4PF6A

Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans (rd1_0742, target efi-510239) with bound 3-deoxy-d-manno-oct-2-ulosonic acid (kdo)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
305
structure length
305
Chain Sequence
DKITLRMSTPASETDQRSVALAEVFAPAVAGFATYQPHYNASLIAQNSELEAIASGDLEMSIASAQELAQFFPEFSIFATGYVHQSAEHQVAVFNDPLMDPFKKTVEDELGIKLLSVMYLGQRHVNLRQTKEELTVTTPADLAGVNLRMPGTDAWQFLGKALGANPTPMAFTEIYTALQTGSVDGQDNPLPTVVDAKFYEVTNQVALTGHLVDLNYIAFSKAVWDGLSPEQQEIVQTAADAAAQSGREKQLAKEQELVSFLEEQGMEIYAPDLDAFRTHVQEQYVGSEFAASWPEGVLDKINALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C4-dicarboxylate-binding protein
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Roseobacter denitrificans
molecule tags Transport protein
total genus 96
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2014-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pf6A00
2HZLA 4PDDA 4LN5A 4MNCA 2VPNA 4N91A 2XWOA 4N6KA 4XFEA 4OVRA 4X04A 2HZKA 4P9KA 4PGPA 2XWVA 2PFYA 2XWIA 4P3LA 3U65A 4P1EA 4PE3A 5LTCA 4N6DA 4O94A 4XEQA 4PF8A 2VPOA 4OVPA 2XA5A 4PC9A 2XXKA 4DI4B 4PFIA 3GYYA 4OVTA 4P8BA 4PBHA 4OA4A 3B50A 4N4UA 4X8RA 5I5PA 2WYPA 2XWKA 4P56A 4NHBA 4MAGA 4DI3D 4O8MA 4NF0A 2CEXA 4N15A 4MCOA 2PFZA 2ZZXA 4MMPA 4O7MA 4P47A 4PF6A 4NGUA 2WX9A 4NQ8A 2HPGA 4MIJA 4N8YA 2ZZWA 4PFBA 4OVSA 4MEVA 4MNPA 4PCDA 4PAIA 5IGAA 4N17A 3FXBA 4MHFA 4N8GA 4UABA 4YICA 4NX1A 2WYKA 4PAFA 5IM2A 4MX6A 5IZZA 2V4CA 4P1LA 4PGNA 4PBQA 4XF5A 4YZZA 4OANA 2CEYA 4PDHA 4OVQA 5I7IA 4NAPA 4PAKA 4PFRA 4NN3A 4MNIA 4NG7A 5CM6A 4PETA 2ZZVA
chains in the Genus database with same CATH superfamily
3A29A 4PDDA 4P0IA 2A5TA 2Q2CA 2Q74A 2PVUA 1MPDA 1IXIA 4JVCA 2XWVA 4JDFA 3FVGA 1FQAA 1OVBA 2CZLA 2UXAA 5LTCA 2FA7A 1R9QA 1MQJA 1UTHB 4WEDA 4PF8A 3DP8A 2DXYA 1EZOA 2ZYKA 1LBXA 5DW8A 4YKPA 4G8HA 4ECFA 4GXSB 3B6WA 2MKZA 3MBPA 2FNCA 3OMBA 3S4UA 2F78A 3D4GA 4NF5A 4Q30B 4U2RA 1DPPA 3VXBA 1MG1A 1GVCA 2PFZA 2Q8JA 3MQ9A 4O3AA 2D21A 1FQFA 3H7MA 1SYHA 3EHTA 3PTYA 2AL5A 3OEKA 1VR5A 1I6BA 3K6VA 3TCHA 3PUZE 4GD5A 2WBDA 1SVXB 3JV9A 1MM6A 1II5A 1MY3A 1QULA 2XXQA 4NF8A 3I3VA 3EQ1A 3KN7A 1BTJA 1DCUA 3O97A 5IZZA 2R71A 2PYYA 3MPLA 1FCKA 1XHYA 4ELPA 1US5A 4OZ9A 4PDHA 3UORA 3IOUA 4PFRA 4NTLA 2AL4A 1IXHA 2DE4A 2Y7KA 1WDNA 2HAUA 4N6KA 5I2NA 4X04A 5FHOA 5L8DA 5JTYB 4I3EA 4XKPA 2H99A 2IA4A 4ZZAA 2QS3A 2WKYA 2WBBA 5I56B 1Y3NA 3IJXB 3G3JA 1NUWA 4EQ9A 3OELA 3MZ9A 2Y7IA 3QMFA 2QS4A 4XXUA 4FIMA 1NMUA 1NNTA 4JWXA 3KC0A 3DP4A 3IB2A 3FATA 3V89B 3QSLA 1B1XA 1NV0A 4LQ5A 1N76A 3MYUA 3KOSA 4N13A 4L17A 4I3YA 4AB5A 4OESA 4GWSA 4EXKA 2YPNA 1B5JA 2NWJA 1OLAA 4YKKA 1ZLQA 4PFBA 5EQ7A 1B58A 4ESXA 4MHFA 3O28A 3LSFB 4ELOA 4IB2A 2V3QA 4TOZA 3RPLB 4RJZA 1MXYA 1AWBA 5CRYA 1EH3A 3FASA 2Y5LA 2QFLA 4PFYA 1FPDA 1YYZA 2RF1A 1YTVA 4KI0E 1Y9UA 1ZTYA 3R6UA 4G68C 4GFRA 4QF9A 2ZNTA 3H03A 1JW5A 3T22A 3C4MA 3IX1A 4GF8A 5I59A 3LUZA 4YB5A 3T9HB 1VFEA 3LSXA 4NWDA 5TP9A 2DSFA 2XXVA 2QSXA 4HE1A 3E4RA 4U4SA 2QJEA 1B7UA 2QVRA 2VPOA 1MXZA 3EPEA 1OQGA 2XA5A 3S9MC 4U21A 1FPJA 3K4UA 4OVTA 2GRVA 2ONRA 1D9YA 1GV8A 1POTA 1AH5A 4ZEBA 3LSWA 3M3KA 4R2BA 4G68B 3IOTA 1FTMA 3H6TA 4YKJA 3TFLA 2RC9A 3KJTA 4MBPA 4E0XA 1QVSA 3M3LA 1JNFA 3CR9A 1B6HA 3E3KA 4TQUQ 1NV2A 4EF1A 1URSA 4JVDA 2P3VA 4OEVA 5M2VA 2WX9A 4DLDA 1LAFE 3D4CA 4WKMA 1Y3QA 3TZAA 2ONSA 4MNPA 4PCDA 4PAIA 2H98A 1Y4TA 1A8FA 2F3DA 1QUJA 3H6WA 1EYJA 2G93A 4NX1A 4MJOA 4QSDA 3MC2A 5B70A 4ZEIA 3G3IA 4WEPA 4I40A 4OQOA 4XKQA 2V93A 2BJIA 3U8QA 4PGNA 4C1TA 1YAEA 1NV3A 4OANA 1ZJLA 3MSTA 1LAXA 1POY1 2QS1A 4LATA 5AA2D 1IUDA 3AXFA 5IZ3B 4FAJA 1IIWA 4GOTA 3W9WA 3THIA 4OHNA 2F7AA 1Y4CA 1IXCA 4DE8A 1BKAA 4HCYA 4N6DA 1N3WA 4NF6A 2V3UA 4GBWA 4XTCQ 5AA4A 4OVJA 1HSLA 3N26A 1FJ9A 3OXNA 4F2OA 2ESNA 1TFAA 2NOOA 2Q89A 4PFUA 1PBQA 4F39A 1LBZA 5IZ1A 2GHAA 4O8MA 3LBSA 4KFQA 1ZIUA 4OTEA 1R1NA 1SQYA 1B4HA 3B6QA 1ATGA 1UTHA 4O7MA 4RA1A 1NNFA 1UIUA 1T0KA 1B2HA 2X7PA 2ZNUA 1B05A 3UGWA 3FBPA 3KN8A 1PC3A 4JWOA 1FW0A 5H8SA 1Q35A 1MXVA 1YXIA 4ZZEA 2NVUB 4F1VA 3IOWA 1B0LA 1VE4A 4HE0A 3RQTA 3Q27A 2Q9TA 3UN6A 1IMEA 3VLVA 3N6UA 2E0SA 4G77A 1NI9A 3G3FA 1B3EA 3K1NA 4ZE8A 3LV0A 1B5IA 4GIZA 4P0GA 4IGRA 4F29A 2DWJA 1MY4A 3BFTA 1L5TA 2HZKA 2VHAA 2CZKA 2FHYA 2KR0A 2OBGA 4JWYA 1QKBA 1OLCA 1USYE 3T93B 1MRPA 2DVCA 1TFDA 2F6PA 3A3UA 4KYEA 2QVUA 4LZ5A 5ISUA 3GYYA 4GX3A 3KG2A 3V8XB 4RYAA 1FBPA 3Q26A 5ICQA 2I4BA 3QUFA 5JK4A 4X8RA 3PGFA 4R9FA 1FJ6A 1Z7NE 3HHFA 3PD9A 2F3BA 3LUYA 4FORA 2H25A 3ECRA 5I58B 4N15A 4MCOA 5JTYA 1N7XA 2CMOA 3JYRA 5KCJB 1N04A 5ESYA 4YKIA 5I56A 4P47A 1PEBA 1MDQA 1SDXA 1MY2A 1FTKA 1DPEA 3IO6A 3KN3A 1JVXA 2I0CA 2HHMA 1DMBA 4YICA 2GFEA 5IM2A 3OD7A 1P99A 4YB6A 5CMMA 3R26A 2RKMA 4ZS9A 3ZS6A 2Y7WA 5HPQA 4F1YA 3RN8A 4FBPA 4EUOA 3HN0A 1SW4A 3IO4A 4THIA 4M1VA 3IB0A 2VPNA 4OEUA 4F18A 1XC1A 4FATA 2QMXA 4HTGA 2XX8A 4PGPA 2O1LA 2H4IA 2WEFA 4EDPA 3SEWA 1LB9A 3KBZA 3FJMA 1DBZA 3MP6A 3U93A 3O6GA 4PE3A 2W7YA 5FTHA 1Y20A 4AS5A 3FGSA 5ET6A 3MW0A 1NL5A 3OO6A 1B5HA 1MXXA 1I6QA 4PFIA 3MP1A 4KQPA 4X48A 4IO2A 2B4LA 2F7CA 1S50A 1IITA 3K0VA 4POWA 1QUKA 1D4NA 1B3FA 3PMVA 4F31B 4NHBA 4DCYA 2G29A 4QFNA 2O1MA 3DELB 3U72A 2OCUA 2HXRA 1CNQA 3A09A 2HFBA 3ROJA 4R72A 5F24A 2HPGA 1CE2A 1DK4A 4JBZA 1SI1A 1UTBB 1MPCA 3H6VA 3C34A 3OEMA 1IXGA 3T1BA 4G68A 3E13X 2DE2A 2F7BA 3FZVA 2OWZA 3FXRA 1FQEA 1H45A 5BWJA 2VD2A 2OK2A 4OFJA 4R2FA 3W15C 1URDA 5CBRA 2FBPA 4EXLA 4LZ8A 2I6EA 4HE2A 3LC8A 1IMCA 2F35A 5DTBA 5FTIA 3PUVE 3BKIB 3CHGA 4GWZA 1AIVA 3OO9A 3K6XA 1I6AA 1JETA 3MVWA 4OYVA 4F3BA 2QMWA 3O6HA 4N91A 2F6GA 4H65A 4KCDA 3PD8A 3H4ZA 3WAEA 3QUJA 4Z7EA 4UA8A 4NEDA 2ALUA 3R7XA 4OVPA 2O51A 3FVOA 2NXOA 2Z22A 3HCQA 2OLBA 3UP9A 2I3WA 5IZ3A 1FBEA 1LCTA 1XVXA 2GH9A 2WYPA 3FVKA 1LSTA 1SYIA 3Q29A 5I2KB 3PV0E 1LBVA 2D3IA 3Q25A 3SEXA 5F1QA 3B8BA 1B3LA 4MF3A 1QUIA 3MZ1A 5B7DA 1OIBA 3TTKA 2Q2AA 4GWYA 1RYXA 4KCCA 4IO7A 2ZZWA 2CZIA 1SW5A 4OVSA 1O7TA 4DCXA 3TTNA 1SW1A 3FXBA 4R73A 4PTKA 5FHMA 1GGGA 4ND9A 3O9PA 1AL3A 3KJ7A 2X26A 3ZSFA 1N84A 1MH3A 2V3TA 1RYOA 3N5LA 4QFLA 4QFKA 2Z8EA 5ITOA 1M5EA 3HV1A 1SI0A 2XX7A 1IQ7A 2CEYA 3VVEA 2E1SA 3TEPA 2ZXTA 3VDFA 1SBPA 4ELQA 1K9ZA 3KSXA 2PBWA 3H3GA 1MM7A 3VLUA 2Q8MA 3PMWA 2HZLA 4H1XA 4LN5A 3EKIA 1DTGA 3IB1A 3IFCA 3T9VA 2I49A 5CI5A 4N6PA 4O7IA 3MWBA 3C9HA 3U65A 2B65A 3RTWB 5EYHA 4TLLB 4XIGQ 4U4XA 4O94A 4XEQA 1FPBA 4ONYA 3ILTB 3MP8A 5DVFA 5K2XA 1TT1A 3QAXA 2VD3A 3CG3A 5AE4A 1KA0A 5H8NB 3KFMA 3QXMA 4LVQA 5K2YA 1TXFA 4P11A 1IMBA 4F3GA 3TUSA 1B4ZA 3LR1A 4GQOA 4G2ZA 3UIFA 1VFDA 3K1PA 4QSEA 5BUUA 4FE8A 5TPAB 3KOTA 4JSDA 5JEIA 1AOVA 4KXPA 4QHQA 4WXJA 5DT6A 2XXIA 3IJOB 4PF6A 4NQ8A 3O66A 4N8YA 3PUWE 3WAFA 4N17A 3H6UA 2I3VA 2O84X 5FHNA 1ELJA 1NFTA 1FPIA 4H8IA 2O6AA 5I58A 2QPQA 1FQDA 4MLQA 3CG1A 4OERA 5KCJA 5H8FB 2JJKA 4GRKA 3VFJA 3RLFE 4H5FA 1FBDA 2KQZA 1GR2A 2XXRA 3E9XA 2ZZVA 2DXRA 4NMYA 2DWHA 4X9TA 2THIA 1S7YA 2B3FA 3HHGA 1XVYA 1LLSA 3C35A 4PFTA 2Q88A 1M5FA 4ZEFA 4DXBA 1N3XA 4GWOA 3U1OA 2ZYMA 1S9TA 5ET7A 3N94A 5ET5A 1LBCA 3GZGA 5CMBA 3RGYA 3K2DA 3K6WA 3TKDA 1P1UA 4HCWA 1MS7A 1I69A 3SEYA 3SZPA 4N07A 4R6YA 3B50A 1LFIA 2L5VA 3CFLA 1FTOA 3MVZA 4GX4A 1DSNA 2XXPA 3PUXE 1EYIA 4ZEDA 3PMXA 4H6DA 4GXAA 4H8JA 4KPTA 1NH8A 1O64A 2O7UA 2RINA 3IR1A 2F34A 1LEVA 2ZYOA 2Z8FA 4KYDA 4R9GA 4JXIA 3FD3A 5LDZA 4TLMB 2H5YA 5H8HB 3TELA 1G0IA 4LUBA 1FBGA 4FJPA 4EF2A 1LGBC 3RNNA 4ZEKA 2KLFA 2R8TA 3T0JA 5CMKA 1EYKA 2FIEA 1H44A 4P1LA 2XD3A 3IFAA 4NF4B 1MPBA 4XF5A 2O7IA 1B3HA 2B4MA 4NN3A 1IMFA 1UTBA 1QJMA 2F36A 1P1QA 2ANJA 1FTLA 4G4PA 4XFEA 2CZHA 1JQFA 5AA1A 1XOCA 3ZKKA 3DM0A 1MQGA 2XWIA 1SD3A 3BFUA 1SW2A 3CFZA 3M3FA 3M8UA 3LSLA 4O3BA 2RCAA 2DP8A 2ONKE 5CC2A 2DQVA 1NUYA 2QRYA 4FECA 4BDOA 2D5WA 3SEVA 1LBYA 3DP6A 1YCJA 3K6UA 3CRBA 1K9YA 4YB7A 4NF0A 3UA8A 3HO7A 4PQJA 4UACA 1D3KA 4OXVA 2HCAA 5A5LA 4ISUA 3CSGA 4GX6A 2F97A 1EU8A 4QSCA 1SPIA 4R6HA 1NNKA 4R74A 1BIYA 3K02A 3FUZA 3UK4A 1B3GA 1NV1A 4ZDMA 5ELVA 3L6GA 2PMSA 3IAZA 1DTZA 2P3NA 4MLVA 4RNSA 4PAFA 1JW1A 1BK4A 4EQ7A 5I2KA 3TCGA 1NV4A 2NUVA 4FEDA 5H8QB 5EQ8A 3RTFB 1FBCA 4G8MA 4IO4A 4NWCA 2VP1A 1FTJA 4IY6A 5L9SA 3JZJA 4R6KA 3QIMA 2VT5A 4YAHX 3I6VA 2HQ0A 4XKRA 2UVGA 3PPPA 4ZE9A 1GTKA 4ESWA 1KZ8A 4ELRA 1LCFA 1N0TA 1N7WA 3MPKA 3O6IA 3PPOA 4OFOA 1FPEA 2RCBA 4OWDA 4PC9A 1XI6A 3PPNA 1QGXA 2IEEA 3HFUA 2UVJA 3U92A 2OX3A 4GVOA 4IO5A 3CVGA 1USYH 4P56A 1XS5A 4Q0CA 3RYDA 5HBCA 4DDDA 3SDFA 2GQ1A 4R75A 2XXXA 4RXLA 4Q8RA 4GL0A 1JW4A 3C33A 3HSTA 4OMBA 1NKXA 3P7IA 4HXVA 5H8NA 4MH5A 4DIGA 2PCRA 3OSQA 4N8GA 5KDTB 1RKMA 2BJJX 2ZMBA 3IL1B 3VV5A 3TQWA 3KZGA 2LAOA 4PP0A 5TPAA 3BIGA 1INPA 5CMCA 3GLBA 2XXYA 1P1WA 1YPNA 5DEXB 4OVQA 4F1UA 5I57B 1Y3PA 4BLAA 1AMFA 5A5XB 4PAKA 4F22A 2F5XA 1US4A 5I3SA 3GXAA 1IZ1A 3MVXA 3MJNA 2FVZA 3PUYE 4YU0A 3EHUA 4OVRA 3O29A 1IMDA 3OOAA 1DOTA 2RC7A 3CIJA 3MUQA 5I84A 4POXA 2P1SA 4LZ7A 4QFOA 4GWWA 1FRPA 3F11A 4H45A 3IOVA 3O2AA 4KD5A 1HSEA 5H8FA 5LOMA 4DI4B 4IGTA 2DOJA 3N6TA 3IORA 1A99A 3V5AA 3NOHA 3VVFA 4N81A 3D1RA 4N4UA 3TAJA 4PFWA 1VSOA 3I5OA 3ONMA 5EQ9A 3FV1A 2Z23A 3FV2A 1J1NA 4RK9A 2DWIA 4F3SA 4DXUA 3T66A 1FBHA 4E0WA 4NGUA 4BDQA 3ILUB 1NUXA 1RDYA 4OENA 5T3JA 2XXTA 4U1OA 2HAVA 1B7ZA 1A40A 2V84A 5FBPA 1Q9DA 1P1NA 2ABHA 4UABA 4IO6A 3V83A 4LONB 4OFLA 4BDMA 4MX6A 1Q1KA 2O69A 3KEIA 3C31A 1UQWA 4JB7A 3IK6B 3KGCA 1B40A 4BDNA 2I4CA 4H0WA 1NNPA 5I7IA 4XKNA 5AA3A 2VGQA 5AA2B 1OVTA 3ISPA 4I62A 4PETA 5H8HA 4MNCA 2XWOA 3FJGA 2B3BA 1NV6A 3MZBA 1Y1MA 1FTAA 3T96B 4LP2B 3T9UA 4P1EA 4NE4A 4YMBA 3BIHA 3A3CA 3PU5A 1MQHA 4NF4A 3SERA 4DZ1A 4Z0IA 1MXUA 1LAHE 5EHSA 3ODBA 4M4GA 3L6HA 4C1UA 3RUMA 3TODA 4IO3A 1LFGA 4X1BA 3RPWA 1F9BA 3ZKLA 2DS9A 3OSRA 1B7HA 1M5BA 1ZMGA 2OZZA 4GWXA 1JVYA 4MMPA 2DE3A 1IMAA 4QFPA 5EHMA 2R9JA 3B6TA 3KC1A 4H67A 4MIJA 3KBRA 2RC8A 5EYGA 2OWSA 3TTLA 1FSAA 2A5TB 2ZNSA 3TYHA 3SETA 2A5SA 2Y7RA 1NH7A 2HXWA 1TWYA 4KYSA 3TMGA 2PT2A 4PBQA 2I58A 5DVIA 3EHSA 1BLFA 1ZKBA 1MXWA 3S9LC 2XXWA 4MNIA 1B46A 1D9QA 2OWTA 2VOZA 4YMAA 1MY0A 4OETA 4DXCA 4RPOA 1O63A 4NF5B 2OJTA 4G61A 2R6GE 4RY1A 1CB6A 3OO8A 2YJPA 2AYSA 3FXQA 4AS4A 2XX9A 1ZU0A 3U94A 5IAIA 5L9OA 5H8QA 1B52A 4O3CA 1JEUA 2XXKA 3C32A 5ET8A 3GBAA 1MY1A 2AIXA 4PBHA 2I48A 3HPIA 2V25A 4BDLA 2DYXA 4I1DA 1R6ZA 2XWKA 4NF8B 4MAGA 4DI3D 1MQDA 1LBWA 1LFHA 1M5CA 2P2AA 2XHDA 2DWAA 1HSJA 5EYFA 2YLNA 2I0BA 3CSBA 3VVDA 2ZZXA 2DVZA 1FPKA 1FQBA 1JP4A 1JEVA 4X1DA 4HS7A 3K00A 3USDA 2Y7PA 3S2VA 4FEBA 3DLNA 4MEVA 4C0RA 5IGAA 1QW0A 3T9XB 1OQHA 5I2NB 3TPAA 4H46A 1KWHA 2F8DA 3FXUA 2M8CA 2V4CA 1MDP1 2H9BA 1PB7A 1B32A 3RT8A 4QRZA 4KR5A 2UVHA 2Y5KA 3KSJA 3B7DA 3PPRA 3G7WA 4JVIA 4NAPA 4IR8A 4RPNA 5CM6A 1NV5A 3MVYA 2PT1A 2UYEA 5KDTA 1H76A 1YZ0A 4P3LA 1A54A 5ICTA 3TTMA 2QS2A 1RDXA 4F19A 3S9EA 4KHZE 3H06B 4MFIA 4U23A 1PBPA 2GHBA 4EQBA 5DEXA 3SESA 5I57A 5A5XA 1Z7ME 1FPFA 3TTRA 4P8BA 1MQIA 1LB8A 3VXCA 5I5PA 1FPGA 1NUZA 3BBRA 1MH4A 2CEXA 5KZTA 3G3HA 1PB9A 1B0HA 2P0SA 3PPQA 5IKBA 3W9VA 4GWUA 2REJA 3TDJA 1EZPA 3SKPA 3E78A 5L9MA 2XXUA 5I59B 4ZECA 4I9DA 1BP5A 1B1HA 2ZYNA 1NV7A 4BDRA 5TP9B 2QVVA 1XT8A 1KA1A 5F7VA 1P1OA 1URGA 4RK2A 1IEJA 3FIRA 4LQ2A 1PDAA 1UIVA 4H5GA 5HM4B 1OMPA 4JSOA 3QYTA 5TU0A 4AQ4A 4NG7A 2DDKA 4HW8A 4Q5TA 3K1MA 2QL3A 3RT6B 1M5DA 1B9JA 1G0HA 1ANFA 1VDWA 1LBBA 1R9LA 2Y84A 4P9KA 4AB6A 4IY5A 2PFYA 2Z8DA 1PB8A 3CI8A 3SEUA 1A7LA 1H43A 4GLIA 3EN3A 5EQAA 4F3PA 2REGA 5AA2A 4OA4A 5DYHA 1EZ9A 3TCFA 3VE1B 4LA9A 5ITPA 3FJ7A 3RY3A 1WVJA 1WODA 4F2QA 3EF7A 3QK6A 4U22A 1FQCA 3OO7A 1B51A 3GBBA 1RDZA 4QXDA 2X7QA 1H3DA 1ZBMA 4U1ZA 3G3KA 1FBFA 2FYIA 3E79A 3FVNA 4QBAA 3TQLA 3Q28A 2XXHA 3S9NC 3CFXA 3G3GA 1A55A 2FIXA 2WYKA 1D9VA 3MAMA 2UYFA 4K3FA 3VLWA 5J1DA 1QKAA 5DVJA 4GBVA 1FPLA 4NF6B 2UVIA 3RPLA 4PE5B 2PX1A 5AA4B 5J16A 2XD2A 4YZZA 4G8NA 1A8EA 5CBSA 4I8CA 3OENA 4GL8A 2O68A 1LAGE 2HEUA 3C36A 3K01A 1Y1ZA
chains in the Genus database with same CATH topology
3A29A 4PDDA 4MNCA 4X9TA 2Q74A 2XWOA 1NV6A 2HZKA 4JVCA 1FTAA 2CZKA 2FHYA 2KR0A 2XWVA 4P1EA 5LTCA 3BIHA 5ET7A 4PF8A 5ET5A 2QVUA 1LBXA 5DW8A 3GYYA 4GX3A 4HCWA 1FBPA 3SZPA 5JK4A 3B50A 4X8RA 2MKZA 2L5VA 1FJ6A 4GX4A 2F3BA 1EYIA 4N15A 4MCOA 2PFZA 4GWXA 5ESYA 4MMPA 1LEVA 2DE3A 1IMAA 4P47A 3KC1A 3PTYA 4MIJA 5LDZA 5EYGA 1FSAA 2WBDA 1G0IA 2HHMA 1FBGA 4YICA 5IM2A 2R8TA 3T0JA 1EYKA 1DCUA 5IZZA 2FIEA 4P1LA 3IFAA 4PBQA 4XF5A 4PDHA 2B4MA 4FBPA 4PFRA 4NN3A 4MNIA 1IMFA 1D9QA 2DE4A 4M1VA 2VPNA 4G61A 4F18A 4N6KA 4XFEA 2CZHA 4X04A 4PGPA 2WEFA 2XWIA 4I3EA 3KBZA 1DBZA 4PE3A 4AS4A 2WBBA 4AS5A 5ET6A 1NUWA 2XXKA 4PFIA 5ET8A 2B4LA 1NUYA 3QMFA 4PBHA 3KC0A 1LBYA 2XWKA 1K9YA 4NHBA 4MAGA 4DI3D 4NF0A 1LBWA 1NV0A 3MYUA 4I3YA 2HXRA 1CNQA 5A5LA 4GWSA 2ZZXA 3ROJA 2DVZA 1FPKA 4GX6A 1JP4A 5F24A 1SPIA 2HPGA 1DK4A 4PFBA 1NV1A 4MEVA 5EQ7A 5IGAA 4MHFA 3T1BA 2DE2A 2OWZA 2P3NA 2V3QA 4PAFA 3RPLB 4H46A 1AWBA 1BK4A 2FBPA 2Y5LA 2QFLA 1NV4A 2V4CA 5EQ8A 4HE2A 1FPDA 1IMCA 1YYZA 1FBCA 2Y5KA 3CHGA 4GWZA 4JVIA 4NAPA 4IR8A 5CM6A 1NV5A 3LUZA 4N91A 2VT5A 1YZ0A 4P3LA 4HE1A 1RDXA 1KZ8A 4F19A 2QVRA 2VPOA 4OVPA 1FPEA 2XA5A 4PC9A 1XI6A 1FPJA 4OVTA 1QGXA 1FPFA 4P8BA 3HFUA 5IZ3A 1FBEA 2OX3A 5I5PA 2WYPA 1FPGA 4P56A 1NUZA 2CEXA 3RYDA 1LBVA 2GQ1A 1NV2A 3B8BA 4JVDA 2P3VA 2WX9A 3W9VA 4GWUA 4GWYA 2ZZWA 2CZIA 3E78A 4OVSA 4MNPA 4PCDA 4HXVA 4PAIA 2PCRA 3FXBA 4N8GA 2F3DA 1EYJA 1NV7A 4PTKA 4NX1A 4MJOA 2QVVA 1KA1A 4I40A 3BIGA 1INPA 2BJIA 4PGNA 1NV3A 4OANA 2CEYA 3MSTA 4OVQA 4F1UA 4PAKA 1K9ZA 4NG7A 2DDKA 5IZ3B 2F5XA 2Q8MA 2HZLA 1G0HA 5I3SA 4LN5A 3EKIA 3W9WA 1VDWA 2FVZA 3IFCA 4OVRA 1IMDA 4P9KA 2PFYA 4O7IA 3U65A 4GWWA 5EYHA 4HCYA 1FRPA 4N6DA 4H45A 4O94A 4XEQA 1FPBA 4GBWA 4DI4B 1FJ9A 5EQAA 1KA0A 3NOHA 4N81A 4OA4A 3D1RA 1IMBA 4N4UA 1LBZA 5EQ9A 5IZ1A 4O8MA 4KXPA 1RDZA 4QXDA 4O7MA 1FBHA 4PF6A 4NGUA 1FBFA 4NQ8A 3E79A 4N8YA 1NUXA 3FBPA 1RDYA 4QBAA 5T3JA 4N17A 5FBPA 1Q9DA 4UABA 1YXIA 4F1VA 2FIXA 2WYKA 4HE0A 1FPIA 4MX6A 5J1DA 2Q9TA 2QPQA 4GBVA 1FPLA 1IMEA 3RPLA 5J16A 2JJKA 4YZZA 1NI9A 5I7IA 3ISPA 2KQZA 1FBDA 3LV0A 4PETA 2ZZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZL A;  4PDD A;  4LN5 A;  4MNC A;  2VPN A;  4N91 A;  2XWO A;  4N6K A;  4XFE A;  4OVR A;  4X04 A;  2HZK A;  4P9K A;  4PGP A;  2XWV A;  2PFY A;  2XWI A;  4P3L A;  3U65 A;  4P1E A;  4PE3 A;  5LTC A;  4N6D A;  4O94 A;  4XEQ A;  4PF8 A;  2VPO A;  4OVP A;  2XA5 A;  4PC9 A;  2XXK A;  4DI4 B;  4PFI A;  3GYY A;  4OVT A;  4P8B A;  4PBH A;  4OA4 A;  3B50 A;  4N4U A;  4X8R A;  5I5P A;  2WYP A;  2XWK A;  4P56 A;  4NHB A;  4MAG A;  4DI3 D;  4O8M A;  4NF0 A;  2CEX A;  4N15 A;  4MCO A;  2PFZ A;  2ZZX A;  4MMP A;  4O7M A;  4P47 A;  4PF6 A;  4NGU A;  2WX9 A;  4NQ8 A;  2HPG A;  4MIJ A;  4N8Y A;  2ZZW A;  4PFB A;  4OVS A;  4MEV A;  4MNP A;  4PCD A;  4PAI A;  5IGA A;  4N17 A;  3FXB A;  4MHF A;  4N8G A;  4UAB A;  4YIC A;  4NX1 A;  2WYK A;  4PAF A;  5IM2 A;  4MX6 A;  5IZZ A;  2V4C A;  4P1L A;  4PGN A;  4PBQ A;  4XF5 A;  4YZZ A;  4OAN A;  2CEY A;  4PDH A;  4OVQ A;  5I7I A;  4NAP A;  4PAK A;  4PFR A;  4NN3 A;  4MNI A;  4NG7 A;  5CM6 A;  4PET A;  2ZZV A; 
#chains in the Genus database with same CATH topology
 3A29 A;  4PDD A;  4P0I A;  2A5T A;  2Q2C A;  2Q74 A;  2PVU A;  1MPD A;  1IXI A;  4JVC A;  2XWV A;  4JDF A;  3FVG A;  1FQA A;  1OVB A;  2CZL A;  2UXA A;  5LTC A;  2FA7 A;  1R9Q A;  1MQJ A;  1UTH B;  4WED A;  4PF8 A;  3DP8 A;  2DXY A;  1EZO A;  2ZYK A;  1LBX A;  5DW8 A;  4YKP A;  4G8H A;  4ECF A;  4GXS B;  3B6W A;  2MKZ A;  3MBP A;  2FNC A;  3OMB A;  3S4U A;  2F78 A;  3D4G A;  4NF5 A;  4Q30 B;  4U2R A;  1DPP A;  3VXB A;  1MG1 A;  1GVC A;  2PFZ A;  2Q8J A;  3MQ9 A;  4O3A A;  2D21 A;  1FQF A;  3H7M A;  1SYH A;  3EHT A;  3PTY A;  2AL5 A;  3OEK A;  1VR5 A;  1I6B A;  3K6V A;  3TCH A;  3PUZ E;  4GD5 A;  2WBD A;  1SVX B;  3JV9 A;  1MM6 A;  1II5 A;  1MY3 A;  1QUL A;  2XXQ A;  4NF8 A;  3I3V A;  3EQ1 A;  3KN7 A;  1BTJ A;  1DCU A;  3O97 A;  5IZZ A;  2R71 A;  2PYY A;  3MPL A;  1FCK A;  1XHY A;  4ELP A;  1US5 A;  4OZ9 A;  4PDH A;  3UOR A;  3IOU A;  4PFR A;  4NTL A;  2AL4 A;  1IXH A;  2DE4 A;  2Y7K A;  1WDN A;  2HAU A;  4N6K A;  5I2N A;  4X04 A;  5FHO A;  5L8D A;  5JTY B;  4I3E A;  4XKP A;  2H99 A;  2IA4 A;  4ZZA A;  2QS3 A;  2WKY A;  2WBB A;  5I56 B;  1Y3N A;  3IJX B;  3G3J A;  1NUW A;  4EQ9 A;  3OEL A;  3MZ9 A;  2Y7I A;  3QMF A;  2QS4 A;  4XXU A;  4FIM A;  1NMU A;  1NNT A;  4JWX A;  3KC0 A;  3DP4 A;  3IB2 A;  3FAT A;  3V89 B;  3QSL A;  1B1X A;  1NV0 A;  4LQ5 A;  1N76 A;  3MYU A;  3KOS A;  4N13 A;  4L17 A;  4I3Y A;  4AB5 A;  4OES A;  4GWS A;  4EXK A;  2YPN A;  1B5J A;  2NWJ A;  1OLA A;  4YKK A;  1ZLQ A;  4PFB A;  5EQ7 A;  1B58 A;  4ESX A;  4MHF A;  3O28 A;  3LSF B;  4ELO A;  4IB2 A;  2V3Q A;  4TOZ A;  3RPL B;  4RJZ A;  1MXY A;  1AWB A;  5CRY A;  1EH3 A;  3FAS A;  2Y5L A;  2QFL A;  4PFY A;  1FPD A;  1YYZ A;  2RF1 A;  1YTV A;  4KI0 E;  1Y9U A;  1ZTY A;  3R6U A;  4G68 C;  4GFR A;  4QF9 A;  2ZNT A;  3H03 A;  1JW5 A;  3T22 A;  3C4M A;  3IX1 A;  4GF8 A;  5I59 A;  3LUZ A;  4YB5 A;  3T9H B;  1VFE A;  3LSX A;  4NWD A;  5TP9 A;  2DSF A;  2XXV A;  2QSX A;  4HE1 A;  3E4R A;  4U4S A;  2QJE A;  1B7U A;  2QVR A;  2VPO A;  1MXZ A;  3EPE A;  1OQG A;  2XA5 A;  3S9M C;  4U21 A;  1FPJ A;  3K4U A;  4OVT A;  2GRV A;  2ONR A;  1D9Y A;  1GV8 A;  1POT A;  1AH5 A;  4ZEB A;  3LSW A;  3M3K A;  4R2B A;  4G68 B;  3IOT A;  1FTM A;  3H6T A;  4YKJ A;  3TFL A;  2RC9 A;  3KJT A;  4MBP A;  4E0X A;  1QVS A;  3M3L A;  1JNF A;  3CR9 A;  1B6H A;  3E3K A;  4TQU Q;  1NV2 A;  4EF1 A;  1URS A;  4JVD A;  2P3V A;  4OEV A;  5M2V A;  2WX9 A;  4DLD A;  1LAF E;  3D4C A;  4WKM A;  1Y3Q A;  3TZA A;  2ONS A;  4MNP A;  4PCD A;  4PAI A;  2H98 A;  1Y4T A;  1A8F A;  2F3D A;  1QUJ A;  3H6W A;  1EYJ A;  2G93 A;  4NX1 A;  4MJO A;  4QSD A;  3MC2 A;  5B70 A;  4ZEI A;  3G3I A;  4WEP A;  4I40 A;  4OQO A;  4XKQ A;  2V93 A;  2BJI A;  3U8Q A;  4PGN A;  4C1T A;  1YAE A;  1NV3 A;  4OAN A;  1ZJL A;  3MST A;  1LAX A;  1POY 1;  2QS1 A;  4LAT A;  5AA2 D;  1IUD A;  3AXF A;  5IZ3 B;  4FAJ A;  1IIW A;  4GOT A;  3W9W A;  3THI A;  4OHN A;  2F7A A;  1Y4C A;  1IXC A;  4DE8 A;  1BKA A;  4HCY A;  4N6D A;  1N3W A;  4NF6 A;  2V3U A;  4GBW A;  4XTC Q;  5AA4 A;  4OVJ A;  1HSL A;  3N26 A;  1FJ9 A;  3OXN A;  4F2O A;  2ESN A;  1TFA A;  2NOO A;  2Q89 A;  4PFU A;  1PBQ A;  4F39 A;  1LBZ A;  5IZ1 A;  2GHA A;  4O8M A;  3LBS A;  4KFQ A;  1ZIU A;  4OTE A;  1R1N A;  1SQY A;  1B4H A;  3B6Q A;  1ATG A;  1UTH A;  4O7M A;  4RA1 A;  1NNF A;  1UIU A;  1T0K A;  1B2H A;  2X7P A;  2ZNU A;  1B05 A;  3UGW A;  3FBP A;  3KN8 A;  1PC3 A;  4JWO A;  1FW0 A;  5H8S A;  1Q35 A;  1MXV A;  1YXI A;  4ZZE A;  2NVU B;  4F1V A;  3IOW A;  1B0L A;  1VE4 A;  4HE0 A;  3RQT A;  3Q27 A;  2Q9T A;  3UN6 A;  1IME A;  3VLV A;  3N6U A;  2E0S A;  4G77 A;  1NI9 A;  3G3F A;  1B3E A;  3K1N A;  4ZE8 A;  3LV0 A;  1B5I A;  4GIZ A;  4P0G A;  4IGR A;  4F29 A;  2DWJ A;  1MY4 A;  3BFT A;  1L5T A;  2HZK A;  2VHA A;  2CZK A;  2FHY A;  2KR0 A;  2OBG A;  4JWY A;  1QKB A;  1OLC A;  1USY E;  3T93 B;  1MRP A;  2DVC A;  1TFD A;  2F6P A;  3A3U A;  4KYE A;  2QVU A;  4LZ5 A;  5ISU A;  3GYY A;  4GX3 A;  3KG2 A;  3V8X B;  4RYA A;  1FBP A;  3Q26 A;  5ICQ A;  2I4B A;  3QUF A;  5JK4 A;  4X8R A;  3PGF A;  4R9F A;  1FJ6 A;  1Z7N E;  3HHF A;  3PD9 A;  2F3B A;  3LUY A;  4FOR A;  2H25 A;  3ECR A;  5I58 B;  4N15 A;  4MCO A;  5JTY A;  1N7X A;  2CMO A;  3JYR A;  5KCJ B;  1N04 A;  5ESY A;  4YKI A;  5I56 A;  4P47 A;  1PEB A;  1MDQ A;  1SDX A;  1MY2 A;  1FTK A;  1DPE A;  3IO6 A;  3KN3 A;  1JVX A;  2I0C A;  2HHM A;  1DMB A;  4YIC A;  2GFE A;  5IM2 A;  3OD7 A;  1P99 A;  4YB6 A;  5CMM A;  3R26 A;  2RKM A;  4ZS9 A;  3ZS6 A;  2Y7W A;  5HPQ A;  4F1Y A;  3RN8 A;  4FBP A;  4EUO A;  3HN0 A;  1SW4 A;  3IO4 A;  4THI A;  4M1V A;  3IB0 A;  2VPN A;  4OEU A;  4F18 A;  1XC1 A;  4FAT A;  2QMX A;  4HTG A;  2XX8 A;  4PGP A;  2O1L A;  2H4I A;  2WEF A;  4EDP A;  3SEW A;  1LB9 A;  3KBZ A;  3FJM A;  1DBZ A;  3MP6 A;  3U93 A;  3O6G A;  4PE3 A;  2W7Y A;  5FTH A;  1Y20 A;  4AS5 A;  3FGS A;  5ET6 A;  3MW0 A;  1NL5 A;  3OO6 A;  1B5H A;  1MXX A;  1I6Q A;  4PFI A;  3MP1 A;  4KQP A;  4X48 A;  4IO2 A;  2B4L A;  2F7C A;  1S50 A;  1IIT A;  3K0V A;  4POW A;  1QUK A;  1D4N A;  1B3F A;  3PMV A;  4F31 B;  4NHB A;  4DCY A;  2G29 A;  4QFN A;  2O1M A;  3DEL B;  3U72 A;  2OCU A;  2HXR A;  1CNQ A;  3A09 A;  2HFB A;  3ROJ A;  4R72 A;  5F24 A;  2HPG A;  1CE2 A;  1DK4 A;  4JBZ A;  1SI1 A;  1UTB B;  1MPC A;  3H6V A;  3C34 A;  3OEM A;  1IXG A;  3T1B A;  4G68 A;  3E13 X;  2DE2 A;  2F7B A;  3FZV A;  2OWZ A;  3FXR A;  1FQE A;  1H45 A;  5BWJ A;  2VD2 A;  2OK2 A;  4OFJ A;  4R2F A;  3W15 C;  1URD A;  5CBR A;  2FBP A;  4EXL A;  4LZ8 A;  2I6E A;  4HE2 A;  3LC8 A;  1IMC A;  2F35 A;  5DTB A;  5FTI A;  3PUV E;  3BKI B;  3CHG A;  4GWZ A;  1AIV A;  3OO9 A;  3K6X A;  1I6A A;  1JET A;  3MVW A;  4OYV A;  4F3B A;  2QMW A;  3O6H A;  4N91 A;  2F6G A;  4H65 A;  4KCD A;  3PD8 A;  3H4Z A;  3WAE A;  3QUJ A;  4Z7E A;  4UA8 A;  4NED A;  2ALU A;  3R7X A;  4OVP A;  2O51 A;  3FVO A;  2NXO A;  2Z22 A;  3HCQ A;  2OLB A;  3UP9 A;  2I3W A;  5IZ3 A;  1FBE A;  1LCT A;  1XVX A;  2GH9 A;  2WYP A;  3FVK A;  1LST A;  1SYI A;  3Q29 A;  5I2K B;  3PV0 E;  1LBV A;  2D3I A;  3Q25 A;  3SEX A;  5F1Q A;  3B8B A;  1B3L A;  4MF3 A;  1QUI A;  3MZ1 A;  5B7D A;  1OIB A;  3TTK A;  2Q2A A;  4GWY A;  1RYX A;  4KCC A;  4IO7 A;  2ZZW A;  2CZI A;  1SW5 A;  4OVS A;  1O7T A;  4DCX A;  3TTN A;  1SW1 A;  3FXB A;  4R73 A;  4PTK A;  5FHM A;  1GGG A;  4ND9 A;  3O9P A;  1AL3 A;  3KJ7 A;  2X26 A;  3ZSF A;  1N84 A;  1MH3 A;  2V3T A;  1RYO A;  3N5L A;  4QFL A;  4QFK A;  2Z8E A;  5ITO A;  1M5E A;  3HV1 A;  1SI0 A;  2XX7 A;  1IQ7 A;  2CEY A;  3VVE A;  2E1S A;  3TEP A;  2ZXT A;  3VDF A;  1SBP A;  4ELQ A;  1K9Z A;  3KSX A;  2PBW A;  3H3G A;  1MM7 A;  3VLU A;  2Q8M A;  3PMW A;  2HZL A;  4H1X A;  4LN5 A;  3EKI A;  1DTG A;  3IB1 A;  3IFC A;  3T9V A;  2I49 A;  5CI5 A;  4N6P A;  4O7I A;  3MWB A;  3C9H A;  3U65 A;  2B65 A;  3RTW B;  5EYH A;  4TLL B;  4XIG Q;  4U4X A;  4O94 A;  4XEQ A;  1FPB A;  4ONY A;  3ILT B;  3MP8 A;  5DVF A;  5K2X A;  1TT1 A;  3QAX A;  2VD3 A;  3CG3 A;  5AE4 A;  1KA0 A;  5H8N B;  3KFM A;  3QXM A;  4LVQ A;  5K2Y A;  1TXF A;  4P11 A;  1IMB A;  4F3G A;  3TUS A;  1B4Z A;  3LR1 A;  4GQO A;  4G2Z A;  3UIF A;  1VFD A;  3K1P A;  4QSE A;  5BUU A;  4FE8 A;  5TPA B;  3KOT A;  4JSD A;  5JEI A;  1AOV A;  4KXP A;  4QHQ A;  4WXJ A;  5DT6 A;  2XXI A;  3IJO B;  4PF6 A;  4NQ8 A;  3O66 A;  4N8Y A;  3PUW E;  3WAF A;  4N17 A;  3H6U A;  2I3V A;  2O84 X;  5FHN A;  1ELJ A;  1NFT A;  1FPI A;  4H8I A;  2O6A A;  5I58 A;  2QPQ A;  1FQD A;  4MLQ A;  3CG1 A;  4OER A;  5KCJ A;  5H8F B;  2JJK A;  4GRK A;  3VFJ A;  3RLF E;  4H5F A;  1FBD A;  2KQZ A;  1GR2 A;  2XXR A;  3E9X A;  2ZZV A;  2DXR A;  4NMY A;  2DWH A;  4X9T A;  2THI A;  1S7Y A;  2B3F A;  3HHG A;  1XVY A;  1LLS A;  3C35 A;  4PFT A;  2Q88 A;  1M5F A;  4ZEF A;  4DXB A;  1N3X A;  4GWO A;  3U1O A;  2ZYM A;  1S9T A;  5ET7 A;  3N94 A;  5ET5 A;  1LBC A;  3GZG A;  5CMB A;  3RGY A;  3K2D A;  3K6W A;  3TKD A;  1P1U A;  4HCW A;  1MS7 A;  1I69 A;  3SEY A;  3SZP A;  4N07 A;  4R6Y A;  3B50 A;  1LFI A;  2L5V A;  3CFL A;  1FTO A;  3MVZ A;  4GX4 A;  1DSN A;  2XXP A;  3PUX E;  1EYI A;  4ZED A;  3PMX A;  4H6D A;  4GXA A;  4H8J A;  4KPT A;  1NH8 A;  1O64 A;  2O7U A;  2RIN A;  3IR1 A;  2F34 A;  1LEV A;  2ZYO A;  2Z8F A;  4KYD A;  4R9G A;  4JXI A;  3FD3 A;  5LDZ A;  4TLM B;  2H5Y A;  5H8H B;  3TEL A;  1G0I A;  4LUB A;  1FBG A;  4FJP A;  4EF2 A;  1LGB C;  3RNN A;  4ZEK A;  2KLF A;  2R8T A;  3T0J A;  5CMK A;  1EYK A;  2FIE A;  1H44 A;  4P1L A;  2XD3 A;  3IFA A;  4NF4 B;  1MPB A;  4XF5 A;  2O7I A;  1B3H A;  2B4M A;  4NN3 A;  1IMF A;  1UTB A;  1QJM A;  2F36 A;  1P1Q A;  2ANJ A;  1FTL A;  4G4P A;  4XFE A;  2CZH A;  1JQF A;  5AA1 A;  1XOC A;  3ZKK A;  3DM0 A;  1MQG A;  2XWI A;  1SD3 A;  3BFU A;  1SW2 A;  3CFZ A;  3M3F A;  3M8U A;  3LSL A;  4O3B A;  2RCA A;  2DP8 A;  2ONK E;  5CC2 A;  2DQV A;  1NUY A;  2QRY A;  4FEC A;  4BDO A;  2D5W A;  3SEV A;  1LBY A;  3DP6 A;  1YCJ A;  3K6U A;  3CRB A;  1K9Y A;  4YB7 A;  4NF0 A;  3UA8 A;  3HO7 A;  4PQJ A;  4UAC A;  1D3K A;  4OXV A;  2HCA A;  5A5L A;  4ISU A;  3CSG A;  4GX6 A;  2F97 A;  1EU8 A;  4QSC A;  1SPI A;  4R6H A;  1NNK A;  4R74 A;  1BIY A;  3K02 A;  3FUZ A;  3UK4 A;  1B3G A;  1NV1 A;  4ZDM A;  5ELV A;  3L6G A;  2PMS A;  3IAZ A;  1DTZ A;  2P3N A;  4MLV A;  4RNS A;  4PAF A;  1JW1 A;  1BK4 A;  4EQ7 A;  5I2K A;  3TCG A;  1NV4 A;  2NUV A;  4FED A;  5H8Q B;  5EQ8 A;  3RTF B;  1FBC A;  4G8M A;  4IO4 A;  4NWC A;  2VP1 A;  1FTJ A;  4IY6 A;  5L9S A;  3JZJ A;  4R6K A;  3QIM A;  2VT5 A;  4YAH X;  3I6V A;  2HQ0 A;  4XKR A;  2UVG A;  3PPP A;  4ZE9 A;  1GTK A;  4ESW A;  1KZ8 A;  4ELR A;  1LCF A;  1N0T A;  1N7W A;  3MPK A;  3O6I A;  3PPO A;  4OFO A;  1FPE A;  2RCB A;  4OWD A;  4PC9 A;  1XI6 A;  3PPN A;  1QGX A;  2IEE A;  3HFU A;  2UVJ A;  3U92 A;  2OX3 A;  4GVO A;  4IO5 A;  3CVG A;  1USY H;  4P56 A;  1XS5 A;  4Q0C A;  3RYD A;  5HBC A;  4DDD A;  3SDF A;  2GQ1 A;  4R75 A;  2XXX A;  4RXL A;  4Q8R A;  4GL0 A;  1JW4 A;  3C33 A;  3HST A;  4OMB A;  1NKX A;  3P7I A;  4HXV A;  5H8N A;  4MH5 A;  4DIG A;  2PCR A;  3OSQ A;  4N8G A;  5KDT B;  1RKM A;  2BJJ X;  2ZMB A;  3IL1 B;  3VV5 A;  3TQW A;  3KZG A;  2LAO A;  4PP0 A;  5TPA A;  3BIG A;  1INP A;  5CMC A;  3GLB A;  2XXY A;  1P1W A;  1YPN A;  5DEX B;  4OVQ A;  4F1U A;  5I57 B;  1Y3P A;  4BLA A;  1AMF A;  5A5X B;  4PAK A;  4F22 A;  2F5X A;  1US4 A;  5I3S A;  3GXA A;  1IZ1 A;  3MVX A;  3MJN A;  2FVZ A;  3PUY E;  4YU0 A;  3EHU A;  4OVR A;  3O29 A;  1IMD A;  3OOA A;  1DOT A;  2RC7 A;  3CIJ A;  3MUQ A;  5I84 A;  4POX A;  2P1S A;  4LZ7 A;  4QFO A;  4GWW A;  1FRP A;  3F11 A;  4H45 A;  3IOV A;  3O2A A;  4KD5 A;  1HSE A;  5H8F A;  5LOM A;  4DI4 B;  4IGT A;  2DOJ A;  3N6T A;  3IOR A;  1A99 A;  3V5A A;  3NOH A;  3VVF A;  4N81 A;  3D1R A;  4N4U A;  3TAJ A;  4PFW A;  1VSO A;  3I5O A;  3ONM A;  5EQ9 A;  3FV1 A;  2Z23 A;  3FV2 A;  1J1N A;  4RK9 A;  2DWI A;  4F3S A;  4DXU A;  3T66 A;  1FBH A;  4E0W A;  4NGU A;  4BDQ A;  3ILU B;  1NUX A;  1RDY A;  4OEN A;  5T3J A;  2XXT A;  4U1O A;  2HAV A;  1B7Z A;  1A40 A;  2V84 A;  5FBP A;  1Q9D A;  1P1N A;  2ABH A;  4UAB A;  4IO6 A;  3V83 A;  4LON B;  4OFL A;  4BDM A;  4MX6 A;  1Q1K A;  2O69 A;  3KEI A;  3C31 A;  1UQW A;  4JB7 A;  3IK6 B;  3KGC A;  1B40 A;  4BDN A;  2I4C A;  4H0W A;  1NNP A;  5I7I A;  4XKN A;  5AA3 A;  2VGQ A;  5AA2 B;  1OVT A;  3ISP A;  4I62 A;  4PET A;  5H8H A;  4MNC A;  2XWO A;  3FJG A;  2B3B A;  1NV6 A;  3MZB A;  1Y1M A;  1FTA A;  3T96 B;  4LP2 B;  3T9U A;  4P1E A;  4NE4 A;  4YMB A;  3BIH A;  3A3C A;  3PU5 A;  1MQH A;  4NF4 A;  3SER A;  4DZ1 A;  4Z0I A;  1MXU A;  1LAH E;  5EHS A;  3ODB A;  4M4G A;  3L6H A;  4C1U A;  3RUM A;  3TOD A;  4IO3 A;  1LFG A;  4X1B A;  3RPW A;  1F9B A;  3ZKL A;  2DS9 A;  3OSR A;  1B7H A;  1M5B A;  1ZMG A;  2OZZ A;  4GWX A;  1JVY A;  4MMP A;  2DE3 A;  1IMA A;  4QFP A;  5EHM A;  2R9J A;  3B6T A;  3KC1 A;  4H67 A;  4MIJ A;  3KBR A;  2RC8 A;  5EYG A;  2OWS A;  3TTL A;  1FSA A;  2A5T B;  2ZNS A;  3TYH A;  3SET A;  2A5S A;  2Y7R A;  1NH7 A;  2HXW A;  1TWY A;  4KYS A;  3TMG A;  2PT2 A;  4PBQ A;  2I58 A;  5DVI A;  3EHS A;  1BLF A;  1ZKB A;  1MXW A;  3S9L C;  2XXW A;  4MNI A;  1B46 A;  1D9Q A;  2OWT A;  2VOZ A;  4YMA A;  1MY0 A;  4OET A;  4DXC A;  4RPO A;  1O63 A;  4NF5 B;  2OJT A;  4G61 A;  2R6G E;  4RY1 A;  1CB6 A;  3OO8 A;  2YJP A;  2AYS A;  3FXQ A;  4AS4 A;  2XX9 A;  1ZU0 A;  3U94 A;  5IAI A;  5L9O A;  5H8Q A;  1B52 A;  4O3C A;  1JEU A;  2XXK A;  3C32 A;  5ET8 A;  3GBA A;  1MY1 A;  2AIX A;  4PBH A;  2I48 A;  3HPI A;  2V25 A;  4BDL A;  2DYX A;  4I1D A;  1R6Z A;  2XWK A;  4NF8 B;  4MAG A;  4DI3 D;  1MQD A;  1LBW A;  1LFH A;  1M5C A;  2P2A A;  2XHD A;  2DWA A;  1HSJ A;  5EYF A;  2YLN A;  2I0B A;  3CSB A;  3VVD A;  2ZZX A;  2DVZ A;  1FPK A;  1FQB A;  1JP4 A;  1JEV A;  4X1D A;  4HS7 A;  3K00 A;  3USD A;  2Y7P A;  3S2V A;  4FEB A;  3DLN A;  4MEV A;  4C0R A;  5IGA A;  1QW0 A;  3T9X B;  1OQH A;  5I2N B;  3TPA A;  4H46 A;  1KWH A;  2F8D A;  3FXU A;  2M8C A;  2V4C A;  1MDP 1;  2H9B A;  1PB7 A;  1B32 A;  3RT8 A;  4QRZ A;  4KR5 A;  2UVH A;  2Y5K A;  3KSJ A;  3B7D A;  3PPR A;  3G7W A;  4JVI A;  4NAP A;  4IR8 A;  4RPN A;  5CM6 A;  1NV5 A;  3MVY A;  2PT1 A;  2UYE A;  5KDT A;  1H76 A;  1YZ0 A;  4P3L A;  1A54 A;  5ICT A;  3TTM A;  2QS2 A;  1RDX A;  4F19 A;  3S9E A;  4KHZ E;  3H06 B;  4MFI A;  4U23 A;  1PBP A;  2GHB A;  4EQB A;  5DEX A;  3SES A;  5I57 A;  5A5X A;  1Z7M E;  1FPF A;  3TTR A;  4P8B A;  1MQI A;  1LB8 A;  3VXC A;  5I5P A;  1FPG A;  1NUZ A;  3BBR A;  1MH4 A;  2CEX A;  5KZT A;  3G3H A;  1PB9 A;  1B0H A;  2P0S A;  3PPQ A;  5IKB A;  3W9V A;  4GWU A;  2REJ A;  3TDJ A;  1EZP A;  3SKP A;  3E78 A;  5L9M A;  2XXU A;  5I59 B;  4ZEC A;  4I9D A;  1BP5 A;  1B1H A;  2ZYN A;  1NV7 A;  4BDR A;  5TP9 B;  2QVV A;  1XT8 A;  1KA1 A;  5F7V A;  1P1O A;  1URG A;  4RK2 A;  1IEJ A;  3FIR A;  4LQ2 A;  1PDA A;  1UIV A;  4H5G A;  5HM4 B;  1OMP A;  4JSO A;  3QYT A;  5TU0 A;  4AQ4 A;  4NG7 A;  2DDK A;  4HW8 A;  4Q5T A;  3K1M A;  2QL3 A;  3RT6 B;  1M5D A;  1B9J A;  1G0H A;  1ANF A;  1VDW A;  1LBB A;  1R9L A;  2Y84 A;  4P9K A;  4AB6 A;  4IY5 A;  2PFY A;  2Z8D A;  1PB8 A;  3CI8 A;  3SEU A;  1A7L A;  1H43 A;  4GLI A;  3EN3 A;  5EQA A;  4F3P A;  2REG A;  5AA2 A;  4OA4 A;  5DYH A;  1EZ9 A;  3TCF A;  3VE1 B;  4LA9 A;  5ITP A;  3FJ7 A;  3RY3 A;  1WVJ A;  1WOD A;  4F2Q A;  3EF7 A;  3QK6 A;  4U22 A;  1FQC A;  3OO7 A;  1B51 A;  3GBB A;  1RDZ A;  4QXD A;  2X7Q A;  1H3D A;  1ZBM A;  4U1Z A;  3G3K A;  1FBF A;  2FYI A;  3E79 A;  3FVN A;  4QBA A;  3TQL A;  3Q28 A;  2XXH A;  3S9N C;  3CFX A;  3G3G A;  1A55 A;  2FIX A;  2WYK A;  1D9V A;  3MAM A;  2UYF A;  4K3F A;  3VLW A;  5J1D A;  1QKA A;  5DVJ A;  4GBV A;  1FPL A;  4NF6 B;  2UVI A;  3RPL A;  4PE5 B;  2PX1 A;  5AA4 B;  5J16 A;  2XD2 A;  4YZZ A;  4G8N A;  1A8E A;  5CBS A;  4I8C A;  3OEN A;  4GL8 A;  2O68 A;  1LAG E;  2HEU A;  3C36 A;  3K01 A;  1Y1Z A; 
#chains in the Genus database with same CATH homology
 3A29 A;  4PDD A;  4MNC A;  4X9T A;  2Q74 A;  2XWO A;  1NV6 A;  2HZK A;  4JVC A;  1FTA A;  2CZK A;  2FHY A;  2KR0 A;  2XWV A;  4P1E A;  5LTC A;  3BIH A;  5ET7 A;  4PF8 A;  5ET5 A;  2QVU A;  1LBX A;  5DW8 A;  3GYY A;  4GX3 A;  4HCW A;  1FBP A;  3SZP A;  5JK4 A;  3B50 A;  4X8R A;  2MKZ A;  2L5V A;  1FJ6 A;  4GX4 A;  2F3B A;  1EYI A;  4N15 A;  4MCO A;  2PFZ A;  4GWX A;  5ESY A;  4MMP A;  1LEV A;  2DE3 A;  1IMA A;  4P47 A;  3KC1 A;  3PTY A;  4MIJ A;  5LDZ A;  5EYG A;  1FSA A;  2WBD A;  1G0I A;  2HHM A;  1FBG A;  4YIC A;  5IM2 A;  2R8T A;  3T0J A;  1EYK A;  1DCU A;  5IZZ A;  2FIE A;  4P1L A;  3IFA A;  4PBQ A;  4XF5 A;  4PDH A;  2B4M A;  4FBP A;  4PFR A;  4NN3 A;  4MNI A;  1IMF A;  1D9Q A;  2DE4 A;  4M1V A;  2VPN A;  4G61 A;  4F18 A;  4N6K A;  4XFE A;  2CZH A;  4X04 A;  4PGP A;  2WEF A;  2XWI A;  4I3E A;  3KBZ A;  1DBZ A;  4PE3 A;  4AS4 A;  2WBB A;  4AS5 A;  5ET6 A;  1NUW A;  2XXK A;  4PFI A;  5ET8 A;  2B4L A;  1NUY A;  3QMF A;  4PBH A;  3KC0 A;  1LBY A;  2XWK A;  1K9Y A;  4NHB A;  4MAG A;  4DI3 D;  4NF0 A;  1LBW A;  1NV0 A;  3MYU A;  4I3Y A;  2HXR A;  1CNQ A;  5A5L A;  4GWS A;  2ZZX A;  3ROJ A;  2DVZ A;  1FPK A;  4GX6 A;  1JP4 A;  5F24 A;  1SPI A;  2HPG A;  1DK4 A;  4PFB A;  1NV1 A;  4MEV A;  5EQ7 A;  5IGA A;  4MHF A;  3T1B A;  2DE2 A;  2OWZ A;  2P3N A;  2V3Q A;  4PAF A;  3RPL B;  4H46 A;  1AWB A;  1BK4 A;  2FBP A;  2Y5L A;  2QFL A;  1NV4 A;  2V4C A;  5EQ8 A;  4HE2 A;  1FPD A;  1IMC A;  1YYZ A;  1FBC A;  2Y5K A;  3CHG A;  4GWZ A;  4JVI A;  4NAP A;  4IR8 A;  5CM6 A;  1NV5 A;  3LUZ A;  4N91 A;  2VT5 A;  1YZ0 A;  4P3L A;  4HE1 A;  1RDX A;  1KZ8 A;  4F19 A;  2QVR A;  2VPO A;  4OVP A;  1FPE A;  2XA5 A;  4PC9 A;  1XI6 A;  1FPJ A;  4OVT A;  1QGX A;  1FPF A;  4P8B A;  3HFU A;  5IZ3 A;  1FBE A;  2OX3 A;  5I5P A;  2WYP A;  1FPG A;  4P56 A;  1NUZ A;  2CEX A;  3RYD A;  1LBV A;  2GQ1 A;  1NV2 A;  3B8B A;  4JVD A;  2P3V A;  2WX9 A;  3W9V A;  4GWU A;  4GWY A;  2ZZW A;  2CZI A;  3E78 A;  4OVS A;  4MNP A;  4PCD A;  4HXV A;  4PAI A;  2PCR A;  3FXB A;  4N8G A;  2F3D A;  1EYJ A;  1NV7 A;  4PTK A;  4NX1 A;  4MJO A;  2QVV A;  1KA1 A;  4I40 A;  3BIG A;  1INP A;  2BJI A;  4PGN A;  1NV3 A;  4OAN A;  2CEY A;  3MST A;  4OVQ A;  4F1U A;  4PAK A;  1K9Z A;  4NG7 A;  2DDK A;  5IZ3 B;  2F5X A;  2Q8M A;  2HZL A;  1G0H A;  5I3S A;  4LN5 A;  3EKI A;  3W9W A;  1VDW A;  2FVZ A;  3IFC A;  4OVR A;  1IMD A;  4P9K A;  2PFY A;  4O7I A;  3U65 A;  4GWW A;  5EYH A;  4HCY A;  1FRP A;  4N6D A;  4H45 A;  4O94 A;  4XEQ A;  1FPB A;  4GBW A;  4DI4 B;  1FJ9 A;  5EQA A;  1KA0 A;  3NOH A;  4N81 A;  4OA4 A;  3D1R A;  1IMB A;  4N4U A;  1LBZ A;  5EQ9 A;  5IZ1 A;  4O8M A;  4KXP A;  1RDZ A;  4QXD A;  4O7M A;  1FBH A;  4PF6 A;  4NGU A;  1FBF A;  4NQ8 A;  3E79 A;  4N8Y A;  1NUX A;  3FBP A;  1RDY A;  4QBA A;  5T3J A;  4N17 A;  5FBP A;  1Q9D A;  4UAB A;  1YXI A;  4F1V A;  2FIX A;  2WYK A;  4HE0 A;  1FPI A;  4MX6 A;  5J1D A;  2Q9T A;  2QPQ A;  4GBV A;  1FPL A;  1IME A;  3RPL A;  5J16 A;  2JJK A;  4YZZ A;  1NI9 A;  5I7I A;  3ISP A;  2KQZ A;  1FBD A;  3LV0 A;  4PET A;  2ZZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...