4PFMA

Shewanella benthica dhdps with lysine and pyruvate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
294
Chain Sequence
HMINGSIVALITPLNSDGTVDYTSLEKLVEYHITEGTDAIVAVGTTGESATLPISEHIAVVGQTVKFASGRIPVIGGNGANATAEAIELTKAQNKLGVAAMLGVTPYYNKPSPKGLIAHYTAVAASTDIPQILYNVPGRTAVDMLPETIAQLVEVPNIIGVDATGDVARVKQLRDLCGNDFLLYSGDDATAREFLTLGGDGVISVANNIVPKLFKLMCDAALAGDTQAAMAAEDQIKGLFSALFCEANPIPVKWAAHKMGLISQGDIRLPLTELSTEFHGLLLDAMKNARIEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
publication title Defining a Molecular Determinant of Lysine-Mediated Allosteric Inhibition of DHDPS.
rcsb
source organism Shewanella benthica kt99
molecule tags Lyase
total genus 106
structure length 294
sequence length 295
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2014-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4pfmA00
2EF9A 3GDRA 3O6DA 3TCEA 1AW1A 4WD0A 2F84A 3OBKA 1WDWA 2Y6ZA 4AXKA 3MI2A 4JTGA 2NV2A 3E49A 2J9ZA 3TMLA 1W5MA 3NQGA 3LHTA 1VPXA 3RLVA 4LNYA 4ZQMA 2VEMA 2W6RA 3GB6A 5HR7A 3TC6A 1TMHA 3BLEA 3GKFA 3MJYA 4MJMA 1ZHAA 3TSMA 1TPB1 1QPQA 4FF7A 4IXHA 2V30A 3A5FA 5K2ZA 1MEIA 3UPBA 3ANYA 3NQFA 2FB3A 3CQ0A 1JQXA 4HKPA 3HPXA 1W5PA 1W3IA 3C4UA 3B04A 3LI1A 1ICPA 3EXSA 1TO3A 2Q3OA 1FCBA 3FKRA 4JTUA 2ZBTA 3CEPA 1RPXA 1WOAA 3LCHA 1KV5A 3TW6A 3NGJA 5CZ0A 5AYYA 4IMEA 2B4GA 2YX0A 5D05A 1KBIA 1EB3A 1L9WA 1QOQA 3W2MA 2B7QA 4IPJA 3TU9A 4UR8A 5AHNA 1X1OA 1M6JA 3QZEA 1H7WA 1QAPA 3FEMA 3W1MA 4O10A 1TPVA 3LLFA 3TJLA 2A5HA 2Y7FA 1Q6QA 3C2RA 5HUOA 1BKSA 2VFGA 3C0JA 4LUJA 1F73A 3OVPA 5DXYA 5HWNA 4UTKA 2HSAA 3GYEA 3TX9A 4O28A 3P74A 1SZEA 1XUUA 3M0ZA 4UFJA 1SO4A 3MBFA 4MZ1A 3T7VA 3W7RA 1U5JA 4QQ3A 3DGRA 4C1LA 5DLCA 4WXYA 4MPQA 4IXXA 3S8HA 3HG4A 5EPDA 2ZRYA 4RKAA 1EPXA 4YXGA 3MMTA 4O16A 4UR7A 3P5ZA 2ZRWA 5GVJA 1PHWA 1XI3A 1H7PA 3W23A 1YDOA 3V75A 2CFFA 1OX4B 4N6EA 3GKAA 4MZYA 3MI3A 4EWND 3UWQA 3EX3A 4E2BA 2BTMA 4MY1A 1GVFA 4O54A 4NNAA 3B0VC 5G4EA 5AHLA 2ZDRA 4UMCA 3TQVA 1LRTA 4AVFA 4BF9A 2Y70A 5K9CA 4NJKA 3W1QA 1XFBA 1U83A 5D33A 3BG3A 4GJ1A 2QCNA 3BARA 3UPWA 2C1HA 2A2IA 2QEZA 3E0IA 1SSDA 4CQAA 4GXMA 4POCA 5D2VA 4YMZA 5I3FA 2QCDB 2R8WA 3LCXA 1P1XA 2ZTKA 1ML1A 2WJZA 1KM1A 1H51A 3UWVA 3NQAA 3W1RA 3EXRA 3PBVA 3W7DA 4O12A 1I4NA 4HSOA 5BNKA 2ZA2A 5I3JA 4IPIA 2W79A 3DHFA 4KKXA 3NA8A 3G3MA 2ALDA 2QKFA 1TRIA 1CW2A 1ME7A 5E0KA 1KFCA 4O57A 4N9BA 1RV8A 1GVRA 2YFOA 3KRZA 1H5YA 4UNLA 3SGUA 3W7PA 1KM3A 2C3ZA 3UYCA 2F7FA 4M19A 2C16A 5HQEA 1SFJA 2WKJA 3CC1A 3RNDA 6ALDA 4UUIA 1YDVA 3IIXA 1FXPA 1QWGA 1BEUA 3B4UA 3BK0A 3BW4A 4XUGA 2X30A 1SUXA 3W70A 3P84A 3HB9A 3TIMA 4BWLC 3W2NA 3Q94A 1J2WA 3FFSA 1Q3NA 1GWJA 3TSDA 4R34A 4FNQA 3EWZA 1JCYA 1QCWA 3HG2A 3W6YA 5G2IA 3NEVA 4O17A 3NL2A 3QPZA 4OBTA 2EHHA 3DFNA 2PURA 4M6VA 4JY9A 3G8RA 5K9DA 3PBWA 3O8AA 4ML9A 3SSJA 1V7YA 1EUAA 3SZ8A 3CT7A 5FEZA 3QW4B 1TJRA 3EWUA 1RVGA 1G4PA 1AW5A 2Q8ZA 3KVKA 4ORMA 1IF2A 3NVTA 1OG0A 1B4KA 5F1VA 4O0KA 1DQXA 1TTIA 4I9AA 2RDUA 4LVBA 2EPHA 4A3UA 2HS6A 2E1DA 1QR7A 3DAQA 3SY5A 4AEOA 4NZJA 4P61A 2J9YA 3M41A 4KFNA 2G95A 5AHFA 1DQWA 3Q37A 4NZFA 4LTSA 2CZDA 3KXQA 2DZVA 1ZAIA 4TMCA 4KFOA 3W86A 2WNQA 4MIMA 2ZZ5A 1LYXA 3O6YX 5BOOA 4FO4A 1XL9A 1UJPA 3N9SA 1A50A 1HFBA 2TMDA 1FQ0A 2C15A 4LY8A 5DBUA 1T99A 4JD4A 3D0CA 3I7SA 3TC7A 3TQKA 3CTLA 1Z44A 4A2SA 1SFLA 1KFEA 3QH2A 2JKEA 5F4XA 3VNDA 3LV5A 4DELA 1UB3A 1YADA 3HIJA 1RD5A 1WV2A 3S5OA 3S1UA 3GVGA 1DOSA 4CCEA 3S5ZA 5EA9A 3F1QA 5EL1A 2C14A 2OMAA 1SO5A 4JIPA 1TPUA 3QW3A 2P10A 1TB3A 3C56A 4B5NA 4M6QA 3SI9A 1VRDA 3QPYA 4O53A 1VC4A 3SECA 1D3HA 1E51A 4IMGA 3T78A 4JTIA 1P0KA 3W7NA 1G7VA 1G4SA 1ZNNA 2ZZ7A 5LNUA 4LS1A 2CW6A 1EWDA 2ISWA 2YSWA 4OU1A 4ZL1A 3W7OA 1RQHA 2QCLA 1AK5A 1XDMA 4OGZA 2ZRVA 4IMDA 1XBVA 4HSNA 3E9AA 4GRSA 1CI1A 4BI6A 4FEZA 5HWJA 2A6LA 3G1DA 3W7JA 4BFAA 3VKJA 2XN0A 1W31A 2Z0IA 4MUZA 4NQ1A 1OF8A 3N34A 5AHMA 1JJKA 2V8ZA 2I1OA 1IXNA 2QDGA 3P67A 4PC8A 2XN1A 3VCRA 3HG5A 4CCCA 4MJZA 2A7NA 2H8XA 3DHDA 2PRLA 2B7PA 4DF2A 4CLMA 3ABRA 3STFA 2ZRUA 2RDWA 4MKNA 4MY8A 2CLEA 2QCFA 1I2RA 2V2HA 1H7OA 4HHPA 1IIHA 1IXOA 1LM1A 4JXCA 1ZENA 1QMLA 1C9DA 4LVDA 3WJWA 4RZ6A 1WX0A 4GE8A 2X1UA 4TU1A 3CLMA 1BTMA 1EP2A 3M7WA 3CEUA 5CPMA 1T96A 3P80A 1Q6OA 1GZGA 4XQ6A 1JUKA 4Z08A 4N02A 1ALDA 5AHIA 3P7YA 3HGOA 4JGDA 5BW6A 1Q6RA 4HPXA 4JTSA 2CLIA 2TRSA 4ALDA 4NJHA 3FJ6A 2DZUA 1XKYA 3FJLA 2VELA 1GG1A 2OT1A 1WQ5A 3LRMA 5G1YA 1JUBA 4AHQA 1I2QA 1UCWA 3MP5A 3GXPA 4IGHA 4AH7A 1J5TA 2AQWA 3N14A 1NF7A 3W2KA 1DORA 4H3DA 1F5ZA 4N4PA 4UTUA 4Q4KA 5K3VA 1EIXA 2QJIA 4CQ9A 3EKLA 4JTHA 3HOJA 3IIZA 5G1TA 1KM6A 3LLDA 1P4CA 2DZXA 3GAKA 1XC4A 3KRUA 1RR2A 1OF6A 4FIQA 2GQ9A 1EX5A 5FF0A 5C6MA 3GDTA 3VE7A 2H6RA 5D37A 3FKKA 2BSLA 2YYUA 4MY9A 4LVFA 2NXGA 1ZCOA 2P0OA 3TW7A 4JNMA 4PFMA 3M5VA 3NO5A 3DXIA 3NQEA 1LOSA 2NLIA 4O1BA 1OYBA 1YPFA 3IIVA 1VCVA 4ZQPA 3I6RA 1JCXA 1LLZA 3U8GA 3M5YA 3W1NA 1DKWA 1SZFA 1SR9A 3A24A 3DU0A 2V2CA 3R13A 1LP6A 4QAIA 4K39A 4NJJA 3L0GA 4NVTA 4WY0B 2CZEA 1VS1A 4KWWA 1C29A 4A21A 4JEQA 3CHVA 2C0AA 3IVTA 4Y9AA 3SR7A 3IV3A 4FIRA 2RFGA 4EIVA 4UNKA 2GUUA 3PAJA 3E12A 3G22A 1TPH1 1KM5A 2Z6IA 5J5DA 2BWGA 2QCHA 3NAVA 1DJQA 4NNCA 3W74A 3TAKA 2FIQA 4O11A 4LWWA 3W75A 4YCPA 2A85A 1KM2A 4YLWA 3CWNA 2EKCA 2PE4A 4DF0A 1Z41A 1SPQA 4NT0A 1KFBA 3L21A 3T44A 4YCOA 5HMSA 3M44A 3DFSA 1TQXA 3M5ZA 3VI2A 4OHQA 1TREA 3O07A 3W3OA 2TPSA 3C52A 3W71A 1FXQA 1F7BA 1ZY9A 3OVRA 3QMSA 3S5YA 4JTJA 5AYZA 4WY0A 3B05A 5CSRA 1W3TA 1B57A 3HGJA 2VENA 4U28A 3GDLA 5CGQA 1OFPA 2ISVA 4X3ZA 3HGSA 5HJLA 1FCVA 1WA3A 1R30A 4IMCA 3JR2A 1TJPA 2VFEA 4DO6A 4DBDA 3G1HA 3TR2A 1G4EA 1TPDA 2CZFA 1I2OA 1SZNA 5G2WA 4UFKA 5DCBA 2YW4A 3MHGA 2NUWA 5D2TA 1XM3A 3F4WA 4JYFA 2YGYA 3G1AA 4TO8A 3LB0A 1S3HA 3BLIA 3NQ8A 2X1TA 2Y63A 5DCEA 1KTCA 3KVLA 2H8ZA 3EWYA 1F76A 1KLZA 1LRNA 4WQ6A 5D2YA 3LHUA 1TV8A 3GNNA 3LX9A 4LRSA 3BGGA 2IQTA 3W1UA 1F2JA 5HULA 5DY2A 3PBYA 1H50A 3FS2A 3HPSA 2ZRZA 3N3MA 3M9YA 5BMXA 1C8VA 4CQ8A 4E0CA 1DHPA 5IM51 2DP3A 3WFAA 2JK2A 3NPWA 2QUUA 1DBTA 1G69A 2FQIA 3P81A 1O95A 2ISSA 5FF3A 1UBSA 2AGKA 3A9IA 3UWWA 3QFEA 5I3IA 1LBLA 1Q6LA 3I7QA 2BX7A 3TQ0A 3W22A 3EWXA 1L6WA 3GDMA 3QM3A 3ZFHA 2WQPA 2Y61A 3H55A 1I2PA 3NZ1A 4UFIA 3IGUA 3MHUA 2NUXA 4AWUA 3G0SA 3GXNA 1THFD 5F4SA 1EA0A 3M1ZA 3JS3A 1Y0EA 1XBXA 1EP3A 3LHWA 4NXKA 4NUWA 1JCLA 3FA5A 3IIOA 4NX5A 3K30A 3TAOA 4BWLA 4N9CA 1VJIA 4K8EA 3S0CA 3IVUA 4NNBA 4A22A 1FCQA 1ZAHA 3UXDA 3QMRA 5KZDA 4LOCA 2H90A 5KMYA 3ATYA 1BWKA 1VH7A 5KITA 4HT3A 5AN7A 3HF3A 5LNSA 1FWRA 1PE1A 4UC5A 5FEPA 3TA6A 5H91A 3LHZA 3NZRA 4ADTA 1S5VA 4YL2A 2QAFA 4KWVA 1TPWA 4FNSA 4WY0F 3I68A 1WAUA 2B0MA 1TCDA 3HBLA 4GNJA 2E6DA 2ZQ0A 3W7QA 3NL6A 3W73A 2GJLA 4G1KA 2J27A 3HJZA 4GUFA 1CX9A 3EWBX 1W5QA 5AB3A 4TMBA 5U7SA 1OABA 3GZ3A 2ZZ4A 2Y7GA 5KINA 4S1FA 1R2RA 1PS9A 5AYXA 1QDSA 4DEFA 3W76A 1AW2A 3L5MA 1PV8A 2X1RA 3O06A 3O6CA 1LRQA 2QF7A 1WYIA 3LCIA 1QO2A 4JTLA 2E5DA 3OHIA 3LDVA 4QIUA 3BLFA 2B7OA 3TH6A 1MXSA 4RCXA 4AMAA 1W0MA 3BO9A 1SQ7A 5F1UA 3LRLA 4RK8A 4WJEA 2PC4A 3BW2A 4UTHA 1OX4A 2CZ5A 2OT0A 3B0PA 3PF3A 1GYLA 6TIMA 2BXVA 3EB2A 4RXGA 5EKYA 4JIQA 4FNRA 1H60A 4QNEA 3WK2A 1TPEA 3KX6A 3QSRA 4ZQNA 4IJBA 1XBZA 5DCDA 4E2DA 5CPLA 5LSMA 3W7MA 5C2XA 2YPIA 1ZFJA 5FEXA 1X7FA 4UMAA 1YYAA 1VYPX 1G6CA 2QCMA 4LV4A 1EUNA 3C61A 4WOQA 1B9BA 1SW3A 1W8SA 1KTNA 2Y62A 2WSYA 3NYZA 4BI7A 4O14A 2A1YA 2QCDA 3LRKA 4A29A 3W07A 2KZHA 4HIBA 3F03K 3LHYA 5CG7A 1QO5A 3OA3A 5LNRA 3RU6A 2CLLA 4LRTA 2QUTA 4UTJA 3NQ6A 2PCQA 2UV8G 1YXYA 4R53A 2ABAA 1YTDA 2XN2A 1VCGA 4M6PA 1FWTA 3KRSA 1FBAA 1ADOA 3FOKA 3TV8A 2CLOA 2YFNA 4XWUA 2H3DA 1BWLA 1HTIA 2ZZ6A 4QITA 5DY3A 4WOZA 1HO4A 4MLJA 3G1VA 4GWEA 3NG3A 1YDNA 3LXCA 4RX0A 2HMCA 3MI6A 3BGJA 3TXZA 3ZWSA 2FLIA 3N19B 1GG0A 1QPOA 4ZQCA 1KFLA 1LORA 2QCCA 2J24A 1N55A 3O63A 1R2SA 3B03A 3S1WA 3QQ1A 5CKSA 3P8IA 2FPTA 1LDCA 1M5WA 4GUGA 4NJIA 4Z1BA 3ZS4A 4NU7A 2V0TA 1YXDA 3P61A 4N6FA 5CZSA 2QUVA 5HUPA 1L2UA 2CWNA 1TV7A 3BG5A 3EKZA 4JTKA 3IIPA 4UFMA 3MYPA 5C54A 1K8ZA 2E77A 4CNOA 2X1SA 2DJXA 2ATMA 1F05A 3WJSA 1SW7A 4U4MA 2W0UA 1OFEA 3G1YA 1ICQA 3GX9A 4TIMA 1KFKA 4GUHA 3CWOX 3T40A 1AL8A 2B7NA 2V2DA 3BPWA 1ME9A 4O4VA 2DZTA 4K7YA 3PUOA 3IEBA 5A5WA 1D9EA 2NXHA 3W83A 4HNNA 1I45A 3O05A 1YLVA 1GT8A 2YR1A 5HR6A 3QF0A 1XDLA 3W72A 4OQVA 1TRDA 2DU2A 1FUYA 1OX6A 3MP3A 4ZQRA 4Y96A 4K38A 5IBXC 3W85A 5AOUA 3STGA 3IVSA 4MOZA 3CM4A 1UUMA 1LTDA 2GVGA 3MUXA 3EX1A 2E5BA 1W37A 1Z42A 3PG9A 1K3UA 1NEYA 1JRBA 4FXSA 1KV8A 3NM1A 3NM3A 2GVLA 1SSGA 1W5OA 3I65A 3G1SA 3WK0A 5F4WA 3GIYA 4K7VA 4PEKA 5L9FA 5TBOA 3IRDA 5FF7A 3CPRA 2X2GA 2YW3A 2EAWA 1G67A 2A7PA 1AL7A 4H6KA 2CLFA 2BLEA 4QNWA 1HO1A 4XBSA 1GVOA 2V5BA 1JRCA 4IMFA 1GVSA 4Z1DA 2CLMA 3GXTA 1FDJA 5CPNA 2ZZ2A 1UASA 2GVJA 1FY6A 1GTHA 4ZZ9A 3SJ3A 1DJNA 3PVFA 2CU0A 2YYTA 1IXPA 3W2LA 5FESA 1TTJA 1FDZA 5F2GA 3DI1A 5LKYA 3GNDA 3ZR4A 3R2GA 1KTBA 5E93A 2GPTA 4FX7A 1EP1A 2VEIA 5SWUA 2GQ8A 4HNUA 3M5XA 2FTPA 4E38A 1QPNA 4X9SA 3IGSA 3L5AA 4Z0SA 2QAPA 1UUOA 1IIGA 4Y8FA 3W7EA 1O5XA 4O8RA 4J9JA 3W2JA 1H1ZA 4O52A 4JX4A 4QM1A 5FF2A 3LOTA 3P5YA 3RFAA 3CU2A 3O15A 4AHPA 3I7RA 3W1XA 1OYAA 3PB0A 3CIXA 4QSHA 4M7TA 3MYOA 3ABOA 3LBCA 5KSWA 3OG3A 4UTWC 3M16A 3ATZA 2CLKA 3G1FA 4UTMA 3L65A 5C5YA 3NPVA 3UZ5A 5F2LA 1MSSA 2RH9A 4LC8A 3KAOA 3NL5A 4HN4A 5HINA 4O4WA 2Y7DA 1A5SA 3QSTA 5TQLA 5CZTA 3UZJA 3WK3A 4IUOA 3PM6A 4DPPA 3PSVA 3NPUA 2NWRA 2JBMA 2J6XA 5EMUA 4IOTA 2VFDA 4YWIA 4PTNA 4UTLA 3B8DA 3BVJA 1A5CA 2JGYA 3DKJA 1H7RA 2XFWA 4OV9A 4JN6A 5AC8A 3FIGA 3GR7A 2DORA 2OJPA 1DL3A 3UY7A 1OFAA 1R46A 3MP4A 3B06A 3O16A 4UTTA 4LT9A 2VOMA 1LZOA 1ZALA 3G0XA 4LV9A 5MHBA 1TSIA 2PRHA 3ABSA 5KTLA 2O7QA 5E1QA 2WV8A 4JY8A 2VFFA 2FB2A 1TV5A 5D02A 2PRMA 4RV8A 3LERA 2DJLA 3A21A 1P0NA 4TR9A 3UWYA 2Q8LA 3G1XA 3PWAA 3INPA 4XBKA 2VKZG 4JTFA 1RQBA 2Z1BA 1A5BA 3P62A 2A6NA 4I7VA 5LHEA 3TFCA 3NDOA 3LTPA 3E96A 4O15A 4ZMGA 4NX0A 4R33A 4N2YA 4NXSA 3RLUA 2C18A 3EWWA 1ONRA 4LS2A 4DO5A 1LBMA 5D03A 2FFCA 5D2WA 1VZWA 4OV4A 3DFTA 1WXJA 3L0NA 1VLIA 3LGEA 4GFSA 3PUDA 3UY8A 3C2EA 1TIMA 3NXFA 5D04C 3KVJA 3NQMA 4RLIA 5AC7A 4HNTA 4QJ1A 4JS3A 2A4AA 1L6YA 3B0UX 3DENA 2WOQA 5G4WA 5TIMA 1WOBA 5CPOA 3S1XA 5AFDA 3WJZA 3DFPA 1TTPA 3G0UA 2J88A 3H54A 2TSYA 4ZQOA 1T0OA 3L5LA 4MVAA 3MHFA 1YPIA 5AHEA 4D2JA 2ATSA 2O7SA 3W7HA 3UWUA 4N9EA 3BW3A 2QCGA 4DXVA 4MFDA 1GEQA 4Z0JA 2ZFAA 3G3DA 1TTQA 3UQNA 3HG3A 1X8FA 4H4IA 1TQJA 3QEZA 4FXRA 3A22A 4O1DA 3KFTA 3A23A 3EXTA 1KW1A 5K4ZA 2FPVA 1IXQA 4UTTC 3T4CA 3N2XA 1OK4A 1OK6A 3W9ZA 4DBEA 2A21A 2QCEA 1GYNA 4RJEA 5G5IA 3O1NA 1W5NA 3VFLA 3LV6A 3MWAA 3NOEA 4HPJA 1JQVA 4LS0A 4UIOA 2E68A 2ZA3A 4DO4A 3GAYA 3LXBA 5KZMA 1GVQA 1OYCA 3M47A 3PC0A 4M7SA 3TFXA 4S2BA 2RKXA 2YDAA 1H61A 4FNPA 1JR1A 4IQLA 4ADUA 2TYSA 3VE9A 4FB7A 3QMTA 5KZEA 2A7RA 1KFJA 3NQ7A 5I3HA 1W54A 1XXXA 3HQ1A 3PULA 1H63A 3WJXA 3NQDA 3LI0A 3PR2A 4MLRA 3AJXA 3TK7A 4A2RA 4K37A 3TSBA 1KM4A 3UWZA 4Q33A 2V9DA 4UFHA 2OX1A 2R14A 3NQVA 4JTEA 3NPXA 3W1TA 3LXAA 2HTMA 1FWSA 1S5WA 2LLEA 4XZ9A 1O5KA 3SGZA 2Z2UA 3L67A 1XBYA 2AAMA 2E6AA 4RZ4A 4XTIA 1ME8A 4KFPA 3G24A 3S5NA 4MYXA 1EEPA 3EX6A 3PUEA 3L9CA 2X16A 5BRBA 3W1AA 4X2RA 2ZZ3A 1I2NA 3P60A 2WNNA 1VR6A 4K8HA 2GJNA 5J5RA 1NF0A 3LCLA 3C3NA 5U4NA 4ORIA 3TJXA 4CCDA 3U6WA 4PL1A 3C6CA 1VCFA 2JKPA 1F74A 4N4QA 3P82A 3S1VA 2NWSA 1VYSX 1QPRA 7TIMA 2NX3A 3DZ1A 3F4NA 3GLCA 1G4TA 1QOPA 3PBUA 3TXVA 3S6DA 3TDFA 1HUVA 1O4UA 3NQCA 5L6UA 3N2MA 4Q32A 4AB4A 4AF0B 4IX0A 1B3OA 1OJXA 1W1ZA 3N9RA 1K8YA 3GK0A 4BR1A 4L4MA 4LVAA 1YXCA 1X1ZA 2Y89A 2JKAA 4O13A 5EYWA 4MFEA 5FEWA 4FX6M 3DBPA 3RK8A 3ZWTA 1OFOA 5FI8A 3HPZA 1XCFA 3LHVA 4M5PA 1AMKA 4EOUA 4JDYA 1N7KA 2NX1A 4EF8A 3UXAA 1K03A 4PL2A 3IGXA 5A8GA 2V81A 3SFKA 2WPBA 5D30A 4RR4A 2VEKA 2C19A 4FNUA 4BI5A 3YPIA 2YCEA 3C8FA 1VQTA 1H1YA 3PG8A 4WZHA 1K02A 1JUEA 2QJGA 2BZNA 4BK9A 1KM0A 3BV4A 4Y6GA 8TIMA 2Y88A 2ZCGA 1OFBA 2ZZ1A 4X22A 1FWWA 1HL2A 2I9EA 1GTEA 3H53A 4AF0A 2VFHA 5ABTA 3THAA 4EVZA 5IBXA 2I14A 1SU5A 1GJPA 5T26A 1M7OA 5LZLA 4S2CA 3THQA 3FYOA 1WBJA 4AHOA 2DZPA 3LTYA 1VGAA 5LGXA 2VEPA 1K7XA 4GBUA 1JCMP 1N8FA 3QYQA 1OFDA 2R91A 4CNNA 2E6YA 3KVMA 4R7JA 1DVJA 4RZ5A 3W2UA 2E09A 4HNVA 5DELA 3EEGA 4OE7A 2NUYA 4TX9A 2NZLA 1L6SA 2Q3RA 3W7LA 3U2OA 3QC3A 4EF9A 5D09A 1GPWA 2ZTJA 5K7JA 3ELFA 2Y7EA 4JYEA 3GDKA 4DPQA 3DKLA 3LBMA 3C2OA 4GUJA 5DBTA 5K9XA 3WJYA 2WNZA 5AC6A 4FHAA 3MW7A 2R94A 2V5LA 2G97A 3DFOA 4O18A 4OWGA 1DV7A 3NL3A 5F2IA 2QR6A 3MBDA 4O0ZA 4LUIA 3R5EA 1NFBA 4L4LA 1MEHA 3JRKA 4ICNA 1FDYA 1H7NA 1A5AA 1MEWA 1WBHA 2VXNA 1PHQA 3QQ0A 3SIZA 3L68A 4PCFA 2JGQA 3T55A 5LNWA 2P1FA 5LHFA 3W1PA 2RHGA 1GQNA 4I7UA 3M43A 3OVQA 5CZJA 1D3GA 1H62A 3ABQA 1OX5A 1O94A 4K36A 4JX5A 3S42A 3DH7A 3STCA 3W88A 4JDBA 2D73A 5D2XA 2YXGA 3BG9A 4O50A 5EBUA 3LTSA 3UD6A 1Q45A 2FJKA 4JTTA 1X6UA 1PL9A 2WSRA 4GC4A 4Y90A 5BMWA 4QISA 4IX2A 4JR5A 4JYDA 1K8XA 2QJHA 3PS7A 2ABBA 2GQAA 3G8EA 3HO8A 3PB2A 4LC6A 2J9XA 3WK1A 5HWMA 2DZWA 3L0KA 3TMQA 5FF4A 2OCZA 3W7KA 4UTWA 2E6FA 3NR0A 3C2VA 4UMBA 3KHJA 4UTIA 4ADSA 1M7PA 3MO7A 1QNVA 1W56A 2VFIA 3FYPA 1PIIA 1LLWA 4PODA 3W87A 4MYAA 2WSQA 3V1PA 2DZSA 4PH6A 1YTEA 3TNOA 4DF1A 5H2ZA 1K7FA 5DN1A 1HG3A 4LW7A 3OIXA 4IWWA 4P2VA 4JX6A 3LCFA 3LM7A 1R2TA 1FWNA 2G5WA 5LGZA 3TROA 1I8JA 1AG1O 1S5TA 1SO6A 3LCGA 4UXDA 3RF9A 1LOQA 2QDHA 1LROA 4AWTA 3P8JA 5C55A 4O1CA 1LOLA 1TPC1 4O1AA 3KOFA 4AAJA 1A53A 2NV1A 2A0NA 4FX8A 4UCGA 2ZA1A 1LCOA 3E02A 3HMJG 1OVDA 3W84A 3USBA 3FLUA 1OFRA 5EY5A 5G2HA 2GOUA 3LCWA 1XUZA 2E5CA 1ZJIA 3N73A 4C1KA 4OT7A 1JCNA 1IGSA 1OFQA 2C6QA 1VHCA 5I3GA 4O19A 1SO3A 4FNTA 3R8RA 1FCUA 3OEXA 5D38A 4ZVJA 1QFEA 1YTKA 2CLHA 3CIWA 3SW6A 3Q58A 3R12A 1ICSA 3PY2A 3A5VA 1V5XA 4XKYB 1LBFA 2Z6JA 1R47A 1F6PA 3Q2DA 3G18A 4RXFA 1P5BA 3PSWA 4W9TA 3QRHA 3UNDA 2FPYA 1Z48A 2RDTA 1TPFA 1FX6A 4N9DA 2WO5A 4JICA 4AWSA 4MZ8A 2EGZA 3TE9A 1W3NA 4LVGA 3L2IA 1NAL1 1SW0A 4GUIA 1JULA 3HGRA 4CNPA 4I7WA 2YZRA 1T8XA 3R89A 2VC6A 1ZAJA 1PVNA 2ZRXA 3W7CA 5HNRA 3C2FA 1VLWA 4PA8A 1OHLA 3EX4A 2NX9A 3AO0A 4DQWA 1RZMA 4NJGA 2OZ0A 1KBJA 4LU0A 3L66A 4ONVA 4K6AA 1VYRA 3TKFA 4Z1AA 5K4XA 4UFLA 3STEA 4WX2A 3W1LA 1NVMA 3DFQA 3NNTA 3M6YA 5D32A 4XKYA 1VHNA 4XTDA 1SZGA 5LNVA 1H7XA 5I3KA 2HS8A 2ZYFA 1O60A 5F2MA 3RMJA 2Y85A 3NQ2A 1KA9F 1PCKA 1F6KA 3W7GA 3GR8A 1NSJA 1B4EA 1EWEA 2V82A 1GOXA 1TYGA 2C13A 3QJAA 2NXIA 1K7EA 3DI0A 3S9YA 1JVNA 3EX2A 4WUIA 5CSSA 3TUUA 3CB8A 2FDSA 1RQEA 1MZHA 2H3BA 1J4EA 2G96A 4WXZA 4Z1CA 3W7IA 1G7UA 5DXXA 1JCJA 1PCWA 1KLYA 1MO0A
chains in the Genus database with same CATH superfamily
4DJFA 4C5YA 3TCEA 3P2VA 1FKWA 4LXFA 1B9ZA 3NQGA 2ZUSA 3GB6A 2W6RA 1LT7A 1TMHA 3BLEA 3GKFA 3MJYA 4MJMA 1ZHAA 4NI3A 3N2OA 2X1IA 2YDSA 1TPB1 3UR5A 8CGTA 1CGUA 1C91A 1J93A 3PZIA 3CQ0A 4PB3A 3C4UA 1ICPA 3EXSA 3CEPA 1VPYA 3POCA 4MDOA 3FYYA 2PZNA 3WSUA 5CZ0A 3WDIA 3I4EA 2OX4A 2A79A 3UXLA 4PEEA 1W2PA 3TU9A 2V67A 2YBTA 1M65A 2YB4A 2DGAA 2GDVA 3FEMA 1NARA 1TPVA 4NILA 3LLFA 2PTDA 2D3LA 3CV6A 3F5LA 4QCEA 2Y7FA 3QZ6A 1YDYA 5XIMA 1EO7A 5XIAA 1TJ2A 4GO9A 3R8GA 3C0JA 4LUJA 1JI1A 5HWNA 1HJSA 5CAKA 4ZOAA 3F2DA 3R8HA 1SO4A 3WF2A 5A3HA 2XWEA 4C6EA 4EAMA 2D2JA 5GJPA 3HV8A 2XUCA 1VIZA 2HCVA 4IIHA 2ZRWA 1C3FA 1QHZA 3GU9A 3KBNA 2Z00A 3V75A 1CGWA 4HK5A 1DXFA 3DYMA 2JEQA 3L4TA 5B7YA 4YTUA 4XZMX 4MY1A 3BCFA 5C9RA 1N82A 4WR3A 2P0IA 1GVFA 3B8TA 2BBFA 3N1AA 1E0XA 4NNAA 3BLKA 2Z1SA 1LRTA 3U0HA 4Q8UA 3PTDA 1RP8A 3PWIA 4IP4A 4NG3A 1E9ZB 3GC5A 2QCNA 3GHUA 3E0IA 4GXMA 3RU8X 5D2VA 2INFA 2WJZA 3ZZ1A 1EDTA 2AMXA 4US6A 1K4HA 4GNKB 3EXRA 2F2KA 5D9PA 1PB0A 1I4NA 4HU4A 3RLGA 1NDVA 3FAXA 1J96A 2W79A 2G8ZA 1J11A 1GHSA 1WB0A 3KL3A 3A4JA 4E2OA 2F61A 4B5UA 2YFOA 1D7KA 1OB0A 1KM3A 1V79A 4RPPA 2DDXA 6ALDA 4UUIA 4CQDA 4S3BA 2FFIA 3V4BA 4HN8A 1QWGA 4L4PA 4XUGA 3T8QA 1UOKA 1SUXA 4KCWA 3W70A 4BWLC 3BTNA 8XIAA 3TSDA 4GQBA 4FNQA 3EWZA 5HMDA 5G2IA 4KGJA 3QPZA 4OBTA 1B3WA 3DFNA 1EPVA 4MPKA 4M6VA 5K9DA 1UH2A 2PA6A 4WGXA 2XM2A 4CKQA 2BB0A 1E55A 1RLCL 1XR2A 3QW4B 4IHCA 1G4PA 2ZX6A 4AMCA 1IF2A 3NVTA 5F1VA 1KRBC 3RO8A 1OSEA 3M41A 2DT3A 4FLOA 4WJ8A 1ZAIA 3V5CA 1HN1A 1BYBA 2ZZ5A 4W88A 3EB4A 4KCVA 1XL9A 4JCLA 1FQ0A 3NXLA 3U48A 2JKEA 5F4XA 3LV5A 1UB3A 1YADA 3BJFA 1R3RA 3N17A 4TTGA 2VR5A 4CQBA 2WZIA 3S5ZA 3V0TA 3XISA 3S2CA 2ESCA 1H4PA 2C14A 1SO5A 2XSXA 1K9FA 5LIUX 1YE6A 3DIPA 1VRDA 1PDZA 3ORWA 1VC4A 2X42A 1D3HA 1E51A 2D20A 3BMWA 3WH6A 2E8YA 2ZZ7A 4MWAC 3PBGA 2CW6A 1PX4A 3L2MA 3T0TA 4OU1A 1TKKA 4WJXA 2XVNA 4LYKA 5FKYA 4DWSD 4AZCB 1XBVA 4HSNA 1UR2A 4GRSA 2PDXA 2Q6ZA 1EYEA 5HWJA 3G1DA 2Q01A 1AQFA 1UOZA 2Z0IA 3N34A 4M1BA 1XPYA 4E4FA 2I1OA 3VZZA 2QDGA 3MTWA 4PC8A 1IZJA 1EHAA 3VCRA 3VCCA 3CWHA 2B7PA 1HKMA 4KEUA 3ABRA 1EOMA 1NOWA 1A5LC 1F4HA 2QCFA 1AQHA 2PDUA 1C9DA 2TAAA 4ES4A 3FNDA 2Y24A 3OQ8A 3U4AA 4E8DA 1FH8A 2VGIA 2X40A 1YNPA 1BSIA 1EP2A 2NQJA 4DLMA 4E2VA 1UPMB 4Z08A 1ALDA 5AHIA 3P7YA 2V5KA 1EQCA 1WKYA 3HGOA 3HPFA 3CIVA 4JGDA 5AZ1A 4JTSA 4ALDA 5BOEA 5RUBA 1WQ5A 2FMOA 1UCWA 2WMKA 3W2KA 1PZ0A 1WZKA 1CDGA 4PBGA 4BS0A 1E6XM 1CTNA 1E0VA 1PWMA 1DQUA 4R88A 3SCRA 2E28A 5AZ0A 4CQ9A 3EKLA 4FR1A 1D2KA 1LUCA 1LL4A 4QX4A 4RNHA 4C1NA 1EXPA 4KEMA 1P4CA 3GAKA 2NVCA 1RR2A 5M17A 3RRAA 3WN6A 1EX5A 5C6MA 3A4WA 3GDTA 3BSMA 2DW7A 3IJDA 3GFZA 1QATA 1BXNA 2RAGA 1EDQA 3R4IA 2J13A 2AOSA 2P0OA 4PFMA 3NO5A 3NQEA 5MF5A 1LOSA 2NLIA 2ZOXA 1PPIA 1VCVA 3ZLGA 4ZQPA 1CBGA 3U8GA 1O1HA 5JH1A 1YBQB 4HCDA 1SZFA 3HJEA 4L1WA 1TA3B 1E70M 1ZQ5A 1QWKA 7REQB 4AC7C 3TTEA 3DU0A 2V3DA 2V2CA 4XZBA 1YW1A 1LP6A 3H8AA 2RGLA 4NVTA 4KERA 3OYXA 3W82A 3ZOAA 2CZEA 4B5TA 4GY0A 5I2UA 1LG1A 1UH4A 3TJ4A 2YIHA 4A21A 2E3ZA 1ZU8A 3SR7A 1UA7A 3CBWA 3IV3A 4Y9AA 2RFGA 4EIVA 2BVTA 1XQLA 3HURA 2GUUA 3G22A 7A3HA 2Z6IA 1L6FA 2BWGA 2QCHA 1WCGA 1DYSA 4AVOA 4LCRA 3PZUA 2FIQA 2CPUA 4DI8A 3CYVA 4HPNA 2A3EA 1RK5A 1YHTA 1JPHA 3U2ZA 1JDCA 4ZXLA 4YLWA 2EKCA 2PE4A 3T0AA 1SPQA 3CS2A 1ESWA 1PYFA 3NSNA 4GZIA 2CETA 2VRJA 4DN1A 7ENLA 2PLKA 1IZCA 3M44A 2R1PA 3DFSA 1M9HA 3M5ZA 1OGGA 3BSHA 4OHQA 3OVRA 3QMSA 2IPGA 3VD9A 4WY0A 3B05A 1OINA 3NGFA 5CSRA 3HGJA 3GDLA 1R86A 4ZTXA 2GL5A 3HGSA 1R30A 4IMCA 1YNQA 1TG7A 3V0SA 4XZWA 2Z4GA 1WAWA 2GVEA 3FK4A 1TPDA 4V1YA 4RW3A 4UB9A 2NUWA 2YW4A 2Y0FA 3G1AA 3NQ8A 1S2UA 5CBBA 1V7AA 3AICA 5DCEA 1DWJM 1KTCA 3EWYA 2Z7GA 4UZSA 1ISXA 3UZXA 1W9DM 1TV8A 1BVWA 3GNNA 3LX9A 4GYKA 3LU2A 2IQTA 4HB7A 2FTYA 4DWDA 2B81A 4BQ4A 5KZ6A 3SCQA 4A4AA 2PP0A 1JGMA 2E1WA 3VOJA 2OR2A 2JK2A 3NPWA 1QNSA 1U1JA 4KW2A 3UJEA 1Q6LA 2QPSA 2BX7A 2JEPA 5E9AA 2WVUA 3GDMA 3LS9A 1JIBA 2WQPA 3UJRA 2Y61A 4M0XA 4OBSA 1I2PA 3WFLA 1B3YA 4ZOBA 4UFIA 3IGUA 4AWUA 3KTCA 2JE8A 2PBOA 2ADAA 1Y0EA 3AYRA 1WXZA 3QV9A 1EP3A 1U22A 4NXKA 3FA5A 4NX5A 2F6XA 4QR6A 4BWLA 1J79A 4N9CA 4AEFA 4L6DA 4K8EA 4KBXA 1L0PA 3IJIA 4MUPA 1ZAHA 4PMDA 3UXDA 3KOWA 3QMRA 3HN3A 1KB3A 5KZDA 4LOCA 3ATYA 3DGBA 1VH7A 5KITA 4HT3A 4Q7IA 5LNSA 4LF2A 1FWRA 3U4FA 1T41A 1UJQA 5H91A 3LHZA 4YL2A 2WVVB 3UJSA 3RCNA 3OQEA 1E6ZA 3KLKA 4WY0F 3HBLA 5HMEA 4KWUA 2ZQ0A 3W73A 1FWJC 3D3AA 4FR6A 1VFTA 3HJZA 4GUFA 2O55A 1XYZA 4E4PA 4B9ZA 1OT2A 2QIWA 3GZ3A 1OQFA 2Y7GA 4S1FA 2QIIA 3EB3A 4GIAA 4XV0A 3SUTA 4DEFA 3W76A 4IMAA 1F9CA 1POJA 1PV8A 1P6CA 3CUXA 3O6CA 5G1MA 1LRQA 4U5KA 3LCIA 3OHIA 3TH6A 3AAMA 4RCXA 1TFVA 1UIPA 1XLCA 4WJEA 4JQ4A 3BW2A 1OX4A 2OT0A 3B0PA 1WDRA 1HJQA 1MXGA 1BGAA 4RXGA 4PSRA 1WUEA 1H60A 3UGVA 4QNEA 5CJNA 2BXZA 3KX6A 2X41A 3RX2A 3VC5A 1D8WA 5CPLA 2AMGA 1H0IA 4C6NA 3BGAA 2PWDA 1EUNA 5I79A 3H4XA 4HSHA 1KTNA 4A6GA 2Y62A 2WSYA 1PUDA 3DUGA 4MWAA 3W07A 1LL6A 3UG5A 4D6GA 3TWBA 2GWNA 2OZ8A 2YA1A 1UQYA 3W27A 3S3GA 1M53A 4XKMA 1QT1A 3MKCA 1OD8A 2AL2A 1CYGA 2CLPA 4URIA 1VCGA 3KTSA 1BQGA 5C2GA 1N2VA 1FWTA 1FBAA 3KRSA 1BWLA 4DJEC 3W00A 1HTIA 2V3FA 4DJDD 2WVTA 3H12A 1XIIA 3WUBA 1QVBA 3IK2A 5I09A 1UR1A 3VNMA 2WZEA 3TXZA 3AXHA 2YBUA 3ZWSA 2FLIA 1QPOA 2EPKX 3CNYA 3RJYA 3N15A 1R2SA 3B8WA 4TV5A 2VUNA 3S1WA 3QQ1A 3P8IA 1M5WA 4NJIA 3ZS4A 1XISA 2J4GA 4DYJA 3HZ3A 4H8UA 3GBDA 4AD3A 1V3IA 1IGWA 3AQUA 5JIWA 2X1SA 2ATMA 1F05A 2IKJA 3GFYA 2PD5A 3U2CA 4B92A 1OFEA 4QFUA 5C0QA 3CUJA 3G1YA 3DC8A 1QRQA 4B91A 1M68A 1EOKA 3CWOX 1AL8A 3C0QA 2O4MA 3H7VA 1ZSXA 4XX6A 5A5WA 5FJJA 4OOUA 1XSKA 3CYJA 1I45A 1S1RA 1A4MA 1XDLA 1TRDA 5D8ZA 3MS8A 4L4OA 4YVXA 1FUYA 3C2YA 3B9AA 3IVSA 4BHYA 1R3VA 1HJUA 1LTDA 3EX1A 3H2EA 2E5BA 1NEYA 3KL5A 4FXSA 3S2JA 3I65A 3CO8A 3G1SA 3GIYA 3MANA 5TBOA 3IRDA 3H70A 5FF7A 3CPRA 4B4FA 2PDQA 2MUCA 2EAWA 2A7PA 1A3WA 1BRLA 4H6KA 2BLEA 1E15A 2OOGA 4PULA 1Q7QA 2D1ZA 4GY7A 4RE3A 1CXFA 1S5MA 2Q71A 3AIQA 2Q09A 1GVSA 3LG3A 4UOJA 5BWAA 5C9WA 4CEUC 3NO1A 3VABA 1FDJA 5CPNA 2ZZ2A 3EDFA 1UASA 1PBGA 4ZZ9A 3SJ3A 3WEMA 2YA0A 3W25A 1FDZA 3DI1A 3C0LA 4JN8A 3R2GA 1KTBA 2YL9A 3WQ8A 3DC0A 1A3XA 2QUNA 3D6NA 2GQ8A 3ZQ9A 4HNUA 3M5XA 1T7LA 3ARYA 4E38A 3CL8A 3IGSA 5HDRA 2FVMA 2PDPA 3W7EA 5I24A 3W2JA 3AWNA 1Q63A 3R6IA 1H1ZA 2ZX5A 4QM1A 1AJ2A 2YB1A 1QI0A 2HVNA 3P5YA 3RFAA 1KRMA 3FAWA 3SN4A 2VURA 4B4HA 3LBCA 2ZADA 3CV7A 2KX9A 1CXKA 1MW3A 3APTA 3M16A 1X39A 4GISA 1FOBA 1NDZA 3ATZA 1A4LA 2VD8A 1TE1A 3MUZ1 3UZ5A 4C6IA 1Q13A 3B97A 2XFRA 2D24A 4E8GA 3QSTA 3UZJA 3PHAA 1QW7A 3ECQA 4Y9MA 3NPUA 1FWCC 5E5CA 1NP0A 2PCEA 2VFDA 4Z17A 3SCPA 3JZEA 4PTNA 4UTLA 3B8DA 4M6UA 3SCTA 3D3FA 1ZBWA 1H0GA 2XFWA 4HK7A 3FIGA 2DORA 1EGMA 1DL3A 1OFAA 1DE5A 3MP4A 3O16A 4F0HA 4UTTA 4HYWA 3BDKA 3DBNA 4HK6A 3FHQA 4A8RA 1NFGA 4HU0A 4Q8NA 2W62A 2VFFA 1SZRA 1GQLA 2WBKA 3LERA 1J6OA 3A21A 4QEEA 3HU7A 1LWIA 3VDBA 3BQ6A 1RQBA 4GCXA 2A6NA 4I7VA 3TOPA 1BVZA 3EOUA 3NDOA 4AY7A 2YA2A 4NX0A 4NP7A 1SJAA 3RLUA 2FZ8A 1ONRA 3PPGA 1R0MA 2CHNA 3IV8A 5M3WA 2PGEA 3AROA 4GH1A 1F8IA 4C5ZA 4YHEA 1Q66A 4DWSB 3URQA 5CJMA 3NQMA 5A2CA 2FZMA 5AC7A 4HNTA 4YPJA 4F66A 3B0UX 2WOQA 1R7AA 1UYQA 3SGGA 4C91A 5A6AA 5TIMA 1J9YA 2ZWYA 2QW5A 2OEKA 3G77A 3G0UA 4Q8PA 1T0OA 8RUCA 4KEZA 3SQSA 1JZ2A 2ATSA 2HJPA 3W7HA 1GEQA 1DTUA 1YIXA 3HG3A 3N6QA 4O1DA 1KGUA 1TVLA 4ZO8A 4JFWA 5CBIA 1FVPA 3OLEA 4S23A 5AYIA 1RCXB 5BZAA 5H8PA 3W9ZA 5DMNA 2V3EA 4NZ3A 1TIWA 2ZICA 4S3FA 2IS7A 4JIHA 4YTTA 3NOEA 4P8XA 1JQVA 2E68A 4GZEA 5KZMA 3M47A 5BWFA 3WDPP 4S2BA 1RLDA 4GYPC 2PP3A 3MSGA 1XHGA 3AHTA 2WMHA 1XRFA 2TYSA 4NKCA 4XD3A 3RX4A 1US3A 3QMTA 1KFJA 4PMNA 1E5NA 3HA1A 5I3HA 3HQ1A 4MLRA 3UXIA 4DNHA 4Q33A 4UFHA 1HJVA 2CCRA 2LLEA 1GOKA 1O5KA 3L67A 1XBYA 4GJIA 2E6AA 1ME8A 4KFPA 2C91A 4MYXA 1EEPA 1TZ9A 3NZQA 3ZM8A 1BPLB 3IRSA 3NVDA 3F2BA 2DVXA 1FHUA 4A3QA 1IEIA 4K8HA 4W8BA 1NF0A 4I9TA 5CC3A 4KEVA 1TWZA 4UOQA 2ZX8A 2Y8VA 2WJEA 4BKNA 4DJEA 4H2HA 2NWSA 4Y9PA 3VNZA 2OELA 2WCSA 3PBUA 4KT2A 2QT3A 1RY0A 4H9ZA 3NQCA 3NIYA 4AYGA 5L6UA 4BJHA 3VOCA 4AF0B 3QR3A 1K8YA 3GK0A 4L4MA 4LVAA 3NZGA 1X98A 2C7FA 2INZA 3HQPA 2L5HA 1NWUA 3RK8A 4QJ4B 3ZWTA 3AZTA 2IQ0A 2J7EA 1AMKA 4S3AA 2X2YA 2XJ7A 1A49A 3UXAA 1OIFA 3A64A 5A6MA 4ACYA 5A8GA 4CUCA 1MDLA 4DUOA 3TTOA 1R87A 2EKGA 3SB0A 4BI5A 2YCEA 4WZHA 1H1YA 2QJGA 1NWSA 4AWEA 3MDUA 2UY2A 4FALA 1C7SA 1XF0A 3CZJA 2I9EA 1GTEA 4EVZA 1SU5A 2OFJA 1GJPA 4XISA 2WZMA 1MNSA 5LZLA 3APGA 1TMQA 3FYOA 2XH2A 4EX4A 1HKWA 1R7OA 4U31A 2BGNE 4AHOA 3LTYA 1K7XA 2XH7A 1OFDA 2R91A 2E6YA 2VCCA 4RZ5A 3VFCA 4F40A 3OB8A 3EEGA 4HCLA 3CPUA 4YYCA 1DTNA 1UD4A 3TLQA 3CH0A 2NUYA 4D6CA 2Q3RA 4FP1A 3AFBA 3U2OA 3QC3A 4FI4A 3VTRA 3ELFA 3CZLA 3WH7A 3DKLA 4JIIX 5HMFA 1PDYA 3I6TA 5CEWA 3VILA 4IQEA 1VJZA 3ARPA 2GUBA 2OSXA 3CL7A 4S3JA 3MW7A 7CGTA 1MWOA 1YMYA 2FGLA 4E6MA 4OWGA 2O56A 2HQAA 3MBDA 4PBFA 4HMCA 4LUIA 1JF6A 1CB2A 3IGHX 4G2DA 1MEHA 3JRKA 1E5JA 4QXIA 4HOZA 3T55A 1V6VA 5LHFA 1JZ7A 4HMDA 1XH2A 3CZEA 2P3EA 2NSOA 4OUEA 3SAZA 4RL3A 4ZE5A 3DH7A 2D73A 4L9ZA 4YU1A 4UWMA 3BG9A 3PJXA 9XIAA 1SJBA 5EBUA 4CU8A 4C7FA 1Q45A 2FJKA 1VEPA 4JTTA 1GQJA 1L8NA 4QISA 2GWGA 1QPKA 3SUVA 2FVLA 3V3WA 2DZWA 3HPAA 5FF4A 2E6FA 2BDQA 3NR0A 4UTIA 2PTWA 4FPSA 3KP1A 4H7CA 2EPNA 4HHMA 2FZNA 1W56A 4KCUA 4LNCA 1PIIA 3B9OA 1LLWA 4PODA 3CZKA 1C92A 3W87A 1UKOA 4ILSA 1C93A 3K5XA 4OOZA 1V6WA 2WSQA 3L4XA 3N6HA 1W1IE 2DZSA 3OZMA 1YTEA 4UQCA 1E4LA 2CBIA 5DN1A 1UKQA 3H2OA 5REQA 4Q8TA 4JX6A 1WKFA 4QQUA 1R2TA 2G5WA 5LGZA 3AS2A 2QGYA 1I8JA 3VNYA 2WNWA 3AMLA 4DNMA 2VZOA 4UXDA 1LROA 2CYGA 1EJUC 5C55A 1ADDA 1MQRA 2A0NA 4FX8A 4UCGA 3ZJKA 1CT5A 3VIJA 3CUHA 4Q8WA 3E02A 3WBYA 3WIJA 2ZC8A 4Y9NA 5G2HA 3U2EA 3LCWA 2E5CA 4J7RA 4AZ6A 1E1CB 1JDEA 1IGSA 1ITXA 5HQMA 5I3GA 4O19A 3R8RA 3ISIX 1GVYA 3WEZA 3CIWA 3H7UA 3SW6A 3Q58A 4Z2KA 4LUTA 3CQIA 1LBFA 2A3BA 4RE0A 1R47A 3MVTA 3AZRA 1NOUA 3N29A 2DIJA 2W3ZA 4FSAA 4MM1A 1BHGA 4A35A 3AIWA 1DWIM 5IHSA 1R38A 2GUYA 3BZGA 4MZ8A 5BOFA 4V15A 3TE9A 4E5TA 5M1TA 1DXIA 1XRSA 4EPDC 2YZRA 3GD6A 4AUBA 1BSLA 3P14A 1EJTC 2ACRA 3DDMA 4F0SA 2I57A 3GNOA 3W7CA 3VKBA 2OG9A 5HNRA 1MUWA 3KUMA 3QY7A 2YZ5A 4UR9A 4KIEA 3THCA 5E70A 4W7UA 3BAJA 1VYRA 2FZDA 4Z1AA 1UMLA 1Z3NA 4AZHA 3WBXA 2GK1B 4PRWA 3Q65A 5LNVA 3GTNA 4PTVA 4CEXC 1XLGA 3GR8A 1NSJA 4GYPA 4A05A 1XGZA 3M0MA 3MA8A 3CGTA 1GORA 3QJAA 3DI0A 4S3KA 4D72A 3XINA 3NFUA 3U5UA 3WNKA 3KM8A 1JVNA 3E74A 4XZHA 4EANA 2X7WA 5HJYA 4F9DA 1RQEA 1WPCA 1K6AA 3S4TA 1TV4A 3ONBA 2YBVA 2CXGA 1N8IA 3FEQA 1MO0A 2DT2A 3GDRA 3PP7A 4JN7A 2ZDSA 2F84A 3OBKA 4UQDA 1WDWA 2D23A 4AXKA 3PUGA 4JTGA 3E49A 3QYSA 2J9ZA 3TMLA 1W5MA 3OZYA 2OLAA 5AC4A 4UNIA 4LNYA 3QV8A 3V1HA 3WH5A 3ALGA 4JQ3A 3AC0A 3M0VA 4Q4MA 3RMEA 1ODZA 3WQOA 4W87A 1TCMA 2V30A 4XD6A 4HZ6A 1JYNA 4IPNB 4B3KA 1REQA 3B04A 1GQKA 1S2TA 5FJUA 1FCBA 2ZBTA 1RPXA 4FLRA 1WOAA 2WMFA 1UBPC 1KR0A 1KV5A 1XIDA 3NGJA 4IMEA 1W3KA 4I3GA 3C5QA 3VNIA 4IPJA 1XYFA 1H7WA 1JPIA 2FH8A 2G3MA 3W1MA 3KDOA 2OYLA 4L80A 1J6PA 2A5HA 3TJLA 2EPOA 4Q4RA 5CZKA 2DIKA 5JBFA 3CV1A 1Q65A 2VFGA 3OVPA 1ZBKA 5DMMA 1R9YA 2G3IA 4HA3A 5ECVA 1KGWA 3EZ4A 4K68A 1ONXA 3M0ZA 4UFJA 3VD4A 5A8OA 4NY2A 3SUUA 4D6HA 1XWYA 4QQ3A 3OG2A 1TWDA 4US5D 5DLCA 2XFFA 4WXYA 4YS1A 4IXXA 3S8HA 4HYRA 2FMNA 1EPXA 1W32A 3MMTA 4YXGA 1B1YA 3P5ZA 3ITYA 2A3LA 4AIBA 2CFFA 1OX4B 1KRAC 3UG8A 1E6NA 5MKGB 1KXTA 4L9XA 3MI3A 3F2CA 4EWND 3MWCA 1WP6A 8A3HA 3QR0A 2DSWA 2QLYA 1SGJA 1A5MC 2VTFA 2BHZA 4R7WA 1FP8A 1GGOA 3B0VC 3UR7A 4OJYA 4UMCA 3TQVA 2Y70A 4NJKA 4ZXOA 5D33A 3BG3A 4GJ1A 1VBJA 3LQLA 3BARA 3DX5A 4DY1A 3WH9A 2QEZA 1SSDA 5EMJA 4EK7A 2PDJA 4GIEA 4IP7A 2R8WA 3LCXA 2ZTKA 4MWAB 3PPFA 4G7EB 3UWVA 4J3VA 4ZEPA 3SY8A 4O12A 4D6DA 5I3JA 4S39A 1NOFA 1B54A 4L6OA 3NA8A 2AL2B 2FZBA 3SCWA 5JH2A 4A3RA 1JFXA 4JTCA 1KFCA 4N9BA 1EH9A 2D0GA 1X1NA 1FWBC 2WKGA 4HYVA 2IQDA 2F7FA 2XPKA 2W5FA 1FWGC 3BC9A 4B9YA 4G6CA 3CC1A 2J7GA 3RNDA 1VD6A 1YDVA 2W27A 1J0KA 4CU7A 1BEUA 2NVDA 4HZ8A 3T6CA 2X30A 3P84A 1Q8JA 3HB9A 3IS4A 3AWOA 2E8ZA 4KH2A 4UQBA 4CD8A 1JCYA 4UZUA 3BOLA 3SRHA 3W6YA 4C6JA 1UWSA 2EHHA 3MUCA 2P5NA 4JTDA 4XAYA 3T9PA 1PEZA 1CGYA 1RP9A 3PBWA 2Z27A 4ZENA 3SURA 5BYWA 3EPMA 4ML9A 1IEQA 1V7YA 4BF7A 3EWUA 1RVGA 4WKFA 3KVKA 4S3GA 4ERIA 1OG0A 2GSHA 1B4KA 3M0YA 2UZ9A 4QAWA 3PPHA 4I8DA 2EPHA 3LGDA 3RN6A 4A3UA 2E1DA 1QR7A 3THDA 4KFNA 4RDYA 1SYTA 5FSEC 1DQWA 3H7RA 3PZ9A 4NZFA 2P53A 2DZVA 4F79A 1BYCA 4I90A 4C6MA 2FHFA 4PN2A 1JZ4A 2VVSA 2WNQA 1C8YA 5BOOA 2XISA 3FVDA 4NAEA 1EBGA 4LY8A 4JD4A 1U5VA 4X63A 3D0CA 5LA2A 3RO6A 3S47A 3CTLA 4CQCA 2HNHA 1ITQA 1SFLA 3QH2A 4B5VA 2PMQA 4DELA 3TVAA 1RD5A 2WM0A 2E67A 2TODA 2ODOA 1B90A 4AZBA 3DOPA 1A5KC 4NYYA 5EL1A 6ENLA 3EMQA 2OMAA 3VINA 2NT1A 3M07A 1JF5A 1BRLB 4YJ5A 2PF0A 1G4SA 1TWSA 1Y5VA 2W9MA 4LS1A 9RUBA 1EIBA 3FJNA 1P48A 4IGNA 5GNXA 1RQHA 4KCTA 4WRHA 4C6BA 2VQTA 4G5DA 1Y8BA 1A0DA 1CECA 4PUMA 4U5IA 1TMLA 4I5RA 2XN0A 3KHDA 2NQ5A 1W31A 3GY1A 4MUZA 2WVSA 4NQ1A 1OF8A 3KE0A 1U30A 3WBWA 1ZB5A 1V3MA 2OODA 2QJJA 2XN1A 2W67A 4CCCA 3OA5A 1DIOA 2CC0A 2H8XA 3DHDA 4XAZA 1T6MA 4GVHA 2Z1XA 4MKNA 4DB7A 2CLEA 2GGEA 1AH3A 1TX2A 3P93A 2FYMA 3R79A 1H7OA 1IXOA 4FF5A 4J4KA 2QYGA 2QNEA 3MSRA 4IL2A 1ZENA 1QMLA 4LVDA 2JFEX 3APYA 3SJNA 5H8UA 1UZ1A 3AHVA 2EG7A 4HNLA 3CLMA 1BTMA 4XG1A 3ONCA 3P80A 2ANUA 4XQ6A 1VIWA 4GX9A 1JUKA 4AZCA 2HPIA 5A8QA 3BV7A 2PDNA 3RM9A 5BW6A 3ZJ7A 1Q6RA 4HPXA 2CIPA 1GNXA 2TRSA 3R0DA 2DFAA 4NJHA 3UYIA 1JUBA 1I2QA 4AH7A 5BXPA 3WNOA 1J5TA 1NF7A 3ARWA 4H3DA 3KBWA 3N4AA 4FLQA 1F5ZA 2R1NA 3MY9A 1Q4NX 4Q4KA 5FL1A 2X7VA 3B8IA 2FZ9A 3B9DA 3CJPA 4QDWA 3LLDA 4FIQA 5FF0A 1R5YA 3VE7A 1XX1A 3T42A 5D37A 2BSLA 2I5QA 4PUDA 4MKSA 2YYUA 4MY9A 1K8CA 5I03A 2WMIB 2WCAA 4IIEA 4WLCA 3DXIA 4QROA 3T8LA 3I6RA 4PMVA 2ISDA 1DKWA 4H9VA 2OKTA 1SR9A 3A24A 4PR4A 3DFHA 2V6AA 3WQDA 1C8XA 1NTHA 4DX3A 1X8CA 3VUSA 4ERGA 1PIFA 3L0GA 1GVIA 1FRBA 3K46A 1C29A 1JL8A 1US0A 3LPGA 2BASA 3GTXA 2Y1HA 3E12A 1TPH1 1VFUA 3L12A 3NUKA 1TWWA 3PK7A 3N12A 4KF1A 1W9BM 3W74A 2VM8A 2XINA 1O68A 4O11A 4ZA0A 4AFYA 2BNJA 4PCSA 3W75A 4YCPA 1KM2A 3OO2A 3OGRA 1PO9A 1KFBA 4NYUA 3L21A 1YBQA 5DO8A 6CGTA 1TA3A 4KMQA 4LAZA 1GOMA 7REQA 3VI2A 3O07A 2YCJA 1F7BA 1JYXA 1G9HA 4JTJA 5AYZA 4J27A 4U28A 3QV7A 4LF1A 2Q02A 3UCDA 1K1DA 5HJLA 1WA3A 5E9XA 5HNNA 1X38A 4CN1A 1TJPA 1JYVA 5A6BA 4LCSA 4OTKA 4GOAA 1G4EA 4DYKA 2CZFA 1I2OA 4KQNA 3D46A 5IHRA 3MHGA 1XJBA 5D2TA 1XM3A 4JYFA 3V5FA 1Q6CA 4TO8A 3LB0A 4AYSA 2X1TA 3NDYA 2J7BA 2YJQA 5TNVA 4WDXA 4MSSA 4B90A 1XLEA 1KLZA 5D2YA 4MJ4A 5E6YA 2DQWA 4CD6A 3GXMA 3FS2A 3HPSA 2ZRZA 3RAOA 3VO0A 3M9YA 4E0CA 3WFAA 1YRRA 2QUUA 5DT5A 1IR2A 2FQIA 3P81A 1O95A 1IWAA 5FF3A 5FIPA 4ZTYA 4P8VA 3UWWA 1E56A 4B2DA 1L6WA 1TZZA 3IANA 4Q8MA 3QM3A 1M03A 1XSIA 2V68A 3H55A 1JG9A 3NZ1A 3SIMA 2R82A 2Z28A 5H1WA 5C7VA 1RCOB 5F4SA 3MMDA 4M82A 1CWYA 4NUWA 3IIOA 1B0IA 1X6NA 3VGBA 1QUMA 2PDWA 2PPGA 5H6HA 4A22A 4G9PA 2H90A 5KMYA 3SN1A 1BWKA 3AYSA 3KS5A 3HF3A 3OOQA 4HZMA 1DPMA 2QV4A 1ZS2A 5FEPA 3TA6A 3NZRA 2QAFA 3WD0A 3OGSA 1S2AA 5T91A 5BXTA 1TPWA 5FL0A 4C60A 1WAUA 5C8BB 2DY3A 1J0JA 4GNJA 4PCPA 3W7QA 4G1KA 1J5SA 2J27A 2ZUNA 1P7TB 2NLYA 1OABA 4M80A 2G50A 2ZZ4A 3SEPA 1NM9A 5KINA 2WSPA 2WJFA 3OGVA 1PS9A 3TYUA 5A8PA 4WIWA 2O4QA 3O06A 2YXXA 1WYIA 4Z1YA 3LDVA 4DWSC 4QIUA 2B7OA 4U33A 3OBAA 1KD0A 3S2LA 1W9PA 5JQ9A 1KNWA 4RK8A 1Z9AA 1W3JA 4JIQA 2VHLA 4FNRA 3WK2A 3SRDA 1TPEA 3QSRA 1OD0A 4IJBA 1XBZA 3PANA 4E2DA 4XSLA 3W7MA 5C2XA 5FEXA 1TZ7A 1ZFJA 2YXOA 3FDGA 1VYPX 2WVVA 2ZVRA 1G6CA 2QCMA 3VIPA 2ZE3A 4WOQA 1T5AA 1S39A 1OCJA 3VYLA 2HE8A 4BI7A 3E0LA 2A1YA 3WLSA 2QCDA 3LRKA 4PMXA 3TZFA 1ITCA 1RALA 5DANA 3F03K 4IQDA 4JQAA 5CG7A 3OA3A 1HXJA 4LRTA 1YXYA 4A8NA 3ABXA 4R53A 4O0QA 2OTDA 2XN2A 4Q22A 4QLKA 4LEFA 1E9LA 3WQ6A 3CO4A 3FOKA 4R85A 1P1MA 3UEQA 2GDQA 4XWUA 2H3DA 4Y7EA 5HA7A 3UBPC 1OGBA 4QITA 4WOZA 4MAVA 2FH6A 3WQ4A 1F4AA 3WLPA 1M3UA 2PD9A 3B8VA 1CEOA 4D8ZA 3LXCA 4RX0A 3R94A 4ZE4A 3P0XA 3MMWA 1ZZMA 5CCZA 1PZ2A 1W1PA 3PZOA 1LDCA 4GUGA 2Y2WA 1H09A 3IAPA 3P0WA 2V0TA 3F5JA 3P61A 3UCQA 3NEHA 3E3HA 4K8GA 2CWNA 4HJWA 2HISA 4IG2B 1EC8A 4V1XA 4JTKA 3VDAA 2WWDA 3IIPA 1EZWA 3M4HA 3OP2A 2OO6A 4IGSA 1A5UA 1J12A 5AVHA 3WELA 2CBUA 1DHKA 4WHBA 4EACA 3GX9A 4I6KA 2Z2AA 4MNJA 1ME9A 4O4VA 1V77A 2IW0A 4IFRA 1IEVA 4K7YA 5DMYA 1Z32X 5REQB 2NXHA 1EJSC 4CNUA 4HNNA 1R9ZA 3UG4A 1YLVA 4PMZA 3LPFA 1ZBCA 5HR6A 3AXIA 2HPMA 3KZSA 4R9OA 2DU2A 3D5HA 4ZQRA 3VPLA 3EOOA 5AOUA 1LF1A 4IPLA 1AD4A 3CM4A 2JIWA 1BGGA 2GVGA 3MUXA 1W37A 1Z42A 3N9KA 1OC5A 3MUAA 2HEJA 3EAUA 4ZB5A 4AZGA 2C1GA 1AODA 3NM3A 5IOBA 1DEDA 1Q6DA 1FKXA 1W5OA 4PEKA 1W1YA 1S3TC 3L4VA 4GVIA 2YW3A 4B16A 3W4RA 1UA3A 3MKKA 4QNWA 4KESA 3SRKA 1HO1A 4AISA 5D9NA 4D6IA 4W7WA 3WDJA 1EO5A 5CPQA 4HD5A 3VIMA 3GXTA 3PZTA 2PWVA 3CUIA 2GVJA 1C7TA 4JTAA 1F6YA 5ABGA 1DJNA 3CUGA 1R3YA 2J7CA 1RY8A 3W2LA 1G01A 1UD6A 3EEZA 5F2GA 2BY1A 4S3EA 5E93A 3CHCA 2GPTA 4FX7A 1EP1A 2VEIA 3VKDA 4TQTA 2FTPA 1QPNA 2IXVA 2QF8A 3DG7A 1IIGA 1NU5A 4O52A 1MW2A 2OU4A 3TYDA 3LZ5A 3LA4A 4HHHA 3CU2A 3PB0A 4QS6A 2HXUA 3CH9A 2RGMA 3ABOA 4UTWC 1VFLA 2WK2A 5HQLA 5C5YA 3NO3A 1I0BA 2RH9A 3OU8A 4LC8A 4HN4A 2GJXA 3PM6A 1X97A 2JBMA 4L65A 1A5OC 4DBUA 3R25A 3QGVA 5I5RA 3BVJA 2DVUA 1OZMA 2ZIDA 1A5CA 4EXQA 1H7RA 5A6LA 4JN6A 1XG3A 4C90A 3FXYA 3GR7A 1R46A 1GJWA 4LT9A 1XG4A 1LZOA 1B2YA 4LV9A 1TJ0A 1DWFM 3LBOA 5BU9A 6A3HA 3ABSA 5KTLA 1V6UA 4IQJA 4LCQA 1RXOB 1TV3A 2WJDA 4PUUA 3HFYA 1TV5A 2W4XA 2PRMA 3GFXA 4TR9A 1P0NA 3I4KA 3PWAA 4PRTA 5KEZA 4DZHA 2VKZG 4JTFA 2Z1BA 2WXDM 3ZR6A 5LHEA 3TFCA 3S9IA 3LTPA 3E96A 4O15A 4R33A 2VP8A 4LS2A 2RDXA 3WY1A 4D8AA 2C0HA 5I78A 1VZWA 4UQ9A 3CHFA 1AMYA 2ZXBA 3OPSA 4QEHA 3L0NA 3TP4A 3VIGA 3E0FA 2VGGA 3LGEA 1E9IA 1FWFC 4B5WA 4E3VA 5D04C 4JQ2A 1IHIA 3KVJA 4RLIA 3K1DA 4PMOA 3VMOA 4S3CA 4JS3A 2A4AA 2D2HA 3TN4A 1WOBA 3WQFA 5CPOA 1OC6A 3WJZA 2BV9A 2J88A 2HBXA 3L5LA 4MVAA 5AHEA 5T9BG 3B8SA 3UWUA 2QCGA 4DXVA 3CMJA 1Q6GA 3UZZA 3UQNA 4MKVA 3WLNA 4LUSB 3QEZA 4FXRA 2OEMA 2QJMA 2ISFA 1WKEA 3II1A 3KFTA 2QUMA 2EEXA 3TYCA 4Z42C 2J77A 4DBEA 2A21A 4RJEA 4B3ZA 1TWIA 4V2XA 3LV6A 3GYCA 1WDDA 4HPJA 4DWSA 2W66A 4M1RA 2OO0A 2ZA3A 3BAYA 3M0JA 4M7SA 3TJIA 5E6ZA 2RKXA 1H61A 2OWWA 4FNPA 1ZUAX 3WMBA 4IT1A 1V08A 3PPCA 3SCSA 1UKPA 4FB7A 1MRAA 4DJDC 1E4IA 1FWHC 1XXXA 1H63A 3WJXA 3NQDA 3LI0A 4JKLA 3AJXA 3R11A 1ISZA 1PTGA 1UR8A 2OLHA 3TSBA 4P7LA 1W2VA 3I3DA 3UWZA 1SVDA 1CXHA 2VZVA 2V9DA 2OX1A 3KBJA 1EGVA 4JTEA 4N42A 3NPXA 4AY8A 1NELA 2HTMA 1XIBA 2GFTA 2FVKA 2ASHA 5A95A 3BMVA 3F4DA 2Z2UA 3NDZA 3G5EA 2AAMA 2P50A 3B4YA 3G24A 3S5NA 1ZCCA 3OW1A 3VIIA 1JAKA 5BRBA 4X2RA 4XB3A 3P60A 2WNNA 4GGBA 1E71M 1QASA 3GE7A 3GG7A 1NH6A 4E4UA 2DSVA 4CCDA 3U6WA 2UY4A 2P8BA 4FK9A 1VCFA 2JKPA 2XVKA 4N4QA 4FXFA 1XKJA 1QPRA 1KC7A 3DFYA 3DZ1A 3GLCA 1QOPA 3VXGA 2G3JA 1M41A 3TXVA 2DZBA 1ADSA 1EYWA 3LY0A 4P7RA 5CGMA 3R1ZA 1A3HA 3N2MA 4Q32A 1HIZA 2R9RA 4RDWA 3UPMA 5TF0A 2PU1A 4QSFA 4G1NA 3A4XA 3ZMRA 4LAUA 2GJRA 5FEWA 3DBPA 4WSHA 1Y7VA 1DIEA 4M5PA 1L2QA 2PWEA 4EOUA 2DH2A 1RAKA 1EJRC 1UP2A 3ARUA 3DYPA 4HVXA 4W84A 2V81A 4RNIA 3MQTA 3CV2A 3WLKX 3V18A 3PTKA 2VEKA 4J2PA 2OGJA 4FNUA 1VQTA 3PG8A 1K02A 4HZ7A 3EOLA 4ASTA 4RE4A 1TJ1A 3WLMA 3RCYA 2H9AB 4D1IA 1IWBA 2ZCGA 1OFBA 2ZZ1A 1GOOA 4NAEB 4AF0A 1PKYA 1J2BA 1Q2RA 2VFHA 3Q45A 2AGTA 2AQVA 2PWFA 3WF1A 1KBLA 2ACSA 3MUIA 3MO4A 1M7OA 2AKMA 2QV5A 3OHMB 4S2CA 3THQA 2O92A 4O1EA 1W1VA 3T2OA 4U2ZA 2DZPA 3AMKA 5HAOA 1VGAA 2VEPA 1S2WA 4GBUA 1V6YA 3A6OA 1UKTA 5ABFB 1E6PA 1VEMA 3W2UA 1BXBA 4GA8A 4HNVA 1W3HA 3OLIA 4Y8EA 1L6SA 4QJ5B 5D09A 2ZTJA 4JYEA 3GDKA 3GU1A 4MB5A 4GUJA 4PYSA 4YVVA 1FWAC 5K9XA 1J8VA 4YTRA 3WJYA 5AC6A 4FHAA 2REQB 3QV6A 2J7FA 2R94A 4LQ1A 2G97A 3DFOA 3AIEA 4K1WA 4LGXA 3LLXA 1DV7A 4TVCA 4ZBCA 3R5EA 4AIEA 1XC6A 4LPCA 1I1WA 2X05A 1A5AA 1MEWA 1WBHA 2VXNA 3WLIA 3PJUA 1PHQA 3L68A 4QGCA 4PCFA 3S2NA 3M43A 1H62A 1QI2A 3ABQA 4JX5A 1VJSA 3S42A 3SO7A 4B5XA 2BOEX 1ISVA 3WLRA 2GZXA 4O50A 1QNOA 3UD6A 1UR9A 4XUYA 4IX2A 4JYDA 3HO8A 3VNKA 2EJAA 4LUYA 3SM0A 5CC5A 3W7KA 4UTWA 2HVMA 4UMBA 3RILA 4I5XA 4ADSA 1M7PA 1NWTA 2NQZA 2UY5A 1O1ZA 3BXWA 3FYPA 1ISYA 3LZ3A 1WZMA 3H26A 4ROPA 3BSGA 4J28A 4DRSA 1HG3A 3OIXA 4IWWA 1FWNA 3KL0A 3TROA 1AG1O 2PGRA 2EQDA 1EZ2A 1W17A 3LCGA 3RF9A 2QDHA 3P8JA 2VC9A 1R3SA 1LOLA 3GUWA 1Q5MA 4AAJA 3UA3A 2ZA1A 5BXSA 3VGGA 3HMJG 1KXQA 2O9OA 1OFRA 3KCOA 2G37A 2GOUA 2OWCA 3VNJA 3N73A 4C1KA 4OT7A 1OFQA 2W91A 4XZNX 1SO3A 4FNTA 4XD4A 1FCUA 5H8MA 4C6OA 1AZ2A 3RJXA 4CNTA 3B9EA 2C1IA 5GNZA 3R12A 4C6QA 1V5XA 4XKYB 4NZ4A 3ITCA 2Z6JA 1XYLA 3TA9A 4OUIA 1AFSA 2ON3A 1ECQA 1F8MA 3BOXA 4RXFA 1P5BA 3UNDA 4ROQA 1TPFA 3T2QA 1FX6A 2BGQA 2CWXA 2WO5A 1PTAA 1E72M 4H9XA 1J01A 1P43A 1PSCA 4K3ZA 3O0KA 3UXKA 5DRIA 4CNPA 4GZ7A 2Z25A 1E1CA 1VLWA 3JU2A 1OHLA 3EX4A 1UIOA 3AO0A 1VEOA 4AD2A 4NJGA 2OZ0A 3QLDA 2W92A 5EGRA 4NSBA 4BEUA 4LU0A 3E2SA 1HKVA 3L66A 4K6AA 3UVIA 4UFLA 4HTYA 3STEA 3W1LA 4HTBA 3USZA 4GQ0A 1CNVA 3ARTA 1ZPTA 1H7XA 5B80A 4QG6A 2GGGA 3RMJA 2Y85A 1OCNA 1F3TA 5FJPA 1F6KA 3W7GA 4WDWA 3QQWA 3MKVA 3W02A 3AISA 2WM1A 1TYGA 3TQPA 2C13A 4DJDA 3SRFA 1JXKA 4WDUA 3E6EA 1QNRA 2VGBA 2VZUA 1Q6FA 1CPUA 3EX2A 3GTHA 4Y9OA 1CGTA 5A1AA 3TUUA 3KOYA 2BVYA 4WXZA 3K1GA 2PWHA 3N4EA 2I9UA 3NTYA 2IUZA 4G56A 1JCJA 4H6RA 1UH3A 3O6DA 1AW1A 1H5VA 1E1FA 3DECA 4D6JA 3MI2A 2GK1A 2NV2A 3TZNA 4XZIA 1Q2SA 2PEVA 3LHTA 1UWTA 4ZQMA 2YL5A 2CKRA 2VC7A 4WKAA 4GI4A 3TSMA 3M0IA 1QPQA 3GR4A 5K2ZA 4LBRA 2XVPA 1MEIA 3ANYA 3NQFA 4HKPA 3HPXA 4J3TA 2GGHA 2Z1KA 3EKGA 3GNRA 1D8CA 5FD0A 2Q3OA 3FKRA 2WPGA 4QHRA 3TW6A 4PTMA 1ISWA 1GPFA 5D05A 1KBIA 1PX3A 2VZSA 1CB7B 1FWEC 5FAJA 3RXZA 1UD3A 4D6EA 3W2MA 2B7QA 4NRSA 5IFTA 4X0VA 3FY1A 5AVNA 1E1EA 1M6JA 1X1OA 2D22A 3AHYA 3QZEA 1QAPA 4MTVA 2V3GA 4CNSA 2VRQA 1HKJA 1FHLA 1XINA 1Q6QA 5HUOA 3LD5A 1BKSA 2VWTA 2QMKA 1F73A 5DXYA 4UTKA 2HSAA 3BZJA 3GYEA 4J2MA 3W37A 4H6QA 1QOXA 1SZEA 1XUUA 4BQ2A 3MBFA 4MZ1A 3T7VA 3W7RA 2Z29A 2PU0A 3NCOA 2OGYA 3DGRA 2E9MA 3DG6A 4C1LA 4M3PA 3HG4A 5EPDA 4MB4A 2ZRYA 3BJSA 4RKAA 4DZAA 3I3BA 4O16A 3DHUA 3QFWA 2QMJA 1WDSA 4J3SA 1PHWA 1H7PA 5ENLA 4HU8A 4PE8A 1YDOA 1UP0A 3NURA 3GVWA 4N6EA 3GKAA 2VOTA 6XIAA 4F3HA 2IKIA 1AZ1A 3WYZA 1J10A 3EX3A 4E2BA 2VR4A 3QOKA 2CHOA 1QBBA 4QG9A 4O54A 3V5OA 1V4YA 4YHGA 5AHLA 3DERA 1Z6KA 3W1QA 1K4GA 4C6FA 1IWPA 4GC3A 3CLWA 2HDJA 2VDHA 3JUGA 4CD5A 2A2IA 2EXOA 3AUJA 5I3FA 3KTXA 4JIEA 2QCDB 4Y2WA 1ML1A 3CTTA 1H51A 3KOXA 5I00A 4HHLA 1KCKA 3IAQA 1XD0A 3W1RA 3PBVA 2ZA2A 4UQEA 3MSYA 4KWOA 3DHFA 2WLZA 2XG9A 2PDBA 2QKFA 1TRIA 1CW2A 1ME7A 4O57A 3OLGA 5MKGA 1C90A 1GVRA 3A3XA 1EJVC 2VCAA 4UNLA 4JPGA 2C3ZA 3UYCA 2C16A 3GVVA 4AC1X 1UWIA 3IIXA 3FSUA 3BW4A 3OZOA 1Q6EA 1IQ8A 3W2NA 3VX0A 4AEEA 3GIPA 1VPQA 2IXUA 4O17A 4G7EA 4MNMA 1JPKA 4L6HA 2FKPA 3VZYA 1QHOA 3SSJA 3CAKA 3SZ8A 3VOFA 3CT7A 5FEZA 4X2PA 1AW5A 2Q8ZA 4ORMA 4IPPA 2ACUA 3GVRA 2FHBA 4O0KA 1DQXA 3CQHA 4I9AA 1XYCA 1XGEA 4LVBA 2HS6A 2WHJA 1GKPA 3AHXA 4MB1A 4XIAA 4R7OA 4AEOA 4NZJA 4PUKA 5AHFA 3ITLA 4LTSA 2BY2A 3IPWA 4TMCA 4KFOA 1ZTVA 1FH7A 3W86A 1LYXA 3O6YX 5TD4A 3DN5A 4XK2A 1DXEA 4FO4A 1UJPA 1HFBA 2TMDA 2C15A 5DBUA 3ICJA 1T99A 3MZ2A 4R5EA 3I7SA 3TC7A 3THUA 3TQKA 1Z44A 4S3DA 2QDEA 4HU3A 4C7GA 4Q7NA 1WV2A 3S5SA 3S1UA 1DOSA 4CCEA 4RPQA 4C7DA 5EA9A 3VIHA 2DT0A 3FA4A 1AUSL 1TPUA 2P10A 1TB3A 4B5NA 4M6QA 2QPXA 4O53A 5IDZA 4ACZB 1TV2A 3N4FA 3SECA 3W29A 4IMGA 4JTIA 2G4JA 1P0KA 2XHYA 3W7NA 3BLPX 1G7VA 5CXPA 3GM8A 2Z26A 1EWDA 3M7SA 1QXLA 4Q4QA 2YSWA 2QCLA 3TEVA 1AK5A 3A12A 5I02A 5D9MA 1SR0A 4IMDA 5CLWA 4QS5A 4FEZA 3W7JA 4BFAA 1XCXA 2PDFA 1XH0A 2HVOA 4L9YA 2DH3A 3VKJA 4XBJA 3KLLA 3N04A 2ZX9A 3A3WA 1KRCC 3RRXA 1OCQA 1IXNA 4UOZA 3HG5A 4MJZA 2PRLA 1XYBA 1E6RA 1R3WA 1F3WA 4JHZA 4CLMA 3STFA 1DJWA 2RDWA 1DP0A 1XIHA 1C8QA 1I2RA 1V3KA 2V2HA 4HHPA 4EXBA 1JFHA 4JXCA 5IFPA 4R27A 5T9CE 4RZ6A 3AIUA 4GE8A 2WW5A 3TN3A 3M7WA 3CEUA 1T96A 2WHLA 1Q6OA 1TVNA 2GSEA 4J1OA 3RX3A 3BL3A 1OZQA 3FCPA 2V5CA 1V3JA 2DZUA 1XKYA 3FJLA 3CB3A 3NSXA 1GG1A 1GZ1A 3MUY1 2GJXB 4W85A 2J8FA 5G1YA 3MDWA 3N14A 5C2CA 1VB9A 4N4PA 4UTUA 2BXYA 2QJIA 4JTHA 3IIZA 5G1TA 2PLJA 3H4WA 4NIRA 2DZXA 1XC4A 1OF6A 2GQ9A 3AS0A 3B8UA 3RUBL 3FKKA 5A8MA 2HK0A 1XCWA 3GHTA 5HPOA 4LVFA 4IF2A 1QHPA 1HJWA 3M5VA 1IZKA 1OYBA 2DPEA 1XRTA 1YPFA 3IIVA 4J3UA 1UC5A 1JCXA 1LLZA 4A3HA 3M5YA 1JCTA 4QG8A 2CBJA 1L6GA 1GCYA 2XGZA 2X0HA 3R13A 2QGHA 4GKTA 1PZ3A 1H11A 5GNYA 2X8RA 4DAFA 4K39A 4NJJA 3ZT6A 1VS1A 2OYKA 1JD7A 3ZO9A 1S2VA 6XIMA 4KWWA 3LNMA 3U7BA 2V63A 1V6XA 1UHVA 2DZAA 4JEQA 1R85A 3L4ZA 3QN3A 2C0AA 4UNKA 3PAJA 3ENLA 4F0KA 2VX5A 4DUXA 5J5DA 1DIDA 1DJQA 4TX6A 1PYMA 1XGDA 3M0LA 4N0RA 1Q4WA 2W63A 2OSWA 1EJWC 1I60A 2A3AA 3UW6A 2WMIA 4LWWA 1QU4A 2A85A 4A8IA 3CWNA 3O9NA 3V16A 1PAMA 1Z41A 4NT0A 2O9TA 2YLAA 1GK8A 1XLAA 3TYAA 2BOFX 4MNKA 5HMSA 5EMMA 3MC5A 3XIMA 1TREA 2MNRA 4HA4A 3W71A 1FXQA 4WCJA 1W1B1 1RSCA 4HQVA 4NHVA 5KETA 1W3TA 3T08A 2WKLA 3ARVA 2VENA 3GBEA 1OFPA 3AXKA 1XD1A 4WSKA 5C7HA 3JR2A 3WUGA 4GG9A 3K4WA 1MI3A 4DBDA 3G1HA 3REQA 5G2WA 3RPDA 4UFKA 3F4WA 4HJFA 4WVXA 1IE7C 1V6TA 2YGYA 4Q8VA 5AECA 1S3HA 5DT7A 2Y63A 3KVLA 1BLIA 1F76A 1LRNA 3ZVIA 3E0WA 3H24A 3LHUA 2I5GA 4LRSA 1UPPA 3BUVA 3C3UA 5T8GA 1E3XA 2FGBA 1A0CA 3COTA 1LWHA 3QHNA 5HULA 5DY2A 3WCZA 3PBYA 3KCLA 3ITOA 5BMXA 4CQ8A 1DHPA 5IM51 1PKLA 4IIBA 4X60A 1MUCA 2Z7KA 3LSCA 1DBTA 1G69A 4N7QA 1S5NA 4FLSA 2ISSA 2HNEA 1U33A 2CBVA 1UBSA 4WF7A 3QFEA 5I3IA 3N25A 1AH0A 3PJWA 3TNBA 4LYPA 3WF4A 4JZ5A 2HROA 4W86A 1RA0A 4J35A 4ZSUA 4HCHA 3V36A 3GXNA 1THFD 2C8NA 2RJHA 3OLDA 3JS3A 1XBXA 2VMFA 4EPEC 1JCLA 3E1F1 3K30A 3TAOA 3WQVA 1VBGA 3S0CA 5I3DA 2E4TA 2OKOA 1FCQA 2ZXDA 1KO0A 4XO6A 2D0HA 2QULA 1PE1A 3PFMA 4INFA 3ZLHA 5HANA 2ALRA 4ADTA 1S5VA 4HMEA 1D3CA 1MVYA 4FNSA 4K1GA 4PB4A 1E40A 3LM3A 4PMRA 3PZNA 1KXVA 2J66A 4W8AA 1I1XA 4QE4A 2V5DA 1HGYA 3EA1A 1EF2A 4H8VA 5AB3A 4Z2GA 2Z24A 3QY6A 1KR1A 1YE4A 3R0UA 4AG0A 4L1XA 1DJZA 5AYXA 1AW2A 1LQ2A 2X1RA 2QF7A 4LX4A 1QO2A 1XH1A 1MXSA 1M1BA 3GNPA 4AMAA 4Q3MA 3LRLA 2WZTA 2PC4A 3T81A 4UTHA 2FJUB 2CZ5A 4MG4A 1GYLA 6TIMA 3EB2A 5EKYA 5HATA 1BYDA 1EFZA 3S6TA 1QW9A 4YTQA 4ZQNA 5DCDA 2YPIA 1X7FA 1WZLA 1YYAA 1IV8A 1H1NA 3TR9A 3VD7A 4LV4A 3C61A 1BKHA 3QXBA 2Z2BA 3KP0A 6REQB 1SW3A 1W8SA 7PTDA 2YL8A 1P7TA 5LXXA 3BE7A 3JZUA 4MWAE 2YOCA 3BLLA 4IFKA 1ZGDA 4A29A 2KZHA 4HIBA 4AQLA 5LNRA 1B3VA 3RU6A 1IR1A 2CLLA 1V03A 2BS9A 2PCQA 1GW9A 2UV8G 4LJ3A 3WQ5A 3L4UA 3PWGA 1UWAA 2ABAA 3L4WA 5HK4A 4UQAA 4M6PA 1XDJA 1ADOA 3TV8A 4PMYA 2CLOA 3ZSTA 1W91A 1XLFA 5DY3A 2NQHA 1HO4A 2J6VA 3G1VA 4IH3A 4GWEA 1BWVA 1YDNA 2HMCA 2XWDA 3MI6A 1M04A 3MSDA 3N19B 1GG0A 2CESA 3WDHA 1LORA 2QCCA 3FGCB 1RA5A 2PGFA 2POZA 1OEPA 4QBXA 4DJFD 3IACA 2NVAA 3B0XA 2ZUTA 2FHCA 4N6FA 2QUVA 5HUPA 4PGLA 1L2UA 1XS2A 3VU2A 3M0HA 4NL1A 1TV7A 4H2CA 5I06A 1UR3M 3EKZA 3MYPA 1K8ZA 2HE5A 1PZ1A 1NQKA 1SFSA 5M5DA 1V0KA 2DJXA 4OKDA 3WJSA 3CAWA 1X7IA 3VMNA 4Q4OA 3UF9A 4ZO6A 4TIMA 1KFKA 1DJXA 4GUHA 3UERA 4BF5A 3T40A 2B7NA 2R1KA 2V2DA 1EDGA 2DZTA 4MHBA 4YWSA 1ELSA 2XH0A 5EB8A 3IEBA 1GT8A 5DX7A 3IJ7A 2GSJA 3MV11 3W72A 3RYSA 1O66A 5DMLA 5M03A