4PF6A

Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans (rd1_0742, target efi-510239) with bound 3-deoxy-d-manno-oct-2-ulosonic acid (kdo)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
305
structure length
305
Chain Sequence
DKITLRMSTPASETDQRSVALAEVFAPAVAGFATYQPHYNASLIAQNSELEAIASGDLEMSIASAQELAQFFPEFSIFATGYVHQSAEHQVAVFNDPLMDPFKKTVEDELGIKLLSVMYLGQRHVNLRQTKEELTVTTPADLAGVNLRMPGTDAWQFLGKALGANPTPMAFTEIYTALQTGSVDGQDNPLPTVVDAKFYEVTNQVALTGHLVDLNYIAFSKAVWDGLSPEQQEIVQTAADAAAQSGREKQLAKEQELVSFLEEQGMEIYAPDLDAFRTHVQEQYVGSEFAASWPEGVLDKINALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Roseobacter denitrificans
molecule tags Transport protein
molecule keywords C4-dicarboxylate-binding protein
total genus 96
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2014-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pf6A00
4MIJA 4P1EA 4MX6A 2XA5A 4NF0A 2HZKA 2PFYA 4P1LA 4YZZA 4PFBA 4PDDA 4PC9A 4O7MA 5IZZA 5I7IA 5IGAA 4OVPA 4PBHA 4X04A 4N4UA 3FXBA 4NX1A 4PGNA 2HPGA 2ZZVA 4N17A 4N91A 2XWIA 4OVSA 2WX9A 2WYKA 4NN3A 4N8YA 4PE3A 4NGUA 4MMPA 2CEXA 4XFEA 4OVRA 4XF5A 2XWKA 4MEVA 2XXKA 4P56A 4MAGA 4N6KA 2CEYA 4P3LA 4N15A 4PF8A 5CM6A 2XWOA 4MNCA 2VPNA 4LN5A 4DI3D 2ZZWA 3B50A 4PCDA 2ZZXA 4N6DA 2WYPA 4NAPA 4PFRA 4P9KA 4MNPA 4DI4B 3GYYA 4PBQA 4OVTA 4PGPA 4OANA 3U65A 4MHFA 4PF6A 4PDHA 4O8MA 4PAFA 4OVQA 5I5PA 5LTCA 4NHBA 4MCOA 4NQ8A 4PFIA 4OA4A 5IM2A 2XWVA 4PAIA 4PETA 2PFZA 4MNIA 4UABA 2HZLA 4O94A 4X8RA 4NG7A 4YICA 2VPOA 4PAKA 4P8BA 4XEQA 4N8GA 2V4CA 4P47A
chains in the Genus database with same CATH superfamily
3TTKA 4OZ9A 3K4UA 2XA5A 3K6XA 4DZ1A 3KJTA 1NKXA 1JQFA 1UIUA 3KOTA 5I56A 5TP9B 3S9MC 4F2QA 2L5VA 1S7YA 2DWHA 3EQ1A 1SW4A 4KQPA 4H8JA 1IMEA 2O69A 4OWDA 4QBAA 2QS1A 3TUSA 2PX1A 1FTOA 3O97A 4GWOA 5KDTB 2Y7RA 4G68B 2ESNA 4G8HA 5CI5A 3SDFA 4EQBA 2IEEA 3IAZA 4R2BA 2F8DA 1FBPA 1S50A 5I57B 1FCKA 2F36A 4H65A 3ODBA 2F34A 3IR1A 4I40A 3MWBA 3E79A 4N81A 4R75A 1FPJA 1M5CA 5JTYA 4UA8A 4F31B 2V25A 3W9WA 4NF4B 1DMBA 1FJ6A 5L8DA 4F39A 3GLBA 1YTVA 3M3LA 1EYJA 4OA4A 3IOTA 1ZMGA 2ZYNA 3Q28A 1HSEA 2Y84A 3THIA 2B4LA 1FPBA 3G3IA 4OYVA 2Z8DA 5B70A 4F18A 1ELJA 1JVXA 3D1RA 3IJOB 4ZEKA 2GH9A 5KDTA 3VLVA 4BDMA 4P8BA 5EQAA 4GWYA 4N8GA 4YKKA 4Z7EA 4WXJA 5H8QB 4X1BA 3IX1A 3IB2A 5ITPA 3FVNA 3GXAA 4GD5A 3A29A 4YB6A 1VE4A 4RNSA 4RPOA 3S2VA 2RCBA 3HO7A 1H3DA 4ZEIA 3EHUA 1WDNA 5EHSA 1LBXA 3EF7A 2FIEA 1BTJA 2Y7PA 2H5YA 3P7IA 5JTYB 2O84X 3LSFB 3CVGA 3C36A 1CE2A 2GRVA 3MVXA 3OO9A 1OQGA 3W15C 4FE8A 3VV5A 2I49A 4U4SA 4H45A 4MAGA 1LAXA 3K6UA 1B0HA 4N07A 2OJTA 4KCDA 1LAFE 1S9TA 1IUDA 5I2NB 3H6UA 2XXHA 1M5DA 4H6DA 4H1XA 1FBEA 1RDYA 5K2XA 2CZHA 4MHFA 2FBPA 2NOOA 3SZPA 5KCJB 2YPNA 1PBPA 3DELB 3BKIB 1PDAA 2WBBA 4P0IA 1IXIA 3RGYA 1DOTA 1B3HA 4H0WA 1NUXA 1A55A 2PT1A 4QFKA 4GL0A 1DBZA 3L6GA 3R7XA 4DCYA 1SI0A 4Q8RA 3HCQA 2DP8A 1SW5A 3JZJA 1AH5A 3MVWA 4RJZA 3S9LC 1O7TA 1PBQA 4PP0A 4KXPA 5I7IA 3TDJA 4YB7A 4LATA 3MZ1A 2IA4A 4Q5TA 2QL3A 2B4MA 2DYXA 4BLAA 3K02A 4OVSA 3FJMA 2DVCA 4R6KA 4N8YA 1URGA 2NXOA 3FUZA 2I6EA 4QRZA 3CI8A 3D4GA 3R6UA 2QVRA 2XX8A 1NV3A 1ZKBA 2RCAA 3B7DA 2OZZA 1DPPA 1NL5A 1MXXA 4ZZEA 4EXLA 1ANFA 1H44A 4RPNA 5LDZA 1P1NA 1B0LA 3RY3A 2OWSA 1N84A 4JVCA 4YB5A 2OCUA 3V83A 3EKIA 1D9YA 4XIGQ 2FHYA 3GYYA 1IMBA 1FBHA 4EF1A 3OXNA 2ZNUA 4QSEA 3VE1B 4DXCA 1N3XA 2CZKA 3GBBA 2XXPA 2AL4A 3E9XA 3E78A 2AIXA 2O1LA 4XKRA 4JSOA 1TWYA 4YKJA 1BLFA 1Z7NE 3MVYA 3CFLA 4Q0CA 3E3KA 1FBGA 3RN8A 1RKMA 1VFDA 3S9EA 4R74A 5H8QA 1VR5A 2X26A 4GWZA 1XVXA 4P1EA 3H6WA 5H8FB 1MQIA 4YZZA 3U72A 2VHAA 2FYIA 2R6GE 4ZE8A 5FTIA 4JB7A 3KC1A 5HBCA 3C31A 3IO6A 4ZECA 3KOSA 2ANJA 1M5BA 3A09A 4TQUQ 5A5XB 2VOZA 2QVUA 1NUYA 4XF5A 1NNPA 3RPLA 4R72A 2XXVA 3MYUA 4RYAA 2ONRA 3TKDA 4IGTA 5BUUA 1AWBA 3DP4A 4N15A 2F3BA 2QFLA 1FTAA 4ELRA 3Q29A 3H6VA 3U8QA 1EZOA 1FPKA 1NNFA 2ALUA 3JYRA 1PB7A 4IGRA 1EYKA 2Q2CA 3W9VA 4HXVA 2Q9TA 3RT6B 2JJKA 1AL3A 3T1BA 1L5TA 1YAEA 1LLSA 3LV0A 4R2FA 5A5XA 2B65A 3B6WA 4HS7A 5LOMA 4OESA 4G77A 3ECRA 2UVIA 4QF9A 3TCFA 4KYEA 2DXYA 1M5FA 4NWCA 1R9LA 2QVVA 1MXYA 3S9NC 1B40A 1MQHA 4MX6A 2O7UA 1LCFA 5J16A 2HZKA 4HE2A 4ZE9A 3CSBA 2Y7WA 1JEVA 4OEVA 4F3GA 3E13X 4KPTA 2XXYA 1GTKA 2DE2A 1LB9A 3G3JA 5JK4A 4ELPA 1CNQA 5AA4B 2F3DA 2WX9A 1Y4TA 1YXIA 3PMVA 3DM0A 1FPGA 1JEUA 3PGFA 4GWSA 1GV8A 4TLLB 1QUJA 1MXUA 4GWWA 2GHAA 4IO3A 3MW0A 1US5A 4PF8A 4THIA 3EHSA 3CG3A 1DK4A 2KLFA 4OERA 3L6HA 3N6UA 1IMDA 2DE4A 3FVKA 4RK9A 1LSTA 1KWHA 2DE3A 2M8CA 4AQ4A 3MQ9A 4NAPA 3RTWB 4JSDA 3QAXA 5EQ8A 3H7MA 1MM7A 4O3CA 1F9BA 3VFJA 3PPOA 2R71A 2XD2A 4EQ9A 3OENA 4IY5A 3G3HA 2ABHA 4JWYA 3BFUA 1R9QA 2B3FA 3DLNA 2I0CA 4IO7A 4ND9A 5H8SA 1A40A 2FVZA 4F19A 2MKZA 3I6VA 2E1SA 3F11A 3O66A 2WKYA 5TPAA 4ISUA 1NUWA 3B6QA 4G61A 4G8NA 1NMUA 3I5OA 2FA7A 1UQWA 1P1QA 1N7WA 4LQ5A 3ROJA 2DWIA 4FATA 3OD7A 2Q88A 2I58A 2XX7A 3SKPA 4N13A 4LA9A 4P0GA 4H5GA 4PFBA 4ESXA 4PC9A 4IO6A 1FQBA 3MPKA 4ZS9A 3KSXA 1NV1A 4ZEFA 3ZS6A 3USDA 1Y9UA 3PUZE 4WEDA 1B51A 3LUYA 4O7IA 3K1PA 3U94A 4QXDA 4DE8A 1H76A 4OFJA 1VFEA 4ESWA 4C0RA 2NVUB 2XXRA 5L9OA 2Z8FA 3CFZA 4GX4A 1D3KA 1QULA 3GZGA 3CHGA 3PPQA 4NEDA 3TELA 4DXBA 1G0HA 1KA1A 1A7LA 1JW5A 3OMBA 2DVZA 3SEYA 4DDDA 4U2RA 4PF6A 1EZ9A 4U23A 1MY0A 1B46A 1MXVA 3G7WA 5M2VA 2PFZA 4MLQA 4F29A 2B3BA 4F3PA 4U4XA 1B3FA 4KCCA 3C34A 4LVQA 5I58B 2XHDA 1Y1MA 3MP1A 5AA3A 2P0SA 4KD5A 4MH5A 3SEUA 2V4CA 3PUYE 3IFCA 2RKMA 3OELA 3KBZA 1CB6A 2Q74A 2QS3A 1MY1A 4DIGA 1MDQA 4PQJA 2Z23A 2A5TB 3KEIA 2CZIA 5ET8A 1LFIA 2RC9A 3LSLA 4N4UA 4NX1A 4F3BA 2H98A 1EU8A 4GBWA 2PT2A 4NF6A 4LUBA 5HM4B 2WEFA 4M4GA 4NN3A 3VDFA 1FTJA 4GQOA 3T66A 2DDKA 3TQLA 1FQFA 1FPDA 2UYEA 4FECA 2RC8A 5EYGA 5I2KB 4IO2A 4MMPA 4C1TA 4JVIA 2XWKA 1MS7A 2P1SA 2XX9A 5A5LA 1MQDA 1QJMA 1A54A 4OFOA 5F1QA 1B3GA 1LB8A 4O3AA 3FVOA 4DLDA 3LR1A 2P2AA 4GLIA 1TFAA 1LGBC 2ZYMA 2NWJA 4NMYA 5ELVA 2ZZXA 4MF3A 1MG1A 2PMSA 5DYHA 2O6AA 4ELQA 5CMKA 3VLUA 1Q9DA 1OMPA 3G3FA 1DTZA 3T22A 4PAFA 1MDP1 1A8EA 3H6TA 4M1VA 4NQ8A 3RYDA 4KI0E 2CZLA 3SEXA 1URDA 3FVGA 3PPPA 1DCUA 2DSFA 3FXQA 3B8BA 3O6GA 4PFUA 3M3KA 4NF6B 4YICA 2VPOA 1B6HA 2XD3A 3HHGA 4BDQA 1RDXA 3QYTA 2HAVA 1M5EA 3IOVA 2I48A 2HEUA 1SPIA 5EQ9A 2KQZA 4P1LA 3RNNA 4HTGA 4NF8A 1XS5A 1B32A 5I2NA 4MFIA 5ICQA 5TU0A 2HFBA 3VVFA 4AS5A 1IXHA 1NV5A 1O63A 4EXKA 1IMCA 5BWJA 4RXLA 4ZEDA 1N0TA 4LONB 4MJOA 4F1VA 1P1UA 2H4IA 3FXRA 3ZKLA 4OVRA 1IMFA 1SW2A 3HFUA 1NV7A 1GVCA 3N26A 3TPAA 4QSDA 3T9VA 5DT6A 3U1OA 2VPNA 3TODA 1GGGA 4LQ2A 3KN8A 4I62A 1Z7ME 3H4ZA 1LFHA 2FNCA 1I69A 1Q1KA 4JBZA 1B5JA 4OVTA 2PCRA 5EYFA 4KHZE 4OVQA 2P3VA 1B5IA 3MZBA 3KJ7A 2YLNA 2QMWA 1N04A 5IM2A 3KZGA 2F35A 3CSGA 4RY1A 1FPFA 1MPCA 3KG2A 1ZU0A 4JXIA 3KBRA 1MH4A 2ZNSA 2GHBA 4GX3A 3IK6B 2UVJA 1POTA 5J1DA 3BBRA 1IMAA 1UIVA 3T9XB 3OOAA 3T93B 3A3UA 2E0SA 1IITA 1K9ZA 1VSOA 1FTLA 1B3LA 2PFYA 1B3EA 5IZZA 5IZ3A 4FJPA 2RC7A 4X04A 1JP4A 3RT8A 3AXFA 4AB5A 4JDFA 1MPBA 5FTHA 1QW0A 4I3YA 1T0KA 4QSCA 1OIBA 4QHQA 2V3UA 3CR9A 1I6QA 2CEXA 1B1HA 3HSTA 4KFQA 4PE5B 3G3GA 1QKAA 1JNFA 3Q27A 3IORA 3UORA 3LC8A 3HPIA 4YMAA 4BDOA 3CIJA 4UACA 1Y1ZA 5DW8A 2R9JA 3RLFE 2PVUA 3OO6A 3O6HA 3O29A 2X7QA 4OXVA 4P9KA 3S4UA 5EHMA 1I6BA 3GBAA 3K6WA 4HW8A 2Q2AA 2Q89A 1J1NA 3U65A 1XOCA 1H45A 5LTCA 3K2DA 4E0WA 2UYFA 3N94A 3KC0A 4F1YA 3EN3A 1RDZA 3UGWA 4O94A 3DP6A 2LAOA 3VLWA 1B58A 4K3FA 4PFWA 1I6AA 1NV2A 1FTKA 4HE0A 4FAJA 2I3WA 1SYIA 1D9VA 3B6TA 2A5TA 2D5WA 3K6VA 3M8UA 3ZKKA 4LP2B 2PBWA 4PDDA 4FIMA 3Q26A 4OVPA 1D4NA 4PBHA 1A8FA 1DPEA 5CMMA 2Y7KA 3FXBA 3TCHA 3PUWE 2DWAA 5I84A 2O51A 1MXZA 2AL5A 2Q8JA 2F78A 4X1DA 1QVSA 3C33A 1POY1 4RK2A 1SQYA 3MBPA 5ET7A 2I0BA 1MY3A 3OSQA 4MEVA 2DQVA 4E0XA 3TAJA 2A5SA 5FHMA 2OBGA 1LBVA 2HXWA 1BP5A 5H8NA 2PYYA 3FBPA 3IOWA 3B50A 1EZPA 2X7PA 3FXUA 3PU5A 4PCDA 2H99A 1D9QA 3V5AA 1MY2A 1SD3A 3TMGA 3EHTA 2XXTA 4P11A 4MNPA 1IIWA 2F5XA 4PGPA 1NUZA 4G68A 5KCJA 3IL1B 1H43A 5I5PA 4ECFA 3LUZA 4YKPA 1IXCA 2F7CA 4WEPA 2O1MA 4PAIA 4MNIA 4OQOA 4XKQA 4I8CA 2KR0A 3RTFB 4Z0IA 3IB0A 3MPLA 5KZTA 4QFLA 1INPA 1Y4CA 1II5A 3N6TA 3HV1A 2UVHA 2F7AA 1LAGE 5IAIA 5I59B 1USYE 5IZ3B 3OEKA 3TQWA 1LBZA 1B5HA 4U22A 1YCJA 1MXWA 1P1WA 4LZ5A 4I3EA 1OLAA 3QIMA 1K9YA 3RQTA 1DTGA 3RPLB 2XWIA 4GOTA 4NF5A 4MBPA 3ONMA 2UVGA 4GXAA 1NV6A 1G0IA 5I58A 3FASA 4XXUA 1LBWA 4DXUA 4G4PA 3CRBA 1MRPA 4LZ7A 3FZVA 4N6KA 2DS9A 4P3LA 3H03A 4ZEBA 3LSWA 5CC2A 4L17A 2CMOA 3TFLA 4I1DA 2OWZA 3M3FA 2V93A 3UA8A 3VVEA 4BDNA 1Y3QA 1PEBA 4PDHA 1LAHE 5FHOA 3FD3A 5AA1A 4PFIA 1FQDA 4X48A 5TP9A 4BDLA 3O9PA 2BJIA 1ZIUA 3K1NA 4YMBA 1B05A 3MP6A 3O6IA 1B52A 4NF5B 1URSA 2RINA 3OSRA 3C32A 1FTMA 1NFTA 1TT1A 3IFAA 4IO5A 2XXWA 2I4BA 1JVYA 5DVFA 4JWXA 4G2ZA 1SDXA 4HCWA 3MAMA 3VXBA 1EH3A 5AA4A 1MQJA 1AMFA 5IGAA 4WKMA 3FV2A 5DEXA 3IB1A 5ISUA 4AS4A 5EQ7A 1BK4A 2HPGA 3CG1A 1YYZA 1UTHB 4Q30B 4MLVA 4N91A 2XXQA 3KN3A 4XTCQ 3SEWA 1TXFA 2Z8EA 2D3IA 1NI9A 2Y5KA 1XT8A 1Y3NA 1WVJA 1ZBMA 4JVDA 2ZNTA 3FIRA 3BIHA 2OLBA 4H67A 3R26A 4X9TA 5CBSA 4GIZA 5CM6A 1USYH 4QFNA 4G8MA 5IKBA 4NF8B 3G3KA 5L9SA 4R73A 3UIFA 1FPEA 4FORA 3C9HA 2WBDA 1P99A 3FJ7A 3ILTB 2ONSA 3BFTA 1B7HA 1B9JA 3TTNA 3PD9A 5F24A 1FQCA 3T0JA 5DEXB 1ZTYA 5AE4A 3HHFA 4OEUA 4YAHX 4PETA 1NNTA 1FPIA 3LSXA 5DTBA 3QMFA 3MJNA 3V89B 4GF8A 1Y3PA 2ZMBA 4KR5A 4F22A 2ZXTA 1R1NA 3K01A 2GQ1A 2FIXA 1B1XA 2ZYOA 1FQEA 2NUVA 4MIJA 2F7BA 4R9FA 1KA0A 2HHMA 3MSTA 5ET5A 1YPNA 3H06B 4POXA 1HSLA 3V8XB 4JWOA 4IO4A 3OEMA 3TYHA 4OTEA 3QUFA 3MZ9A 1XC1A 2VP1A 3TZAA 2I3VA 5I57A 2ZZVA 4N17A 1JETA 3RUMA 2QJEA 4ZZAA 1SVXB 4H8IA 3N5LA 1N7XA 2G29A 4GVOA 4PE3A 3FATA 4TLMB 3E4RA 2ONKE 4U21A 4QFPA 4P56A 5CRYA 3A3CA 1PC3A 4MNCA 4R6YA 3IO4A 4U1ZA 4DI3D 2F6PA 1SBPA 3TCGA 4OHNA 4IB2A 1SI1A 4F3SA 3TTLA 1B7ZA 4NTLA 2Q8MA 2XXUA 3OO7A 3PMXA 4BDRA 4DI4B 5ESYA 1NV4A 3SEVA 4H46A 1R6ZA 3KFMA 2ZYKA 4GWUA 1LBYA 5H8HA 2XWVA 3T9UA 4R6HA 5CMBA 4N6PA 4X8RA 5JEIA 1WODA 4IY6A 4OVJA 3WAEA 4GFRA 1PB8A 1IZ1A 3PV0E 4OFLA 1ZLQA 3WAFA 1B4ZA 2H9BA 3LBSA 1IQ7A 4NF0A 3C4MA 1XI6A 4OETA 4GX6A 5I59A 3UK4A 1MQGA 3TTRA 1JW1A 3SETA 1B4HA 1UTHA 4KYSA 5ITOA 4NE4A 2HAUA 2HQ0A 4C1UA 3KGCA 3JV9A 4YKIA 2P3NA 3K0VA 3FJGA 3BIGA 1US4A 2HCAA 1IXGA 1FPLA 3PPNA 5H8HB 2BJJX 2XXKA 2OX3A 3H3GA 1N76A 2QPQA 5H8FA 2H25A 3EPEA 4FEBA 2ZZWA 1QUKA 2D21A 3ILUB 3KSJA 3C35A 3PUVE 1MH3A 4DCXA 1FBFA 3PPRA 4FBPA 4NF4A 1BIYA 1FSAA 4PFRA 4EUOA 1XHYA 4ELOA 4EQ7A 3U93A 3NOHA 2VD3A 1RYXA 4HE1A 1FRPA 4O8MA 3FV1A 1DSNA 4F2OA 1GR2A 5B7DA 4MCOA 4GBVA 2AYSA 1AOVA 4UABA 5F7VA 2UXAA 1NH8A 5ICTA 3QUJA 4PFYA 4HCYA 1SYHA 1LBCA 1OVTA 1BKAA 3OO8A 4NG7A 2F6GA 4NWDA 1ATGA 4PAKA 5AA2B 1RYOA 1YZ0A 3T9HB 3U92A 1TFDA 2DOJA 3QXMA 1IEJA 3KN7A 4KYDA 1LCTA 3QSLA 1FW0A 1ZJLA 2O7IA 1MY4A 2Z22A 3ISPA 3DP8A 4O3BA 4PGNA 3MVZA 1FBDA 1B7UA 2VGQA 3CFXA 1P1OA 3UN6A 3TEPA 4OENA 5TPAB 2QMXA 2HXRA 4RA1A 2R8TA 2REJA 2V3QA 3D4CA 2G93A 4XFEA 1OQHA 1OVBA 5I56B 1HSJA 1SW1A 4POWA 3UP9A 3PD8A 5FBPA 2OK2A 3IOUA 2CEYA 3K1MA 2QS2A 1LBBA 4H5FA 3I3VA 4FEDA 4IR8A 5AA2A 4ZDMA 4N6DA 1JW4A 2RF1A 5AA2D 5IZ1A 5EYHA 2V3TA 4QFOA 4PFTA 4XKPA 2W7YA 4GWXA 4R9GA 4PBQA 3MUQA 1B2HA 1UTBA 3T96B 2O68A 3PUXE 3TTMA 4AB6A 3RPWA 3ZSFA 2DXRA 5L9MA 1AIVA 1PB9A 2HZLA 5H8NB 5CBRA 3HN0A 1FJ9A 1MM6A 3O2AA 5HPQA 2VD2A 3MP8A 1VDWA 1MPDA 4P47A 1XVYA 4GRKA 2V84A 3SERA 2F97A 4O7MA 5K2YA 1QGXA 1UTBB 1Q35A 5I3SA 1QKBA 3PTYA 3QK6A 4XKNA 2OWTA 2WYKA 2VT5A 2QRYA 2XXXA 4GL8A 2I4CA 3SESA 4NGUA 3K00A 3Q25A 3FGSA 2DWJA 1NH7A 3MC2A 3PMWA 5ET6A 4LZ8A 1LFGA 1Y20A 2THIA 2REGA 1NV0A 1OLCA 4ONYA 2XWOA 4YU0A 4LN5A 1LEVA 2WYPA 5FHNA 1QUIA 4EF2A 3VXCA 5DVIA 2Y7IA 2YJPA 4TOZA 2XXIA 4G68C 4OANA 1O64A 1A99A 5I2KA 1NNKA 4EDPA 1KZ8A 4NHBA 1EYIA 3IJXB 1FBCA 3VVDA 4I9DA 3O28A 2QS4A 2Y5LA 4PTKA 5DVJA 4F1UA 1N3WA 2QSXA 4OMBA 4GXSB 5CMCA 5T3JA 4XEQA 2GFEA 4U1OA 1FQAA
chains in the Genus database with same CATH topology
4MIJA 3KBZA 4P1EA 1YZ0A 2Q74A 3ROJA 1SPIA 1KA0A 2HHMA 2XA5A 3MSTA 4MX6A 1K9ZA 2KQZA 5EQ9A 5ET5A 5J16A 4NF0A 2HZKA 2PFYA 3A29A 4P1LA 4YZZA 4PFBA 1XI6A 4HCWA 4HE2A 4PDDA 4GX6A 5IZ3B 4PC9A 2CZIA 4O7MA 4KXPA 1LBZA 5ET8A 5IZ3A 5I7IA 5IGAA 5IZZA 4OVPA 4PBHA 3ISPA 4AS4A 4X04A 1BK4A 1JP4A 2L5VA 3KC1A 5EQ7A 1QGXA 4AS5A 1NV1A 1NV5A 3FXBA 2DE2A 4N4UA 4NX1A 2HPGA 4I3EA 4PGNA 5JK4A 1FBDA 1K9YA 1YYZA 2ZZVA 4GBWA 4N17A 3T1BA 1LBXA 4N91A 2B4MA 5I3SA 3PTYA 1IMCA 2FIEA 2XWIA 3RPLB 1CNQA 4OVSA 2F3DA 4I3YA 2P3NA 2WEFA 2WX9A 2WYKA 2VT5A 1IMEA 4NN3A 1YXIA 4MJOA 4QBAA 1FPGA 2DDKA 1NI9A 1NV6A 2HXRA 2Y5KA 3BIGA 4F1VA 1FPDA 1G0IA 2R8TA 2V3QA 4N8YA 4O7IA 4PE3A 4GWSA 4NGUA 4MMPA 2CEXA 2QVUA 4OVRA 1FPLA 1IMFA 1NUYA 4JVDA 4XFEA 4XF5A 1LBWA 4JVIA 2XWKA 3BIHA 2QVRA 3HFUA 4GWWA 4MEVA 4QXDA 5EYGA 3RPLA 1NV7A 5ET6A 3MYUA 5A5LA 5FBPA 2XXKA 1NV3A 2OX3A 4P56A 4H45A 1LBVA 1FBPA 4MAGA 4N6KA 4X9TA 2CEYA 4P3LA 1NV0A 1AWBA 2QPQA 4N15A 4PF8A 2F3BA 2QFLA 2XWOA 1FTAA 5CM6A 4MNCA 4IR8A 5ET7A 1DK4A 2VPNA 3FBPA 4I40A 4LN5A 2ZZWA 4DI3D 3B50A 4GX4A 3CHGA 1IMDA 1LEVA 2DE4A 4PCDA 3E79A 4N81A 2ZZXA 4N6DA 1D9QA 2WYPA 5DW8A 5LDZA 1G0HA 5IZ1A 4JVCA 2DE3A 5EYHA 1FBFA 1KA1A 1FPEA 1FPJA 1FPKA 4FBPA 4NAPA 4GWXA 1FSAA 3EKIA 2OWZA 4PFRA 2WBDA 4P9KA 2Q8MA 1FBEA 2FHYA 1RDYA 4MNPA 4DI4B 1EYKA 2DVZA 5EQ8A 3W9WA 2F5XA 1NV4A 5ESYA 3GYYA 4PBQA 3NOHA 4OVTA 1NUZA 1IMBA 1FJ6A 1Q9DA 4OANA 4HE1A 4PGPA 4H46A 3U65A 3W9VA 2CZHA 1FBHA 4HXVA 2Q9TA 1FRPA 4MHFA 2FBPA 4PDHA 4PF6A 4O8MA 2PCRA 4PAFA 3SZPA 1KZ8A 4OVQA 2JJKA 5F24A 4NHBA 5I5PA 2P3VA 4MCOA 4M1VA 4NQ8A 1EYJA 4PFIA 3RYDA 1EYIA 3T0JA 4OA4A 3LUZA 5IM2A 1FBCA 4GWUA 2WBBA 3LV0A 1LBYA 2CZKA 2XWVA 4GBVA 3KC0A 2BJIA 1FPFA 4PAIA 4PETA 1RDZA 2PFZA 4MNIA 1FPIA 3E78A 4UABA 1DCUA 2B4LA 2HZLA 2KR0A 1FPBA 5LTCA 4O94A 2Y5LA 3B8BA 4PTKA 3QMFA 4F1UA 1NUXA 4GX3A 4HCYA 4X8RA 4F18A 4NG7A 1NV2A 4YICA 5J1DA 4HE0A 1IMAA 3D1RA 5T3JA 1INPA 1FJ9A 2FVZA 2VPOA 1DBZA 2MKZA 4PAKA 1RDXA 4P8BA 5EQAA 1FBGA 4F19A 4GWYA 2GQ1A 1NUWA 1VDWA 2FIXA 4G61A 4XEQA 4N8GA 2V4CA 3IFCA 4GWZA 2QVVA 4P47A 3IFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MIJ A;  4P1E A;  4MX6 A;  2XA5 A;  4NF0 A;  2HZK A;  2PFY A;  4P1L A;  4YZZ A;  4PFB A;  4PDD A;  4PC9 A;  4O7M A;  5IZZ A;  5I7I A;  5IGA A;  4OVP A;  4PBH A;  4X04 A;  4N4U A;  3FXB A;  4NX1 A;  4PGN A;  2HPG A;  2ZZV A;  4N17 A;  4N91 A;  2XWI A;  4OVS A;  2WX9 A;  2WYK A;  4NN3 A;  4N8Y A;  4PE3 A;  4NGU A;  4MMP A;  2CEX A;  4XFE A;  4OVR A;  4XF5 A;  2XWK A;  4MEV A;  2XXK A;  4P56 A;  4MAG A;  4N6K A;  2CEY A;  4P3L A;  4N15 A;  4PF8 A;  5CM6 A;  2XWO A;  4MNC A;  2VPN A;  4LN5 A;  4DI3 D;  2ZZW A;  3B50 A;  4PCD A;  2ZZX A;  4N6D A;  2WYP A;  4NAP A;  4PFR A;  4P9K A;  4MNP A;  4DI4 B;  3GYY A;  4PBQ A;  4OVT A;  4PGP A;  4OAN A;  3U65 A;  4MHF A;  4PF6 A;  4PDH A;  4O8M A;  4PAF A;  4OVQ A;  5I5P A;  5LTC A;  4NHB A;  4MCO A;  4NQ8 A;  4PFI A;  4OA4 A;  5IM2 A;  2XWV A;  4PAI A;  4PET A;  2PFZ A;  4MNI A;  4UAB A;  2HZL A;  4O94 A;  4X8R A;  4NG7 A;  4YIC A;  2VPO A;  4PAK A;  4P8B A;  4XEQ A;  4N8G A;  2V4C A;  4P47 A; 
#chains in the Genus database with same CATH topology
 3TTK A;  4OZ9 A;  3K4U A;  2XA5 A;  3K6X A;  4DZ1 A;  3KJT A;  1NKX A;  1JQF A;  1UIU A;  3KOT A;  5I56 A;  5TP9 B;  3S9M C;  4F2Q A;  2L5V A;  1S7Y A;  2DWH A;  3EQ1 A;  1SW4 A;  4KQP A;  4H8J A;  1IME A;  2O69 A;  4OWD A;  4QBA A;  2QS1 A;  3TUS A;  2PX1 A;  1FTO A;  3O97 A;  4GWO A;  5KDT B;  2Y7R A;  4G68 B;  2ESN A;  4G8H A;  5CI5 A;  3SDF A;  4EQB A;  2IEE A;  3IAZ A;  4R2B A;  2F8D A;  1FBP A;  1S50 A;  5I57 B;  1FCK A;  2F36 A;  4H65 A;  3ODB A;  2F34 A;  3IR1 A;  4I40 A;  3MWB A;  3E79 A;  4N81 A;  4R75 A;  1FPJ A;  1M5C A;  5JTY A;  4UA8 A;  4F31 B;  2V25 A;  3W9W A;  4NF4 B;  1DMB A;  1FJ6 A;  5L8D A;  4F39 A;  3GLB A;  1YTV A;  3M3L A;  1EYJ A;  4OA4 A;  3IOT A;  1ZMG A;  2ZYN A;  3Q28 A;  1HSE A;  2Y84 A;  3THI A;  2B4L A;  1FPB A;  3G3I A;  4OYV A;  2Z8D A;  5B70 A;  4F18 A;  1ELJ A;  1JVX A;  3D1R A;  3IJO B;  4ZEK A;  2GH9 A;  5KDT A;  3VLV A;  4BDM A;  4P8B A;  5EQA A;  4GWY A;  4N8G A;  4YKK A;  4Z7E A;  4WXJ A;  5H8Q B;  4X1B A;  3IX1 A;  3IB2 A;  5ITP A;  3FVN A;  3GXA A;  4GD5 A;  3A29 A;  4YB6 A;  1VE4 A;  4RNS A;  4RPO A;  3S2V A;  2RCB A;  3HO7 A;  1H3D A;  4ZEI A;  3EHU A;  1WDN A;  5EHS A;  1LBX A;  3EF7 A;  2FIE A;  1BTJ A;  2Y7P A;  2H5Y A;  3P7I A;  5JTY B;  2O84 X;  3LSF B;  3CVG A;  3C36 A;  1CE2 A;  2GRV A;  3MVX A;  3OO9 A;  1OQG A;  3W15 C;  4FE8 A;  3VV5 A;  2I49 A;  4U4S A;  4H45 A;  4MAG A;  1LAX A;  3K6U A;  1B0H A;  4N07 A;  2OJT A;  4KCD A;  1LAF E;  1S9T A;  1IUD A;  5I2N B;  3H6U A;  2XXH A;  1M5D A;  4H6D A;  4H1X A;  1FBE A;  1RDY A;  5K2X A;  2CZH A;  4MHF A;  2FBP A;  2NOO A;  3SZP A;  5KCJ B;  2YPN A;  1PBP A;  3DEL B;  3BKI B;  1PDA A;  2WBB A;  4P0I A;  1IXI A;  3RGY A;  1DOT A;  1B3H A;  4H0W A;  1NUX A;  1A55 A;  2PT1 A;  4QFK A;  4GL0 A;  1DBZ A;  3L6G A;  3R7X A;  4DCY A;  1SI0 A;  4Q8R A;  3HCQ A;  2DP8 A;  1SW5 A;  3JZJ A;  1AH5 A;  3MVW A;  4RJZ A;  3S9L C;  1O7T A;  1PBQ A;  4PP0 A;  4KXP A;  5I7I A;  3TDJ A;  4YB7 A;  4LAT A;  3MZ1 A;  2IA4 A;  4Q5T A;  2QL3 A;  2B4M A;  2DYX A;  4BLA A;  3K02 A;  4OVS A;  3FJM A;  2DVC A;  4R6K A;  4N8Y A;  1URG A;  2NXO A;  3FUZ A;  2I6E A;  4QRZ A;  3CI8 A;  3D4G A;  3R6U A;  2QVR A;  2XX8 A;  1NV3 A;  1ZKB A;  2RCA A;  3B7D A;  2OZZ A;  1DPP A;  1NL5 A;  1MXX A;  4ZZE A;  4EXL A;  1ANF A;  1H44 A;  4RPN A;  5LDZ A;  1P1N A;  1B0L A;  3RY3 A;  2OWS A;  1N84 A;  4JVC A;  4YB5 A;  2OCU A;  3V83 A;  3EKI A;  1D9Y A;  4XIG Q;  2FHY A;  3GYY A;  1IMB A;  1FBH A;  4EF1 A;  3OXN A;  2ZNU A;  4QSE A;  3VE1 B;  4DXC A;  1N3X A;  2CZK A;  3GBB A;  2XXP A;  2AL4 A;  3E9X A;  3E78 A;  2AIX A;  2O1L A;  4XKR A;  4JSO A;  1TWY A;  4YKJ A;  1BLF A;  1Z7N E;  3MVY A;  3CFL A;  4Q0C A;  3E3K A;  1FBG A;  3RN8 A;  1RKM A;  1VFD A;  3S9E A;  4R74 A;  5H8Q A;  1VR5 A;  2X26 A;  4GWZ A;  1XVX A;  4P1E A;  3H6W A;  5H8F B;  1MQI A;  4YZZ A;  3U72 A;  2VHA A;  2FYI A;  2R6G E;  4ZE8 A;  5FTI A;  4JB7 A;  3KC1 A;  5HBC A;  3C31 A;  3IO6 A;  4ZEC A;  3KOS A;  2ANJ A;  1M5B A;  3A09 A;  4TQU Q;  5A5X B;  2VOZ A;  2QVU A;  1NUY A;  4XF5 A;  1NNP A;  3RPL A;  4R72 A;  2XXV A;  3MYU A;  4RYA A;  2ONR A;  3TKD A;  4IGT A;  5BUU A;  1AWB A;  3DP4 A;  4N15 A;  2F3B A;  2QFL A;  1FTA A;  4ELR A;  3Q29 A;  3H6V A;  3U8Q A;  1EZO A;  1FPK A;  1NNF A;  2ALU A;  3JYR A;  1PB7 A;  4IGR A;  1EYK A;  2Q2C A;  3W9V A;  4HXV A;  2Q9T A;  3RT6 B;  2JJK A;  1AL3 A;  3T1B A;  1L5T A;  1YAE A;  1LLS A;  3LV0 A;  4R2F A;  5A5X A;  2B65 A;  3B6W A;  4HS7 A;  5LOM A;  4OES A;  4G77 A;  3ECR A;  2UVI A;  4QF9 A;  3TCF A;  4KYE A;  2DXY A;  1M5F A;  4NWC A;  1R9L A;  2QVV A;  1MXY A;  3S9N C;  1B40 A;  1MQH A;  4MX6 A;  2O7U A;  1LCF A;  5J16 A;  2HZK A;  4HE2 A;  4ZE9 A;  3CSB A;  2Y7W A;  1JEV A;  4OEV A;  4F3G A;  3E13 X;  4KPT A;  2XXY A;  1GTK A;  2DE2 A;  1LB9 A;  3G3J A;  5JK4 A;  4ELP A;  1CNQ A;  5AA4 B;  2F3D A;  2WX9 A;  1Y4T A;  1YXI A;  3PMV A;  3DM0 A;  1FPG A;  1JEU A;  3PGF A;  4GWS A;  1GV8 A;  4TLL B;  1QUJ A;  1MXU A;  4GWW A;  2GHA A;  4IO3 A;  3MW0 A;  1US5 A;  4PF8 A;  4THI A;  3EHS A;  3CG3 A;  1DK4 A;  2KLF A;  4OER A;  3L6H A;  3N6U A;  1IMD A;  2DE4 A;  3FVK A;  4RK9 A;  1LST A;  1KWH A;  2DE3 A;  2M8C A;  4AQ4 A;  3MQ9 A;  4NAP A;  3RTW B;  4JSD A;  3QAX A;  5EQ8 A;  3H7M A;  1MM7 A;  4O3C A;  1F9B A;  3VFJ A;  3PPO A;  2R71 A;  2XD2 A;  4EQ9 A;  3OEN A;  4IY5 A;  3G3H A;  2ABH A;  4JWY A;  3BFU A;  1R9Q A;  2B3F A;  3DLN A;  2I0C A;  4IO7 A;  4ND9 A;  5H8S A;  1A40 A;  2FVZ A;  4F19 A;  2MKZ A;  3I6V A;  2E1S A;  3F11 A;  3O66 A;  2WKY A;  5TPA A;  4ISU A;  1NUW A;  3B6Q A;  4G61 A;  4G8N A;  1NMU A;  3I5O A;  2FA7 A;  1UQW A;  1P1Q A;  1N7W A;  4LQ5 A;  3ROJ A;  2DWI A;  4FAT A;  3OD7 A;  2Q88 A;  2I58 A;  2XX7 A;  3SKP A;  4N13 A;  4LA9 A;  4P0G A;  4H5G A;  4PFB A;  4ESX A;  4PC9 A;  4IO6 A;  1FQB A;  3MPK A;  4ZS9 A;  3KSX A;  1NV1 A;  4ZEF A;  3ZS6 A;  3USD A;  1Y9U A;  3PUZ E;  4WED A;  1B51 A;  3LUY A;  4O7I A;  3K1P A;  3U94 A;  4QXD A;  4DE8 A;  1H76 A;  4OFJ A;  1VFE A;  4ESW A;  4C0R A;  2NVU B;  2XXR A;  5L9O A;  2Z8F A;  3CFZ A;  4GX4 A;  1D3K A;  1QUL A;  3GZG A;  3CHG A;  3PPQ A;  4NED A;  3TEL A;  4DXB A;  1G0H A;  1KA1 A;  1A7L A;  1JW5 A;  3OMB A;  2DVZ A;  3SEY A;  4DDD A;  4U2R A;  4PF6 A;  1EZ9 A;  4U23 A;  1MY0 A;  1B46 A;  1MXV A;  3G7W A;  5M2V A;  2PFZ A;  4MLQ A;  4F29 A;  2B3B A;  4F3P A;  4U4X A;  1B3F A;  4KCC A;  3C34 A;  4LVQ A;  5I58 B;  2XHD A;  1Y1M A;  3MP1 A;  5AA3 A;  2P0S A;  4KD5 A;  4MH5 A;  3SEU A;  2V4C A;  3PUY E;  3IFC A;  2RKM A;  3OEL A;  3KBZ A;  1CB6 A;  2Q74 A;  2QS3 A;  1MY1 A;  4DIG A;  1MDQ A;  4PQJ A;  2Z23 A;  2A5T B;  3KEI A;  2CZI A;  5ET8 A;  1LFI A;  2RC9 A;  3LSL A;  4N4U A;  4NX1 A;  4F3B A;  2H98 A;  1EU8 A;  4GBW A;  2PT2 A;  4NF6 A;  4LUB A;  5HM4 B;  2WEF A;  4M4G A;  4NN3 A;  3VDF A;  1FTJ A;  4GQO A;  3T66 A;  2DDK A;  3TQL A;  1FQF A;  1FPD A;  2UYE A;  4FEC A;  2RC8 A;  5EYG A;  5I2K B;  4IO2 A;  4MMP A;  4C1T A;  4JVI A;  2XWK A;  1MS7 A;  2P1S A;  2XX9 A;  5A5L A;  1MQD A;  1QJM A;  1A54 A;  4OFO A;  5F1Q A;  1B3G A;  1LB8 A;  4O3A A;  3FVO A;  4DLD A;  3LR1 A;  2P2A A;  4GLI A;  1TFA A;  1LGB C;  2ZYM A;  2NWJ A;  4NMY A;  5ELV A;  2ZZX A;  4MF3 A;  1MG1 A;  2PMS A;  5DYH A;  2O6A A;  4ELQ A;  5CMK A;  3VLU A;  1Q9D A;  1OMP A;  3G3F A;  1DTZ A;  3T22 A;  4PAF A;  1MDP 1;  1A8E A;  3H6T A;  4M1V A;  4NQ8 A;  3RYD A;  4KI0 E;  2CZL A;  3SEX A;  1URD A;  3FVG A;  3PPP A;  1DCU A;  2DSF A;  3FXQ A;  3B8B A;  3O6G A;  4PFU A;  3M3K A;  4NF6 B;  4YIC A;  2VPO A;  1B6H A;  2XD3 A;  3HHG A;  4BDQ A;  1RDX A;  3QYT A;  2HAV A;  1M5E A;  3IOV A;  2I48 A;  2HEU A;  1SPI A;  5EQ9 A;  2KQZ A;  4P1L A;  3RNN A;  4HTG A;  4NF8 A;  1XS5 A;  1B32 A;  5I2N A;  4MFI A;  5ICQ A;  5TU0 A;  2HFB A;  3VVF A;  4AS5 A;  1IXH A;  1NV5 A;  1O63 A;  4EXK A;  1IMC A;  5BWJ A;  4RXL A;  4ZED A;  1N0T A;  4LON B;  4MJO A;  4F1V A;  1P1U A;  2H4I A;  3FXR A;  3ZKL A;  4OVR A;  1IMF A;  1SW2 A;  3HFU A;  1NV7 A;  1GVC A;  3N26 A;  3TPA A;  4QSD A;  3T9V A;  5DT6 A;  3U1O A;  2VPN A;  3TOD A;  1GGG A;  4LQ2 A;  3KN8 A;  4I62 A;  1Z7M E;  3H4Z A;  1LFH A;  2FNC A;  1I69 A;  1Q1K A;  4JBZ A;  1B5J A;  4OVT A;  2PCR A;  5EYF A;  4KHZ E;  4OVQ A;  2P3V A;  1B5I A;  3MZB A;  3KJ7 A;  2YLN A;  2QMW A;  1N04 A;  5IM2 A;  3KZG A;  2F35 A;  3CSG A;  4RY1 A;  1FPF A;  1MPC A;  3KG2 A;  1ZU0 A;  4JXI A;  3KBR A;  1MH4 A;  2ZNS A;  2GHB A;  4GX3 A;  3IK6 B;  2UVJ A;  1POT A;  5J1D A;  3BBR A;  1IMA A;  1UIV A;  3T9X B;  3OOA A;  3T93 B;  3A3U A;  2E0S A;  1IIT A;  1K9Z A;  1VSO A;  1FTL A;  1B3L A;  2PFY A;  1B3E A;  5IZZ A;  5IZ3 A;  4FJP A;  2RC7 A;  4X04 A;  1JP4 A;  3RT8 A;  3AXF A;  4AB5 A;  4JDF A;  1MPB A;  5FTH A;  1QW0 A;  4I3Y A;  1T0K A;  4QSC A;  1OIB A;  4QHQ A;  2V3U A;  3CR9 A;  1I6Q A;  2CEX A;  1B1H A;  3HST A;  4KFQ A;  4PE5 B;  3G3G A;  1QKA A;  1JNF A;  3Q27 A;  3IOR A;  3UOR A;  3LC8 A;  3HPI A;  4YMA A;  4BDO A;  3CIJ A;  4UAC A;  1Y1Z A;  5DW8 A;  2R9J A;  3RLF E;  2PVU A;  3OO6 A;  3O6H A;  3O29 A;  2X7Q A;  4OXV A;  4P9K A;  3S4U A;  5EHM A;  1I6B A;  3GBA A;  3K6W A;  4HW8 A;  2Q2A A;  2Q89 A;  1J1N A;  3U65 A;  1XOC A;  1H45 A;  5LTC A;  3K2D A;  4E0W A;  2UYF A;  3N94 A;  3KC0 A;  4F1Y A;  3EN3 A;  1RDZ A;  3UGW A;  4O94 A;  3DP6 A;  2LAO A;  3VLW A;  1B58 A;  4K3F A;  4PFW A;  1I6A A;  1NV2 A;  1FTK A;  4HE0 A;  4FAJ A;  2I3W A;  1SYI A;  1D9V A;  3B6T A;  2A5T A;  2D5W A;  3K6V A;  3M8U A;  3ZKK A;  4LP2 B;  2PBW A;  4PDD A;  4FIM A;  3Q26 A;  4OVP A;  1D4N A;  4PBH A;  1A8F A;  1DPE A;  5CMM A;  2Y7K A;  3FXB A;  3TCH A;  3PUW E;  2DWA A;  5I84 A;  2O51 A;  1MXZ A;  2AL5 A;  2Q8J A;  2F78 A;  4X1D A;  1QVS A;  3C33 A;  1POY 1;  4RK2 A;  1SQY A;  3MBP A;  5ET7 A;  2I0B A;  1MY3 A;  3OSQ A;  4MEV A;  2DQV A;  4E0X A;  3TAJ A;  2A5S A;  5FHM A;  2OBG A;  1LBV A;  2HXW A;  1BP5 A;  5H8N A;  2PYY A;  3FBP A;  3IOW A;  3B50 A;  1EZP A;  2X7P A;  3FXU A;  3PU5 A;  4PCD A;  2H99 A;  1D9Q A;  3V5A A;  1MY2 A;  1SD3 A;  3TMG A;  3EHT A;  2XXT A;  4P11 A;  4MNP A;  1IIW A;  2F5X A;  4PGP A;  1NUZ A;  4G68 A;  5KCJ A;  3IL1 B;  1H43 A;  5I5P A;  4ECF A;  3LUZ A;  4YKP A;  1IXC A;  2F7C A;  4WEP A;  2O1M A;  4PAI A;  4MNI A;  4OQO A;  4XKQ A;  4I8C A;  2KR0 A;  3RTF B;  4Z0I A;  3IB0 A;  3MPL A;  5KZT A;  4QFL A;  1INP A;  1Y4C A;  1II5 A;  3N6T A;  3HV1 A;  2UVH A;  2F7A A;  1LAG E;  5IAI A;  5I59 B;  1USY E;  5IZ3 B;  3OEK A;  3TQW A;  1LBZ A;  1B5H A;  4U22 A;  1YCJ A;  1MXW A;  1P1W A;  4LZ5 A;  4I3E A;  1OLA A;  3QIM A;  1K9Y A;  3RQT A;  1DTG A;  3RPL B;  2XWI A;  4GOT A;  4NF5 A;  4MBP A;  3ONM A;  2UVG A;  4GXA A;  1NV6 A;  1G0I A;  5I58 A;  3FAS A;  4XXU A;  1LBW A;  4DXU A;  4G4P A;  3CRB A;  1MRP A;  4LZ7 A;  3FZV A;  4N6K A;  2DS9 A;  4P3L A;  3H03 A;  4ZEB A;  3LSW A;  5CC2 A;  4L17 A;  2CMO A;  3TFL A;  4I1D A;  2OWZ A;  3M3F A;  2V93 A;  3UA8 A;  3VVE A;  4BDN A;  1Y3Q A;  1PEB A;  4PDH A;  1LAH E;  5FHO A;  3FD3 A;  5AA1 A;  4PFI A;  1FQD A;  4X48 A;  5TP9 A;  4BDL A;  3O9P A;  2BJI A;  1ZIU A;  3K1N A;  4YMB A;  1B05 A;  3MP6 A;  3O6I A;  1B52 A;  4NF5 B;  1URS A;  2RIN A;  3OSR A;  3C32 A;  1FTM A;  1NFT A;  1TT1 A;  3IFA A;  4IO5 A;  2XXW A;  2I4B A;  1JVY A;  5DVF A;  4JWX A;  4G2Z A;  1SDX A;  4HCW A;  3MAM A;  3VXB A;  1EH3 A;  5AA4 A;  1MQJ A;  1AMF A;  5IGA A;  4WKM A;  3FV2 A;  5DEX A;  3IB1 A;  5ISU A;  4AS4 A;  5EQ7 A;  1BK4 A;  2HPG A;  3CG1 A;  1YYZ A;  1UTH B;  4Q30 B;  4MLV A;  4N91 A;  2XXQ A;  3KN3 A;  4XTC Q;  3SEW A;  1TXF A;  2Z8E A;  2D3I A;  1NI9 A;  2Y5K A;  1XT8 A;  1Y3N A;  1WVJ A;  1ZBM A;  4JVD A;  2ZNT A;  3FIR A;  3BIH A;  2OLB A;  4H67 A;  3R26 A;  4X9T A;  5CBS A;  4GIZ A;  5CM6 A;  1USY H;  4QFN A;  4G8M A;  5IKB A;  4NF8 B;  3G3K A;  5L9S A;  4R73 A;  3UIF A;  1FPE A;  4FOR A;  3C9H A;  2WBD A;  1P99 A;  3FJ7 A;  3ILT B;  2ONS A;  3BFT A;  1B7H A;  1B9J A;  3TTN A;  3PD9 A;  5F24 A;  1FQC A;  3T0J A;  5DEX B;  1ZTY A;  5AE4 A;  3HHF A;  4OEU A;  4YAH X;  4PET A;  1NNT A;  1FPI A;  3LSX A;  5DTB A;  3QMF A;  3MJN A;  3V89 B;  4GF8 A;  1Y3P A;  2ZMB A;  4KR5 A;  4F22 A;  2ZXT A;  1R1N A;  3K01 A;  2GQ1 A;  2FIX A;  1B1X A;  2ZYO A;  1FQE A;  2NUV A;  4MIJ A;  2F7B A;  4R9F A;  1KA0 A;  2HHM A;  3MST A;  5ET5 A;  1YPN A;  3H06 B;  4POX A;  1HSL A;  3V8X B;  4JWO A;  4IO4 A;  3OEM A;  3TYH A;  4OTE A;  3QUF A;  3MZ9 A;  1XC1 A;  2VP1 A;  3TZA A;  2I3V A;  5I57 A;  2ZZV A;  4N17 A;  1JET A;  3RUM A;  2QJE A;  4ZZA A;  1SVX B;  4H8I A;  3N5L A;  1N7X A;  2G29 A;  4GVO A;  4PE3 A;  3FAT A;  4TLM B;  3E4R A;  2ONK E;  4U21 A;  4QFP A;  4P56 A;  5CRY A;  3A3C A;  1PC3 A;  4MNC A;  4R6Y A;  3IO4 A;  4U1Z A;  4DI3 D;  2F6P A;  1SBP A;  3TCG A;  4OHN A;  4IB2 A;  1SI1 A;  4F3S A;  3TTL A;  1B7Z A;  4NTL A;  2Q8M A;  2XXU A;  3OO7 A;  3PMX A;  4BDR A;  4DI4 B;  5ESY A;  1NV4 A;  3SEV A;  4H46 A;  1R6Z A;  3KFM A;  2ZYK A;  4GWU A;  1LBY A;  5H8H A;  2XWV A;  3T9U A;  4R6H A;  5CMB A;  4N6P A;  4X8R A;  5JEI A;  1WOD A;  4IY6 A;  4OVJ A;  3WAE A;  4GFR A;  1PB8 A;  1IZ1 A;  3PV0 E;  4OFL A;  1ZLQ A;  3WAF A;  1B4Z A;  2H9B A;  3LBS A;  1IQ7 A;  4NF0 A;  3C4M A;  1XI6 A;  4OET A;  4GX6 A;  5I59 A;  3UK4 A;  1MQG A;  3TTR A;  1JW1 A;  3SET A;  1B4H A;  1UTH A;  4KYS A;  5ITO A;  4NE4 A;  2HAU A;  2HQ0 A;  4C1U A;  3KGC A;  3JV9 A;  4YKI A;  2P3N A;  3K0V A;  3FJG A;  3BIG A;  1US4 A;  2HCA A;  1IXG A;  1FPL A;  3PPN A;  5H8H B;  2BJJ X;  2XXK A;  2OX3 A;  3H3G A;  1N76 A;  2QPQ A;  5H8F A;  2H25 A;  3EPE A;  4FEB A;  2ZZW A;  1QUK A;  2D21 A;  3ILU B;  3KSJ A;  3C35 A;  3PUV E;  1MH3 A;  4DCX A;  1FBF A;  3PPR A;  4FBP A;  4NF4 A;  1BIY A;  1FSA A;  4PFR A;  4EUO A;  1XHY A;  4ELO A;  4EQ7 A;  3U93 A;  3NOH A;  2VD3 A;  1RYX A;  4HE1 A;  1FRP A;  4O8M A;  3FV1 A;  1DSN A;  4F2O A;  1GR2 A;  5B7D A;  4MCO A;  4GBV A;  2AYS A;  1AOV A;  4UAB A;  5F7V A;  2UXA A;  1NH8 A;  5ICT A;  3QUJ A;  4PFY A;  4HCY A;  1SYH A;  1LBC A;  1OVT A;  1BKA A;  3OO8 A;  4NG7 A;  2F6G A;  4NWD A;  1ATG A;  4PAK A;  5AA2 B;  1RYO A;  1YZ0 A;  3T9H B;  3U92 A;  1TFD A;  2DOJ A;  3QXM A;  1IEJ A;  3KN7 A;  4KYD A;  1LCT A;  3QSL A;  1FW0 A;  1ZJL A;  2O7I A;  1MY4 A;  2Z22 A;  3ISP A;  3DP8 A;  4O3B A;  4PGN A;  3MVZ A;  1FBD A;  1B7U A;  2VGQ A;  3CFX A;  1P1O A;  3UN6 A;  3TEP A;  4OEN A;  5TPA B;  2QMX A;  2HXR A;  4RA1 A;  2R8T A;  2REJ A;  2V3Q A;  3D4C A;  2G93 A;  4XFE A;  1OQH A;  1OVB A;  5I56 B;  1HSJ A;  1SW1 A;  4POW A;  3UP9 A;  3PD8 A;  5FBP A;  2OK2 A;  3IOU A;  2CEY A;  3K1M A;  2QS2 A;  1LBB A;  4H5F A;  3I3V A;  4FED A;  4IR8 A;  5AA2 A;  4ZDM A;  4N6D A;  1JW4 A;  2RF1 A;  5AA2 D;  5IZ1 A;  5EYH A;  2V3T A;  4QFO A;  4PFT A;  4XKP A;  2W7Y A;  4GWX A;  4R9G A;  4PBQ A;  3MUQ A;  1B2H A;  1UTB A;  3T96 B;  2O68 A;  3PUX E;  3TTM A;  4AB6 A;  3RPW A;  3ZSF A;  2DXR A;  5L9M A;  1AIV A;  1PB9 A;  2HZL A;  5H8N B;  5CBR A;  3HN0 A;  1FJ9 A;  1MM6 A;  3O2A A;  5HPQ A;  2VD2 A;  3MP8 A;  1VDW A;  1MPD A;  4P47 A;  1XVY A;  4GRK A;  2V84 A;  3SER A;  2F97 A;  4O7M A;  5K2Y A;  1QGX A;  1UTB B;  1Q35 A;  5I3S A;  1QKB A;  3PTY A;  3QK6 A;  4XKN A;  2OWT A;  2WYK A;  2VT5 A;  2QRY A;  2XXX A;  4GL8 A;  2I4C A;  3SES A;  4NGU A;  3K00 A;  3Q25 A;  3FGS A;  2DWJ A;  1NH7 A;  3MC2 A;  3PMW A;  5ET6 A;  4LZ8 A;  1LFG A;  1Y20 A;  2THI A;  2REG A;  1NV0 A;  1OLC A;  4ONY A;  2XWO A;  4YU0 A;  4LN5 A;  1LEV A;  2WYP A;  5FHN A;  1QUI A;  4EF2 A;  3VXC A;  5DVI A;  2Y7I A;  2YJP A;  4TOZ A;  2XXI A;  4G68 C;  4OAN A;  1O64 A;  1A99 A;  5I2K A;  1NNK A;  4EDP A;  1KZ8 A;  4NHB A;  1EYI A;  3IJX B;  1FBC A;  3VVD A;  4I9D A;  3O28 A;  2QS4 A;  2Y5L A;  4PTK A;  5DVJ A;  4F1U A;  1N3W A;  2QSX A;  4OMB A;  4GXS B;  5CMC A;  5T3J A;  4XEQ A;  2GFE A;  4U1O A;  1FQA A; 
#chains in the Genus database with same CATH homology
 4MIJ A;  3KBZ A;  4P1E A;  1YZ0 A;  2Q74 A;  3ROJ A;  1SPI A;  1KA0 A;  2HHM A;  2XA5 A;  3MST A;  4MX6 A;  1K9Z A;  2KQZ A;  5EQ9 A;  5ET5 A;  5J16 A;  4NF0 A;  2HZK A;  2PFY A;  3A29 A;  4P1L A;  4YZZ A;  4PFB A;  1XI6 A;  4HCW A;  4HE2 A;  4PDD A;  4GX6 A;  5IZ3 B;  4PC9 A;  2CZI A;  4O7M A;  4KXP A;  1LBZ A;  5ET8 A;  5IZ3 A;  5I7I A;  5IGA A;  5IZZ A;  4OVP A;  4PBH A;  3ISP A;  4AS4 A;  4X04 A;  1BK4 A;  1JP4 A;  2L5V A;  3KC1 A;  5EQ7 A;  1QGX A;  4AS5 A;  1NV1 A;  1NV5 A;  3FXB A;  2DE2 A;  4N4U A;  4NX1 A;  2HPG A;  4I3E A;  4PGN A;  5JK4 A;  1FBD A;  1K9Y A;  1YYZ A;  2ZZV A;  4GBW A;  4N17 A;  3T1B A;  1LBX A;  4N91 A;  2B4M A;  5I3S A;  3PTY A;  1IMC A;  2FIE A;  2XWI A;  3RPL B;  1CNQ A;  4OVS A;  2F3D A;  4I3Y A;  2P3N A;  2WEF A;  2WX9 A;  2WYK A;  2VT5 A;  1IME A;  4NN3 A;  1YXI A;  4MJO A;  4QBA A;  1FPG A;  2DDK A;  1NI9 A;  1NV6 A;  2HXR A;  2Y5K A;  3BIG A;  4F1V A;  1FPD A;  1G0I A;  2R8T A;  2V3Q A;  4N8Y A;  4O7I A;  4PE3 A;  4GWS A;  4NGU A;  4MMP A;  2CEX A;  2QVU A;  4OVR A;  1FPL A;  1IMF A;  1NUY A;  4JVD A;  4XFE A;  4XF5 A;  1LBW A;  4JVI A;  2XWK A;  3BIH A;  2QVR A;  3HFU A;  4GWW A;  4MEV A;  4QXD A;  5EYG A;  3RPL A;  1NV7 A;  5ET6 A;  3MYU A;  5A5L A;  5FBP A;  2XXK A;  1NV3 A;  2OX3 A;  4P56 A;  4H45 A;  1LBV A;  1FBP A;  4MAG A;  4N6K A;  4X9T A;  2CEY A;  4P3L A;  1NV0 A;  1AWB A;  2QPQ A;  4N15 A;  4PF8 A;  2F3B A;  2QFL A;  2XWO A;  1FTA A;  5CM6 A;  4MNC A;  4IR8 A;  5ET7 A;  1DK4 A;  2VPN A;  3FBP A;  4I40 A;  4LN5 A;  2ZZW A;  4DI3 D;  3B50 A;  4GX4 A;  3CHG A;  1IMD A;  1LEV A;  2DE4 A;  4PCD A;  3E79 A;  4N81 A;  2ZZX A;  4N6D A;  1D9Q A;  2WYP A;  5DW8 A;  5LDZ A;  1G0H A;  5IZ1 A;  4JVC A;  2DE3 A;  5EYH A;  1FBF A;  1KA1 A;  1FPE A;  1FPJ A;  1FPK A;  4FBP A;  4NAP A;  4GWX A;  1FSA A;  3EKI A;  2OWZ A;  4PFR A;  2WBD A;  4P9K A;  2Q8M A;  1FBE A;  2FHY A;  1RDY A;  4MNP A;  4DI4 B;  1EYK A;  2DVZ A;  5EQ8 A;  3W9W A;  2F5X A;  1NV4 A;  5ESY A;  3GYY A;  4PBQ A;  3NOH A;  4OVT A;  1NUZ A;  1IMB A;  1FJ6 A;  1Q9D A;  4OAN A;  4HE1 A;  4PGP A;  4H46 A;  3U65 A;  3W9V A;  2CZH A;  1FBH A;  4HXV A;  2Q9T A;  1FRP A;  4MHF A;  2FBP A;  4PDH A;  4PF6 A;  4O8M A;  2PCR A;  4PAF A;  3SZP A;  1KZ8 A;  4OVQ A;  2JJK A;  5F24 A;  4NHB A;  5I5P A;  2P3V A;  4MCO A;  4M1V A;  4NQ8 A;  1EYJ A;  4PFI A;  3RYD A;  1EYI A;  3T0J A;  4OA4 A;  3LUZ A;  5IM2 A;  1FBC A;  4GWU A;  2WBB A;  3LV0 A;  1LBY A;  2CZK A;  2XWV A;  4GBV A;  3KC0 A;  2BJI A;  1FPF A;  4PAI A;  4PET A;  1RDZ A;  2PFZ A;  4MNI A;  1FPI A;  3E78 A;  4UAB A;  1DCU A;  2B4L A;  2HZL A;  2KR0 A;  1FPB A;  5LTC A;  4O94 A;  2Y5L A;  3B8B A;  4PTK A;  3QMF A;  4F1U A;  1NUX A;  4GX3 A;  4HCY A;  4X8R A;  4F18 A;  4NG7 A;  1NV2 A;  4YIC A;  5J1D A;  4HE0 A;  1IMA A;  3D1R A;  5T3J A;  1INP A;  1FJ9 A;  2FVZ A;  2VPO A;  1DBZ A;  2MKZ A;  4PAK A;  1RDX A;  4P8B A;  5EQA A;  1FBG A;  4F19 A;  4GWY A;  2GQ1 A;  1NUW A;  1VDW A;  2FIX A;  4G61 A;  4XEQ A;  4N8G A;  2V4C A;  3IFC A;  4GWZ A;  2QVV A;  4P47 A;  3IFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...