQXA 3CIFA 4MGIR 4PTLA 4S1NA 1TQ2A 2PUCA 2YYYA 3HWSA 5ERXA 4BEWA 1XKQA 3H1TA 1K7YA 3ZI7A 1O8CA 1WXFA 1RZUA 1L1RA 5T3UA 1EFKA 4I3GA 4RK4A 3GJ0A 3IBYA 5LKRA 1NULA 3E9ZA 3GLHA 2WWRA 5KYWB 1FFAA 1HNNA 4RGBA 1RQNA 1SXJB 1XPUA 2NTJA 1JJIA 3MBIA 3BD8A 2QM7A 2XMQA 3O8BA 5KTMA 3ZDQA 1LXCA 3KUKA 4MHOA 2HU2A 5HZGA 2RK6A 4KR6A 2Q4EA 1JKIA 1KEEB 3GFPA 4MMYB 4CQMB 3V7NA 1PG5A 1OD6A 1JEJA 2PZBA 3D0OA 3MXTA 1H22A 1W34A 2ZETA 4F12A 1A96A 9ABPA 1D6NA 1INLA 1FFHA 1HUQA 4PFQA 3T1VA 4TKUA 1Z63A 4KR2A 1PJ8A 2PYDA 3EHDA 4NS4A 3Q7QA 4ESHA 2QAIA 1KYQA 1OMOA 4QUHA 3VPHA 3T5PA 3VC1A 4MCIA 1BCRA 3L18A 4Q7QA 4C4OA 1L7OA 2OENG 1JI0A 1YACA 4BNZA 5KWSA 5KNDD 4W9MC 1N8TA 4XCVA 1KERA 1LRLA 3PG5A 5ECDA 4AKIA 1VPLA 1YI1A 4RIGA 1NBIA 1N9GB 1JV2B 1Z8HA 2X76A 3HN7A 3R0IA 4F5WA 2HTEA 4I5GA 4EDFA 1GPUA 3KE9A 3NYRA 2Y1DA 4JOQA 4C7JA 4ZD6A 1TUIA 4WBNA 2BD0A 5ALRA 1NMQA 2GKGA 4NS1A 1P4AA 5HG0A 4TL7A 5DFAA 3WX0A 1SKAA 4XQEA 5F3RA 3H5TA 3A1FA 4A26A 2ZRQA 1CZOA 1U2EA 1WXIA 3HJRA 1FQOA 3COZA 4EB6B 5A04A 2WMDA 4PQFA 4B09A 2VPWA 3CXUA 5KQSA 2ZS9A 1P2BA 1O94A 1Q15A 1ODTC 2QSZA 3AZOA 1BWRA 2PCLA 4IVQA 2P9HA 3ADOA 3DUFA 5FUXA 4K1XA 1I1NA 2HF7A 3N74A 3G5AA 2BAGA 1BWQA 1C0IA 3JWHA 1W30A 2TECE 3HLKA 4R7TA 2OESA 1KVRA 2CF6A 1P39A 3QF4A 2XIQA 4KK4A 4AG3A 2YWCA 1O5IA 3PCXA 4M0DA 4R1PA 5IHXA 1YS2X 2A0XA 1F8GA 3GOHA 2P9ZA 2VZ0A 2FV8A 1PNOA 1YRQA 2I71A 2GA8A 1QGYA 1IDOA 1J20A 1GAQA 1Y8QA 2Y77A 2YIVX 4ZP1A 5BXQC 5KSOA 3SP1A 2H4XA 4LV5B 1VGVA 2F1IA 4RUKA 4UVEA 4AYTA 5FPTA 2IHUA 1TVEA 1Z0UA 3TTVA 1M6NA 1E64A 2D1YA 2A0YA 5FPSA 2ZWIA 2I4OA 5CFMA 3CLKA 4RNCA 3B85A 2YJZA 4O4LA 1KARA 1V25A 3IP8A 1XMOB 4EEKA 1EE2A 5EZYA 4P58A 3E05A 2VPXA 1N7JA 2W43A 3CPEA 5E9QA 5SY9A 3URKA 3ZXSA 2RK4A 3EW9A 3LGAA 5KYXB 3ZWOA 2MR6A 5ALDA 3C45A 721PA 5FHQA 1ZXXA 2VZLA 5AVUA 2FEMA 4OXYA 4WA8A 5HXAA 2R3SA 3NH6A 3HV0A 1QO9A 4KXLA 3ABOB 4DY4A 3TGPA 5CT6A 5SZIA 3S55A 3O9MA 4FWIB 5HRUA 3DULA 3B78A 3TAXA 5CCXA 1RE0A 1T6BY 3V97A 1XJWA 3RC3A 2ORWA 4GKKB 3KG2A 4DG8A 1N1DA 4BZPA 1H8ED 3B5JA 3NHYA 4FZ5A 1HE2A 1ZMRA 1I9GA 3MCTA 3RVDA 4EVRA 3JZMA 2D4AA 1PT5A 1X2BA 2O2ZA 4TYPA 3OP1A 3MBOA 3CONA 4QQNA 2FPWA 2F3SA 1N2OA 1NXWA 4HRAA 3IP6A 2I22A 1KQOA 3DGFC 4QGAA 1N6HA 4LTMA 5FOQA 1UJCA 4YT4A 3OZDA 2V45A 2WV7A 2ZB3A 3I1JA 3JQFA 5G1NA 3FSEA 3GNLA 3EVNA 3NPMA 2RHDA 2Y1KA 3PQ4A 2B37A 1K75A 2FPOA 3GUVA 2J7PA 3WWYA 1G8YA 1V8FA 1XD2B 2EW8A 2FG6C 1J90A 4HDAA 5AKHA 4J0KA 3KQKA 1IE3A 2KS6A 3ETEA 4UHJA 1XDUA 3F8WA 3GD5A 2C61A 1SG6A 3C5CA 2O6LA 4MVJM 3UKJA 5HQ3A 1LS6A 4BTVA 4Q4JA 2I4NA 1U1IA 1E99A 4FOTA 4MGKR 2XV1A 3I61A 2GDJA 4BLOA 1FYFA 5JOQA 5JPDA 3ZJ5A 3A6DA 3DZIA 5IW8A 1OAKA 2OFXA 2YV3A 1QDLB 5JT1A 2OZLB 3JAWA 3TPCA 5AHXA 1TKRA 4BLVA 4RA9A 1PZMA 1X7WB 2ZJZA 3OTHA 3DXZA 2R6DA 2NX2A 1PR0A 1UDRA 4PSAA 1N77A 2MSKA 4YCDA 4RD2A 3ITEA 3T5BA 5L3RA 1OFUA 4NWIA 1AKQA 1XZQA 2LXNA 3GDOA 2BP7B 1FU4A 4G4JA 2PZKA 4C04A 2DFPA 4CKWA 5JXIA 2Y1EA 4IJ5A 5G40A 3T7SA 3TGWA 4CIBA 3AMVA 1JPVA 1CQJA 2VDWB 4C4ZA 1DZ3A 4US1R 3R6GA 3AZQA 5TPWA 5COQA 5KTTA 2LCQA 1DOZA 3LT1A 4QIHA 1DRJA 4ALJA 2UZAA 2G9ZA 1YE5A 2CE2X 1NUQA 3D7RA 3QV1A 5ALFA 4MSUA 5U9CA 1QZUA 2B1RA 2J3IA 4NCAA 1VBNA 4DR3B 5BXYA 3WYBA 3K09A 4UMFA 3PE4A 1ABFA 4I3HA 5JVDF 5LPNA 5DGCA 4Z54A 1YV9A 1ESMA 1P9RA 1V96A 1XJ5A 2B99A 2CJYA 2EQBA 2QVBA 3L0PA 3NBQA 4K6MA 2B7BA 4LYDA 4RZ3A 5D5PA 1L8XA 2H3HA 3RYFB 5KQRA 4WOBA 1Z5VA 5LP1A 4RJTA 1EWVA 3JYLA 3K9LA 3QY9A 2APJA 4POOA 4MP3A 4FQ7A 4B76A 2HPAA 3G0DA 1KGDA 3CR7A 5LOVA 1OZHA 3BWDD 3OD1A 13PKA 3NRJA 4PRYA 2P2DA 2H6EA 1GFSA 3U60B 5J3JA 4I6GA 1V43A 3A2NA 1L3BA 3RRYA 5K8LA 1DOHA 4BKOA 1ISGA 2VA8A 1N3IA 2RBEA 2YNMD 3LFTA 4J8PA 4L8LA 1AQ6A 4U9UA 3Q3IA 3R74A 3SC6A 4YAKA 1KXZA 3JQ8A 2DYKA 1L9XA 5J2UB 3TL3A 3VR4H 5IT9A 5CU7A 2JANA 5BP7A 4I1OA 1SKUA 4CHTA 1L4YA 1C0LA 4URZR 3M0EA 2R47A 3LY9A 2J0UA 4GBGA 5JSYA 4GMDA 3IKLA 3ZZ0A 4KO8A 1MORA 4LIPD 4QYWA 5FKJA 1X7ZB 2D62A 4YR9A 2IF0A 3ZDZB 4GOJA 4N47A 5DKFA 1N75A 2CZGA 3WO0A 3I9JA 1C14A 3FNHA 4JOCA 1IU9A 1NLUA 3K5IA 4DARA 2M9MA 5CEEA 1HL7A 2J3LA 3F98A 1EK5A 1BHJA 3BYZA 1RBQA 4X3OA 4WTOA 4M1ZA 4UKDA 1XU7A 1BZYA 4LKRA 1ULHA 4KPFC 1CY1A 4KQFA 1NASA 4V38A 3S0JA 4CMEC 2BFEA 2JFGA 2IIVA 3UOWA 1WCYA 3V4ZA 4AMBA 1VJ1A 1RWOA 1Z5WA 4N0DA 1WQ3A 2XECA 2GN2A 3DLBA 3U4IA 3VTFA 2XT0A 4YCBA 4MRMA 1EZ4A 1XLVA 2E18A 2IEGA 5ALEA 4BO2A 2XIJA 3PJEA 4H7PA 4RJKA 2PYZA 3Q8LA 3AGPA 3MJSA 4LZWA 1E3WB 1MFPA 4PYLA 2J09A 4BZWA 4MGHA 1HXHA 3OLQA 4HAYA 4II7A 2J9GA 2GPBA 4JY7A 3G2OA 3W6PA 1VA4A 3ON5A 1U3GA 4IHJF 1PDWA 2K7FA 2A57A 3OESA 1DARA 3TMAA 2DGDA 4UPEA 2L17A 4D4GA 2PS9A 4L4RA 1N0VC 4FVTA 1O96A 2O2JA 2ZU0C 4TZ6A 3AL2A 1BCSA 4N5IX 3BTUA 1DS6A 3ESDA 4MICA 3KBBA 4W7SA 3RFUA 4H6PA 4MKGA 1N0HA 3HZHA 4UXIA 4DCPA 5JSQA 3V7UA 2OKGA 4B4WA 3MHTA 1WB4A 3NDIA 3FMIA 3S1SA 3RH0A 1L8OA 2FLKA 5LA6F 4M87A 3S2ZA 3G2MA 4HNGA 1KRXA 5CYPA 5GM1A 4ZMRA 2GH1A 3PVZA 1ONNA 3IHTA 4YT8A 1FA9A 1R0SA 2EJBA 3SJAA 1UT8A 1R4NB 3DHNA 4ARCA 4DWVA 4O0LA 1XLWA 2CHVA 1ORWA 1GDHA 5C31A 3BCUA 1NVGA 3T7IA 1P1KA 4ALLA 4NMHA 2M6KA 3RYTC 1P9WA 2JFHA 5A6SB 1UCFA 5T64A 1F2TA 2GFHA 3BWCA 1DBPA 3EPKA 3OOEA 3AJEA 1SKYE 1TMGE 1JDZA 2GS9A 2PZJA 2Q4OA 3R8XA 4B8YA 4ARBA 2Q07A 1W5EA 2IYOA 2R00C 3FYDA 2JAUA 3C6XA 5DASA 4LWZA 2IC5A 2BOVA 4AS1A 1BIFA 1XD8A 1N6KA 3ESYA 1N7HA 1E96A 2CUZA 3P19A 3UCFA 1UZNA 5J5CA 2O20A 3LWZA 1A4IA 1IN4A 5CHYA 5BN1A 5COAA 3TMYA 1MX9A 3WDMA 4C5AA 5DLYA 5C35A 3OQOA 3C48A 1I1QB 5ILQA 5AOCA 4D45A 3R7NA 4DQ0A 4DR2B 4D25A 3HCPA 5J2UA 4AP6A 4ZWNA 1Q0UA 1VIMA 1BXGB 2HGSA 1TYAE 3ANYB 5A5EA 3U19A 1HI9A 3B36A 4DNQA 1EHCA 1JG6A 5B6PA 3DE1X 3ICOA 1IHUA 4G6ZA 1NJ5A 2OGWA 5CK5A 8AT1A 3K6SB 3KQLA 3W7VA 4UM9B 1E7QA 1YDEA 3DLIA 4HGOA 2Q7OE 4DMKA 1E9CA 5KVAA 1ESNA 1SHUX 3ADDA 3WADA 2E6KA 4PGMA 2JFYA 4GPZA 4XYBA 1UK9A 3K05A 5CLQA 1CJCA 2PJDA 3BD7A 5FL7A 5M7EA 4YUXA 3WBKA 2WHEA 1NW8A 4O2BF 1L7RA 4TV9A 3CZ5A 5A06A 5KQPA 3FCYA 2OXTA 1AB5A 3MWYW 4L9WA 5KTYA 3W8DA 3DTYA 3K5WA 4EB0A 3JVUA 4WBSA 3U26A 4Z4IA 4DZTA 3ZKWB 1ULUA 5EZ5A 3GJ5A 1U1GA 2AEJA 3PK0A 3QELA 4JN6B 5AK6A 3WNBA 2PZAA 3TAUA 4XWOA 3LIPA 5CDFE 1F06A 1CJVC 1BROA 2F9LA 3CUYA 3T94A 3WC4A 2PANA 1OF1A 3MWJA 5JS7A 4MR9A 4QD3A 4IRMA 2EARA 3B5IA 5FV4A 2XA9A 1QR2A 4TT3A 2JA2A 1SGWA 2DOKA 1IXYA 5B53A 3WQQA 3KWMA 1M6WA 2BR3A 3WVNA 3ZJVA 4OJTA 4L5YA 3X0DA 2XD4A 2XYHA 3U1VA 1VHTA 7REQB 4IDGA 1AN0A 4RGYA 1IBLB 2BUCA 2ZU6A 4OK6A 4KGZA 5T8KC 4CL0A 1PW7A 2A5GA 4RTOA 3CZAA 1NQTA 3DQQA 3I9NA 1UR5A 621PA 2AKEA 2IF2A 3ENVA 1G55A 3CO5A 1D5CA 5CFNA 4LC0A 5FNVB 4PWZA 1KA9H 1XLTA 3NIGB 2R1ZA 4W8OA 3RU2A 5EUMA 1YU9A 1Y6FA 4OH1A 3O8OB 2Q3FA 2CHQA 4MUNA 4HR7A 4PGGA 2Q28A 4B35A 2BGRA 4EKDA 3IP9A 1ZNQO 1YQGA 2GPAA 1VBKA 2QD5A 1XUOA 3C1UA 1IAVA 1Z6XA 2NZWA 3GLKA 3HUDA 2BFFB 4WJZA 3EMVA 1FBNA 3AHCA 5FD8A 4H7IA 4N9WA 3PPVA 2DB3A 2QMZA 1M72A 4LISA 1DKPA 1T2DA 5TJ9A 3V4VB 3G23A 3B2NA 4XGRA 1HE1C 1Q0RA 1P7CA 2HIMA 3GAMA 2R6JA 5LOVF 2FCAA 1PDVA 1RYZA 4BAUA 4B73A 4YDQA 4HQRA 2RB5A 4JYCA 5CH8A 5JCJD 4KFCA 3C8UA 2RAFA 1XCJA 3JALA 3UH0A 1KI9A 5H82A 2QRVB 3FPGA 4GMXA 4W4TA 1FYEA