4PEVA

Crystal structure of abc transporter system solute-binding proteins from aeropyrum pernix k1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
370
structure length
370
Chain Sequence
b'PISVLVLFDVGGRGDLSFNDMAALGADRAAEELGVDVVFQTPQSLAVMESVLDAASRSGEYDLIVLVGFLWQEPLEKVAPRYPEQKYALIDAATRERYDNVASYLFREQEVASLVGIIAADIANNISKATGEEAKAGAVAGMDIPPLWRFHIGYLYGVQYYNQAMGTDVEMVWTYTGRFDDPTLGKTTAEQMLQQGVRVFYGVAGLTHVGMFNAVKEAAARGVIAFSIGQDASQEWYDPQTIIISGLKRVDVAVYTAIKDVVEGRFRGGIVSLGLKEGGLGLSDEEIIRYFAEIAAETGQLPEGLTPEKVVEIVMSQREKWISNDGWRLVEELKQKIISGEIKFVTPQDHDTYDSIIEELKAGNLEAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane lipoprotein family protein
publication title Crystal structure of ABC transporter system solute-binding proteins from Aeropyrum pernix K1
rcsb
source organism Aeropyrum pernix
molecule tags Solute-binding protein
total genus 138
structure length 370
sequence length 370
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02608 Bmp ABC transporter substrate-binding protein PnrA-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pevA01
4NQRA 2OENG 2H3HA 3RVJA 3QEMA 4G0MA 1JDPA 3HXMA 3N8IA 3H5WA 2MYPA 4XXHA 1FSPA 3C97A 4RXUA 3MM4A 4EYGA 4RU1A 1CYEA 5TQ2B 4KNYA 2ID9A 1JF8A 1GUBA 3HDVA 4G86A 4FE7A 4XLTA 4ZPJA 1YK1A 4G97A 4PYRA 1UDRA 3EGCA 4CBVA 1BDJA 1P6UA 2BGGA 3RVSA 1E6MA 3HV2A 1Z25A 4EVSA 3QLUA 5IULC 3C6QA 2QZJA 3H5IA 3IDOA 2GKGA 1NXXA 2FLKA 1F51E 2PJUA 3RVOA 2PUGA 3JS5A 1Z12A 3CTPA 5F64A 1XHEA 4LE0A 3O1JC 5JNSA 3HK2A 3QELA 2X7XA 1QNLA 2PL9A 1B00A 2IPAB 1P6QA 5IUKC 2VYCA 3SAJA 1ZITA 1IIBA 3CNBA 4WXMA 1L5ZA 1FFGA 3HJFA 4HNQA 4EYQA 3MIZA 3LKVA 3M6MD 3R0JA 4IMIB 3O1HB 4HYEA 3CLKA 1W25A 3VNBA 1BAPA 2QVCA 3KKEA 2R25B 4H60A 3Q9SA 1MAVA 4DN6A 1LBIA 2JCGA 1YS6A 5KI6A 3D8UA 2Q5CA 3LFTA 1A0OA 1R8JA 3GWGA 4RXMA 4LDAA 2MSWA 4M88A 1JFSA 4KK4A 1KMIY 1JLKA 1NY5A 1GUDA 4H3KB 4RKQA 3JPWA 1VLZA 2M1ZA 5TE9A 5JS1A 5TQ0B 4ETNA 1BA2A 3QLUC 3P9YA 1J56A 2IKSA 2IOYA 4ML3A 4IILA 3DGFC 4N0PA 4RXTA 3TMYA 1CHNA 2PUEA 4NCBA 3KHTA 4TN5A 4JP1A 1ZY2A 2MYNA 3FMVA 5DCLA 4OATA 1LJUA 1P8AA 3QX9A 3N0XA 4P98A 1U04A 1C4WA 2IPLA 2F8TA 4MLDA 2ZAYA 5KC9A 1AB6A 3HUUA 2HJ9A 5EWLA 3MYYA 1Z13A 4Z4HA 4YWHA 1NXVA 4Z4EA 3JVDA 1M2FA 3DBIA 3CG0A 2JK1A 3GT7A 3O2SB 5HQJA 3CHYA 3H5TA 4W5NA 5CNJA 3OLZA 3A0UA 5IC5A 3O74A 5HKOA 1QP0A 2NUBA 1VPWA 2QVGA 4MS4A 3HSYA 4S04A 4Z99A 1GCGA 1SRRA 3KG2A 2YHBA 4PE5B 2JB9A 3EQ2A 2H0AA 3DGEC 3LKBA 5EWLB 4RKRA 4ETMA 3LUGA 1JYEA 1L5YA 1MIHA 2LBPA 3H1GA 3H75A 4XASA 3OQMA 5E3JA 3OLXA 2CD7A 3CG4A 5EWJA 1NXSA 5IBQA 4EVRA 1KRWA 2GBPA 3GRCA 4YV7A 4RY9A 4N47A 3KYIB 1M5UA 2L17A 2FXIA 2QW1A 3UUGA 3NBMA 3HS3A 1EFAA 4RY0A 3Q7RA 3T6KA 6CHYA 3OQNA 4ZMRA 1BDIA 5KWSA 3G85A 2E4ZA 5BR1A 3BBLA 4OLAA 3HEBA 5FBHA 2IYNA 5DKFA 2PUBA 4MLCA 1WETA 1K66A 3HCWA 3B2NA 3QEKA 3RVKA 1ZN2A 2MYUA 4N03A 5D2CA 1H9CA 2IDMA 1JX6A 3OO0A 4G0QA 4KMRA 5B3JC 4QICA 3E3MA 3ILHA 1YIOA 1E2BA 1ABFA 1YVUA 3LUKA 3H1FA 1ZHHA 4RK7A 2E4VA 3JPYA 5TPWA 1Y1LA 2HPHA 1VRVA 3LUDA 3LUHA 2XDYA 1SXIA 1YK0A 2YHAA 3MMNA 3OMWA 2B4AA 5T7BA 3CS3A 4MRMB 4RZSA 4UHJA 4FB4A 5IUNC 3KYJB 3JTEA 3KSMA 3T95A 3RVMA 1ZAYA 4EY3A 1LK0A 2FSPA 1APBA 1JFVA 4G0YA 3LMKA 1U2QA 1RXEA 3LUAA 1EWVA 3H6GA 2FN9A 2FMKA 4RY8A 5TPWB 4WUTA 4N76A 4W5QA 2RDMA 3NNDA 1QKKA 3N0WA 2HQOA 4OTZA 1TVMA 4QYMA 3BRSA 3Q15C 4O1IA 5EWMB 4RWEA 1DG9A 1F4VA 3HUTA 2FVYA 2A9OA 1W9HA 1OXBB 2LPMA 1U0SY 2MYTA 3H5OA 3N53A 3SG0A 1SXGA 5TQ0A 2V0NA 2NZVG 3IP9A 4XAQA 2GWRA 2WB4A 3EODA 3GYBA 3O21A 4Q6WA 1FFSA 4JAVC 4MS1A 4OG2A 2WRZA 4TLMB 1ABEA 1DBPA 3URMA 3OQOA 4LZLA 4YP9A 1BVHA 4RK0A 4FE4A 2FMHA 1JL3A 3DZDA 3RH0A 4B09A 1C0EA 1XHFA 3T38A 2JBAB 3KS9A 4W5OA 1PEAA 1YTUA 5BQ3A 3MA0A 1ZH2A 6ABPA 3EJWA 2WWVD 1PUXA 3I45A 2L18A 2HQBA 4W5RA 1U8TA 5JS2A 2QXYA 4MS1B 1FQWA 2WMYA 4H3HB 3F6CA 3LOPA 1A2OA 1LBHA 4JA2A 2KYRA 1DJMA 3H6HA 2M98A 3O1IC 1TJYA 4RDCA 4Q6BA 4DQDA 2QV0A 4IRXA 1HEYA 3H5VA 3OM0A 2PUFA 1RXIA 2WJAA 4KFCA 1QQAA 3HM9A 4O1HA 4RSMA 3SNKA 4Z9BA 3L6UA 4IF4A 4F06A 4YR7A 4LE2A 1ZVVA 1OXKB 4RK4A 3RVNA 2VK2A 3ROTA 4DADA 3IP5A 7ABPA 4IGAA 1DCKA 1D2AA 4Z4IA 3O2JA 1E6KA 4NICA 5B3JA 3ROFA 4W5TA 1ZH4A 5TPZA 3MF4A 1NXWA 3EQZA 1NXTA 1NATA 2CWDA 3CZ5A 4GNRA 3C3MA 1DRKA 2FMIA 3O75A 1DRJA 4JOQA 4LE1A 5CNKA 4NCAA 2FEPA 1ZGZA 3MQ4A 5KQMA 1FFWA 5CNIA 2PMCA 1JFTA 2LIVA 2I6FA 1JH9A 3Q7TA 5JNRA 3BREA 2MSLA 5PNTA 2A9QA 3TX6A 1RZRA 1NXOA 3L49A 1JWLA 4UHKA 4KRFA 4F3TA 2OQRA 3EAFA 4G0OA 1RPJA 3Q7SA 1PHRA 1QO0A 1JBEA 4KV7A 3KJXA 3GBVA 3DLBA 4G0ZA 3Q41A 3CKMA 3BRQA 1DC8A 4L4UA 3I5AA 3N75A 4JASB 2R47A 3A10A 1VKRA 2L19A 3GV0A 1JHZA 4MRMA 4TMYA 1USGA 4NV3A 3NHMA 4G0XA 5IUJC 1A04A 2FLWA 3FFWA 3QLVA 2NT4A 1RNLA 4IMJB 2JVJA 2P9HA 1D5WA 1MB0A 4D6YA 4KQ9A 5C5CA 2R48A 5JNTA 4KQCA 3UKJA 3EULA 4PEVA 1DCFA 4LDZA 2E4WA 2LP4Y 1QP7A 1CEYA 3QK7A 2PL1A 1ZGGA 1QPZA 3LUFA 4LRQA 3ILYA 3C3WA 1EWKA 1PEYA 5T3YA 1M5TA 3O2QB 1S8NA 4G0PA 3RVLA 1ISSA 5EWMA 4EYOA 4MS3B 2O20A 3OM1A 2FQWA 3EDCA 3T8YA 5IX8A 5GOTA 3TD9A 5JNVA 1EWTA 4MR8A 5BRJA 5CNMA 3FFXA 3H5LA 2W42A 4D74A 3SY8A 3D02A 5FWXB 4N0QA 4ZJPA 3I42A 3CRNA 4WT7A 1ISRA 5KQPA 2FQXA 5KQLA 4RK1A 2FQYA 4KREA 1NXPA 2GX6A 4MR9B 3G1WA 4OLBA 1USIA 3LTEA 3QLVC 3OLYA 3UK0A 4KVFA 4MAAA 3IPCA 5BRAA 1YS7A 2JBAA 2PLNA 5TQJA 1QQBA 4MR8B 1QMPA 1JDNA 3H1EA 3OO1A 3GL9A 2F8SA 3N6VA 1BDHA 2QSJA 4P1ZA 3QLTA 2R4QA 4MPTA 3QEMB 2CHEA 2PE5A 5HSGA 2B1JA 3K4HA 3HVRA 3KTOA 3I09A 3IPAA 2HQRA 4EUKA 1MB3A 3E61A 1DCMA 2P4UA 3RVRA 4RK5A 4O5AA 2J48A 2ZWMA 4KZKA 5IEJA 5I4CA 5ED4A 2JVIA 2JRLA 2DRIA 1TM2A 4JB2A 4F8JA 2PUCA 2JVKA 2NT3A 2AYZA 4WXEA 5JNWA 1Z2DA 3OLVA 1EHCA 4E7PA 2PKXA 1I3CA 1P2FA 1YMUA 2VUHB 3M9XA 4JB0A 4MGEA 2E4UA 3SQNA 2VUIB 2E4YA 2FEKA 3DLHA 3OMXA 1KGSA 5FBKA 3A0RB 3FFTA 3F73A 1Z2EA 4D6XA 1QP4A 3TO5A 3QELB 4HNSA 4PZ0A 5IEBA 4PICA 2QU7A 4YLEA 3W9SA 1PNRA 1D1QA 3JY6A 3RQIA 2PAFA 4MQFA 1LJLA 5TPZD 2AYXA 3HDGA 5FWYA 4QYWA 9ABPA 2N9UA 4MQEA 2QR3A 3IP7A 2FTKE 4KPYA 3LUJA 4YS6A 5DTEA 4YO7A 1Z15A 2WJWA 2FKAA 1JYFA 1EAYA 1DC7A 1ZESA 1RZRD 2CHFA 4ETIA 4HNRA 3FGZA 4YGXB 3KCNA 4MQFB 3JVIA 4LX8A 1Z17A 3F6PA 1D1PA 4ZYLA 1QO0D 2RGYA 5JNUA 1Z16A 5FWYB 2L2QA 8ABPA 3RVPA 2TMYA 2IPNA 4MR7A 4MQEB 4EVQA 3C3KA 4Y9TA 4N41A 3F7NA 3OLWA 4Z9AA 2HSGA 2RJOA 3NNNA 4GPAA 2MSKA 2GI4A 1YMVA 2IPMA 5KC8A 2WY2D 3A3KA 1TMYA 2A9RA 3HO1A 1KRXA 3KLNA 1URPA 1M2EA 3HZHA 5GQSA 1E6LA 1Z26A 3VNAA 4YCSA 5HM6A 1DBQA 1U2PA 3QX8A 4MS3A 4S05A 2ID7A 4KK3A 4Q7EA 4RV5A 5DLEA 5C5EA 2PUDA 2A9PA 1USKA 2FMFA 2RJNA 3CZCA 5ABPA 1TLFA 2E4XA 4YRZA 1D4ZA 1AB5A 4MR7B 2FW0A 3BILA 4TLLB 4Z0NA 5DGCA 4RS3A 1PNTA 3NHZA 4MS4B 1GLGA 4MYRA 5FWXA 4L85A 3RVQA 3CFYA 2PUAA 1Z18A 5CHYA 3M9WA 4RK6A 4XARA 1SD5A 2FN8A 3KLOA 3TB6A 1DP4A 4EYKA 4Z4CA 4WWHA 1DZ3A 1XWWA 5KQGA 4MR9A 4Z4GA 1DBWA 4QPJC 4OBBA 3N0RA 3SM9A 4ZMSA 5EWJB 1T34A 3CU5A 5TQ2A 4EGSA 1ZDMA 3S99A 3IP6A 4F11A 2LUOA 1K68A 3LUCA 4F12A 1GCAA 1MVOA 4E7OA 2NZUG 3FDFA 3GA5A 2FEWB 3GBPA 4XFKA 3K9CA 4Z4FA 4WZZA 1SXHA 1NTRA 3NNSA
chains in the Genus database with same CATH superfamily
1N7HA 4LSMA 1GPUA 1T0UA 2OENG 3DC2A 2AJBA 2OUKA 1ZI6A 2RGGA 3BWEA 3OE4A 4KAAA 5JADA 5JAIA 4OFZA 4A0FA 3H6KA 1MQ9A 4RD2A 2BJVA 2H7VA 3E9QA 4YRMA 2QW8A 3L6BA 4TQGA 4YT8A 4O4JB 1X19A 2G17A 4QBTA 1XA3A 1YB7A 1JHYA 1T6BY 2FSSA 4LVUA 4QM6A 4ZO4A 1NBME 2WYOA 4A36A 2HWUA 1XK6A 3E8MA 3LS2A 4MGYR 4JN6B 2HT6A 4C29A 3ZY6A 1BKYA 5CB0A 2EWMA 5TX7A 1Y6GA 2Y2UA 2A59A 3QPCA 3CLHA 4FP9A 3ZIDA 3BDVA 2OP1A 2GCPA 2HMTA 3D7RA 3O3OB 2QNIA 4RELA 4PG8A 3IIIA 4HX5A 3PDJA 5IULC 2H1IA 3H2GA 4E1VA 3IDOA 4FZ3A 3DNPA 1PJ2A 2FWPA 1SXJA 4NZMA 4GE3A 1W36B 3OTIA 2OGUA 4MVWA 2OILA 2RHLA 1T6YA 5HMMA 3O93A 1LVUA 1FJGB 4YJKA 4WINA 2NP6A 4K81B 2IY8A 2JZNA 3ESQA 3CM0A 3L18A 4OX9Y 4AZ0B 5G02A 2G71A 2H59A 3AUSA 3WIVA 3A1DA 2IP4A 1U99A 2H06A 1OB5A 1MFZA 3ON5A 1B2RA 3EFOB 2CHUA 4UPVA 1L0BA 421PA 4F0JA 3HZZA 4IIJB 1PFQA 2OAGA 1IZZA 4LF7B 1GTMA 2NVBA 3LHKA 4JLMA 3QMPA 5FR2A 2VUSA 4JLUA 2PX0A 4QG7A 2H8KA 3JX9A 3NTRA 3VNRA 5A04A 4LFBB 3PQ2A 2C94A 1V11B 2UZ3A 2XWPA 4HNAB 4BFZA 2XKKA 4FUQA 5CB4B 4QG3A 1N5DA 2Q5CA 3K70B 5DMXA 6Q21A 5JCPA 3LL4A 3PXBA 4QEDA 3TRHA 3EXEB 1XYYA 2C9MA 4LDAA 1QLHA 2Z43A 1K4KA 3NBQA 5EUCA 3DWFA 1CQZA 2CNWD 4AVYA 2VCYA 4INZA 2XGMA 4RL6A 2K87A 3TW6A 4RKQA 3FZQA 4BNNA 3NHYA 1OHHD 4DYDA 3C7CB 4JUBA 4YMTA 3QQPA 5AKJA 2VAPA 2XXJA 4YI3A 3KM0A 1NN3A 3MGGA 4XGIA 5DI3B 1PR9A 3E18A 3P52A 5AKZA 1KA9H 2MU1A 4BC1A 4CMBA 2I03A 1P8AA 3WI7A 2H5EA 3AB8A 4G5RA 4EZIA 3NX4A 4X8MA 4E12A 4P2BA 1R6TA 5EXSA 4AUKA 1UBFA 2Y93A 5DDIP 1U04A 4DGSA 4RA6B 3L8MA 4J0GA 5H4HA 4TV9F 1GTSA 3AL2A 4LHZA 4LSZA 1N5RA 5CM2Z 5AK0A 1IEVA 2KWIA 3K1TA 3IUYA 3WGTA 5DEOA 2Q5HA 3WK7A 3ZX4A 3JVDA 2QAGB 2BFCA 5HQJA 1JSRA 2HSZA 4RTRA 3ELDA 3EXHC 3IS3A 1R66A 3K1JA 3UGTA 3E1GA 3LZCA 5C51B 2AJTA 3EVCA 4NCNA 3VJMA 1TA9A 1Z4PX 2X0KA 4LNHA 2C20A 1X7YA 1GG9A 2ODQA 3PJGA 3GA7A 5DASA 3SOZA 4FSHA 4S04A 1A96A 2YHBA 2DFDA 2G88A 4PE5B 4C0HA 3V4VB 5LM3A 1X42A 4KYVA 2DBYA 2YJ4A 4A3SA 1IMOA 5EN4A 5B2EA 3C8ZA 4X65B 3W5CA 3IYLW 4XASA 2YJTD 3EFHA 1K06A 2IPOA 1G66A 3IHTA 2P4EA 3H2HA 2VSFA 1FZTA 1KRWA 1Y1TA 2V9ZA 3V7NA 3E70C 2IYOA 4MMXB 4FHEA 5AVXA 4TTIA 5T64A 2IS1A 3WKBA 4Q1VA 1VMAA 3KYIB 5FNVA 4P08A 5KTRA 1VE5A 4HDAA 2CXNA 3K9HA 4L4RA 4CM4B 2XJ4A 2JKZA 6CHYA 5FADA 4DA9A 2K6GA 3AETB 3A9SA 4B48A 1EVYA 2XEDA 2QJOA 3UHFA 1KI6A 4JBLA 4MI9A 3TECE 4U9IS 1CFJA 4XDZA 2F3TA 1GFSA 1M34E 2RGDA 3CB2A 4IKPA 3WDKA 5K3OA 3DS8A 3CR3C 1CY7A 4DLZA 2J07A 2HR1A 3AHGA 2JJQA 5FBWB 1XI2A 1DV1A 4DW8A 5L53A 1R0RE 1R9GA 2NO0A 3KKKA 1DTSA 4KRGA 4BVLA 4QTYA 2WVAA 3IUNA 3L0BA 3SK0A 1M1NB 1W29A 2OVBA 1YIOA 3V4LA 1Z75A 4Z2AA 1K75A 3Q72A 4N9WA 2EWVA 3IB3A 2O2GA 2DP4E 2ZYUX 2PWYA 3KXDA 5AJUA 2OWDA 3M0EA 1CB0A 4RYDA 2ZTHA 3SNHA 1ONNA 1XMJA 5T7BA 3Q5DA 2AEJA 4K6CA 3BMQA 2W0MA 1R6VA 1RJGA 1KSGA 5K0BA 4NBTA 3GJZA 1Q0TA 1UC9A 1FJ2A 2JGLA 3LLSA 1TM4E 2FW8A 4YHBA 3TPZA 1RAIA 3IEKA 4RA9A 5JZVA 1IVNA 2V74B 4YWJA 1NBAA 2P6OA 2X2OA 3PJEA 3IXLA 4M99A 1WUKS 3HACA 3LWDA 2BD0A 1D2HA 3SM3A 3AR4A 2J4DA 3MUFA 2PSSA 2ZR9A 3L0DA 4HZGA 4WTOA 1T1IA 1UIRA 1AT1A 2FE1A 1EP3B 1IN5A 3KJHA 3JQAA 4HF7A 3DVAB 2PX8A 3ETLA 4RV4A 5DM2A 3SZUA 3AVWA 4CKEB 1Y3AA 4JJAA 3VRHA 1M34B 5AIAA 5HDBB 3ZDBA 2YVLA 1WUYA 4CG3A 3AFMA 5I51A 4F1KA 1NRIA 1QNFA 4DLKA 4IIBA 2XD9A 1W0JD 4HWGA 3TI9A 3TTYA 1ADFA 4E5NA 4RS4A 3IP9A 4R31A 4TWAA 2YWJA 5EZYB 2W4IA 3L93A 4I5DA 1WZUA 1GSIA 1GZHB 4M37A 3RKSA 1XTVA 2BCJQ 1I3KA 1I2BA 3AUXA 4O3FA 1VI5A 4ZYXA 5F1YA 2QJWA 3R7WB 3AL0C 1M8JA 2R3SA 3LAWA 4YP9A 4F2HA 4C3ZA 2FMHA 4DIEA 4MDHA 5DVZA 1O94D 2HIMA 1REQB 3O3MB 4QBIA 4G8BA 2BRUA 5ALFA 1XJ5A 2AOTB 3L4EA 3PUHA 5LC1A 3WLHA 1C4OA 1E1LA 1HFWA 1FNSA 3IVCA 3NW9A 4LYJA 1NQUA 4Q4AA 1VB5A 2XZTA 3OX2A 2QTBA 3MUNA 2XPCA 1E2DA 3OZ7A 4B87A 1H4SA 3DD5A 4LZOA 1J9ZA 1C3LA 1TZCA 3QVSA 1FTYA 2ZUWA 3F6CA 4CMEC 3U5ZB 2CDBA 1THGA 3E3NA 4OAQA 1V3QE 4FZRA 3L4SO 4JXJA 3H6HA 1R6BX 5DYWA 3ZD7A 4RDCA 4MVJA 4A10A 1YA6A 2JH9A 1DUVG 4X3CA 2JD1A 1ZFNA 3FFBA 3F47A 3N5CA 4OQDA 4LHEA 1V1RA 1XZHA 4PFSA 5LJIA 5K1ZA 2OZVA 1A97A 2AW3A 1WB4A 2I67A 2O1EA 3GGOA 2WJGA 5E8JA 3LD9A 1JG4A 3SXUB 4Y1GA 2ZIVB 1GWNA 3NM4A 4ENUA 2VHYA 1QG2A 3T9FA 4PNHA 2F1RA 1FYWA 3N74A 2R7KA 3TZBA 2W83A 7ABPA 3KVYA 3ADBA 4HD8A 3EVBA 5HQTA 4DE5A 1JKJB 4G1CA 4F1JA 4RJKA 1UM9B 3M9LA 4HUTA 3A4NA 1BE6A 3IPLA 3F8WA 1YV9A 2SICE 4ZVNA 1PZXA 3ACDA 3PQ5A 4DVGA 1AK2A 1MNAA 7REQB 2RHMA 3M49A 3P0EA 1T9HA 3R0XA 4MWDA 5CNKA 5CTAA 1HE1C 2HCRA 1NASA 4PCAA 4X66B 1K3UB 4B6OA 1O94C 2DQZA 3Q12A 5KQMA 1CLEA 4RPLA 5CNIA 2PMCA 1JFTA 3RFFA 5K8UA 5IHPA 1MGOA 2J1LA 3BREA 3OD5A 5PNTA 2A9QA 4QRDA 4EW6A 3B60A 4UHKA 3JD2A 1I5OA 5IKMA 2JFNA 2WPNA 3EAFA 2VUTA 1QRDA 1MDFA 2V5VA 1UIMA 2VP6A 4HLUC 3ZHBA 3L4BA 3AXSA 4GI7A 1SAYA 3FVRA 3JQFA 4Y1EA 3ANMA 4ZQEA 4RENA 1EWQA 3M89A 1YTLA 2QM8A 4DVJA 1I2AA 3GGCA 2R47A 2QROA 1QFMA 3KKNA 4NV3A 3LA6A 4G0XA 4HXEB 3QLVA 2R6ZA 2C3MA 2YN4A 4URVR 4KQ9A 3HH8A 4QYIB 3LCVB 4NYIR 4DWOA 2G6BA 2FK8A 2R1TB 3VMMA 5J23A 1PYGA 2D0PB 4JP5A 5DGTA 4ENQA 5CD9A 4KQ6A 3B51X 2J0QA 3TZKA 3V3KA 1M6VB 2X8AA 1NVTA 3CLVA 3ILYA 4R5MA 1YFZA 1PDVA 3S8EA 1XTUA 5TF4A 2VHUA 3EXG2 3CLUC 4L4SA 4F3YA 4F85A 3RVLA 2W00A 1X1QA 3A06A 3BQMB 2JLSA 5IWAB 1PGJA 1WL8A 4YIHA 1RLMA 1GNVA 2FQWA 3BL8A 3PXEA 4CI9A 4BNIA 1J7JA 4HG2A 2J5XA 1GRVA 4B31A 4D74A 3SY8A 3C7DB 4Z51A 4H59A 2C2GA 3QVJA 4DCPA 1CX9B 1II8A 3VZBA 1DFHA 3LXUX 2AWNA 2A0XA 3CWZA 3WFIA 2EGGA 3AM1A 1NNLA 4ARZA 3I8SA 2Y0DA 3LFHA 4BTLA 5KMGB 5CVVA 1MZPA 4KREA 2HF7A 1NXPA 4I66A 3G1WA 1VBMA 3ELUA 8ATCA 1DBIA 1RM4A 2AZXA 2UYYA 1Z8HA 1RYEA 4H7KA 4HZUB 3DEAA 3TQOA 3VR2A 2QTLA 4JHXA 1HRKA 1RYNA 1YZVA 4H15A 4LEIA 3X1KA 2RBEA 2ZRFA 1W48A 2PX5A 4R7TA 3AUFA 1DLJA 2SKCA 2AR9A 2H2IA 5H1YA 3BFJA 2XXBA 2WKRA 3ZZ1A 4F92B 3QA3E 2H31A 2L42A 2J7PA 1E0SA 4AW9A 1F5NA 3HN7A 4TL6A 5EJFA 1MXFA 4E2XA 1QQBA 1JH8A 5DGIA 4RKWA 1ECBA 3BIFA 4IDAA 2GESA 3IPAA 2CL7X 4BB5A 1U0RA 1H42A 5JXWA 3M3PA 1F48A 1DCMA 2ZSBA 1QIHA 2E5FA 1M72A 1SCAA 2I1QA 4U6SA 2C7QA 1EWYA 2IE0A 2IDKA 3D6UA 2WU3A 3CLSD 3ELBA 1ZZGA 1MORA 4LDQA 4TL8A 5GOZA 3RF6A 3DQZA 4X8HA 2X0FA 2RGUA 3ZVRA 4IDGA 2CT8A 4DRXA 4R9UC 1XXHA 1C3OB 2AYZA 2W71A 1GEGA 3JR3A 1L8AA 2H4YA 3BYZA 3ASUA 2CYCA 3DF7A 3HNRA 3IJPA 5KNBH 3B48A 4HAZA 4IR7A 4OUDB 4TMVA 3T9DA 2POQX 1ESZA 3SFZA 4L5YA 4P9NA 5DM0A 5AKIA 4X6XA 4R0MA 5KJFA 3H16A 3EMKA 1KGSA 4FR0A 4NARA 3U3JA 2FXVA 4RF2A 1JR3A 1XCBA 4G36A 2BF4A 1KFEB 4HJRA 1QP4A 1BQ4A 4Y9DA 2XF8A 2VYQA 3OH8A 2FSIA 4KDFA 4NFYA 5HUHA 4MB6A 4S2UA 1ZXXA 4MKZA 4CT0A 3R5SA 4MQFA 4XUDA 1V1MB 1MABA 1Y80A 1A4UA 2YV4A 3A1UA 1IXKA 3BB1A 3IIEA 3QRWA 3RV3A 2CJYA 4RFVA 2A0WA 1OOEA 2UVDA 1IONA 1EFRA 2EGHA 2V4UA 5FWYA 3PVZA 3LIIA 4H4EA 3HJTA 1UMBB 1K8ZB 3NDRA 4OB8A 4ZVUA 5AVSA 3EXHB 3G2NA 3IP7A 2PX4A 3NAGA 4MRAA 1NSYA 1U02A 3HYLA 2VHXA 3WQSB 5CFZA 2HCJB 3UYLA 3DE1X 3V8NA 3LQ1A 3DLAA 2OAQ1 2GRUA 1JJFA 1DC7A 3A1VA 5EFZA 3V8EA 3CUUA 4F38A 2RB5A 1TZBA 3AG5A 3H7AA 5JDCC 3WWZA 2HUNA 4E51A 4XD2A 3I6MA 1VCMA 4F2PA 3RG2A 1GTZA 5AD1A 4KL8S 1MV8A 1GLVA 1S3SA 3N9IA 1L4EA 3QY9A 2OV1A 2W11A 3VR3A 3PQDA 3RPEA 3W4JA 3KXLA 4XW2A 3WL5A 3R5JA 2RI0A 3WRYA 3ZVLA 4AP9A 2PXHA 3DT8A 4QKQA 5EHZA 5KJ6A 1BGXT 3JXEA 4OKSA 4MUFA 5DHUA 3VBEA 1ISGA 1WZNA 2Q8NA 1JXOA 3E58A 3ND8A 3FDIA 4TMXA 3I1FA 3OPXA 4BLVA 2GUGA 2CF6A 3IUBA 1T2UA 2ZATA 1V8DA 1N3BA 2V55B 3ABOB 3EVEA 2GAIA 3B1KA 1ATIA 3UF0A 3WLAA 1KRXA 3VV3A 5GADl 3A36A 5EE3A 1Z26A 4MA4A 4B71A 4DFDA 1DBQA 2FSVA 3H9BA 3HY3A 4FEAA 4QATA 2M2IA 5AKXA 9ATCA 1Q7TA 1JB9A 4RLSA 2FMFA 1W5SA 2X9LA 3QUSA 1F3LA 3ZCPA 2NOAA 1G5PA 4D9CA 3TB4A 1QKIA 3WGMA 3R6LA 4QU5A 2KQUA 4MUKA 1J0EA 2FETA 2JIOA 2WTUA 1IN7A 2XWBF 3R1IA 1QV9A 2OCKA 4BO8A 4R40A 3TZEA 1PN3A 2ZYDA 4QD3A 3B3FA 4FZJA 3DZHA 4WWHA 2OHGA 2PBZA 2PZLA 2CXHA 2O2ZA 2YW9A 4E6PA 5FCDA 4ZMSA 2A1TR 1U65A 2X19A 3W2HA 4G24A 5EXPA 3F1LA 2VDPB 2F8LA 3EPRA 4F11A 1JKXA 5HRCA 2JK0A 3TR0A 3MWEB 3RROA 1AUPA 2I8CA 4M8SA 5IKEA 4XFKA 1E8NA 3JAKA 2W6CX 2Z0MA 1XK7A 4HGQA 1G38A 2CMGA 3H5WA 3OY2A 4DWJA 1QS0A 3WLLA 5C37A 4RZIA 3A6PC 3QEMA 1CQJB 5A4FS 5LZ5A 1MDBA 1DQYA 3EASA 2RGCA 1KQFA 1SH7A 3RJMA 1GUAA 1CULC 1KJNA 1P7VA 1PG2A 2B92A 2RG1A 3PTLA 4RU1A 4WA8A 5CT5A 1KP3A 1U9JA 5TQ2B 1NJ8A 4MQMA 1C0KA 2VAXA 3ZYCA 4EL0A 5A4AA 4D8UA 2D7JA 1WEHA 2ZCJA 3ZVNA 1ZWLA 4D4KA 4JFAA 1Z9BA 1F9EA 2QUZA 4NE2A 2O2EA 1E3IA 1EZZA 3GGJA 2CZGA 4GX2A 4LWZA 3CN9A 3GRZA 5C7YA 3I8OA 4AWAA 3AI1A 3TOSA 1DUSA 2XGGA 3FY4A 4YRQA 4BLQA 3MJTA 4H7EA 4ER7A 4FMCB 3TPCA 2I6UA 2PJUA 3EBPA 1DDGA 3JS5A 1KU6A 1EUDA 1W1WA 2WP0A 3TRIA 3WK8A 1I3MA 4GDMA 3PXAA 2Q1SA 3K8OE 3QXSA 3I28A 4OYHA 5EZ6B 3T5DA 3WB1A 5L7WA 2K7FA 2ZR7A 4QSHA 3T5PA 4D0LB 1D0SA 2OFXA 2JBWA 1G4UR 4K28A 4UTOA 3SAJA 3VHXB 2YNMA 4JBGA 1ZITA 2O3RA 2P35A 1A5SB 3CNBA 1L5WA 2C4KA 4KE8A 3DMDA 2ZB7A 5DSZA 2PZEA 2QP3A 4Z8XA 4JDUA 5EQJB 2W8ZA 1F8FA 3N8HA 2G07A 3VNBA 4NECA 4C3OB 3GFTA 3D4NA 1U9YA 4KQXA 3FNEA 5J2TB 3DL0A 1VKNA 3N2KA 3RT1A 4D4MA 4D9HA 4RQAA 4HWKA 5DLQC 4TS4A 4P31A 4MIEA 4C05A 3TW0A 2A0UA 2R9VA 1AA9A 5U4QA 2Z5VA 2BC9A 3MINB 2PSJA 2C2ZA 1WXHA 2PR7A 4OK3A 3BXEA 5I7VA 1KHHA 3MJCA 3CVUA 3FM9A 3WLSA 4RTQA 1FOEB 4R0NA 3R41A 4PPQA 1R16A 1QGUB 4DG5A 2XAUA 1SXJC 4TWJA 2OT3B 4HH3C 5SYAA 4OGWA 3AEKA 1GL6A 5WRFA 4J1TA 1N1DA 3L41A 4PX5A 3B52X 5KU7A 4JI0B 3LC2O 1T2VA 4NPAA 2I29A 5IMBA 2ENUA 2Q7OE 1KEPA 1E0AA 2EW1A 5CD1A 2G9RA 1M7GA 3HKBA 2QTWB 3F67A 3L6RA 1ZINA 1JJ7A 2ZJ7A 2UXBB 2BFOA 4TLDA 3C3BA 2DECA 4MKIA 3W5UA 4UFPA 3AW9A 1NXVA 3GDFA 1U8FO 5T6BA 3W05A 4LYAA 1X1EA 3F7MA 3JQQA 2VIIA 4C0BA 4CEHA 3O2SB 3H5TA 4D99A 3VJRA 5A5FA 4W5NA 1S8FA 4I9UA 1HG1A 5TNXA 4OJNA 2VWGA 1GGMA 2MMGA 3ZH9B 3R5KA 4PBRA 3DYIA 4ILEA 5HKOA 3FROA 2GYYA 4EA7A 3T7TA 1P3JA 2QVGA 2PGNA 1C41A 3RYFB 1CRZA 1LW7A 2ACEA 3ZLUA 4EW3A 5CA0B 2OKGA 2QI9F 1ZUHA 2LV8A 1CCWA 3GCDA 5ESXA 2WKQA 5FD8A 1TVKB 3ICWA 5C8YF 5EWLB 4Y2XA 5J9FA 1YRLA 2WPDD 3EVZA 2GLUA 3KD3A 3VR5H 4BFTA 3F78A 3NASA 4R1TA 1ODTC 4YP0A 2VSQA 1GPNA 4A6XA 4OQQA 1T91A 5ED0A 1KRHA 4XE5A 1GSHA 3TFQA 4E31A 2HFJA 2F1OA 2Z08A 4M9XA 3F46A 2VKQA 4O2BA 1DTEA 2AUNA 3C7KA 4HH0A 2JAUA 4BUCA 4F8YA 1NVEA 1LC3A 4ANFA 3PD0A 1FDRA 3EA5A 1LEHA 4ZMRA 4BJ1A 5BVGA 2GSDA 1NFFA 3OFND 2CSXA 3GCWA 3CNHA 3THRA 2YTZA 2WIGA 1B1CA 2E49A 1JNXX 1H2FA 5GJBA 4AULA 1L4BA 3CCBA 3MWFA 4QVGA 4B6SA 2HNKA 5EZSA 4EJ2A 2EKLA 1II9A 2EFDB 5EHQA 4QHSA 4HWSA 4M9UA 1N2EA 2NZYA 1CUSA 1XUOA 3DOIA 1C9NA 5BN5B 2HF9A 4B35A 3K15A 5ARDA 2I6XA 1L4MA 1TUIA 1IFXA 1XTKA 3E3MA 1AZLA 1H2EA 3NBKA 5KNCH 1FFEA 4KR7A 3HO6A 5H4GA 3OT1B 1T5IA 4N40A 4HQKA 4HRVA 2WWWA 1BKSB 1QCYA 2FRDA 1NLMA 1JA9A 1EH5A 2XDYA 1CF2O 2QJFA 3AF2A 3G5LA 3MD9A 3L9XA 3QVTA 4V38A 1K0UA 3PHJA 1A7AA 3U7JA 1QRUA 2ZJBA 4WK2B 3ZXXA 2G67A 3B9PA 3QEJA 5CFLA 1KS2A 5P21A 2Z5GA 4DSNA 5LU8A 1N3YA 4GI1A 1OB2A 2XB4A 3W5BA 3AUKA 1APBA 2XSZD 3H11A 4U2EA 1R0LA 4E21A 1ZRMA 1H2BA 3AFIA 3BF7A 3CZRA 3PYLA 4MKXA 2F3UA 3QE0A 4E2ZA 4X1YB 5A3QA 1CIPA 1CR6A 2OHOA 3CRZA 1TVMA 2WZDA 4DANA 3DPIA 3UWMA 1Y3DE 2WDPA 1O96B 1AQLA 2OV8A 3WLTA 3GQVA 3ZUPA 2UUBB 1KYWA 1WP4A 3DYVA 3JYPA 3QF4B 5D3MA 3LX6A 2A9OA 2IX9A 1OW3B 3TTTA 3U9SA 4CMIB 4YX9A 1G8PA 3UT5A 2O8NA 2MYTA 4JEMA 1E5TA 3HNOA 3WGJA 4F4JA 1RE1A 2GHRA 3PQ6A 5BO5A 3DQPA 3V46A 4CIDA 3GEBA 3KR9A 1N5KA 1TU4A 5JLAA 1FSGA 2G1KA 3MT9A 3QMMA 3R24A 1NW4A 1AGNA 1YKGA 4F71A 1VRCA 4ZCSA 2A5GA 4I8IA 1MB4A 3LT1A 3QI2A 3DE7X 2ZBQA 3QKWA 4JBHA 1KJJA 1JBKA 3PI7A 2AD1A 5ISMA 4IIFA 2XUHA 1XPRA 3R0QA 2N0SA 3TWOA 3VTZA 4M55A 2GYUA 2QRJA 2VK8A 1LX7A 4Q3NA 2G1UA 1YBAA 3EYWA 1J0BA 1E32A 5CDFA 2WJVA 4D80A 4Y1RB 5LQAA 2VF4X 3K16A 4OM8A 3KTAA 2WAXA 1QDLB 5C1OA 3THXB 1U8TA 4OHXA 2Q50A 3CRMA 1ZVJA 2BEUB 2WYWA 3CNNA 3O84A 4JZKA 1S4MA 1UDXA 4QREA 4EHAA 1A2OA 1QHSA 3BQ9A 3VUEA 3CO5A 7ADHA 4AYWA 2AMLA 2P3OA 2J3JA 4EJSA 4JI7B 4IRXA 4HQLA 5KSOA 2N75A 3K5IA 4OY3A 3FVQA 4HSEA 3OE7D 4XVRA 1ZD2P 2IHZA 4ZTUB 1PR4A 1T0BA 3CZPA 3WMEA 1U7WA 2AR7A 4MV9A 1FXWF 4M8IA 4QDUA 3U3XA 2FN3A 4DOMA 1OXKB 4BX3A 1ODIA 2ZSIA 4O63O 2ZTLA 3OLCX 2Y66A 5M5BA 3FR7A 3CH6A 4LFCB 1E0JA 4KR0A 1PR3A 2IH2A 3G82C 3SEFA 5KHOC 5HHTA 2QX4A 1GNRA 2BRUC 4KHZA 4D3FA 1AF4A 1HFKA 5ADUS 2O19A 3PKZA 4OJYA 2QN2A 1AN0A 2PO5A 5BYJA 3RC1A 2PT6A 2WU1A 1WQ4A 2E5LB 5BOVA 1Z0KA 3MTEA 4R1SA 4G65A 2DGDA 4JB8A 4CL8A 1T6NA 3CH7A 3ZR4B 2YZKA 621PA 1FLNA 2XRYA 2O2SA 2O7RA 4BVEA 3JALA 2BHLA 3GLIA 1N5MA 4BVFA 5LYJB 4KV7A 1M5RA 2NUPA 3VYWA 1DC5A 2E82A 2W37A 4KDCA 4RCVA 3PC2A 4Y6LA 3DLBA 4G26A 3NHKA 2J9GA 1N9GA 1CQXA 2QL7A 3DMHA 4FMDF 2CHVA 3N87A 4BLOA 4D45A 5JYBA 3ESRA 1GYPA 3DCJA 3O8QA 1KJQA 1OLXB 2FLWA 2PD4A 4YH1A 5ALKA 3DTVB 5E7IA 1OI3A 1WMAA 2EFJA 3JD1A 4MA5A 1YZHA 1E2HA 4ZT6A 1XR3A 4EITA 5C5CA 3R0IA 4X8LA 4KQCA 1YI0A 3G2MA 3EVAA 3HE3A 1ODSA 1UBHS 4PFJA 4U1RA 3AV3A 2A0YA 4A92A 1FVOA 1MN6A 4G3XA 3KQQA 1YACA 5F2OA 3T99A 4ZI5A 5IJWA 2IS4A 1P4RA 1C2YA 4YPOA 4G1EB 4KH0A 1DJPA 1GO2A 1V5FA 4OQNA 4BKQA 4C4RA 1NVXQ 4DMCA 1MKYA 3T61A 3PICA 3RHTA 4DLLA 4HL6A 5EWMA 2EFGA 2X4LA 2C0PA 2QN7A 1WDWB 3IDFA 4FXPA 3UBTA 2PX3A 2REQA 4GICA 3C85A 1M75A 2OCAA 4U2KA 1L3IA 2C59A 2DT5A 3L1HA 3E81A 2WIKA 3L4BC 3JQFC 3N2GA 4QYSA 1LS6A 4MIOA 4IDOA 5HK9A 2RHWA 2Q4DA 2XA1A 2VHZA 1D6JA 5CT6A 1SXJE 3RC9A 4CLOA 3MTDA 1YA8A 1M2OA 1T15A 2ID8A 5A4JA 5IAAA 2CUKA 1RHRA 3Q88A 3QLVC 4X54A 3IOEA 3SSNA 4KE9A 1AKVA 1KYVA 3PHHA 1MAUA 3KWMA 3SKVA 4TM8A 7GPBA 2JBAA 1QJCA 2J5KA 2X1MA 4JU9A 1BXZA 1GRCA 1L4UA 1IXZA 2QTGA 1JHPA 1TKAA 2GAOA 5EZ5A 3N6VA 1F12A 1KFJB 2W9XA 3FCOA 1NX6A 3RRMA 2D8AA 2OHJA 1AKRA 3FWYA 3STTA 1KAGA 2BFBB 1Q77A 2O7NA 5LJLA 4MPTA 2JHAA 1NJ1A 3FUVA 4Q5IA 3TLGB 1CG6A 4IG9A 4CDRA 4EKNB 4URUR 4ZHQF 2GLXA 3Q2OA 1NFRA 4QBKA 4XOUA 3ZZ0A 3HJRA 4CKWA 2HC9A 3LHSA 2C8VA 4RK5A 3OX4A 4X1KA 2Y0CA 1W2WB 4DMMA 3ANNA 1I3LA 2EKPA 1NR1A 4GLOA 4EHDA 5ED4A 3UCEA 2GK3A 3UJ7A 3IO3A 2Q0XA 2CB9A 4Y8VA 4YAJA 2GXAA 3IULA 5IFLA 3ZWDA 5AI8A 2H92A 2I76A 2DBQA 1LA2A 2X4DA 4JBYA 4Y6OA 5U9CA 4U8GA 4L2IB 3SQNA 4BFWA 3DLHA 4KIJA 3VPHA 1MJGA 1JIQA 4PZDA 1ESCA 2VC2B 3TZCA 1UOEA 1CQWA 1GGEA 3QPWA 4RFSA 4IV0A 1MO5A 2OECA 2CUNA 2P9EA 4RH1A 2UYCA 1EA7A 4AG5A 3BKXA 4BO5A 4QTZA 2HH9A 1PNRA 4YCMA 1BSVA 2XDWA 3VC2A 2ZRHA 4ARBA 3GUHA 3HDGA 4Y2QA 4I14A 4TUYF 3D2AA 2GN2A 3FTDA 3TLKA 1AG9A 1JVBA 3CEMA 5K3CA 4ZOCA 5CCEA 3PR3A 3NOOA 2WF8A 3LF1A 4J91A 1I9GA 1TPYA 4OHFA 3ZDXB 4AJLA 2GUWA 1Z15A 4W8GA 4ZJZA 3D1LA 1AGXA 5KVQA 4KAJA 2HHAA 2YUIA 4DV6B 2B25A 3IR6A 1ZD1A 2BGMA 1Y4AE 1I4WA 4LX8A 5ALUA 3WGKA 5KWJA 3LLUA 1BU5A 1G9TA 3EEQA 4KXUA 1DPGA 1RJFA 4RLQA 3SDSA 4CG1A 4WL0A 6PFKA 4DDMA 5M7EA 3C70A 1LF0A 1EUYA 3ENZA 4LOKA 3ERCA 8MHTA 2V6GA 1Z5ZA 1H6DA 3C3KA 3ZV3A 2AE2A 1I51A 3FJ1A 1A8HA 4UAVA 2ZS9A 4GU5A 2Y1FA 2QY9A 5D00A 5IBPA 2ZRDA 4IIUA 1YMVA 1LKZA 4RVCA 5A9RA 4I0WB 4GC9A 3P9IA 3UEOA 2W2PA 3LUBA 3BWXA 2BPOA 3U2QA 1O9HA 4I5IA 4M83A 3VAAA 1PZMA 2A5JA 4D9FA 1RBQA 1TYCA 3D8SA 1QFSA 3X1MA 2BFCB 4AK9A 3U4IA 2E4XA 4NBLA 1K6IA 2JAOA 3BM5A 4EY4A 3DDOA 1ITZA 5LB4A 3NU1A 2QMEA 3RK1A 4JSYA 1A7KA 1EVIA 1GPWB 1KSFX 1NUAA 1X7YB 2CLMB 2WHEA 1MQ8B 1GPDG 2YXPX 3BDIA 3DFIA 4IFEA 2WTMA 4IVRA 5FWXA 3RTDA 3MJRA 3O4GA 3R7BA 1UFKA 1JRLA 4ESHA 5C1IA 5G0WA 3KLOA 4LDPA 3S29A 1QU2A 5DHAA 4MR9A 2P2YA 3SYRA 4LG1A 1UP4A 5DK6A 4K86A 1QPGA 1SHJA 3UKDA 1LSSA 4DXHA 1HY3A 3IAM6 4ZAVA 3WRYC 2RHDA 4JIMA 5BMVA 5BW5A 3K92A 5FNVB 1I3OA 3B6IA 3IBSA 1KAMA 5L7YA 4JI2B 1VCOA 2RGRA 2WHQA 2E48A 2NQ2C 4KU4A 5U1PA 5CBPB 4NQRA 5JZBA 3UHJA 1H66A 4AJKA 3I52A 3RS0A 2H2WA 1VSBA 4NBWA 2QUHA 2YWCA 2ZIGA 3ZUGA 1YVPA 1KI6B 4HAIA 4QUIA 3O8RA 2X86A 2WT4A 1SKAA 4RXUA 2FSVC 3U5TA 4BY9E 2C4UA 5JXIA 4X44A 3DMFA 1XFDA 2XB9A 3K8ZA 3DDHA 5EP1A 4IP0A 4YT2A 4EG5A 4F60A 2GJ8A 1B23P 2A9KA 2DSNA 1JU3A 1XZMA 4RHEA 1Y6QA 4HRYA 5JSHA 4JI4B 1GQSA 1FDWA 3LT5A 3OM8A 3MCAA 1ZN7A 3SEQA 4NR0A 3CKYA 5GTDA 2YIMA 5CBKA 4CEIB 1LNQA 4FHZA 3LC7O 5HZHA 2W4MA 4FKZA 5H83A 4JT8A 2PX2A 4Y3UA 4TL7A 1IOVA 1NXXA 4TN1A 4U7GA 5EJ2A 5BY2A 2OB1A 4KWHA 2YNMD 3KJZA 3KX2A 4TWIA 5JEDA 3FRJA 3O1JC 1W94A 3GFFA 4NWIA 2ZWPA 3QKRA 4FYHA 4RA9B 1L5QA 4YASA 3ZE2B 3OQIA 4AJOA 5A3JA 1QAQA 4CETA 4F6LA 1RWXA 3K6SA 1OE0A 2GZRA 2IZ1A 2X7JA 5EJIA 3ST7A 1EGHA 2M6SA 1VCHA 4XRGA 2DUMA 1RLJA 1XLUA 5AKLA 4EYQA 2WOOA 4EI7A 4DQLA 2C7OA 3BORA 3W7AA 3JQ9A 1CZLA 3T54A 3JARA 4KFUA 1VMDA 3JQAB 4LW8A 1H8EA 4MNTA 1R15A 4MVJE 4DN6A 3SS7X 3AEXA 2V7PA 3KPUA 1XE3A 3VPCA 4HV4A 2ZVDA 3S6JA 2Q9UA 2QX6A 3EIEA 1GPH1 1MO2A 2BGKA 2Q3CA 4J0CA 2MSWA 2GSWA 3E8SA 4ARVA 1S3FA 3C3EA 3UOGA 4QGSA 1CUYA 1NY5A 1OYVA 3CVWA 3CX8A 5HK8A 3TTSA 2DQ4A 3AM3A 2NZ8A 2L69A 4K0KB 4ETNA 3WICA 5LIRA 2VJDA 2AJ8A 1SVIA 1VRWA 2D1SA 4IILA 1Y9ZA 3BC1A 3BCSA 4LHVA 4NU8X 2CUZA 3WO0A 4CM7A 3KHTA 3GMSA 1X8LA 3ORFA 2C7BA 4L5AA 1ZY2A 1GQYA 1KZ6A 4E33A 2VRCA 1HQKA 1NQXA 4OYRA 3R8CA 1LDGA 1NVVR 1QM5A 2JHPA 3HXLA 3D4LA 3RR2A 3VKUA 3MT0A 5DN6D 1UP6A 1VXOA 4QULA 4DA7A 1QZ3A 3CYFA 2YNMC 4A5OA 3F5SA 1C1DA 1P91A 1WPQA 2IF2A 3H8VA 1NTOA 3PNBA 1P5RA 4GF5A 3K1AA 2DTXA 4MQ5A 1O4VA 5GWXA 4D81A 4CM8A 5I7OA 2GD6A 1E62A 3UFXB 5F9HA 2NNLD 2EYUA 1L4YA 2E1PA 5H8WA 2YBDA 1E3QA 3HABA 4TSFA 2I4IA 2PEZA 2IVZA 1H1LA 2P0AA 4P5PA 4WACA 4B3BA 4ZN6A 1LSJA 3W78A 2X8WA 4A26A 1GIAA 1JUDA 3HUEA 4S24A 3V1MA 1WPXA 1W1UA 2Y1EA 4NEGA 3LKBA 3T1NA 5C8YA 3UVEA 4RZUA 4O8CA 4UU8A 4XCXA 3HM2A 1SU7A 1ESNA 3ICCA 3QKUA 2IOFK 3CT4A 4O4HA 3GC6A 4D8VA 2FZKA 3O8BA 1RWWA 4DIBA 3NXSA 2GPAA 1UPXA 1DX4A 1Z88A 1EVKA 4N1AA 4J1TC 4F7WA 1T13A 5CCDA 1C9KA 1C3XA 2OO5C 3HS3A 2PGDA 4CLXA 2DX7A 2XZPA 1YA4A 4PAMA 2EF0A 2FK7A 2IXGA 3FHOA 2JJ2D 4WZ6A 4BL5A 1L7DA 3PIIA 1FX1A 2IV2X 3ZDAA 4ZIRA 1XLVA 1BS9A 1KI8A 1KP2A 3T3IA 5C8VA 1EI9A 1L7EA 3FUUA 4CCSA 5FO1A 2ZT8A 1J2EA 3GJYA 4W1SA 5E9AA 4C2UA 2ZRGA 4ZT2A 4AMBA 4ND1A 5JYCA 3FX2A 3K09A 3NTLA 4C07A 1HLPA 1JX6A 2W58A 1DXQA 5C8DA 3C6ZA 3VU9A 1RZVA 4A82A 4QT4A 3B1WA 5EXTA 2G9NA 1E3MA 5JD4A 2NU8A 4A6EA 1MVLA 4K6FA 2YWFA 4KIFA 5LL6P 2CJPA 4QICA 4JMPA 3U3ZA 4XFDA 1MVNA 2VDUE 3I4CA 2GEKA 1G8FA 1XTJA 3JPYA 4WBNA 4MP3A 2AEEA 3DVSX 3RIMA 2PZKA 4K6KA 4D92A 2GB4A 4EG6A 4L51A 1CEQA 1WAMA 1XN1A 2X2FA 2YHAA 4NDAA 4BU1A 3GH3A 2O8FA 4IQ8A 1PZFA 5LWHA 1PR1A 1QVRA 3Q8MA 1YR2A 4C0JA 2GO1A 2IOHA 4LBYA 3MLBA 4OP1A 5IUNC 4L3OA 1B26A 4PLCA 4FD2A 4HMOA 2E18A 4PBSA 1KHTA 3TOZA 4BIMA 1OIXA 4WVFA 3L0YA 4YXWD 2GCGA 2ZTMA 4TYNA 4XTCS 4AKHA 1HUQA 3H87A 4Z8YA 1HE3A 4NYJR 5H80A 3CJRA 2VJAA 3T0FA 2PM8A 3DOFA 2WIDA 4K5QA 3DEYX 4D3ZA 3QVXA 4Q4HA 3MQ2A 1IDN1 4Q9DA 4D4JA 1SC9A 4PZLA 3DBHA 4ETWA 1UKCA 3KOXA 1DOHA 2IFTA 3LY9A 1Z45A 4QRIA 2IIVA 3Q15C 4JOCA 3CUYA 3OTGA 4YJFA 3VO1A 3WGYA 5CFNA 2Q45A 2W6QA 4KLNA 4U2CA 3OZWA 1E1RD 1Z5VA 5AHKA 3S2FA 5A05A 3UA3A 4CMCA 1K2WA 1XXHE 3H5OA 1H2RS 3MJFA 2ZRBA 5LKAA 2A88A 3UUWA 5GPBA 1ILWA 5CG2A 2QHXA 3CVVA 1SBHA 4GGOA 4XSHA 1MAWA 3SVLA 1ZUD1 1V39A 3QMVA 3U37A 1Y1SA 4REQA 4E6EA 2FRDC 2EWWA 1PT7A 1U7ZA 4XTRA 3RTAA 4M98A 4ARZB 4JCCA 2WRZA 2ZJ0A 1JR3E 3KFXA 4HB0A 1NNSA 1L5NA 4DEVA 1DIOB 1N9ZA 5M04A 1RTKA 3F6YA 3FTEA 5F51A 1HE4A 3A2MA 3N3AC 3MA0A 1WIWA 3TW8B 1DL5A 2WWVD 1UDWA 3ZLTA 4TKUA 4W5WA 5DISB 3HDHA 2GBGA 4URYR 3ZGLA 4A23A 5BNWA 1EKXA 2G3YA 3AERA 3I6YA 5AI5A 4W5RA 1FQWA 3P5SA 3NVDA 4DCSA 3CZAA 3DL4A 4NL4H 3R7NA 1AA6A 4B76A 5K8TA 1XAJA 4BMZA 1U28A 4LZJA 3SMVA 1QE0A 2Q46A 2QK4A 1IHYA 2HKIA 2PMKA 4FLMA 4GAEA 4ZQBA 1HEYA 4R7ZA 5FKJA 4DQDA 5BOSA 2PUFA 1BHQ1 4NKRA 5KCMA 4D4GA 2XNDD 3K2BA 4TT3A 3N76A 1XDWA 3GLHA 2RHOA 2VP4A 2JHFA 4XGQA 3UK6A 3VZDA 1JXMA 3ZU4A 4CM5A 1XXHB 3VSBA 3JQGA 2BV3A 4LYYA 2ISCA 3MMXA 4F45A 3OAAA 2AHOA 3U1VA 2Q41A 1YZFA 2A2ZA 1Z0UA 2AVNA 3E9NA 3IAS1 3L8EA 3Q2KA 4HK4A 4LDNA 4XZ3A 3FPSA 3WWDA 1SG0A 4D3YA 4DPKA 1IWOA 3DZGA 1D2AA 2GZDA 5DGHA 3LWNA 3UAVA 4MICA 5DNDA 4PSCA 3TCKA 2ROQA 5KOJA 3WHLA 1HQDA 2NU7A 2QX7A 1A9ZA 3IVXA 4GNRA 5JO9A 1IVYA 2QM7A 2RKOA 1YJQA 4OQPA 4JD5A 3LUPA 4FPXA 4IKEA 2JFZA 1MABB 3P45A 3VFDA 5JVDB 3D1VA 3DCIA 2ZRMA 4RH3A 3COZA 4ZT5A 1YQQA 3COPA 3DZKA 5KVCA 2UYOA 3TMAA 2YXNA 2IZ6A 4XJSA 1WXDA 4RZ3A 2J45A 5I9TA 3A9CA 5CLLA 2WYIA 4BZZA 4LWPA 4U5XA 5D6OA 3VKVA 4EJSC 1YBMA 3AKCA 4OHOA 4OHMA 4GMXA 4R4JA 1Y7LA 1Y9EA 5ER6A 2R1ZA 6REQA 2IYTA 3KZOA 3ZDYB 2QAIA 2P11A 4FGWA 5K6AA 5A02A 2CXRA 3A10A 2L19A 3BJMA 1I14A 1V3TA 1B14A 2O50A 5A5EA 3KHUA 3NAZA 4ZVTA 3F4LA 4RPGA 3LIPA 4O0MA 2HYDA 4XH9B 4IMJB 5BWCA 4WERA 1D5WA 2J9ZB 4OIMA 3KU4A 3RU9A 3EX7C 2FPRA 1RTTA 1Z29A 2ABWA 5DHFA 4BX9A 5IJZA 2VT2A 3TLCA 2AMFA 3U1BA 3CQ9A 1AHNA 2I9KA 1ZGGA 2WD7A 4IEFB 4G84A 1YQGA 1QG4A 1ECLA 4WEOA 5AVUA 2EARA 3KQKA 3LY7A 4DSOA 4IWXA 1JHOA 2OD7A 3FUWA 4QARA 1DAPA 3C6KA 4YVFA 1ECGA 3ZCUA 2OCGA 4PLTA 4I1VA 4EPXA 1QIIA 2C1EA 3AQ4A 3A3PA 4HMQA 2OMKA 5KX5B 4LJYA 3FTQA 4YR9A 5IX8A 1U4SA 5FPSA 1RHMA 3OFJA 4GT1A 4RVSA 4X7PA 4EG1A 5CFOA 3W06A 4R2WA 2C31A 3GOHA 3LBNA 4MIKA 3FGPA 1CIVA 4JGIA 2JGKA 2VH2A 2YBEA 2FG6C 2BBTA 2VDLB 4BMXA 5JS7A 1T8WA 1PK8A 1UWKA 4F4DA 2B0JA 2XNSA 3C6YA 5E0KB 3W79A 5F12A 1L5FA 3FZYA 4QC2A 5BPHA 4V0NA 2BI4A 2AQHA 2VP0A 1B73A 2QYSA 2ZRPA 1IRIA 5KDOA 1RKQA 1T2DA 4Y2PA 4HCJA 4DJJA 4NOJA 1F2TA 1J8FA 4G01B 3GHYA 3JAKB 4NENA 4UVEA 5E7MA 3WHPA 2X0RA 5FUYA 4O8ZA 3NANA 1R88A 2M32A 2XTAA 1QS0B 3CX7A 1QHHA 1YB5A 2GYWA 3KAKA 4YQZA 2ZIZA 1P4GA 4YFVA 3RSQA 3UAZA 3QEMB 3WA6A 1LW6E 1MJGM 1BROA 3IOCA 2Y1LA 3OE5A 1HR0B 2Q7XA 3T3PB 1UBNA 2VSOA 4HVAA 3NRJA 5B5SA 1IAVA 4KNVA 4NFSA 3E61A 521PA 3RBAA 3OX1A 4MB2A 4NOKA 1PZNA 1R8QA 3C15C 1CKEA 3VU3A 4KZKA 1T8TA 1M1XB 2XMPA 2K5UA 3ZK9A 3LT0A 4MQ4A 5I01A 2PUCA 1ULSA 3F2IA 3ZHXA 1D9XA 2NT3A 4TS9A 4BAGA 1RMYA 4DLBA 3BK7A 1YR8A 3GR6A 1JTFA 3R7LA 3TOCA 3H5AA 3WIDA 1JG3A 1C50A 2B9EA 1XTBA 4EHLA 4H31A 4JB0A 2DF8A 4LKOA 2E4UA 4QNMA 4L3WA 5THQA 2GK7A 5CW1A 3FFTA 1SOWA 1NW6A 1TZJA 1VLLA 5HS4A 4XOIA 5MF6A 3GD7A 4ZK2A 2YHUA 3MGCA 1NONA 2O3SA 3AUJB 4V03A 4WBXC 1NFQA 3RQIA 1C9JA 3H2JA 4MUGA 4DUZB 3HHPA 2AD5A 1AKWA 3F9RA 3MAAC 1AQUA 3BFXA 3VA7A 3NC1C 1K6MA 3WWPA 4BBZA 3HBMA 3PG5A 3BFPA 1ZNZA 1CZHA 4MYSA 4OFXA 4ZCRA 1TYBE 3B6EA 3D8HA 4TUYA 5E3HA 9ABPA 3AUTA 3QXCA 4L8YA 5A9TA 5JMWA 3T41A 2ZRQA 3CZ9A 1E94E 3N2KB 3LBFA 2ONKA 2Z8YA 4GWGA 5I4KA 1BX0A 1VL0A 2CVPA 2FKAA 1JYFA 1PGPA 1G4AE 2RH4A 1DHTA 3BFVA 3G8AA 2YIVX 3IKVA 3QP9A 4G4IA 4XSVA 5CLIA 3IJEB 4NXMB 2ZVPX 4R9VA 4OQEA 5DX8A 1ZHFA 3QBEA 2AN3A 4AZ3A 3O3NB 4P3KA 3QOXA 2VCHA 4ZI3A 2RGYA 2HA0A 4ZYLA 5TGZA 1KO1A 4ZYVA 1A82A 2H1FA 4D56A 1RJDA 3T15A 4PHCA 3U61B 3CSUA 5KSWB 5ADVA 3AEKB 3NFYA 4IX9A 1ZNWA 1EDBA 3CE9A 1GRNA 3NNNA 4C4ZA 2GFIA 1G42A 5HOEA 2FPPA 3DE6X 4I1SA 5KCZA 2W2KA 4BKPA 4BV2A 3HKBB 4PHGA 3RUHA 4N6NA 2R85A 3G3EA 5GQSA 1E6LA 1NVWQ 1F7VA 1DC6A 4M1QA 1GTVA 1KI1A 1Z06A 4YRZA 4B1FA 4Q0MA 3WNBA 4KXXA 5IRCD 1QRTA 3RV4A 1A95A 2W7TA 1JG7A 3RC8A 3JRNA 4HLNA 3JAWA 1S9HA 1A9YA 1GLGA 4KP7A 4QOGA 2WMDA 1DE0A 1K7YA 3GNQA 1UK8A 3WQBA 1YBVA 4MUJA 4BEJA 1WG8A 4ND7A 4XARA 4LTMA 3AR8A 1CTQA 1YCHA 2ES4A 3Q40A 4FGKA 4YCBA 5DNUA 1K89A 1JIKA 4KE7A 1WD5A 3ZD9A 3WQRA 1J9EA 3OJWA 1R10A 4LXTA 2NVWA 2YC4C 4R1LA 2QV7A 4XYBA 4HVLA 5K3EA 2VP2A 2XRFA 5J47A 4O2BB 3C3PA 4A73A 4DV2B 5F98A 2DTDA 1JQAA 1HV8A 2JD0A 3GBPA 3KTDA 2QTZA 4Z0HO 3AF6A 1OROA 3Q3VA 4JLPA 5DCUA 4ENWA 2ZU0C 2VPIA 4IIDA 5BVGB 1HQYE 5KJEA 4OF4A 5E38A 4AKSA 3AR9A 5BSMA 3RYCA 3B6JA 2EEZA 4DPLA 1CQIA 1ZVKA 3RRFA 1XNJA 4EEXA 2ILTA 3T3NA 3MM4A 2DQYA 3D43A 4QGAA 4EYGA 2HT1A 1M7HA 4YDQA 3BXXA 2NO5A 2GTIA 4C14A 2A9VA 1EX9A 1XT6A 2I7DA 5LWQA 1FL9A 1I7LA 1WUTA 3HR7A 4PCVA 3SU8A 2HAEA 9LDTA 4NFHA 2AI3A 5KKCA 1M6EX 3ZVMA 1JEYA 1BDJA 1ZXLA 3ADOA 3DEKA 1E96A 2CF5A 1ZSNA 3ET4A 4FSXA 3OEHD 4KI7A 3T3EA 1SC1A 4WW0A 2ZSKA 1K9SA 2WIAA 4ZZ1A 2YZNA 4LNUA 5GM2A 5B4UA 3WGQA 3BSFA 3NT2A 4JT4A 3VV2A 2PUGA 4GMHA 2AA3A 1KBOA 3U7RA 1MX1A 4R8KA 4BNJA 5CDFE 2BKEA 4IQFA 4WADA 3BICA 2EG9A 3L79A 3GQBA 4UHDA 3FOAA 3NEJA 3T7RA 4MINA 5BW6B 2N42A 5K0FA 1L1EA 1R50A 2Q29A 3H11B 1OUMA 4F91B 2W6IA 1H8ED 3QJGA 3AJRA 3R9XB 2WIFA 3HL0A 1NUPA 1UKYA 3N8KA 4F4HA 3A2LA 3LVRE 8LDHA 3O1HB 4MUYA 3KE8A 2F4NA 1R0BA 4NE9A 4Q9JA 1UZUA 3ANTA 3RUFA 1GLNA 3IHWA 4BQIA 3ELWA 4PGMA 1C7EA 4RPHA 1T2AA 2ARKA 2C77A 3NYWA 4B81A 1NC1A 1SQ0A 3B9QA 4DUGD 4IEEA 3FCAA 2YQZA 4M7WA 3D8UA 5D3MB 1Z3IX 3RKRA 4Q3AA 5ALGA 5IARA 3RIXA 4LC9A 1FNCA 1RFLA 3STXA 4ZI7F 1F14A 3UT5B 4C4TA 3MRTA 4FFLA 3RC3A 1SQ5A 4YN3A 1L5SA 2DBZA 2QD3A 5FJJA 3UC9A 1BFDA 1KJ8A 1QTIA 1HBJA 2DKOA 2WSSD 4NBUA 3S5JA 2VRCD 3CUTA 3V5NA 1NDQA 4HLQB 4DA4A 1J56A 1QU3A 2IKSA 4LWOA 4PAGA 1D8AA 1GTL1 4EHFA 1RS0A 2ZXEA 4CMJA 1ICEA 3MRXA 4Y2HA 4D4IA 2WP8J 1TQ4A 3JR7A 1OXUA 2B9VA 2NLOA 3JZMA 2IQIA 3K53A 4I1OA 2ZPTX 1JMVA 4P98A 1LVGA 4XWGA 2VBIA 2VLBA 2VT7A 1VPEA 5E95A 2C1XA 3GG2A 4JGGA 2SCUB 1G3UA 2C3PA 5KC9A 2QYHA 2TMDA 4B5LA 3P4YA 1IEQA 3S1AB 1PG0A 4Z4EA 5EINA 1OA0A 2O06A 3ZDRA 1M2FA 3SSAA 1SCBA 1OH6A 3JQ9C 4B40A 1Z38A 5H16A 3WQQA 2E55A 3GFPA 2N1MA 2WUFA 3B70A 2DWQA 2A5LA 3DJFA 3IDQA 3O74A 3GLIE 1JAIA 1A9RA 4WBSA 2PIDA 1H0KA 3RDPA 3I32A 2IYVA 3MTJA 3I39X 3V1TC 4EJSB 8AT1A 3RD5A 2XGOA 2Q7DA 3NZEA 1W0KA 1JHVA 1SUEA 4ENRA 4MK4A 4ETMA 3FYSA 1U0HC 3OD1A 2WLTA 4UU7A 3ZTTA 1Q50A 5EMHA 4UQLA 1ZC4A 1HFJA 3E4DA 3E5NA 1U3VA 2G09A 3ZG6A 5HKKD 2HQ1A 3GP5A 1V8PA 3UAWA 3D2BA 3LLCA 3OQJA 4O33A 4RY9A 4KXNA 5E9JA 3UUGA 3UWKA 5AW5A 2ACVA 2AC4A 2HCFA 2WBLC 2AE1A 3K0KA 4JI8B 1CXZA 5J1TB 1Q19A 1Y3FE 1OGIA 2OFWA 3JCZA 2V9CA 4YBRA 3LX5A 4DXDA 3HEBA 1U7UA 1PLLA 3EAGA 3RSCA 1TCCA 4NCHA 2DPMA 3VTFA 1QUFA 2EKBA 4ZEVA 2VQ6A 3HCWA 3R3YA 3DDWA 2QPTA 4PSVA 1NJGA 1X13A 2YMQA 3D7LA 1YH3A 5AK6A 3CXUA 4YY3B 4CWAA 1AO0A 4HEHA 3WNZA 3FZEA 5CX1A 3OF2A 5BQXA 4CLRA 2QLBA 4RWZA 4D0GA 4MQLA 2O14A 4CNBA 3JALB 2FSUA 3OZTA 5JTTA 3DZJA 3F2VA 3H1FA 2IYRA 1FQKA 4IOKA 1X9GA 1QIJA 2HPHA 3NETA 2OV2A 3KFVA 1N9GB 3MMNA 4M8KA 5HJ2A 2CMKA 4RAQA 3WYCA 1USUA 2JJ1D 3O8QB 2UAGA 2C82A 3B7GA 4MJLA 4Q1AA 2Q1TA 1NWCA 5JZ9A 4BAZA 1WUHS 5K99A 3T95A 3BSWA 3TSZA 3GBSA 3WNVA 4BLWA 3WDSA 3VAYA 2CLDX 2Q1UA 3OU7A 2DXIA 1JILA 3PR1A 2Z95A 3IMEA 4XX1A 3UHAA 3TINA 4TLAA 2LDXA 3OBIA 3L8CA 1CS4C 1HE8B 1K8XB 3FH0A 4UTXA 4DUPA 5F23A 4E13A 1N2HA 1BEZA 2HLHA 2IYAA 4K2HA 3TAXA 3HA2A 2YMPA 2ZOSA 3N0WA 4M22A 4M9RA 3IHLA 2WJPA 1VL2A 2Q9AA 1IJFA 3ORYA 5EWMB 4F5YA 3K09C 1X7HA 1KI9A 3JD4A 4MV7A 3J80A 1RCUA 2ENWA 3DNMA 5FA5A 1LBQA 2PKCA 3REQA 3ZXIA 2REQB 1AHPA 2LPMA 2ZTSA 1WS6A 4W9RA 2QTCA 3PWZA 1LPPA 5HFJA 4K6OA 1KC1A 3QTLA 3TJZA 2CNNA 3N2GB 1HE5A 3U4AA 1GZ6A 5JAOA 2ZIFA 2V7XA 4Q6WA 2AMJA 5F35A 2FMUA 2W2LA 2XT9A 4CLOB 4XWWA 3I61A 1M2OB 1NF9A 3T5TA 1UKEA 3LT4A 1K6JA 1YJ5A 4PX3A 2IEGA 3U16A 3DBOB 4FMPA 1YZ3A 5JRZA 2EX1A 5ES4B 3K5WA 3QOWA 1DX6A 4B09A 2AHRA 4MVCA 4YDHB 2OYSA 3FPKA 2JBAB 1ZWKA 2XIQA 4TMFA 3ZHCA 4CCYA 2VPYA 3MBIA 3AUYA 2Q28A 3R09A 3KJIA 4ZVLA 1N1EA 4DAEA 3EZLA 3HBAA 3QYFA 4WOKA 5KYVA 2E3JA 3KXIA 4BNVA 2G9UA 4BFXA 1Y9JA 2XI4A 5JQGF 2P69A 5CVTA 4JR1A 3QG1A 3NPAA 3NHRA 1JWAB 3EARA 3BIOA 3OI7A 1D7AA 4UUAA 2FRVA 4PYJA 4D9BA 2WZQA 1PK9A 4KBYA 3ITNA 2J85A 4CKWB 4X1KB 2LKCA 1L5KA 3CLTC 3ZS8A 1Y82A 5F3DA 1QRRA 2AOXA 4ISBA 2AXQA 3TRFA 3L6UA 4YR7A 1OU4A 2I2AA 2Q49A 1LTQA 2VBGA 3HKDA 5IU6A 4RIHA 1M33A 1V7CA 1JEJA 2ADMA 2CL6X 4IGAA 2TS1A 3PHGA 3OT5A 1YS1X 4L6IA 2CV2A 3H1TA 5TPZA 5KINB 3NRCA 4UVGA 2UYGA 1RC1A 3HP7A 3GRKA 3U56A 2FSGA 1YU9A 4RFSB 1KVUA 2CWDA 4PYOA 4X20A 1L5OA 2FEOA 4RF5A 4B7CA 1TUBA 2PHZA 3AFHA 2HHLA 3UAXA 2QZ9A 1R9NA 1MRNA 3DR5A 2WR8A 3LCCA 3AIKA 4S1OA 3JYOA 5DHSA 3FKJA 2XJ9A 3H3JA 3BCHA 4QRHA 1GCIA 3V6LA 2Y77A 1ZM3A 2HSDA 3KHKA 3I4FA 2G5TA 2F67A 1P2GA 3W6PA 3AYZB 2WV7A 5KNLA 3NGLA 1DLIA 1T3SA 1U28C 1WKCA 3LRPA 3RB8A 3O7WA 2HZ7A 1KXJA 4I7EA 4DRZA 5I7WA 1M8GA 3JTMA 3KJXA 4IW3B 4LI3X 3KETA 3M6WA 1J22A 3Q41A 2HWXA 4XM2A 2ZYIA 4ZO9A 1D04A 4JASB 5C32A 1JEEA 1X1CA 2J33A 2QRMA 4N0DA 3CWCA 3FFWA 4IWNA 2GN4A 2Z4RA 1EFPA 4EAAA 3UPTA 2IE8A 3KEGA 1P7WA 2BKAA 1CZUA 2Z09A 4BNKA 5KU1A 5HIAA 2I6QA 2LP4Y 2QT9A 4LDZA 821PA 3EIFA 5J4KA 3O38A 2B4KA 3PPWA 1OZAA 2ZI7A 3O90A 4YRJA 1F1JA 5IN4A 3SZGA 2X5XA 1HE2A 2X8JA 3AR7A 4IDNA 2Q4OA 2XQJA 1UBOS 1VL5A 2IHKA 2PWBA 1XCGB 1Q95A 1LPBB 1KYTA 1QJ4A 2JIPA 2PS9A 3COWA 3P94A 1YDMA 4J07A 3N7UA 5C4GB 3ZBPA 2PUHA 2RK3A 4NEQA 4Y67A 3SIWA 1HDCA 5FDFA 2JEZA 1WJGA 1XQYA 3TD9A 2H00A 2R5NA 3ESZA 1G3QA 4ND8A 4QPNA 3ZY2A 4OHZA 4EFDA 4WXPA 5FWXB 1JLMA 4XCVA 3PNPA 1CFZA 1E3TA 4HRAA 4IUDS 1B6TA 4FFNA 2VJYA 2D3TA 1PZHA 2OR3A 4WLNA 4DJEC 5K6AC 1D6SA 2B1IA 2EU8A 1NDUA 3ZZNA 1MOZA 1DJNA 1ZJ4A 1F8GA 2J46A 3CH4B 3DE5X 4BWFB 3UT6A 1GAXA 4MR9B 2AGVA 5JT1A 1NR7A 2IC5A 2XTMA 4IINA 3L40A 3FLBA 2DZDA 3E7PA 1U31A 3DEHA 3NP7A 4OQZA 4QQ8A 5EIEA 4GL2A 2GERA 1ABBA 3KB8A 3ZKAA 5DNVA 5BMVB 4IJVA 4TYYA 4WN3A 2BHSA 2FPGA 2WYUA 3G8CA 2OD2A 5IF9A 2BYTA 2F8SA 3PFBA 1LCIA 1ZVMA 2JGEA 5INTA 1GKLA 1NKTA 5E9WA 4OLFA 2BGWA 4J6EA 1KJIA 1ZEMA 3OQ6A 5AJVB 3COJA 1TJ4A 4EGFA 5EE5B 1PYOA 5ALMA 4PTLA 4BRSA 2XY4A 3SQXA 1O6BA 2YMLA 1XVAA 5JWOA 4HAXA 3U3KA 4Q16A 1QONA 4KUHA 3AJAA 4B7UA 2I65A 1H2ZA 4TKVA 1KDRA 7MHTA 2GHTA 3ZU5A 1UANA 1PFYA 3IUEA 1T1JA 1V3UA 4WK4B 3TBKA 4C7MA 4R8VA 2ECFA 2ECQA 2WVJA 2V8OA 4PRZA 4ROSA 4N82A 4ZGBA 3OG9A 3RBZA 2Z8YM 2HLPA 2P1RA 3L1IA 3NRBA 4PRYA 5ARBA 4BVJA 2D7DA 3L4KA 4EO7A 1AUXA 1RWOA 1VIMA 2GBIA 3WZ2A 3FOFC 5K3BA 2WA1A 1V41E 1GAWA 3JZDA 3NDPA 1AXRA 1ZD9A 3B5EA 4YV1A 4OGKA 4PZ0A 1PR0A 3GNSA 4PICA 3OTHA 4YLEA 2PA3A 5L51A 2GJKA 3OQIB 4BECA 1TD1A 5HVNA 3DTNA 1TTPB 3SSOA 2FPWA 1M7BA 3LBHA 4W7HA 1XEWY 1BE0A 1ZNYA 2CFTA 4P7FA 1CIJA 5FR1A 3TVYA 4ADSG 3D64A 5AM1A 1YQUA 1P17A 3K9LA 3UW1A 3ITDA 3ZNQA 4AJIA 4EF6A 1M2HA 3JARB 1G1MA 3A1SA 2HFKA 1HYBA 4NJMB 4QUGA 1XLTA 3VI3B 2WM2A 3C48A 1F4LA 1JMKC 1OFIA 3VPAA 4IDEA 1U2TA 1I30A 3M7IA 4LRUA 3ZIUA 5BSVA 3L5OA 2ORIA 3BTUA 3D5EA 4DLPA 2FWAA 6LDHA 3O4VA 1SC6A 4ZVRA 1I4OA 2FOIA 5GJVC 1SWWA 5KTKA 4HDRB 3JVVA 1XZ8A 4JL8A 4AJEA 5KYWA 2DMRA 2QL9A 1BXGA 4TVBA 1SY7A 2WWTA 1QZUA 1SQSA 3LQRA 4CMAA 2TMYA 2IPNA 1TKCA 1JJVA 4NHEA 4Y0NA 3WDLA 3BS4A 1G291 1WKBA 2PQ0A 1ZA1A 2Y1XA 1E9CA 2A1TS 3K9GA 4TS1A 3UB4A 2IUFA 3OQVA 3CPHA 4GEGA 2ISQA 4LOJA 5ICGA 1ZONA 4I6EA 4RHYA 2JFFA 4EA9A 4MVJH 3GPLA 3A3KA 1QF7A 1E9BA 2Z2YA 2UKDA 1YAHA 3LQKA 4WJZA 3IRUA 3KLNA 5GV8A 4E14A 5ALVA 2IHVA 3BL5A 3LL7A 1BS2A 2YZ7A 5K03A 3D6MA 4PZEA 3K1AB 3V1YA 3VNAA 3C6MA 1PKEA 5FH9A 1NNUA 4GXQA 4FJ0A 3RIYA 4P2GA 1OILA 4DB4A 4MR7B 2FW0A 5CFRA 3ZWYA 4UFNA 1T3HA 4Q1DA 3CA8A 1JDBC 3AB3A 3P20A 2XQGA 3LNTA 1SZDA 2BLLA 4B6GA 4PYMA 1DAFA 4IGEA 2Y27A 4H9GA 4WOJA 4Q93A 2GETA 4BMNA 5CDHA 3PE4A 1G5IA 3BZBA 4RF4A 2XOKA 2WUVA 4Z3DA 2Q1XA 5IS2A 3PUXA 4EYKA 4EY5A 1FXUA 1WP9A 3WP1B 1H94A 2UVPA 4DIMA 4O4JF 1G41A 4KQFA 4RANA 5DOZA 4EWLA 4O4HB 2JI4A 4PPYA 2JAHA 4YC7A 2P5SA 1ATZA 2DM6A 3PK0A 4JSTA 4KQ2A 4CM9A 1QYCA 3STWA 1P5FA 2P5TB 4XWYA 1N6PA 5CH8A 3D8RA 5IJ9A 1KYYA 3K9CA 2QMUA 3WLJA 3RREA 4Z4FA 4NLLA 4C01A 3HDTA 2ZRCA 3AC0A 2A9FA 1TZ2A 4GWKA 4PGHA 1RP7A 1W75A 1CEXA 1PV2A 4IXTA 1QQ7A 3G59A 4C6HA 3T1TA 4DM3A 1LLCA 2NQ8A 3P4UA 4EGAA 1I2CA 4R81A 3EY9A 2MYPA 4AN4A 5CB8A 3F1KA 4MDEA 1MT0A 2CLSA 3R3ZA 1P9OA 1JWBB 2B8TA 5IT5A 2IBTA 3ZCTA 1CUUA 2ZR0A 5KDLA 1Q84A 1ZUIA 3ZOKA 3AKEA 2IXFA 1JDTA 3ORSA 1NVBA 1IZYA 1PS0A 2RH9B 2VH1A 5CDTA 1J42A 1K7CA 3VU9B 1DKQA 3PVCA 1KY3A 2QPOA 2NU8B 2AZDA 3SBOA 4R8RA 1E4VA 1VG9B 1P6UA 2YICA 4IIJF 5TT1A 4B2YA 1GGFA 4QHTA 3KEMA 3O9MA 4E09A 3I5UA 3LSYA 4BCDA 4DARA 4WBNB 1FSFA 2PY6A 3MT8A 4HNVA 2C4MA 4GX0A 4M1SA 2GKGA 3V42A 3T7EA 4XLLA 5CB4F 3N39C 2LCIA 2R79A 4XA8A 2W6ID 4TXNA 1JAHA 2B4RO 3T4PA 1SWVA 1IOZA 5JNSA 3BE6A 3PQ4A 3QELA 2FPOA 1QNLA 2GPTA 2PU5A 1ORIA 2VSYA 1KH2A 1IG0A 5IUKC 1XPOA 2PV7A 2DHRA 4EI2A 2Q1YA 3M82A 4WIAA 4CEJA 3OTWA 4O4IA 3FMOB 1V8OA 4CIWA 3L7CA 3DDSA 1H3FA 3D5TA 3DBHB 4MMYB 4GBED 3W5IA 1AV6A 3Q9SA 3DXZA 1O95A 1H2HA 4Y2JA 2A35A 2I71A 2V6BA 1JDSA 1IH8A 1ZGCA 3BVPA 3H1AA 3Q7EA 4IDFA 1IHDA 2ATVA 4YJFB 4YMIA 5AQEA 5YASA 3WV5A 4I5FA 3AP1A 4EO9A 1AKQA 1TCUA 3GLHE 4M88A 2X3UA 2UYHA 1FRNA 1VE1A 3TLYA 4ZI7A 1IWPB 4G8DA 1G8SA 4NEHB 3TNYA 4EMSA 1JXAA 4P3NA 3WLIA 1X14A 4EG8A 1TZMA 3BOSA 2AG6A 2CVQA 4IVPA 5IXSA 1K2VN 2B5WA 1Q1GA 1Z08A 1UPBA 2F17A 1L7MA 3DGFC 2JAWA 4O2AF 2PUEA 2IDJA 1E98A 1CNMA 1KSHA 3PTZA 2VRBA 3I9LA 4NC9A 3FMVA 2QVXX 4KPUA 4U0JA 2Q4EA 4MPPA 4BE4A 1Q5PA 4HRXA 4IL5A 4U2DA 1XNRB 4DV4B 2BFAA 2IXBA 1NSTA 1ZM7A 4U2GA 2FY8A 2O5CA 5I9BA 5AKHA 3PC6A 2ATEA 1A5ZA 1JDZA 4MWEA 2HJ9A 4MARA 2JZCA 4NF2A 4Y2VA 1SMKA 5ICEA 2RKBA 2WJZB 4KQIA 4I3FA 4LDRA 4NOLA 4OLHA 5IJAA 4ZEWA 1KDYA 4TKUB 2GBFA 5AI4A 4BLRA 1FU7A 2DWOA 4EB6A 3AERB 3I5MA 1HDIA 5LYYA 4D97A 3CPSA 3W2EA 4II2A 3HDJA 2AN9A 1OBCA 5C4IA 3G7SA 4MS4A 3R4VA 5KEIA 4NXNB 1U8XX 2DY1A 3QXHA 1ZUWA 2EZ8A 3COSA 1PT9A 2NG1A 1P0QA 5J5AA 5BN4B 4FS8A 4MA0A 3PXUA 2QXTA 2OAEA 4R2HA 4YREA 2Y6UA 2A14A 3MMSA 4LKRA 3OLXA 1U0JA 4Y0AA 1FP1D 3CG4A 3HJAA 2V0GA 4J3FA 1EQUA 2PSEA 1I2DA 3SC2A 1SCDA 4NCXA 5HZKA 3UPDA 4RKYA 3JYQA 3K6RA 3N5KA 1U1CA 5K9ZA 3EF0A 1JKMA 2O8VA 3H05A 1YVDA 2ZW9A 3I04M 3VDNB 3T6KA 3WB0A 3TUZC 3TLMA 1AD2A 5ALRA 3EEIA 1FMJA 4YIKA 3S1LA 3ZNPA 5KOJB 5KWSA 1UFQA 3G85A 3OIDA 2NU7B 4FW9A 3UJ3X 5BR1A 4RZ2A 3L4JA 1DIGA 1SULA 4KX3A 4Q39A 5KHLB 5BVHA 2ZXUA 1QLJA 3HA7A 4GXTA 4TLEA 1GQ2A 2WK1A 3ZD6A 3RAEC 1WMFA 4B46A 1Z5WA 3QYJA 2PCJA 3Q87B 3G49A 5HP4A 2ZYVX 2IDMA 1MRSA 4FGSA 5CVCA 5DMHA 4Q66C 2YFKA 2VJMA 4QJ4A 1QHIA 1X92A 3HU1A 5EI5A 1G3MA 4K9QA 1SVNA 1ZNQO 1OAKA 3J81k 1E79A 4FSDA 3G6WA 5ALLA 1N7GA 4KGDA 1GGHA 1V5GA 3CRW1 1NT2A 3LUDA 3TSWA 5H3LA 3VDXA 6REQB 3QVOA 4EHNA 2DEUA 2IBMA 2OBXA 4BN0A 1TKRA 3TQCA 3KYJB 1QB7A 2R87A 2G7ZA 3CPJB 1SEVA 1W4BA 3HV0A 1R6DA 2DUUA 2IVFA 1EXNA 3G9ZA 3H2IA 2IRWA 4ZYZA 3NTUA 3PA8A 2GNPA 4LF5B 3UMCA 3LMKA 4J16A 3H9CA 5DCWA 3LUAA 4FDUA 1Q2XA 2WD7B 1MW9X 2ZWAA 3D4BA 1G21A 2IYEA 5EZYF 2YWGA 5TPWB 4WUTA 4RV9A 4M0EA 3CRQA 5ELLA 4IZHA 4AD8A 3RUPA 1FFDA 2HQOA 2VS1A 3HYNA 4K46A 5AJWA 3U26A 3QGMA 1B0AA 1YZYA 3VJLA 4EH1A 5SICE 3QFSA 3C3YA 2GM9A 3BEOA 3JQCA 4P4LA 4X0EA 3HYSA 4AC9A 4JYZA 2ZDHA 2RIRA 3IKLA 2YL2A 3QWFA 1W4RA 5CW2A 2Q6LA 2WHXA 2JF0A 3PFIA 4KSCA 5TS2A 1R0XA 4E70A 3NJ4A 3UTCA 2JI7A 4TTPA 4WD3A 1P9NA 2VQFB 4JV5B 5EXDA 4KFTA 2HGSA 1ONOA 1X0VA 5AHRA 3V00A 4WY8A 3ZE0B 4YJ3A 1B0PA 4K9OA 4KO3S 1DO8A 2V54A 3L7OA 3QPBA 1DV2A 1GILA 1R2QA 2WICA 3QV2A 5FQOA 1N33B 3M4XA 1WCIA 4XB1A 3F3MA 3PEFA 4LQ4A 3AM5A 4BO2A 3HRHA 1XP8A 1LPAB 1A7JA 1LY1A 2D2XA 3G2PA 1MC5A 4DLSA 1F2TB 2NSHA 4NENB 3EN0A 3NTOA 5DV9A 1NBOA 1JLLB 3VR6A 5A6VA 3MJEA 2FGJA 2OGZA 1EJ2A 2P6NA 3Q3GE 3UZUA 1GKKA 2IV3A 2HQBA 3LE8A 3O94A 2A5YB 1QCZA 2FFBA 3NIBA 4W99A 4ZOEA 2NSLA 3D7SA 4P35A 2NO7A 4DLTA 2NYUA 3KJQA 1X1DA 4HR7A 5E6UB 1FVFA 1GVNB 3BE5A 5AICA 2C2BA 5IVKA 4GP9A 4TOIA 1SZCA 1WDLA 3TQRA 3ETGA 3GLRA 2QV0A 3UH1A 2FFJA 1HC7A 3OM0A 1RQNA 3OSUA 1BOFA 1NN0A 1V6AA 4OI4A 5EKSA 2D1RA 3OCYA 3FWZA 5AVZA 5KYXA 2ZBVA 4ZU1X 4ZEOA 2X5OA 2KLHA 2Z4SA 1E77A 1JJIA