4PFEA

Crystal structure of vsfgfp-0
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
343
structure length
342
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGIAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Rational Structure-Based Design of Bright GFP-Based Complexes with Tunable Dimerization.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 92
structure length 342
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4pfeA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pfeA02
2NXZD 3EOTH 1KULA 4XVSH 4V2BA 2R4SH 1XMZA 3CVIL 5AYUH 4BZ1L 5GS0D 3SVSA 5ANMA 5EPMB 4GF6B 5LBSH 1GXEA 3OKLA 1YJFA 2QQKH 4HUVB 3RDTA 2BVEA 15C8L 4MMZC 1ZSDB 4XNUH 3W1CA 1NC2D 3TBSA 1XGUA 2YMXL 4YJZL 3VU2A 1OSPL 1YHHA 3H3KA 3SDAD 4W7RA 1FFOA 2X4TB 3RHWF 3HB3C 3L6FA 5TDPA 2X4RB 3U0KA 4KK8D 3QBTB 4EVNB 2YD9A 3RZWA 5CBEB 3VD7A 3UMTA 4UTAH 4BZYA 5CFHA 1VFBA 3IKCA 4Z7NE 4X9IA 1Q9KB 4XNMB 5BTTB 4EDXA 1IE5A 3O2VH 2V5MA 1INQB 2DQJL 4TVPE 4GAGL 4IRZH 1JV5A 1NBYB 2ADGA 1DZBA 3EJYD 3BIKB 3QJFA 3CNKA 3MJ7B 2MPAH 1G1CA 5KBNC 4UQ2B 2EDXA 4KTDL 3ZDZE 5HHVL 3T0EB 1CXKA 1NANH 4FXKA 4DOHE 4R2GB 1HIML 1EMTL 1OOAA 3ARDA 4JKPL 3ARGD 5CEZL 5FKPA 1SBBA 1B6DA 4XCEB 4JZNB 2DQCH 4CKVX 1FVCA 4Y5YA 1VPOH 4APQC 2IQAB 4YC2C 4AMKL 4KDWA 5K9KA 4YDIH 3G9AA 4OKDA 4ONGH 2KUTA 2C1OA 5E6ID 4GRWE 3C2AL 1A7BA 1KCLA 5DTZA 4FA8A 4P48A 5BVJA 4HCRH 1BOYA 2ICWI 5DRWB 1XF2B 4Z0XA 1RJYB 2EDFA 3TA3C 3QWQB 4B30A 3O81A 1B90A 1OTUC 3MLVH 4O2EA 1WVZA 5AZ2H 4N0RA 3CH1B 4GSDH 1MJUL 3QXDA 5HHNB 3O6ML 5FYJU 1UKSA 1CXIA 2F54B 3RUGB 3LKQB 3L7EA 3EYSH 1A9BB 4ZXBB 4QHMA 4EI5B 1N64H 4G8IB 1IT9L 3FFDB 2YWZA 3VICA 4QXTB 1QR1A 2ADFL 3VWKD 2MHAA 2YD4A 3WFBL 4ODTL 4Z76B 4G5ZL 3HUJF 1SYSA 4ZAKA 4E42A 5FHBL 2EE9A 2JCCB 4XVTL 2C7UA 1CZ8L 1I9RH 5GZND 2A6JA 2WBJC 4Z7QE 1S7QB 5E5RB 4UB0H 1EFQA 4KTEH 4FTVB 4DN4H 4JPWH 2A52B 1FSKB 2WINB 2DTSA 4NQXA 3ABZA 4Y1AE 1KCVH 1VADA 3C5JB 1TZIB 5GRUH 4LARH 5L0QC 4Y8AA 2NPLX 4EN3D 1A4KA 3GMOB 2HRPL 4PJ5D 1A3QA 4PJ8D 3AS0A 2HFFB 5SV3A 1IQDA 5GGVH 4POYA 1E6JL 4MA7L 4KROD 3V4VH 2UV3A 4LCCA 3PWPA 5FGSA 1J1OL 1MH5B 2XKSA 5FUZL 5DD6B 5T3XH 3TPUB 2VLJB 3OV6A 4NQCB 1LK3H 3IRZA 3KYOA 3F7VB 5SWZE 3WLWD 3KLAB 1LP9B 1CL7I 4J6RL 4Q0XH 5DPHA 4OFIA 5JPMB 5ID1B 3T65B 3SQOL 2V2XA 4XBPB 3O4LB 3C8KA 3DOSA 3B2UD 3FAXA 4JY6A 3BDYL 1EHNA 3RZCB 4YHYB 2DQIH 2I26N 3ES6A 1MLBB 4NDMB 4XPBH 5DD1H 4ZB1A 1YDPA 1A7NH 2CQVA 4U1GB 2NXZC 5H35B 4X7TB 2AK4E 3GKWL 1LK2B 1WGOA 4P5KB 4TULH 1Q9LA 1FL3A 4LLYA 1TITA 4EIGB 5DK3A 1MIMH 4FXGB 2ZPKL 4XC1L 4ZFGH 3QJHB 3VFRA 1U36A 3V5DB 1QFUL 5ABDE 1JWMB 2EE2A 1I1FB 4I18B 1RIUH 3P9MA 2VDKL 3SDAC 5DUPH 3BZ4B 1N7ML 3OX8A 1CL7L 3THML 3AM8A 1X5AA 2R0KH 2ADJB 5TDOA 3MRQA 5L2KE 4NM8H 5L8KB 3SE4A 3FONA 4HMEA 3E3QE 5IG7B 3SKJL 1I8KA 1EUUA 4LCUB 5FYJL 3P77A 1IM9B 5DURB 4PRIB 4U6XA 3LIZL 3OGCB 3WXVH 3RVWD 2IOVA 2AXFA 2DQHL 3EJYC 3SE3A 5CGTA 3UYRH 4PJDB 4NBYB 5EOCJ 1M4KA 1U8PB 3UJJL 1KGCE 3RBGA 4Y4FB 3GSUA 4Y16B 3GSNA 4CAGA 5C0EB 4N5EC 1EFXD 1RZJC 5KW9L 4OD2B 1FP5A 3BXBA 1WK0A 1CG9B 3ARGC 4HQ9A 1ZGOA 2XYCA 1MVUB 4ZOBA 1YJDL 2J6EL 4KRNA 2QLGA 5DJDB 5HHPA 4M00A 5JW4M 4OI9A 4Z78A 2AWJA 2J8UB 4GW5A 3PGCB 1DANT 1FFRA 5D6DC 1S7XA 4BQ8A 5E6IC 2VQUA 4JFEB 5D1XD 4DXQA 4LKCB 4LVHC 1NCCL 5I15L 1LNUA 3C2SA 3IFLH 3MRGA 4NQSA 2EC9T 2WMPA 4YDJB 2G60H 3SKMB 4Z7VA 5EA0L 4MQXC 2R2BA 4AG4H 4XAWH 5BO1L 3OAYK 3GO1H 2PW1A 1WLHA 4NO0D 5CEYA 1RZ7H 5E1HB 3VD3A 3OXRA 5IHBA 3DQJA 1QBML 5KS9F 5ANMB 2BNRE 3OKLB 1F02I 1YNLL 4IK9A 1NAKL 3RDTB 5E8PA 5HYJE 5A1AA 3LQAL 3TBSB 1XAEA 5DPIA 1X5KA 3U6RB 1XGUB 2G2SB 3GB3A 3W0WE 3VWKC 1N5YL 3I6LE 1I8MA 5EU6A 4Z8FL 5DTFA 4LF3A 4KRPD 4NC1C 3CX5K 4LPXA 3EJJX 3L6FB 3K8MA 5TDPB 2DBJA 4P0DA 5HGHA 3MODL 4PJIF 5D1ZD 3K1KA 4M8QB 2RFXA 4G6JL 1VFBB 4W74A 4KJPC 2JJWA 2A46A 1CDJA 3IKCB 4LMQI 3CVIH 4BZ1H 4EDXB 4KF5C 4NBZB 1KJMA 1JV5B 2ADGB 5FOBA 2ATPA 15C8H 1UXSA 4DKNA 4MJIB 2WSOA 2YMXH 1OSPH 4FXKB 5D7KE 4PJ8C 4J1UA 2ZNXA 1KYPA 43CAA 4ZNCD 3UG0A 3GSXA 4KROC 5FKPB 3CCHA 1CFQA 3P0VL 4HDIB 1FVCB 4Y5YB 5E7FA 2XKNA 3STLA 4Z5RA 4QHLA 1MRFL 1QEWA 3G9AB 4W7DA 3WLWC 4GESB 3SG7A 1X5YA 3HE6A 4U2YA 2C1OB 2DQJH 5C0AA 4GAGH 3EYQD 5JHLL 2PYEE 3I2CL 3B2UC 1QP1A 2EDKA 2CH8A 4K71B 4NOFA 5E8DL 5K9QG 1OXDA 4IRSC 4Z0XB 5HHVH 2EDLA 2PO6B 4B30B 3QIBD 1J0JA 4O2EB 3SG4A 1HIMH 1EMTH 4HWZA 4JKPH 5CEZH 4RFEA 3Q5YA 4WGVB 3QXDB 5I8KL 4XP6L 4AMKH 5JQ6L 4Q7DA 4TPRL 3G6JF 2KDGA 4RGNB 5JDSA 4OY4A 1HOCB 1NJ9A 4XNQA 1I1AD 4QHMB 1S9YA 3C2AH 1ZLUH 3HE7D 4G3YH 1QR1B 1FLRL 4PLJD 2UYLA 2MHAB 3ARBA 3T1WA 4DN3L 3RPIB 4ZAKB 3SVUA 2XTJB 4E42B 1TFHA 4FQ1L 2RH7A 1VERA 3NPSB 4X6DE 2C7UB 2MKWA 3EVUA 1LHZA 2DTML 2A6JB 3P4LA 4HC1A 3RVWC 1I85A 1MJUH 2XZQL 3QYCA 1QRNB 1UWGL 3O6MH 4GJTB 4DVBA 4BZ2L 1FJ1A 1ZT1A 4KAQL 4CGTA 4NQXB 3ZDXF 3IXTA 5EULV 4W69A 3D87B 3EDKA 1J1PL 1VADB 3EO0B 2P8MA 1IT9H 1MHHA 1A2YA 3BN9C 1CDGA 3N1QC 2ADFH 1ZE3C 1A4KB 3WFBH 4ODTH 4U2VA 4G5ZH 3CU1A 1MPAL 3L3IA 2CR6A 1TVHA 3BEVA 1KF9B 1IQDB 1MHEA 5FHBH 4JN2B 2R1XA 2X9YA 4I2XA 4XVTH 1VEOA 1ACZA 1CZ8H 3PWPB 5EBGA 3O6LL 5HZSA 4LSPL 3CD1A 1G84A 1T6WA 2AWKA 2FH6A 3WFEL 3F7YA 3KYOB 4NQEE 4OFYD 2XRAL 3QXVA 4JG0L 4X4MA 2V2XB 1EO5A 3C8KB 4JY6B 1EK3A 4KK6C 1L6XA 3ES6B 3WHE1 3GM8A 2APTA 1YDPB 2HRPH 3MLWL 2NW3A 3UPCA 1G0XA 1E6JH 4MA7H 2X7LA 1Q9LB 1FL3B 1Z5LA 1IC7L 4LLYB 1J1OH 5FUZH 2VWEC 3VFRB 4DGYL 2YPLB 1OQXA 3IJSA 2DM7A 2ZOKA 4C83A 4D9RD 3V0WL 4J6RH 1O5DT 2VLMD 3P9MB 3SQOH 2V6HA 4MZ3A 1WEJL 4H25B 3OX8B 3BDYH 5EOQL 4W76A 5C7XL 1F4WL 4ZFOA 2XICA 4KVNL 5TDOB 5JW4R 3OL2A 2VZSA 2ORBL 2NLJA 5IK3A 4NC1E 4NO2A 3GKWH 3FONB 3GSRA 5D7IB 1I8KB 5CJ5A 2IMMA 3P77B 3T0ED 1B0GA 3V7MA 5GS0L 4U6XB 3IAQA 5MENE 4XXDA 2DQFB 2Q76A 5ENWA 2VABA 2CDEA 2AXFB 4R2GD 4XC1H 2ZPKH 1EDQA 1KJ2L 2FX8L 4LIQE 5BQLA 3VE0A 1QFUH 3RI5K 2O5ZL 3GSUB 3GSNB 2VDKH 1A6TA 5FECA 5IR1A 3H9HA 2FRGP 1N7MH 4PJAA 1CL7H 3THMH 4XTRD 2BDNL 5K59E 2QLGB 3MRJA 1LO0L 5HHPB 4Z78B 4GW5B 4GKOA 3RWHB 1X9QA 3MGTA 1S7XB 4P5TD 12E8L 5FYJH 1AR1D 4HAGA 5C70A 4JVUA 3LIZH 4AEIL 4ANJA 1L9MA 4MWFA 1FNFA 2DQHH 1HK6A 5LGKA 1LNUB 3MRGB 4NQSB 3RTQB 3SGJC 3D48R 2OS7A 3KYKH 3UJJH 4Z7VB 2R2BB 3KYNA 1ZWIA 5KW9H 1WBYA 1FZMA 3RGVA 4ZXBD 3NIFF 3S8WA 5CEYB 4Q9CA 1KG0A 3K80A 4J3XA 1YJDH 2J6EH 5J12C 3OXRB 1TPXC 1SEBA 5I0DA 4HF5L 5E2TL 1EMFA 3O3EA 1LE9A 5ACLA 2JB5L 4L9LC 5E8PB 3KS0H 3JWOL 3QEUB 5IROA 2WUCL 3SSVA 4M7LT 3QP3A 3UJTL 4ZBLA 1NCCH 5I15H 4P9ML 3C8HA 2PCPA 4FQIL 1I8MB 4NQVA 3C09C 5EU6B 2O26U 5DTFB 4FTVD 5EA0H 3K1DA 2R9HD 1H3XA 4XCYA 4Y2DA 5BO1H 2YFPA 2DQUL 4IRJA 2OTWA 1S7RA 4JCLA 4UI2A 3UTOA 1PG7L 2BOBA 4S1RL 2RFXB 1ZHNA 2NY3B 3DVNA 1QBMH 1UADC 3MOBL 1G7KA 1KJMB 5F7LB 2BRQA 1A6AA 4LVOB 5JMRA 3IAGC 1NAKH 2ATPB 4GS7B 1UXSB 5TPWL 2FD6L 3LQAH 3MNWA 4PJ7F 5BZWA 4ZUWA 4R6DA 2VLJD 2Q7NA 4NQCD 1N5YH 4PPTA 4AENA 1E4WL 4Z8FH 3QDGA 4J1UB 1UH4A 43CAB 3GSXB 3CCHB 3T3PE 1MAML 1VEPA 3O4LD 3VRJA 1EHAA 3MODH 1KBGL 2XKNB 3RWAA 3STLB 4Z5RB 4QHLB 1B88A 4G6JH 1QEWB 3B3IA 3QUXC 3U1SL 1BX2A 1ADQA 3HE6B 4NNXA 5KVEL 4JY5H 5TGBA 1ZOXA 5DZOA 3TBVA 2CGRL 3SV5A 4NBXB 4U2ZA 5IT2L 4ZUUA 4PIRF 1E4XI 3SQBA 1V7NL 5BS0E 5HYQA 4PREA 1IQWL 3DECA 1ACYL 3IDYC 5KSBA 4MCYA 2H41A 4HWZB 4RFEB 3P0VH 4MNHA 1CGXA 2Z6XA 3OF6D 1XGQA 1MRFH 3BW9A 1W7UA 1BVZA 4CN4A 1X5XA 5JDSB 3QQ9C 1VKXA 1BD2A 4XNQB 1WISA 2QHLA 1S9YB 5J1AA 1FAIL 2VWEE 5HDBF 3MV8A 1IM9D 3EKJA 5DURD 3P2TA 2UYLB 3ARBB 5E8DH 1QYFA 3DGCR 2XWBA 4HD9A 3I75A 2I07A 4BJLA 2FEEI 1QSEA 2GX2A 2N1KA 4C54A 1E4XL 4Y4FD 3LV3A 3SG2A 3T0EC 4J8AA 2ZJSL 4YNYA 5BJTA 5I8KH 1CXEA 4XP6H 4DVBB 5JQ6H 1FJ1B 1ZT1B 2WWMC 4TPRH 4HQQL 1M6OA 2E7HA 3IXTB 3LB6D 4L4TA 2APXA 1X6LA 2P8MB 2DQEL 2RCSL 4R4BA 4X6BA 1FLRH 3HKFA 1UYWL 2X1OA 1XGYL 1JGUL 2UVFA 4DN3H 4XWGL 5EIVA 1HDMA 3L3IB 2VZOA 1JYXA 1TVHB 3BEVB 4RAVB 5E5UB 1MHEB 3MJ9L 4FQ1H 4F15B 1B2WL 5DUBA 4I2XB 4ZF4A 2X1QA 5HI5D 2DTMH 5F8RC 2FEEL 5I71B 2XZQH 3F7YB 1UWGH 1MFAL 5HGBA 4KAQH 3V5HB 4BQCA 4PY8I 1Z9MA 1I3VA 1J1PH 1C7TA 3WSQL 3T77A 4ZXBC 4X9GA 4NRZA 2P4AB 3RDTD 4EI5C 4NQDE 1OAXL 1MPAH 2AABL 2NW3B 2X7LB 3GBML 2E6QA 3O6LH 4LSPH 1MHCA 4ODSL 1GGUA 3WFEH 3IJSB 2ZOKB 4C83B 5I1GL 3TLRA 4KJQC 4L3CA 2XRAH 4J12A 4JG0H 1OW0C 4MLIA 2ZG2A 2R9HC 2D0GA 1FSKC 1SVZA 4PYHA 5ISZA 3OKNA 4ZFOB 1DJSA 1JP5A 2VRAA 1S6ZA 2NLJB 5IK3B 4NO2B 3TCLA 4PY7A 5GZOD 5E1AA 1IGTA 3GSRB 4WEMB 4RMWA 3MLWH 3DQ1A 1B0GB 2DMBA 4MA1B 4XXDB 1IC7H 2Q76B 5ENWB 5CJBA 2VABB 2CDEB 3ARDD 1TMCB 4DGYH 4K23L 2IANE 3VE0B 3V0WH 2HVKA 2POXA 3L3KA 1A6TB 5FECB 5IR1B 3H9HB 3MFGB 4JQIL 4PJAB 5EOQH 1E0OB 3P4OA 5C7XH 1F4WH 5FVFA 3P4NA 4KVNH 5E56A 1PY4A 3LEYL 3MRJB 2ORBH 3C60A 1V3KA 2A6KA 3RZCC 1DR9A 3PWUA 1A3LL 1P1ZA 5KSVA 3MGTB 5DK2A 4U1GC 5DT1L 5FUCE 5GS0H 1WIPA 3KPOA 4MWFB 1KJ2H 2FX8H 3DUUA 2DM3A 3CLFL 2O5ZH 1F6LL 4ZUVB 2R2HA 4PJEA 3KYNB 4RGND 1ZWIB 5DEGA 2RAMA 1WBYB 1FDLL 1FZMB 4JJ5A 1CTOA 1KG0B 2BDNH 2YUZA 5FXCH 1LO0H 5D9SA 1EEYA 1S5IL 4BUHA 3UBXI 4ZAKD 12E8H 5I74B 2XTJD 3O3EB 1LE9B 1Q4AA 2FDBP 1GOGA 2CRIA 1D5MA 4L29A 4AEIH 5GGSA 2XZAL 1HNGA 5JPNA 4KPIA 5D2NE 3ZDZF 4NQVB 5I19L 3MGAA 3OB0H 5DHVA 4G8EA 4XCYB 4WW2F 8CGTA 4Y2DB 4YXHL 4IRJB 4IS6A 1I3RA 2XKUA 2OTWB 1S7RB 4Y4FC 4Y16C 2P7TA 2BOBB 1CV7A 1QY3A 1ZHNB 2P49B 4OLYL 3DVNB 4W6CA 2YUVA 2PNDA 4BKLA 3SVRA 3U0NA 1TCRA 2CIIA 4HF5H 5E2TH 1DL7L 3LB6C 1A6AB 2JB5H 2R1WA 2D3VA 4W7XA 4LGRB 1M7IA 1HQRA 3JWOH 3MNWB 3PWPD 5BZWB 4ZUWB 3UJTH 4P9MH 1NEZA 2ARWA 4CVZA 2YD8A 3PP3H 3ZZ1A 4L8SC 4FQIH 4AENB 2Z8WC 3IDJA 4R4ND 3IFPA 3QDGB 1MVFA 1YC7A 4OHSA 1BBDL 2VH5H 1M05A 4KDTA 2DQUH 3VRJB 3IS1X 3T08A 2VXUL 4QRPE 5EDXA 4ZODA 1PG7H 4MJ6B 5HI5C 4W6AA 2UZXB 1ZK9A 4ODHL 4S1RH 3GIZL 1NCBL 4N8VG 1BX2B 3MOBH 2QHRL 3VFMB 4NNXB 3T3ME 1N0XL 2GJ6B 5TGBB 3REVA 1EMBA 2JE8A 5TPWH 2FD6H 1HYSD 4ZUUB 4WNQA 5SWSE 5HYQB 1AE6L 4PREB 1E4WH 2F54E 2HQKA 4G6KH 5KSBB 4MCYB 5HHMB 4GG6E 1FFPA 5E7BA 1S78C 1XF4A 1MAMH 4MNHB 3EOBA 5DJ8B 3DQDA 1KBGH 1XGQB 3BO8A 1WFTA 4L5FL 3BW9B 1SBSH 2I5YL 9CGTA 5KVMC 1VACA 4R90L 4E41E 3U1SH 1VKXB 2NCMA 3F6IA 5J1AB 5KVEH 1ORSA 3MV8B 5JOPE 4HUKB 2XG4A 3OKMA 2CGRH 1SMAA 2R23A 3I6GA 1T1WA 5IT2H 3MLTA 2C3WA 2PXYA 1V7NH 2XWBB 2DWEA 3I75B 2I07B 2H32B 4KI5C 5FO9A 1IQWH 1QSEB 3L5XL 2JTDA 1CFTA 3ZHDA 5GZOC 1ACYH 3KJ6L 4LSVL 3LV3B 4OCSL 2AQ2A 2HG5A 2BZDA 4TTGA 4X7FC 4OJFL 3L3DA 3HZKA 4YNYB 4EXKA 5BJTB 4F7TA 3F7RA 1JRHI 1M6OB 1RZKL 4ZO7A 2GCYA 1QOKA 3QUMA 4L4TB 4WHCA 1P6FA 4IM8A 4R4BB 1FAIH 1JZ3A 4X6BB 2F5AL 3JVGC 5DQJA 5DQ9A 4W81A 1HDMB 2FGWL 5D2LE 4K71C 3OR6B 5DUBB 4HGWB 5EUOE 3TIDA 2KZWA 2PO6C 1BFVL 2Z31A 5GS1A 4YFDB 4JFFA 2ZJSH 1R3IH 3FOMA 4ETYA 5CSGA 3QG6A 2VVJA 1I3UA 4KJWC 5JUEL 5HGBB 5E4IA 3ARSA 4HQQH 2VDOH 4KW8A 3MROA 5GGQL 4ZF5A 1JF5A 3VRLF 1FG2A 1K4CB 5DLML 1EBPA 4WW1A 2DQEH 2RCSH 4HS3A 4LCIL 3T77B 3ZT5A 4RGNC 1J87A 1JRHL 3CD9A 1UYWH 1XGYH 4NRZB 1JGUH 1CDHA 4OV6F 2ZO7A 3CSPA 1KCRL 4XWGH 2LU4A 2DL9A 4U0QB 1YYLL 4J8RA 1LGVA 3MJ9H 5EU6D 5GRZA 4ZAKC 3R0MA 2CDFA 3MBXL 4ETQA 1YPZA 1MHCB 3DROA 2ZOLA 3ZYIA 4XWOD 3DQLA 4YBHA 1MFAH 4L3CB 1UZ8A 2NY3D 4IJ3B 4OZIF 5F1NA 3QDMA 4FQCH 2VZUA 3WSQH 2PN5A 5ISZB 1DN0B 3OKNB 5KAQG 2HLFC 1PD6A 3EIFA 1OAXH 3BZEA 3TCLB 2PW2A 4PY7B 2AABH 1IGTB 5HBBA 4PJDE 2P5EA 2X4QA 1N8ZA 2VITA 2VAEA 1NFDA 3IU4L 5JZ7C 4F9LC 5C6TL 4ODSH 1FZKB 4YDKL 5I1GH 1UG9A 2HVKB 2YD6A 2X6MA 3ILQD 3WIFA 3P4OB 3DSNA 5C0AD 3P4NB 4P2YA 3C60B 3U4BL 4EUPH 3KLHD 2A6KB 2DIAA 3PWUB 4PJGF 1P1ZB 1F11A 4UT7H 4UINL 5DK2B 3HZMA 5KSVB 2DUFA 1W72H 2O5YL 1OTTD 3KPOB 1QFWI 1NLBL 1CLOL 4GAFB 4K23H 1U95A 3TMTA 3DUUB 4PBXA 1OM3L 5C6WH 3HI1A 2R2HB 4WHDA 4PJEB 3U8CA 5DEGB 3H3PL 4KQ3L 4JQIH 1AD9A 3E5VA 4JJ5B 2GT9A 1BJ1J 4J3OC 3TBWA 3LEYH 4OT1L 3OTTA 1CGUA 5D9SB 1EEYB 2BVOB 3IDIA 1TLKA 5DT1H 3L5WA 3SE4C 2B1HL 2P44B 5GGSB 1DUYA 1HE7A 5JPNB 3C6LA 2NR6C 2UZYB 3OWEA 3CLFH 2KQMA 2IAMA 1K85A 1PKOA 1QFWL 4G8EB 3QWOA 4IS6B 1I3RB 1FDLH 1JPTL 5MP6L 5FYLD 5C3LD 2P7TB 1L0YA 1F4HA 3UP1A 3QUKA 2X4UA 1ODAA 2JJSA 4KI5E 4MJIE 4CU8A 5MEOA 2KPNA 4NWSA 2FECI 4WFGE 1S5IH 3IFOA 2P5WA 4BKLB 1TCRB 4N0YL 4F7CA 2CIIB 4M7LL 2E7LA 5K9QI 3FO2A 2FLRT 3B43A 1KPVA 2R1WB 1M7IB 2XZAH 1HQRB 3U4EA 1J88A 1PSKL 1NEZB 3SO3B 1K8DA 3RWEA 2NY6B 1SJEB 3DMMA 3SBWA 3IDJB 1HHKA 4H26A 2ESVE 4KGFA 1I4FA 3RTQC 3O6KL 3A6OA 8FABA 3MLYH 1OD9A 1ZHKA 1KTDA 4I0CC 4ZS7L 3O3BA 3EK4A 1BOGA 3KPLA 4OLYH 32C2A 3W2DL 3QIUA 4Z9KB 1DL7H 1NBZA 4PJCA 4WUUA 2FECL 2BVYA 3IAPA 5DJCA 4OBSA 1T5WA 1Q4BA 3F12A 5D70H 4JR9L 1X5HA 4OQTA 4P9HL 4WNQB 5GISH 3RX8A 4JFDA 1TZHB 2QKIA 1QO3A 3EOYG 3EDJA 1FN4A 1KTLA 5IV2A 1BBDH 3DQOA 3S88L 1X5ZA 2X4OA 4UTSA 1XF4B 5A40E 5CEXA 3EOBB 1XCTA 2VXUH 2J12B 3JTSA 5B8CA 4ODHH 1EEUA 3BO8B 3GIZH 1J5OL 4XWOC 1NCBH 2GFBA 1VACB 4PP1D 3K1KC 2QHRH 3WLDA 2PXSA 4MNGE 5HYSA 4P2RB 1N0XH 3BI9X 3OKMB 1CIUA 3O4OC 3MV7A 2VAJA 2RB8A 2R23B 3I6GB 1OTSD 1T1WB 3MLTB 1NMCB 4IIQA 2PXYB 1J8HD 2DWEB 4GS7C 1AE6H 1QRNE 5FO9B 2AJ3A 4HQCA 3PIQA 1CFTB 1HN1A 1ZTXL 4ZSOA 4WEBL 2HG5B 2F15A 1E4JA 2QTEA 3L3DB 3BGFC 3HZKB 2BVTA 5J1TC 4F7TB 2JJTA 4L5FH 2ZUQB 2I5YH 1RAMA 4R90H 3K7UA 2GCYB 3HRZA 3CLEL 3WE6A 3QUMB 3QNYA 2VDLL 3GFUA 3P0YL 3T1FA 1MFNA 4FRWA 2IPUG 3ILQC 3D3VE 4MDIA 3HE6C 2OYPA 5DQ9B 3TF7C 4N0CC 1RHFA 3KLHC 3L5XH 4BK5A 1Q94B 3KJ6H 4S11A 4LSVH 3TIDB 1MAKA 3MOAL 4OCSH 4U6TA 1AKJB 4WV1A 2Z31B 4CN6A 5GS1B 4JFFB 4OJFH 1EIBA 4URTB 3FOMB 4PFEA 3QG6B 3RGVD 3PIBA 1Z9SA 4IHOA 1AIFA 1OP5H 3MROB 1RZKH 1MWAA 1WV7T 1FG2B 3Q6FA 2H5PA 4WW1B 3IDGA 4NO5A 4ENEC 4HS3B 5E03A 3CH8A 2GW5A 1RU9L 2F5AH 4EEEA 2VO5A 1BWWA 1EO7A 2P47B 2YPLE 5CHNA 2FGWH 1IKNA 1I7UB 3ARBC 3LEXA 3UAJC 4H3MA 2CDFB 4ETQB 1T3FA 1BFVH 1WC7A 1YPZB 3GBLA 3DROB 2ZOLB 4Y2DD 4IRJD 3BE1L 4QY8A 2X2YA 3LQZA 5JUEH 1D6VL 4YO0A 1UZ8B 1XEDA 1MREL 1QR4A 5F1NB 4KGEA 5BMFL 5GGQH 4BFEA 3QA3B 3K4AA 5FVGA 3QDMB 5DLMH 1R3HA 5D7IE 1T1ZA 3WJLA 4LCIH 4JJHA 1JRHH 4JRWA 5F8QC 5K59F 3GSQA 5I6XB 3BZEB 1KCRH 4NZJA 2PW2B 2QLIA 1C8PA 1CVRA 1YYLH 2P5EB 3UTPE 2X4QB 5IW1A 2FEDD 2VKWA 1N8ZB 2VITB 3MXWL 1NFDB 3QDGD 4I9WE 4N90E 4P4RA 3MBXH 5CIPA 1DVFC 2V7NA 1II4E 2XZCL 4OF5A 2B5IB 3UPRA 1PW3A 1R3KA 3SDDC 4WRLA 3RY4A 4K7PY 5I71C 3DX6A 3HC0A 1NGXA 3L5IA 4GQPH 1YUHA 2QEJA 3BYTA 4O00A 3SHSA 3O3AA 2JJUA 3WIFB 5H8DA 1OT2A 1DN2A 1NCNA 3JV4A 2LE9A 2VIRB 3SG6A 4WI5A 1ES0A 1D9KD 2Y5TA 1IARB 3LKPA 1F11B 2AJSH 3WN5A 3HZMB 1FV1A 1D5XA 3D69A 3MLUL 3MV01 1MRCL 4EZMA 5SX5K 3IU4H 3OSQA 5HHMD 3AI5A 5C6TH 1UM4L 4MS8D 4M7JL 4YDKH 1FNEA 1EHLL 5EBJA 4DTGL 5L6YL 2PTTA 3RI5F 2A77L 1AD9B 1EMEA 1BD2D 2GT9B 3FHQA 3MV8D 3TBWB 3PDDA 2VXVL 4J2XA 3U4BH 4CW1A 4KZDL 3BT2L 3IDIB 5LTRA 4UINH 3QB7C 3BVNA 5J13B 4OGSA 4LOUD 3V4PL 5J11B 3L5WB 1KFAL 1QSED 2O5YH 1DUYB 5D7JA 1JGLL 1NLBH 1CLOH 4X6CA 3C6LB 4MA1C 4MNQA 4UV7L 4HEME 1OTSC 1OM3H 2WSNA 1XGRA 3A6BL 1I9IH 3N9GL 5IVXA 3SPVA 3P73A 2IAMB 3ALPA 3EVRA 5F7DA 3FFCD 2KKQA 3KPSE 4OGXL 3B4NA 3QWOB 1AC0A 4P4KA 3H3PH 4JKMA 4KQ3H 1UJ3C 4L4TD 4NM4L 1F3DH 2FWOA 2PTVA 3IB4A 2L7UA 3NFNA 4BH7A 4KUCD 4MB3A 3HNTL 3QUKB 2X4UB 4OT1H 5MEOB 1HHJA 1MCQA 1EPFA 4A2LA 3ZKNC 4Y4HD 3IFOB 2P5WB 2Z4QA 3OXSA 5A2FA 4P1QA 5CD5D 1KPVB 2B1HH 4JE4B 3EJZC 4DJMA 5I0ZA 3TT1L 3U4EB 3NAAL 3T0XA 3SGEI 3CD4A 1K8DB 3Q5TA 3AI4A 1ZVSA 3RWEB 3LAFA 3DMMB 4KH2A 1HHKB 4W6YB 1QFWH 4H26B 2G2RA 2D0HA 1I4FB 1AO7A 3WDJA 5MP6H 3AKOA 1JPTH 8FABB 2IPTL 4QOKA 5F89A 1HSAA 1KTDB 3VI4E 3O3BB 4M5ZL 1FL5A 3SJVE 1BOGB 3KPLB 4OM1H 2MMXA 1YEDA 1P84J 4N0YH 32C2B 1KUMA 4I0KA 4M7LH 1I1RA 3QIUB 2GX0A 1RRXA 1LO3L 1NBZB 4PJCB 4F33B 4NCC2 4WUUB 4EKXA 4MJ5A 3ESUF 4OCWL 3ZMRA 2QBWA 3FN3A 4M3JA 5DJCB 3QUYA 3TV3L 1T5WB 2H26A 5I74C 3F12B 4MD0A 2C4FU 4H48A 1PSKH 4JFZL 5IROC 5HW9A 4JFDB 3GJEA 2QKIB 4RISL 2APFA 1QO3B 4RFNB 3S36X 2D03L 4C58B 1FN4B 1KTLB 3DYMA 2X4OB 3O6KH 5CEXB 4YHOL 3JTSB 1J1XL 1MEXL 5B8CB 2QR0B 5ISZD 4Y2DC 4ZS7H 2B20A 2GFBB 2VYRE 3ZYZA 1G7PA 5K33A 4ELME 3AS2A 5HYSB 2DRUA 1GPOL 3W2DH 1WFUA 3MV7B 4JR9H 5DRZA 4YHLL 4JVWA 1HKFA 4P9HH 3VD5A 5DQBA 1U91A 2AJ3B 3PIQB 4FQJH 1R24A 2WV3A 2W65A 4ZSOB 2FEDC 3S88H 4H3NA 4GW1A 1KIQA 3U36A 1J5OH 4L3EE 4KQ4L 3C60D 3HRZB 3WE6B 3QNYB 3RWFA 2IFFL 3DUHA 4W4OC 3T1FB 1ZXQA 3P0GB 3QQ3A 1X44A 2LTQB 1T5XA 3DIFA 4MDIB 4YFLI 2ADIA 1TTFA 4P23B 4YK4C 3BOVA 3PWVA 5M7QA 1ZTXH 4WV1B 4WEBH 2AWLA 1SEQL 3MSPA 1KYRA 3RGHA 4PJ9C 1T21A 4ZFZA 3A6CL 4IHOB 1HILA 2UWEE 3O78A 1AIFB 2HCGA 4JHZA 3CLEH 1MWAB 4JKLA 2VDQL 3Q6FB 1SYVA 2VDLH 3K46A 3IDGB 5C8JA 3P0YH 3RNKA 4M6ML 4U1MA 5HXMA 5I1LA 1F58L 2GW4B 4F80A 2J88L 5CHNB 1VFOA 4QHNA 2WBKA 3MRRA 3IDUA 4WWID 2BVQA 1EA9C 4OIIL 1CU4L 2Q6WA 3LEXB 5TE6H 3BSZL 3MOAH 5KN5B 3WKML 1T3FB 1WC7B 4JRYE 4OLWL 1Z1QA 1BQHA 2YEZA 4LRIC 4ZNEA 1JNLL 4QY8B 3LQZB 5I76A 3MOQA 5CINL 4WI3A 1R3HB 3JWDL 4GBXA 1AGEA 1T1ZB 3OSKA 2R1YA 1RU9H 2EDJA 3GK8L 2YA2A 4WFED 4EOWL 3PWJA 5HYSG 4O02L 3GSQB 1IGML 2J4WH 5L8LB 1MI5A 1FHGA 1GC1L 3OSRA 5IW1B 4ZOAA 1EZVY 1M71A 1KSRA 3T0BA 2NY6D 2V5TA 4FZ8L 1K2DA 1PEZA 4LVEA 4P4RB 4HKXB 1CDYA 5CIPB 3EFDL 3UPRB 1JVKA 3NCYS 1R3KB 3S3PA 3BE1H 1H6RA 4N3DA 5CP3H 1G7QB 2G75A 5DGQA 1D6VH 3EBAA 4PRNA 4W6WB 3DX6B 3HC0B 1MREH 1MJJA 1NGXB 2ICWA 4HC1L 3KPRE 4WHYH 5BMFH 1YUHB 4JB9L 5IKCA 3O3AB 5C71A 2F8OA 4HS6A 1OAKL 3JV4B 5SX4I 5BW7A 2VVIA 1ES0B 5HYEA 4YPGA 3LKPB 3WN5B 1WTLA 2AEPL 4HUMB 1FV1B 5EH1A 1D5XB 3D69B 3VXTB 1BF8A 4HIEA 3STBA 3WNKA 3MXWH 5T1MA 1G0DA 2XZCH 3W9EA 5HHOE 5F6HJ 3MR9A 1TVDA 1FNEB 3MV9E 2QU1A 1BJ8A 2YR3A 3LKOA 3V95A 4BQBA 4XMLL 4F7PA 2PTTB 5CLWA 2MCG1 4IJ3C 3OKOA 4OZGA 3BKML 4LLQB 5JHDE 3GBNL 3MNVB 2F9BT 4XL5A 3JV5A 4CW1B 2VZVA 1TTUA 2HRLA 2PXYD 4NQTA 1GGIL 4KKAC 3MLUH 1MRCH 3SDYL 2CKNA 4Y7MA 1IZKA 1UM4H 4X6CB 3VXSA 2IALA 4MNQB 4M7JH 5A3ID 1XGRB 3MRIA 5IVXB 4KKBD 3SPVB 3P73B 4JN1L 5F7DB 5JW5A 1EHLH 1JWUA 3M17A 4DTGH 5L6YH 5IP4A 4P4KB 4OAWA 2A77H 3U48A 4KK5D 4ODUA 2FWOB 2MFNA 4LIQL 4BH7B 2ARJQ 2GJZB 5I1EL 1HHJB 3DYOA 3LRGA 4LPCA 4HQ8A 4KZDH 4M7ZC 1RIVL 3DQEA 2Z4QB 4ZFOL 1V05A 1E6OL 1J05A 4G8GE 3FZUC 3V4PH 2ED8A 5A2JH 1KFAH 2EE3A 1JGLH 1FL6A 3NEZA 2Z31D 3OJVC 4JFFD 4UV7H 4ZPTA 1ZVSB 3PGDB 3A6BH 3N9GH 1PQZA 2G2RB 4HK3N 2WP3O 4HW6A 4FOMA 4JFQB 4OGXH 3HNSL 5LJYH 3NPZB 1AO7B 4GG6F 1XCQA 4YDLC 2G5ZB 4NM4H 1YY9D 2GJ6E 4QWWD 1HSAB 4YEEA 1RI8A 3T2NL 3HNTH 1FL5B 2A73A 5C0JA 1I8LA 1YEDB 4KXZI 4MVBD 3H9SA 5HVGB 1A64A 4AEHL 1K8IB 5FCSH 4MJ5B 1T1YA 5ADPL 3ESVF 2A1WL 2FB4L 2FL5A 5FHAL 2RBLA 5IBLD 3ULVE 3QUYB 1I7RB 4GMSL 1V7ML 2JCCF 1WAAA 2H26B 5FA3A 4TOYL 3TT1H 4MD0B 4TNWK 3NAAH 4LFHG 5DTYA 4PBVC 1MHPL 4UOJA 1YEKL 4JKKA 3GJEB 4DUVA 3QZWA 3V4UL 4FFWC 1NBQA 1EVTC 2QSTA 3GHBL 5HBDA 3QDMD 2IPTH 1M7XA 2NXYB 1JN6A 1GGYA 4HIIA 3VGGA 3N1MC 5FDWA 1V5JA 4M5ZH 3MRFA 1FFNA 1G7PB 1CLYL 5SWQB 2VTFA 1CS6A 1LO3H 2HFEA 2HT3C 2P5ED 3L9RA 4OCWH 3TV3H 3BKYL 4FP8L 2XT1B 3NTCL 3ZTNH 5DRZB 1J0ZA 1AGDA 2NZ9D 4JFZH 5F7WC 3GEXA 4MAUL 1KLUA 1U91B 5D2LF 1SJVA 4RISH 5CZXD 4LEOA 1GAFL 3WS3A 2D03H 1LP9F 3SO3C 3R1GL 4EI6A 4ZG1A 3SGEH 2W65B 2NY6C 1DBKL 4PRHE 4L4VA 4GW1B 4YHOH 1J1XH 1MEXH 1KIQB 3D2UA 4YE4L 3U36B 2Z93A 3C87A 2W60A 4KDTC 4KZEH 3TN0B 4I13B 3KPTA 1GPOH 1QYOA 6FABL 2ICRA 5I73B 4BFBD 1H3UA 3QQ3B 1T5XB 1ZA3A 3DIFB 3CBEA 1NUNB 2ADIB 5J6HA 4YHLH 4XRCA 5IMKA 2M1KA 2ATKA 4X7CC 3FOLA 4QRRE 3D25A 3PWVB 4Z7WE 5EXBA 1OY3B 2MTPA 4FQPA 5MERA 3MJ8A 5F7YC 1OWRM 5F1SA 1T21B 4ZFZB 1HILB 4KU1A 1CDBA 1N2RB 1QUNA 5AUMA 4Z4MA 4KQ4H 3D0LB 1ETZA 4HMCA 2IFFH 4I3SL 5C8JB 3DJ9A 3RNKB 1A8JH 1J0HA 4U1MB 3LVCA 1L6ZA 4YPJA 5I1LB 1ADQL 4MAYA 3RVXC 4FQQB 4OIAA 5F1IA 4WCYL 4QHNB 3OB8A 3MRRB 1I3GL 2BVQB 1AQKL 1FZJA 1NMCC 4PJDF 2PXYC 2Q6WB 5DMYA 2IAMD 5BCAA 3BHBA 1QQDA 1R3JA 2ZP0T 4B41A 4Y5XC 1P84K 1BQHB 1SEQH 5HD8D 3A6CH 2FZ3A 5B3JE 5I76B 5A3IC 5L88L 1KCUL 4KKBC 4W7AA 2DI8A 4PJFA 2J8UF 2VDQH 2X4PA 2ZUQC 4TQEL 4GBXB 1AGEB 4JHBA 1OSZA 3MBEA 4M6MH 2HYMA 3VMNA 1F58H 4KK5C 4OF3A 3PWJB 3PP4L 3ARFA 5AD0A 5IVZA 1M71B 1PJ9A 4OIIH 1CU4H 4Z18A 3TYFA 3DMMD 4I48B 3IP2A 1B6UA 1K2DB 2V7HA 3EYVA 5D4QA 3WKMH 5HVHB 3TO4C 4OLWH 1JNLH 1JI2A 2G75B 5A43C 4PRNB 2WK2A 4D9QE 1MJJB 5CINH 2ICWB 5L7XL 3O41A 4P59L 4H8WL 5IKCB 3JWDH 3QIUD 4HS6B 2A9ML 4RNRA 4WUUD 3GK8H 4K9EC 1FLTX 4OLEA 4EOWH 4O02H 2OMNA 1IGMH 4OGAC 2J5LB 1GC1H 2EC8A 4YPGB 2GW3A 3HNVL 2OTBA 3CFCL 2VN7A 4HIEB 1G7HA 4FZ8H 2P43B 4K8RD 5T1MB 4PRAA 3EFDH 4RMSA 1EZVX 4RMRA 1RMMA 5IBLC 3FQXA 3MR9B 1Y6NR 2EDOA 2JKXA 3AY4A 4NCDA 1E27B 3DPZA 2DJUA 4H0HB 4HC1H 1GCFA 3SVBA 3DQUA 4JB9H 4F7PB 2Z0BA 5IFJA 3OKOB 4OZGB 5I1CL 5T5FL 1OAKH 2XNAA 4IK1A 2E9BA 1NC4A 3MV7D 2W91A 1LDSA 5FYLH 4KI5F 1E4KA 2AEPH 5I6XC 4BFGA 2VLRB 4C56E 4J4PA 3VXSB 2IALB 5B22A 3MRIB 2X1WL 5AAMA 2B5IC 5K9OA 4RMVA 5JW5B 4LPWA 1JWUB 5C2BL 3M17B 4XMLH 1KXQE 1BQHG 5A2IH 4XVPA 3OKKA 1Y6MR 4ODUB 2X1PA 3BKMH 3VMOA 4FQLL 3HAEA 1KOAA 3VA2C 4DAGL 2HTLC 3NT3A 5MEPA 4PJBA 4UDUA 5IMOA 5EBWA 2OQJA 1U8IB 1GGIH 4EXPX 2NY0C 1J05B 4NKOA 1ZGLM 5SX4H 2OR8A 3SDYH 4QRSA 3DBXA 2M2DA 5F21B 1FL6B 2Z1OA 4ZPTB 2PETA 1A1MA 2LV4A 3AXLA 2YA1A 4JN1H 1PQZB 3RKPA 1SQ2N 2H45A 1HZHL 1XCQB 5DFVC 3SVNA 3LRHA 4NKQB 5F7NC 5FYKE 4Y19A 3OZ9L 1QPXA 4GAYA 4FHBD 5I1EH 1W7TA 2A73B 1BJ1H 3EW3B 3AS1A 5C0JB 3D0VB 1RIVH 3H9SB 4HFWA 1E6OH 3D39E 2CKBA 1ONQA 3GMMA 4OCRL 1T1YB 1XQMA 3TMRA 2FL5B 4Z0BL 2ZUWA 1AD0B 5FA3B 2GJJA 4WJ5A 3SSPA 3FCTA 4QCIA 3HUJE 3QZWB 3C6LC 3MCLH 3HNSH 2DLEA 2YE1A 2CJUL 3CDFA 1WCBA 1BQSA 2IAMC 5GSRA 4P2RE 1YQVL 4D9LL 4HIIB 5FDWB 5DK0A 3T2NH 3MRFB 5DVNA 1INDL 4M5YL 1FFNB 2HJKA 2COQA 1F42A 4KPHL 4WHTA 4EIZC 5HD8C 2LVCA 5IWLC 4AEHH 5F71A 1OLZA 5ADPH 2HFEB 3BQUA 3L9RB 1WFOA 2A1WH 2FB4H 4XBGA 4K3HA 4GMSH 5IM7A 1V7MH 4XCNA 4TOYH 1AGDB 5FK9A 5D96B 1MHPH 1YEKH 1KLUB 5BV7B 3WS3B 4PGEA 2AKRA 3V4UH 3WNMA 1BMGA 1T2XA 5E9DE 5DC9B 3MPCA 4JFXA 3DMMC 4L4VB 3SBWC 3GHBH 4JZJC 2YC1A 4QEGA 4QT5A 2Z93B 2W60B 2OR7A 1PX3A 3FN9A 2HPWA 4OZHB 4Q7TA 4KKCC 4LFHD 1G7LA 1ZA3B 3QIUC 4KXZH 3BKYH 4FP8H 5J6HB 3NTCH 5E6ZA 3U9PL 4MAUH 5IMKB 5C0ND 2ATKB 1T7YA 4F58L 3L3HA 3FOLB 1GAFH 3LSAA 3D25B 4WI8A 3R1GH 5C09A 5MERB 1EMGA 4ZUSA 3MJ8B 1DBKH 4RFNC 1K3IA 2M8XA 3WKNA 4M1CC 1JTOA 3GJFA 4YE4H 4H88L 4C4KO 3VWJD 1OQOA 1RZFL 4LL9A 4QXUL 1CBVL 3TEUA 5B8CC 5AUMB 1FO0L 5AWNL 3BWUC 1ETZB 4P99A 6FABH 4NOBA 5D7IF 5I30L 1DQTA 5GRXG 2AEQL 4MAYB 2GTZA 4NO3A 5D7JD 1IAOA 3IT8D 5F1IB 5LGJB 4FQXC 1I1YA 4DK6A 1OCWL 4MNQD 5AQBB 4X5WA 3TH3T 3LQMA 4P76A 3BHBB 5JIHA 1QQDB 1R3JB 1SHMA 2YS4A 4LQUA 1P5UA 1UVQA 3QZWG 5DEFB 4U3XA 2FZ3B 4WTWA 4W6TA 4PJ5A 2HJLA 2EDNA 3NFSL 1RSFA 5L2JA 3UZVB 4PJFB 2X4PB 4LCWE 4I3SH 3PDGA 1OSZB 3MBEB 1HCJA 1NFDE 1ADQH 3PE9A 3ET9F 3ARFB 5AD0B 4WCYH 5IVZB 2EKSA 1I3GH 3G5ZA 1AQKH 2AJYL 2QLEA 4P23C 2V7HB 3EYVB 4PRPB 3QDJD 5DC4B 1JF6A 3K74B 4QGYA 1EGJA 1IGFL 4QOKD 2B2XL 5LXGL 5L88H 1KCUH 3O41B 3OJMB 4XC3H 4NJAL 3ZUFA 4TQEH 1OGAE 4RNRB 4V1DA 1J0YA 5E5MA 2J7LA 4H0IA 2WQRA 2VUOA 1T6VN 3PP4H 3QUYD 2VB5A 1C12A 3RL1A 3WJJC 3F65A 5KS9E 2GY5A 3BP4A 5C2UB 5F44A 1IGIL 3RAJL 3SKNA 4PRAB 3V8CA 5HYIA 3IVKA 3FQXB 1J8KA 1A47A 1DBAL 3EDEA 4YDVA 2NYYC 1JYWA 2NXYD 3OPZL 3MJ9A 3B9VA 2EIZA 1K6QL 3QPXL 5L7XH 4P59H 4H8WH 3TYGL 5F7MC 5IFJB 2A9MH 2XNAB 1XIWA 1NC4B 1G7IA 3WJLC 4PJIE 3ZL4L 3MUGA 1TJHL 1S3KL 1X3DA 4LHUD 3HNVH 4TNVK 3TBTA 1HI6A 3CFCH 4JQVA 4W6MA 3ALXA 4PTTA 4X4YA 2OKWA 1OPGL 5FAAA 1S7WA 2DD7A 3BUTA 1S7UA 4NKDA 4FFVC 2ZG3A 5K9OB 1XR9A 4LDLB 4MB4A 4L8DA 3RWCA 3I02A 5KSAD 1ND0A 2NTFB 2YA0A 2P5WE 4OCYL 2BNQE 5T3ZE 5DEZA 4A2MA 4N1EA 2ICWJ 5E2UL 4LSTH 5I1CH 1QSFE 2CK0L 5T5FH 5D1XA 5MEPB 4PJBB 3KPQA 4UDUB 5IMOB 5E70A 1HHHA 4HAFA 4U1IA 3VI4F 4BFIA 5EBWB 2EYTA 2YN5A 2Q7YB 4WTXA 2APVA 2OQJB 2W0FA 2ZG1A 4NKOB 1FVEA 25C8L 2LQRA 3DBXB 4QRSB 4IK8A 5C08A 4XGZA 3MX0A 1A1MB 3AXLB 3UZQA 2FBOJ 5SV4A 5FM5O 3GSVA 3TNMA 5C0NC 3C5SA 3ZKMD 5C2BH 2EH7L 3I85A 1D5BA 1FNGA 4JGEA 1TQCC 4OLUL 4Y19B 4HMDA 2WWKT 4FQLH 1BIIA 4DAGH 4TZAA 2H3NA 2C9AA 1Z3GL 1ZLWH 5FVIA 4XT1C 3S96A 1F4XL 3KYMA 3NN8A 4ELMF 5DA4A 3JV6B 3G6JE 2CKBB 1ONQB 3GMMB 4JFDE 2YK1L 4U7MA 1U8JA 1I9EA 1XH3A 2R8SL 2GUOA 2CLRA 5D1ZA 5DU0A 4WJ5B 1YHGA 3UYPA 5IW6A 3FCTB 4QCIB 4MCZA 3LVAA 4PGJA 4HBQA 5DSCA 3FJTA 2DDQL 1HZHH 1WCBB 5GSRB 2AH8A 3R8QA 4GBXD 3OZ9H 4P4KC 2HJKB 3TWCL 3ZKXB 5H89A 1MI5D 1K5NA 2NZIA 3MLRL 3HR5A 3O9WA 4OCRH 3BQUB 2FIRT 3HG1E 3ZDXE 5IB5B 1EV2E 4Z0BH 4LW5A 4XBGB 1VESA 5IM7B 4F9PA 4XCNB 3MJGX 2QQNL 4OCXL 5FK9B 4NGHL 2GTWA 3DQ4A 2Q57A 2IQ9L 2FNBA 2JB6A 3BZDA 4PGEB 2AKRB 1WIOA 1YEJL 2W1NA 4JFXB 3F7QA 1X4ZA 2CJUH 4HIJA 4QRUA 2YC1B 5TF1L 2MSPA 3PL6A 5ACZA 4D9LH 4QT5B 3GRWL 5IJVA 1INDH 4M5YH 1J11A 2UWEF 4KPHH 4OLVL 3CC5A 1FYHB 3MLSL 1RZGA 1YY8A 1P4BL 4JAMA 3LKRA 4N8PA 5F88A 5DTLA 5BRZA 3B2VL 4X8JA 1QZ1A 1Q9WA 2FBJH 3B9KA 3L3HB 4HPYL 3U0TA 2KZ1B 3SG3A 1AP2B 4M03A 4OF8A 4ZUSB 5C09B 3K8KA 4TUKL 1S7SA 3KS0J 4NN6B 5D7LA 4KMTL 3GJFB 4OKVA 5DHVH 3B6SA 2WHUA 1U42A 2Y36L 5I2IB 2NXYC 5GRVL 3E8UL 4J3VA 1B4RA 4MXVF 1QBAA 2YRZA 2FX9L 3EDDA 3S34L 5DI8A 2GTZB 4NO3B 5D7SH 4G8GD 3U9PH 1I1YB 3HI6L 3VXSD 4F58H 4X5WB 4C57C 2QADB 1D6EA 3Q3GA 1NMAL 4OQTL 5DMIL 4KHXL 1QACA 2KQNA 4K8RL 2ZWLT 1WT5A 4OD1L 5FM4A 5F6IB 1RZFH 2VQTA 2HJLB 4PJ5B 1CBVH 2HT4C 5AWNH 5L2JB 2DMCA 3C5ZA 2W9DL 2WBWB 2B3QA 3TN0C 2AS5M 5I30H 2AEQH 1WCQA 3S37X 1TNMA 3LSOA 2EKSB 4XMKL 5ALCL 1OCWH 3G5ZB 2YD5A 3F7PC 1VENA 4W6DA 3FQWB 3VG9C 5FYJD 2I9LB 4W6LA 5DVLA 5T3XE 1EH9A 1QG3A 1UXWA 2NX5A 4BH8A 1IM3A 1MQ8A 4FQ2L 5DTXA 5MHSD 3NFSH 4C55A 1IGCL 4K3EL 2QQLL 3BJ91 2AW2A 3H9SD 1MIEL 1NMBL 1VGKA 3CSBA 4V1DB 4ZIOA 4NFBA 4MGXA 5E5MB 1NCUA 4PJXA 2AV1A 1FC2D 4XB7A 5FKAA 1C12B 5K93A 3RL1B 5I8OL 2AJYH 3H9YA 3BDXA 2A83A 3BP4B 4NQUA 2GSIA 3CFIC 3SKNB 3IVKB 5BVPH 3UTTA 2XXMB 1EXUA 1IGFH 4QTHB 4YDVB 2DQGL 2B2XH 2WIIA 2EIZB 2CPCA 4LSDA 4ZDHA 5F7KC 3UCRA 1JE6A 4PJ7A 4NJAH 3B9DA 5DF0A 4J88A 2EYRA 5H2BB 1XIWB 5CJXA 3VFWA 1MWAL 3QUMH 3VXRA 1G7IB 4CVUA 3DRQA 4PJHA 1F0BA 3VDCA 2UY7A 3QQ4A 4W70A 3TBTB 3U46A 5C0FA 1HI6B 1H3GA 4PTTB 3ZTFA 4X4YB 4JRXA 1JBYA 4J23A 1IGIH 3RAJH 1ED3A 1S7WB 3T0VA 4L4VD 1C4FA 3MLXL 1DBAH 5C9JA 4XVUD 1S7UB 3P4MA 3D2UD 4FFYL 4NKDB 4Y0GA 3OPZH 5HVHC 4U1JA 1XR9B 4L8DB 3RWCB 1NUFA 1ND0B 3ST2A 1K6QH 3QPXH 3QEQE 4LCYA 3RP1A 4UNVA 3TYGH 1HHGA 1JI1A 3K81A 5D1XB 2X05A 3DQNA 2HWZL 1JGEA 3KPQB 1HHHB 4U1IB 4WWKC 4BFIB 3WLBA 1TENA 3ZL4H 2EYTB 4PRDA 5ESAA 4GRLC 3P11L 1TJHH 3V7AG 2W0FB 4QLRA 4W75A 1Q1JL 1FVEB 2EDHA 5EBLB 3WFHA 4NJ9L 2J5LC 2P24A 4XGZB 1OPGH 5KSBF 1AO7E 4OFVA 1NCDL 2ZMWA 4AT6A 2DI9A 3GSVB 3TNMB 5KAQF 3C5SB 4OCYH 3IDMA 4HZAA 2VDML 3O6FA 4N0FA 1D5BB 1FNGB 2CK0H 3N1FC 3DQAA 2LU7A 1BIIB 3DQFA 3NA4A 2H3NB 3PXJA 4MAYD 5FGCE 3S96B 2BY2A 3KYMB 3NN8B 1OLLA 2RGSA 2IE2A 4KRPB 2FCBA 1NLDH 25C8H 4G80A 1DBML 1U8JB 4RMUA 1P9MA 1G9ML 3M8OL 1XH3B 1HKLL 2Y6SC 5HDBE 3VFUA 2CLRB 5D1ZB 5D1QA 2IB5A 5IW6B 2EMOA 4MCZB 1XF5A 4L8BA 3S37L 3NVQA 4P2QA 2EH7H 1EEQA 3IU3A 1OP9A 2DUGA 2Y0GA 4OLUH 3U4AA 2HJOA 3X13A 4KUCF 2GI7A 4E9LA 4JFGA 4J3UA 3MBED 1GL4A 4X7SL 1Z3GH 2HMID 1U3HA 4FS0A 1F4XH 4LQ1A 3KJ4B 3ARFD 1K5NB 2DS4A 3HR5B 3O9WB 2YK1H 4JM2C 4G9FA 2HA1A 4U0RB 1RQ5A 4M62L 2XFXA 1CGTA 2R8SH 2FH8A 2GTWB 3O11A 2JB6B 1EUTA 4LEXL 2NY1C 4TNWF 1U2CA 1DBJL 1ZA6A 2DDQH 4HIJB 2KL6A 4QRUB 3VI3F 3SGKA 5ACZB 5HDQL 3QAZC 4JFYA 4LASL 5F93C 5IJVB 3E2HB 2NNAA 3OJ2C 5CSBA 1I7ZA 3CC5B 4KMLB 3G08B 4FG6D 4Y5VB 3MLRH 1RZGB 5ICXA 2QL1A 1YY8B 3MCG1 4JAMB 5F88B 4S1DC 5BRZB 3DXAD 4EN1A 1CGSL 2BSRA 1Q9WB 5JOEA 4OCXH 4NGHH 3B9KB 4RSVA 2DIBA 1YJDC 2H2PD 3CFDA 5JLZB 5D93C 2Z8SA 2IQ9H 4MXQD 3U0TB 4C56D 2A6DA 1YEJH 3DUSA 3UBXB 5CEZE 1S7SB 2VC2H 1NGWA 5D7LB 1IAKA 1W8NA 5TF1H 1GHFL 1T0PB 2ZCHL 4LPTA 4OKVB 3CPLA 4XNZC 5DVOA 3B6SB 1VDGA 4JO2L 1ZVHA 4ZFSA 4OLVH 2VADA 1NC4D 4RCAA 4ZTPL 3T0AA 1M7DA 2DBLL 3MLSH 3G6AA 4F8QA 4JPIB 1BIHA 2B0SL 1Q9OA 1VA9A 3B2VH 4UAOC 4PUBL 3TH4T 4G6AC 3VXME 3KCTA 5B4MC 4W6BA 4AL8L 1CF8L 5DI8B 4NPYA 5CS7A 4OGZA 4HGKC 2EIDA 5C0BD 5JTWA 4J4PD 2PF6A 4N8CL 3QFJE 1D6EB 3Q3GB 1U8NA 4GT7A 5D96C 4TUKH 4DGVL 3S98A 2H2SD 3G6DL 3MRHA 3QCTL 3X12A 1JYVA 4BSWA 2P42B 4NNPL 4KMTH 3FQNA 3LQAC 1KPRA 2D4DA 2D31A 2GIYA 4H20L 3E8UH 1S7VB 3T2PA 2FX9H 3DI3B 5H88A 3S34H 2HT2C 2YPKA 1EMLA 2DLIA 3LSOB 3LRSA 3HI6H 3ROOA 2VOTA 1INEH 3BPOB 1HWGB 4WY7L 1NMAH 4LLVA 2AK1L 4OQTH 5DMIH 4PJEF 4S1QH 1UXWB 4DCQA 2NX5B 5JA8B 4KHXH 4XI5C 1IM3B 4K8RH 4M6NL 3LN9A 4OD1H 4Y19D 3U0LA 5JQHC 4OI7A 2DDDA 2AEIT 3ZKQD 4R9HA 2XY2A 4WO4A 2W9DH 2YZ8A 3IETA 2BP3A 1VGKB 4PR5B 4LJDC 1FE8L 2K7PA 4PJXB 2DM2A 2AV1B 4WW2A 5FKAB 4XMKH 5DFTA 2AJXL 3PV7A 1WBXA 2A83B 3ARYA 2OZ4A 2CR3A 1RFDL 1OWWA 3E5TA 2GSIB 2FWQA 2CSPA 3U0MA 3UTTB 4JCMA 1EXUB 3KVQA 4FQ2H 4KMQA 2WIIB 4UU9A 3OKEA 4I0PA 3UBXG 1IGCH 4ZDHB 4K3EH 2QQLH 3SS0A 3B9EA 2MKLC 4K3DL 1MIEH 2EYRB 1NMBH 3LD8B 3BQUD 2F53D 1IC1A 1P6AB 2FATL 2VLRE 3RVUD 3VFWB 3VXRB 5ICZA 1S9KC 3NCBB 4PJHB 3SE8L 3TBYA 5I8OH 5DJZA 3QQ4B 3U46B 5C0FB 2HN7A 3ARFC 5HGAA 5IVNA 1ED3B 1RVFL 5GGTA 5HDLA 3V6OC 4BUGA 1MCHA 5C9JB 3DSFL 2OP4L 3P4MB 2DQGH 1X5LA 4U1JB 5D5MA 4JREC 1R3LA 4HH9A 4LCYB 3AFLA 3DURB 4P5TB 1HHGB 1H5BC 1GFLA 1YZZA 3H7LA 3V6FA 5CP3A 5TE7L 2BFVL 1JGEB 1VFUA 3BP5B 4XAKD 1MWAH 1XA9A 2W38A 4DK3A 3WLBB 3MRMA 1ZMYA 4PRDB 5ESAB 5GGRA 3ARTA 5CP7A 5JXAL 3WFHB 2P24B 2ZUVA 3HTLX 5C09D 3ZYOA 1V3JA 5IJKA 5DO2C 1RUAL 3MLXH 2XWTA 4FFYH 4RYWA 1FYTE 4AT6B 2YPVL 1Z9OA 2H2PC 3V6ZB 3VMPA 4P46A 3IDMB 3B9AA 3GIVA 3O6FB 4N0FB 4XPTL 4N9GA 3KG5A 1CD1A 1D5IL 2HWZH 5C0CE 1TDQA 2FHCA 2P8LA 2ZCLL 4B50A 3P11H 2WIMA 3GL4A 1Q1JH 2J3SA 4G80B 4LPYA 4NJ9H 3ROLA 43C9A 1U8OA 2QADD 1E4KC 5SWZA 1NCDH 3VFUB 2OCFD 5D1QB 2FZUA 4LNVA 2Y23A 5CIPH 1XF5B 4L8BB 4P2QB 1EX0A 5ETUA 2VDMH 3IU3B 4H5SA 2AI0L 5IW3A 1NAMA 2AK4A 3X13B 1G6RL 3Q6GL 1U3HB 5GJTL 1L9NA 4WFHE 2RIKA 4IOFD 4W68A 4TTDC 4Y4KC 1L4IA 1XR8A 4R0LC 1T0NA 4UOW1 3NT9A 1DBMH 4G9FB 2O24A 4CU6A 1G9MH 2XN9E 3M8OH 1HKLH 1WZMA 2XFXB 4JFPA 4PY8J 4ZO6A 4ESKA 3O11B 2D7QA 5C3TA 2DKMA 3S37H 4HULB 1BQLL 1H4UA 1ZA6B 4JFHE 1KCSL 1ZHLA 2UUDH 1HXMA 5L2KA 4OZHE 5GS0C 1EERB 4AH2B 4V1DD 1DQML 2JLLA 4JFYB 5F1KC 4IMKA 4X7SH 2NNAB 1JBJA 4BDUA 2X1XR 5ICXB 3BX9A 4NUJB 2BTJA 3VRLE 4JFOA 3AC0A 4UIKL 2BSRB 2PKDA 4M62H 3KLDA 4ORGA 3VGEA 1RD6A 1YPZF 1JPFA 2R56H 4FMFA 4Q97A 4KK8C 3UDWC 4M93B 5I75B 1JTPA 1UEYA 2XQBL 4LEXH 2A6DB 4RA3A 1DBJH 2JK5A 3DUSB 3V9FA 3ULVL 4IMLA 2DJ4A 3QRGL 1JIBA 1NGWB 2ARJA 1IAKB 5TJWK 2WZPD 4PV8A 3P3YA 3CPLB 4MD4A 5HDQH 5C0IA 1AXSA 1GZPA 4LASH 1XIWD 1YMME 2ZCKL 3SDXB 3MRBA 1FNAA 5A16A 3G6AB 4APQA 3V2AR 4OZIE 1Q9OB 3ZKXC 3ME0A 1LEGB 1CGSH 1NFDF 1SJXA 4NPYB 3BQUC 5T1DL 1KTKE 3Q1SL 1N59A 5DJ2A 3TA3A 3MRHB 3X12B 4BSWB 1GHFH 1VCAA 3CDYA 2J8OA 3S35L 2ZCHH 2IH3A 1YJ2A 5C0DA 2BNRA 3JWOC 1KPRB 1QBLL 3KPMA 4XP5L 4JO2H 2H5OA 1X5JA 2D31B 4OM0L 4ZTPH 2DBLH 5HYJA 2OLDA 3C8DA 3T2QA 2B0SH 4TRPL 1KJVA 3V6OE 3BRGC 3W0WA 3VGDA 4PUBH 2EIBA 4PRPE 4OCNC 5C08D 3ZHKA 1CF8H 4AL8H 2YPKB 4OUOA 2WNGA 5ILTH 3ROOB 2VLKE 4N8CH 3S6CA 2WUBL 2H5QA 4PJGE 4LLVB 2V2WA 3G6DH 3KXFD 1NGQL 3QCTH 5BV7L 4DCQB 4JZOA 4NNPH 5EO0A 4JM4L 1ZLVH 2ZUSA 4R26L 3UTSE 4NN6C 3VXUE 2VDPL 3BKJL 4H20H 4WO4B 5C07D 5IB1A 3IETB 4M61A 4X6EA 2IBZY 3ED8A 3ECBA 3FRUA 1FFOB 4E5XA 4XNXL 1LE5A 4QKXB 5DMGD 1NUDA 2P8PA 3HG1D 4PP2A 4DOHB 4U3CA 2XOTA 5GZNC 1KIUA 7FABL 4MA3A 4WY7H 2AK1H 4UBDD 4GFTB 4MA8L 1UH2A 4M6NH 1MYWA 2D4FA 3ULUD 3QJFB 4GRWB 5CMAA 4UU9B 3OKEB 4I0PB 1YECL 2PYEA 5D8JL 4X4XA 2V9RA 5F6IC 4EN3C 3O9WD 3DQ3A 3NA9L 3ARDB 5J6GA 1FE8H 1IL1A 2ZUUA 5H87A 5ICZB 3SVCA 2P46B 1RIHL 2DI7A 3RVVD 5I1AA 5DJZB 4YQXL 2AJXH 2HN7B 3DETD 3PGFL 3HLAA 5K9KB 3PWNA 1RFDH 2N56A 2HKFL 5HGAB 3VXQA 1UACL 3KPNA 3H42L 4DUXA 3OB0K 2QSQA 3PL6D 4RFOL 4HLZG 3A8SA 5FYKU 3H8NA 5D5MB 4OSUL 5BVJB 1R3LB 4HH9B 2AVGA 4KTDH 1QKZL 1G9NL 2ERJB 4K3DH 3V6FB 3MZGB 5BRZD 2FATH 3T8XA 4OFDA 1F97A 3MRMB 5GRYA 4X6DA 4HKJA 3SE8H 1NL0L 5GGRB 3VXNA 1YEEL 5CP7B 5DQMA 3B9KD 3EO9L 1OB1A 3L7EB 4X8XA 3PP3K 4TNVF 1WQVT 2GEEA 2XWTB 3DSFH 5D7LD 4L12A 4RBPH 3SEPA 4W6KA 5TH2A 2O2BA 5E2WL 3GM0A 3DPWA 4D3CL 1SYSB 1OXEA 3GIVB 4UQ3A 2DJSA 1C5CL 4DW2L 2KBGA 4N9GB 1CD1B 2CO6B 5TE7H 1CE1L 2BFVH 4WU5A 3RJQB 2P8LB 1KIRA 5E8EA 3LPGA 3PQYD 1Z6JT 5JXAH 4HZLA 2OJKA 2V17L 4NQEA 5SWZB 5D6DA 1BBJA 5E8NA 1Q72L 1G7JA 1RUAH 1KB5L 3V8OA 5DMKA 1JMXA 5IF0A 2FIKA 2YPVH 3U7YL 3NCYP 4XHJD 1GSMA 4UNTA 1I9JL 1TZGL 5ETUB 3C5ZD 4XPTH 5CGMA 1A21A 1HINL 2AK4B 1PG7X 4P3DA 1D5IH 4LCCB 2ZCLH 4HPOL 3HZVA 1U58A 3TH2T 1KT2A 4B7IA 5D1XC 1PYWA 2AERT 1XR8B 1T0NB 5GGVY 5T3IA 1UWEL 4LP5A 2BHZA 3IJHA 3LS5L 2H6PA 4JFPB 3AU1A 1BFPA 3ZLQC 2NX5D 1J86A 3DQIA 5EWIL 2BXZA 5BOPA 4L3AA 3DLQR 1ZHLB 5I8CA 4JF9A 5L2KB 4EDSA 2AI0H 3MGOA 4HBCL 4KHTL 4LVNB 3VGBA 1G6RH 5DMJB 3ST0A 3OR7A 3Q6GH 5GJTH 5MENA 1F3RB 2VJXA 1M1SA 4GOSA 4JFOB 1RURL 2EKJA 1BVKA 4WHYG 2WW8A 4KF5A 4KRPC 4ORGB 1HXYA 1P4IL 1JPFB 1F8TL 5DMGC 3UTTD 4Q9QL 3MRQB 5D1ZC 1LEIA 2NMSA 2Q3ZA 1BQLH 1KCSH 2JK5B 3Q5OA 3IJYA 4IMLB 5JA9A 1ZT7A 2PUQT 5IGXL 3BXNA 1N6QL 4PV8B 4MD4B 5C0IB 1AXSB 1GZPB 1DQMH 4P2CG 3E6FA 2Y25A 4WI2A 1J8HA 3MRBB 3VXRD 5A16B 4APQB 3LOWA 4YC2B 4QHKJ 1MCBA 3UEZA 2EDEA 1F3DJ 4UIKH 4JRXD 5LGHL 2V5SA 2CKBL 4N68A 3WCKA 1MNUL 5J4MA 3CB9A 1T7VA 3UROR 5ERWA 4F9PC 4I8DA 1A7OL 4PJ5E 1NDGA 2XQBH 1N59B 3DETC 4IRSA 5DJ2B 4JO3L 1XT5A 3H0TA 3ULVH 3TA3B 4KA9A 3QRGH 3SKJH 1BGXL 5C0DB 2BNRB 5F3HA 5HZTA 2I27N 3D5OF 1T1XA 1F5WA 3EYQC 2MWCA 2ZCKH 5CJOL 5HYJB 3D18A 4LLUA 1Z2KA 3E2HC 5F1OB 5JIKA 3VFNA 1KJVB 2H5RA 3W0WB 2OBGA 4Y5VC 3MA9L 4HXBL 3QIBC 4Q6YA 3VW3L 1HHIA 2PW1B 1FNLA 1YN6A 2IBBA 5T1DH 2GITA 3FHAA 3ILPA 5MEQA 3RRQA 3Q1SH 4ERSL 3GHEL 1NBVL 3RJDA 3B9KC 1NH6A 2VQ1A 3CAFA 3LF3A 1B0WA 2VUYA 3NCJL 3O6FD 4JZOB 1OT1A 5EO0B 5IBTL 3U0WL 1I1AC 1CDIA 1QBLH 4XP5H 4GUPA 4G8FA 5C0GA 3WUWA 4LNRA 3HE7C 2XA8L 4OM0H 5IB4A 4PLJC 2EMNA 1KTRL 3QEHA 5IB1B 4M61B 4X6EB 3HHRB 4TRPH 5CKAA 3ECBB 3FRUB 4LF3B 1JC1A 4E5XB 2CUHA 1ORQA 2WISA 3BPNC 1LE5B 4PP2B 2ENSA 1QSZA 5HGHB 5JORA 5L0QB 4X6CF 5CBAA 4N0UE 2EEBA 5D1QD 3WS6C 3RIAK 3W82A 2WUBH 5IVXF 4X7EC 2F19L 4MA3B 4P2QD 3GGWA 1NGQH 5BV7H 3MUY1 2G6YA 2HRSA 1MJ8L 1YNLH 4JM4H 5FOBB 2YUWA 4R26H 2DAVA 1LWRA 4XX1E 2PYEB 4F7MA 4X4XB 1U3HD 2VDPH 3BKJH 1WT5C 4L1DA 4XHJC 5T1KA 5BS0A 2YD2A 3JV0A 4M43L 5EN2A 5J6GB 4G9FD 4TVSa 1IL1B 4XNXH 3KDMA 3LN4A 1CFQB 5D72L 3SGDI 4HWNA 5I1AB 3IGAA 4YHML 5F96L 7FABH 4Z7OF 3VXQB 3EKHA 2H6VA 4IEFB 4RWHA 5C0AB 2IF7A 4MA8H 3DQ5A 3O2DA 3H1RA 1D9KA 1YECH 5D8JH 2J2ZA 4WFFD 3HS0A 2VERN 5JR1L 1L7IL 3NA9H 4OTXL 3T8XB 3X3FL 1WWCA 2BY3A 1TVBA 5I17A 1RIHH 4HKJB 4X6DB 3VXNB 4MSWA 1MCPL 4YQXH 1U6AL 3VXMD 3PGFH 2Y72A 1CXFA 1RZKC 1OB1B 1O7SA 2HKFH 1IMHC 4BELD 1NJ9B 1GGBL 3MUHL 4PGCA 1MCRA 4B53A 1YFPA 3H42H 2R15A 5JHLH 1SMOA 3I2CH 4RFOH 5TH2B 2P1YA 1GVIA 4OSUH 4HFUL 4WI4A 2JIXA 2BC4A 1EGJL 5IB3A 1QKZH 2X41A 4UQ3B 1G9NH 4NRYA 3G5VA 3CFBA 4S0TD 2ENYA 4OZFA 4WU5B 1QRKA 1WFNA 1GGCL 1KIRB 5E8EB 1NL0H 1YEEH 4R2GC 4XB8A 3FFCA 4HZLB 3EO9H 2OTUA 1KP5A 1UKTA 1KENL 4NQEB 4RX4A 3MRPA 4ODBD 5HI4D 1BBJB 5E8NB 1MHHB 1G7JB 1A2YB 1ZEAL 1ITBB 5DMKB 2FJFA 3BPCA 1FZOA 5IF0B 2FIKB 4XTRC 1NGZA 4Y4HA 3L7FA 4ODVL 5DXWA 4LVHB 5E2WH 4CDGC 2G6XA 4D3CH 5CD3A 3I84A 2XWJA 1JJUA 4CADA 4NQDA 2IH1A 1C5CH 4DW2H 2R1XB 1KN2L 4P3DB 5DZNA 4KKNA 4OLZL 1CE1H 4QXGL 2EXWD 4P5TC 3EK8A 3MQIA 1AR1C 3HZVB 1U58B 5CKGA 1KT2B 2CUMA 1NKRA 1NGYA 1PYWB 1OAYL 4LLMA 1QHOA 4BZ2H 5E0QA 2V17H 1AJ7L 3HRPA 2DD8L 3IJHB 2H6PB 1Q72H 3AU1B 2ZNWA 1KB5H 4L9LA 4EJ1C 3FO9A 3OHXA 4GH7B 4K3JL 4TVPD 4UUJA 3U7YH 3WO4B 1I9JH 1TZGH 1ZUXA 3PHQA 4WO4D 4QTIL 4RWYL 5KSUA 3MGOB 5HI3D 4YAQA 1HINH 1DUZA 1WIUA 1Z5LB 3ZO0A 5C92A 5DZLA 3OR7B 4HPOH 4YXLL 5MENB 4KUZL 4R7DA 3SY0A 4CMMA 3SG5A 1UWEH 2IANA 3DQ7A 1BVKB 1DQDL 3LS5H 4NWUL 1IC4L 3ZT7A 2D7TL 3U79A 5EWIH 1LEIB 1TCMA 5D1QC 4I0PD 1T89C 1J9CT 1UFUA 1T20A 1ZT7B 4HBCH 4KHTH 5HPOA 4KKLD 3BXNB 5JMOC 1OP5K 1V3LA 3V0VA 2YXFA 3E6FB 3OAUL 1J8HB 1VEMA 4J89A 5J3HD 3CDGA 4H1LA 3HAEH 3WCYA 2BVUA 1UWXH 1CQYA 3QUXA 1CDUA 1RURH 1NCAL 2X70A 3NCFB 5CCKL 1WEJH 1OHQA 3K4ZA 2LFGA 1P4IH 1KEGL 1F8TH 5ERWB 2OSLA 3QG7L 4Q9QH 1REIA 1GOFA 5FO7A 1NDGB 2DYPA 4HG4J 4IRSB 3H0TB 3EK7A 4YHYC 2VLLA 5IGXH 4EDWL 4UMGA 1N6QH 5F3HB 1T1XB 5AYQA 3SGKC 3IXAA 3ULUL 3D18B 4LLUB 2GY7B 5INCA 3VFNB 3Q2CA 5D2NA 2BY0A 2QLHA 4DKDC 5B39A 1NKOA 5AG8A 3QI9A 1VPOL 4HUUA 5KVFL 5JOFA 5LGHH 1HHIB 2CKBH 3RGVB 1MNUH 3QHZL 3ARQA 4I18C 3L3OA 4DXOA 4XP1L 1YN6B 3CVHA 1CTNA 4Y1AD 1A7OH 2GITB 5KG9A 3ILPB 5MEQB 5DY6A 1KXTB 5JXED 4RAHA 4UILL 4JO3H 1SEBB 2EZ0D 3NEDA 4P46D 1BGXH 3BJLA 4M93C 1S5HA 2Q8AL 5I75C 1IJ9A 2K3TA 4OZGF 4GUPB 4G8FB 3WUWB 3ULSA 4LNRB 5C0GB 4HIXL 5AAWA 5IB4B 1YNKL 5CJOH 3QEHB 3OKDA 4D9RE 2PCPB 4UT6L 2VLME 1ORQB 3MA9H 4HXBH 5SWZD 3VW3H 4AIXA 5ID0A 5JORB 5CBAB 4QRPA 1CN4A 5GJSL 1S7TA 3GHEH 1NBVH 3L3JA 4ERSH 1H15A 2UZIL 2ZO6A 3GGWB 3ARVA 5IFHL 3T0EE 1LQSR 3NCJH 4BA8A 5IBTH 4W6SA 3U0WH 2AK4D 2B4CL 1MFCL 2WUCH 1OAUL 2XA8H 4G6ML 4P9HC 4F7MB 2DL2A 4YR6A 4JM2F 4DZ8A 5F7EL 3ZE1F 5T1KB 4B5EA 5BS0B 5SWSA 5EN2B 1JPST 4NFCA 3RWJA 3LS4L 3QQNA 3KDMB 3LN4B 3OGOE 1FO0A 3LKQA 4D0BA 4GG6A 4F2MA 2BHYA 3IGAB 4EI5A 1YHIA 2F19H 2OL3A 3B3IB 4ORZC 5LTQA 2FHFA 2G6EA 4YH6A 4E41A 5L2KD 1MJ8H 1NUGA 3TBVB 4Q58C 3CZJA 1X4XA 4PS4L 1D7FA 1FIGL 1U92A 3HB3D 1D9KB 3RDTC 4X0KA 3GJFH 3GB7A 3HS0B 3RUGE 4WO4C 3LPFA 3WXWL 4M43H 4DGIL 5HI3C 3BN3B 2F5BL 5I17B 2AXHA 5D72H 1KGCD 3PWLA 4MSWB 1UENA 4YHMH 2N4IA 5CAYB 3RX7A 1TZIA 3ZHLA 3AB0B 5J57B 1XGTA 1U2HA 1BD2B 2XTLA 3GMLA 5DD1L 3GMOA 2JCCE 3BEWA 2JIXB 3NFPA 2BC4B 3E0GA 4JVPA 2PTUA 4OF0A 3G5XA 4APQD 3TPUA 4FTVE 4I0PC 4NRYB 5F9WB 2QV2A 3G5VB 3WUWG 3CFBB 5D2LA 5JR1H 4OZFB 4XPFL 3F7VA 4OTXH 1URLA 4ZINA 3WYRA 5EUOA 3IRPX 4PPJA 1MCPH 3ARDC 1U6AH 3MFFA 3FFCB 4ZOCA 1L7TL 2OTUB 3NABL 3UTQA 4JQXA 3MLZL 4Y5YC 1BFTA 3SGDH 3IR8A 3MRPB 3UTZA 1GGBH 3WV0A 1IILE 3TA3D 2R0LL 2XY1A 1OTUD 2FJFB 2VDNL 3BPCB 3ZSTA 3MRDA 2BNRD 1RMPA 4Y4HB 3L7FB 1HQ4A 4HFUH 2VLJE 4NQCE 5DPGA 1EGJH 5CD3B 2XWJB 3FMGL 4CADB 3V5KA 4NQDB 5HYJD 5B3NA 1LP9E 3QJHA 4PRBA 2LVEA 4OZHF 1QPPA 3HMXA 1E4XH 3W0WD 4H3LA 4BSVA 2ERJC 1GGCH 3O4LE 3FTGA 3I6LD 1NGYB 4LLMB 3CU7A 3GI8L 5J12B 3AS3A 1I1CA 1KENH 3W11D 4CDHA 3GEWB 4HKZA 3VCLA 1ZEAH 5EIIA 3VA6A 4JEGB 4L9LB 4N1HB 3FO9B 3OHXB 5IG7A 5IJKC 2X5PA 2C4FT 1XMWA 4ODVH 4UUJB 4OUUA 1IEBA 3OGCA 4OCLC 3PHQB 5DA0B 5KSUB 2OXHA 3C09B 4KDVA 3GMNA 4YAQB 1B2WH 1KN2H 1OAZL 1DUZB 1QTYT 3B5TA 3IFLL 3BYYA 3P40A 4OLZH 4PJDA 2XTJC 3QHFL 4LDOB 1CI5A 1DQJA 4LAJH 3R8BB 2YXMA 4Y16A 4R7DB 5D7KD 3SY0B 3IFNL 3NPSC 1OAYH 2E9IA 3NBNA 3CIQA 4CMMB 2Q20A 1H8SA 1DQLL 4JO1L 2IANB 5C9KA 3UO1L 2DD8H 4GQ9L 3PGCA 1P7KA 2YUXA 4PRIE 4K3JH 2FO4A 3SDXE 1SM3L 2PYED 1A6UL 5E1AB 4QTIH 3T04D 1T20B 4L8SA 4PJFF 4RWYH 3W9DA 3GBMH 1I8IA 3V0VB 1K9TA 1L0QA 1B0RA 4OGYL 1LILA 4YXLH 4QHKI 4PLNC 4KUZH 4KGLA 3K3QA 1FCGA 4H1LB 4LCCC 1OF2A 5CZVL 4ZTOL 4OZFG 4XH2A 3QUXB 4LDEB 2BY1A 2J8UE 3L3KB 5GQBA 2X70B 1DQDH 4R4NC 5DDHA 4MJ2A 4NWUH 1UC6A 1IC4H 4M6OL 2D7TH 3WDHA 3TJHD 2OSLB 4JFEE 5FO7B 2QSCL 4ALAL 2DYPB 3SOBL 5C0RL 3MNZA 4GOBA 2VLLB 4MHHI 3U6RA 2EECA 3IDYB 3F6LA 3KLSA 3DRTA 3OAUH 1ZLSL 2ARLA 4LVNC 3TVMA 3IXAB 4XPHL 1IRAY 2ZKHL 3E3QC 4LBEA 1HYSC 4IMKC 5INCB 5D2NB 2W92A 5B39B 3DQ9A 4DXNA 1NCAH 1T80A 3QI9B 4HUUB 5J1SC 1X5GA 4M8QA 4WGWB 5CGYD 5ANME 5CCKH 5JOFB 3L3OB 1U8KA 1KEGH 3QG7H 3CVHB 5F9OL 1EO8L 5KG9B 2P4MA 4S2SA 1CFVL 4JLRA 3AM8C 4YZFE 4MJIA 1A3LH 2WM0A 5HJ3A 1S5HB 1MCCA 1JFQL 4EDWH 2F74A 3PXHA 1D5MB 4L29B 3GNML 4EDOA 4LKXA 3ARZA 4UZGA 5CJQL 3ULSB 4BM7A 4DKEL 4N5ED 1CICA 3ULUH 5DD0L 3RFZC 3OKDB 2ED7A 3SSYA 3SE3C 4NZDA 4HDIA 1WZ1L 5DHVB 5KVFH 3GRWA 4CUCA 4LRNL 4NQED 2WURA 2ESVA 3QHZH 5ID0B 1ZS8A 4FQHA 4XP1H 1IZJA 3JVGA 2HGDA 4QRPB 1S7TB 1OGTA 3L3JB 3FRPA 4G3YL 1DQQA 1H15B 1Z0NA 3AMKA 4UILH 2E9WA 1K3ZA 5DHYA 1KIPA 2Q8AH 3QT2A 2VN4A 2PO6A 4HV8A 4NHCL 4MQXD 4HIXH 4PJBF 1YNKH 2BRRL 3S5LA 4XOVA 4CVZB 4YR6B 3G5YA 4UT6H 4HK0A 2IWGA 4DZ8B 2NY5L 1A7PL 3IFPB 5EBMA 5I19H 5SWSB 4TN9A 3RWJB 4B7LA 1M05B 4YXHH 3ELAT 4H1LG 4D0BB 1FO0B 4GG6B 4F2MB 1HOCA 3QUZA 4LSQL 5D5ME 5GJSH 1HUYA 2OL3B 2UZIH 3HA0A 5IFHH 3W11C 4E41B 3QPQD 2SEBA 3REVB 1RY7B 3RPIA 4MNGA 3VRIA 2B4CH 1MFCH 4D2NA 1U92B 3ETBF 1OAUH 3I3BA 4G6MH 1A9EA 4X0KB 5MEND 4LLWA 4G9DA 3GB7B 5F7EH 3KAAA 1EMAA 3U8PA 3FN0L 3AROA 4KJPD 2WANA 4POUB 1QRNA 1FFPB 4RGNE 2D9CA 5B21A 3LS4H 4HG4K 2VISA 1RUKL 1JC0A 3PWLB 1BLNA 5B39G 5IFAL 3V52L 3EO0A 3P30L 4OFKA 5JIPA 1XGTB 2NY3C 3GMLB 2XTJE 1Z9LA 1SY6A 1ORSB 4M1GL 1JUFA 1G6VK 3CX2A 2MQ3A 3SO5A 4PS4H 1FIGH 3BEWB 4F9LA 3ARRA 4JN2A 3NFPB 2WSKA 3D3VA 4LVOC 2PXWA 3G5XB 4TVPL 4K94L 5D2LB 5EORL 3WFCL 3WXWH 4DGIH 1A02N 2F5BH 1VFMA 5EUOB 1CVSC 2HJFA 3BD5A 1PAMA 3MFFB 5CILL 1RK1A 1DTUA 3UTQB 1CXLA 3UTZB 4IRSD 1MQKL 4D8PA 4OV5A 4QRTA 3NH7L 1T2QL 4QF1A 2OZ4L 3MRDB 3PWPE 3TESA 5DQJB 3TJHC 1HQ4B 4KV5F 5FEBA 2DQTL 3TPKA 3V5KB 1RMOA 3BD4A 4LHJB 4PRBB 2YPLA 3O0RL 4XPFH 1IAMA 2DOCA 4BSVB 1NEZG 3FTGB 4YFEA 4GW4A 1OTTC 1U3YA 3ZE0E 5DFWH 1L7TH 4H25A 3NABH 4NIKB 4Z7UA 2R69L 3MLZH 3JWDC 4HKZB 3VCLB 2R0LH 5EIIB 5CGYC 3SSLA 1D5ZA 2VDNH 5D7IA 5HYFA 4KWUA 3L95A 5GGTL 1GC1C 4OUUB 5GXBB 1IEBB 2DQFA 4JHWL 3FMGH 2R0WL 5EB6A 4J8RB 5L9DL 3GMNB 1S9WA 4RQQA 5E2JA 4DZBA 2ZUXA 3KYKL 1DQJB 3D6GA 1ULVA 3BN9D 2YE0A 3GI8H 2QT2A 1RULL 1QYQA 1R6VA 2VSCA 1I85C 1IBGL 5E2VL 4ZFFA 1P