4PFMA

Shewanella benthica dhdps with lysine and pyruvate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
294
Chain Sequence
HMINGSIVALITPLNSDGTVDYTSLEKLVEYHITEGTDAIVAVGTTGESATLPISEHIAVVGQTVKFASGRIPVIGGNGANATAEAIELTKAQNKLGVAAMLGVTPYYNKPSPKGLIAHYTAVAASTDIPQILYNVPGRTAVDMLPETIAQLVEVPNIIGVDATGDVARVKQLRDLCGNDFLLYSGDDATAREFLTLGGDGVISVANNIVPKLFKLMCDAALAGDTQAAMAAEDQIKGLFSALFCEANPIPVKWAAHKMGLISQGDIRLPLTELSTEFHGLLLDAMKNARIEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining a Molecular Determinant of Lysine-Mediated Allosteric Inhibition of DHDPS.
rcsb
source organism Shewanella benthica kt99
molecule tags Lyase
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
total genus 106
structure length 294
sequence length 295
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2014-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4pfmA00
3BG3A 1KFLA 4HSNA 2OX1A 3VFLA 2Y6ZA 2ZRWA 5FEZA 2ISWA 1QPNA 1TPC1 1KA9F 3GDTA 4DXVA 3R89A 5LNRA 4G1KA 2C16A 4K39A 4JY8A 2H6RA 3W2KA 3JS3A 2ZRYA 3TU9A 3UQNA 4ZZ9A 2ZYFA 3UNDA 4ONVA 4UTUA 3N14A 2C0AA 1QFEA 5AFDA 6ALDA 1G69A 3U6WA 1IIGA 4O10A 1BEUA 4GUHA 1H7OA 3E96A 3M16A 4JDBA 3PWAA 5CZ0A 2TYSA 1EWEA 4XTIA 1KV8A 1FWSA 1YTDA 3TDFA 1FDZA 3M0ZA 4O17A 4CQAA 3S1XA 1W54A 3M44A 3GX9A 4UNLA 2YR1A 2Y88A 5AOUA 2C19A 3GDMA 3LRLA 4NNAA 4MUZA 2V81A 2C1HA 2FPYA 2YZRA 4PEKA 4LRTA 1HUVA 4U28A 4LVFA 3CPRA 4UTTA 1M5WA 3G1HA 3TAOA 3DAQA 3TK7A 2A7NA 3LCFA 2WSRA 3USBA 4DBDA 4DO6A 2PURA 4AAJA 3QMTA 4XTDA 3EWWA 2A7RA 2Y63A 4OQVA 3THAA 1GT8A 1V7YA 3IEBA 4IPJA 3MP4A 1XXXA 3NEVA 2J9ZA 2NUWA 1QCWA 5DXXA 5AHEA 5AC6A 1KM6A 1W8SA 2DZUA 3W2JA 3W7NA 2HMCA 3WK1A 1ME9A 4WXZA 4Z0SA 3UWUA 4EOUA 4M6VA 4NJKA 2RFGA 1LRQA 3PUDA 5I3IA 4IUOA 2R8WA 3RLVA 5F1VA 5L9FA 3PF3A 3CC1A 4MYXA 3IIZA 3HF3A 4FNRA 2J6XA 5FI8A 1I45A 1SO4A 3STGA 2FDSA 1W31A 4O57A 5F2IA 5EA9A 3W9ZA 2GPTA 1QAPA 3DFPA 3N2XA 4DQWA 3IGXA 4NT0A 1TQXA 3BLFA 1K3UA 3IVSA 3Q37A 3G0SA 5KZEA 3W7HA 3SGZA 2YW3A 4OHQA 2RDTA 3PSVA 2FPTA 4DO4A 5HWMA 3TSDA 4LS2A 3O6CA 2ZQ0A 1EP1A 1GWJA 5K9XA 1NEYA 1G7UA 2GQ9A 3KAOA 5K4ZA 2UV8G 2Z1BA 3HG2A 1FDJA 3SGUA 3IIOA 2B4GA 2TSYA 1QDSA 3T78A 4FHAA 4DEFA 2CLFA 3V1PA 2QJGA 3G0UA 3MP5A 2PC4A 4N9EA 3W1TA 1UUOA 2A85A 1IXQA 5G4EA 4P61A 2GVGA 1HO1A 1GQNA 3S5NA 4S1FA 4UFKA 5EL1A 1ICSA 1N8FA 4HNVA 1ALDA 1FCVA 2A7PA 3FIGA 2CWNA 3W2NA 2QAPA 2VXNA 4ZVJA 1LRNA 2DJLA 3HPZA 2YPIA 2QCDA 1GVSA 1TPDA 4ZQRA 2ISSA 1VC4A 1LRTA 3OG3A 4NZJA 5G1TA 1OK4A 3OVPA 1W5NA 3DH7A 3S42A 5BRBA 4O4VA 3LHVA 3TQKA 1XC4A 4PFMA 4O1AA 3K30A 4HHPA 1JQXA 1P5BA 4EF9A 1JRCA 4RXGA 1SFJA 4O1BA 3L67A 1L9WA 2J9XA 2YYUA 1C29A 3NL2A 4O0ZA 1EEPA 4CQ9A 3HB9A 3WJSA 3W86A 3HG5A 2YFOA 3P67A 3W1MA 3LRMA 1AG1O 4LC6A 2E09A 3W7CA 2X2GA 3S1UA 4MPQA 3MMTA 3UXDA 3W84A 3HG3A 5KMYA 3FYPA 4R53A 3TXVA 7TIMA 2WSYA 3P7YA 2CLHA 2X1UA 2ZDRA 4K37A 5BW6A 3A23A 3L5AA 3ANYA 4NVTA 4Z0JA 1W5QA 3QFEA 2FIQA 2E68A 1PL9A 4B5NA 1F2JA 4EWND 1N7KA 4MJMA 3ABQA 3S1WA 4FX6M 4N4QA 1TMHA 1TQJA 3TSMA 3HJZA 1DKWA 3ELFA 4HNUA 3P84A 3HGOA 4L4MA 3GAYA 3N9SA 2CLOA 1SW7A 2FB3A 1F5ZA 2GQAA 2O7QA 4WJEA 2DU2A 1PIIA 4ML9A 1PCKA 3JRKA 4GWEA 3B0VC 4C1LA 1KM0A 3Q58A 2B7PA 3R2GA 3EXRA 1LYXA 2VFIA 3LTPA 4GJ1A 3TW6A 1H7NA 1WXJA 1BKSA 3GNDA 1GZGA 4IJBA 4RJEA 5TQLA 4HSOA 4I7UA 4PCFA 3LHWA 3NG3A 3NQGA 3ZWTA 3M5XA 1OX4A 4M6QA 1ZJIA 3WK3A 4JTGA 2QCEA 1W5MA 1W3NA 3P60A 4M7TA 5EPDA 4QAIA 1I2OA 1IGSA 3LTSA 2QJIA 4O12A 2EAWA 3QMSA 1Q45A 1W56A 2QAFA 5HR6A 2R14A 3M7WA 5HWJA 2H3BA 2PCQA 3P80A 4X9SA 1ICQA 1OHLA 3C56A 2X16A 1IIHA 1SW3A 1F6PA 3E0IA 4NNCA 3DKLA 1SFLA 4FNPA 2DZVA 4KFPA 3W85A 4UTWA 5DY3A 2OJPA 2ZA3A 5D09A 3W7JA 4GUJA 4TU1A 1A5AA 3L0NA 4O53A 2Q8ZA 2GVJA 4JTLA 3TH6A 2X1TA 4UIOA 1W0MA 5EY5A 1GTEA 1GTHA 4RLIA 1P0KA 2FTPA 4H6KA 4FX8A 3AO0A 2VKZG 3UZJA 3BK0A 1SO5A 1SSGA 4PC8A 1ONRA 2YW4A 2QCMA 1XL9A 3W22A 2C18A 3GXNA 1VCVA 3L0KA 4JTHA 5AB3A 5F4SA 4U4MA 3O63A 4JN6A 5EBUA 2Y85A 2RH9A 3P61A 1MEHA 2V5BA 3FS2A 1LORA 5H91A 3EEGA 3TMQA 3TC6A 5FF0A 3NQAA 2OT1A 1WOAA 2VEKA 1WV2A 3QJAA 1G6CA 3TFCA 3EX2A 4RCXA 3W87A 4QNWA 2NX3A 3W72A 4LV4A 3GKAA 1FY6A 1RPXA 1VPXA 3BG9A 2OZ0A 4AHOA 2F84A 2Z2UA 1I4NA 1Z42A 1NVMA 4DBEA 3DHFA 3LXAA 4I7VA 4ZQMA 3PSWA 3PS7A 2ZZ7A 4N6EA 3LBCA 3P62A 1W1ZA 4ZQPA 4WOZA 3GYEA 2JK2A 5E93A 2C14A 2FQIA 5D33A 1A5BA 1VHNA 3HGJA 1QMLA 4JTKA 5D2WA 1LLWA 2V0TA 3W1RA 3ATYA 3KVKA 3OEXA 4JY9A 5C6MA 5LHFA 1VCGA 3S0CA 3GDLA 2A6LA 3W83A 1XM3A 4J9JA 3PBVA 5AHLA 2NV1A 1LTDA 1FXQA 1WA3A 4YL2A 1AW2A 1XDMA 1H1ZA 1J4EA 3DHDA 2CZEA 4WZHA 3W71A 2HS6A 4JTUA 1PHQA 3BLIA 3MHGA 3HGSA 3NPVA 4GFSA 1X7FA 1ZENA 4RXFA 1LZOA 1LM1A 4IMEA 5F2LA 4Y8FA 2BLEA 5K9CA 1YADA 3C4UA 3W07A 1RR2A 3MO7A 2QJHA 1OFDA 1F7BA 2V9DA 3QSTA 5L6UA 4PODA 3GDKA 1UUMA 2Z6IA 3UY8A 1H7PA 1ZALA 4N9CA 2NUYA 5A8GA 3UWVA 2V2CA 3IVTA 4X3ZA 1R47A 2DZTA 3BG5A 2VELA 3LXCA 1G67A 4UR8A 1L6YA 2EPHA 2AAMA 1QNVA 2FPVA 1KM4A 1ICPA 1YLVA 1LCOA 4XUGA 4EIVA 4LTSA 3WJZA 1BWLA 1FQ0A 1SW0A 3LB0A 3B04A 1YPFA 1SQ7A 4LNYA 3LCXA 1OFAA 5G2HA 4RZ5A 1XCFA 2FFCA 3LCIA 3TCEA 1FDYA 3LHTA 4R33A 4PH6A 1TPFA 3O05A 4O16A 1RVGA 2I9EA 2GJNA 4KWVA 1O60A 1OX6A 2E5CA 1JCXA 2EHHA 3W1LA 4TR9A 2PE4A 4UC5A 2JKPA 5HJLA 1OFPA 4HNNA 4LVGA 5I3JA 2CLEA 1ME8A 5C2XA 1KM1A 3ATZA 3M5ZA 2NX1A 4O18A 2QCNA 1HL2A 3TXZA 2WO5A 1SPQA 1QO2A 4CQ8A 1DVJA 3C2EA 3L68A 1GVFA 2B7NA 3O6DA 2QKFA 2V5LA 1ZFJA 2ALDA 1DV7A 3DI0A 1H61A 4AF0B 3ABSA 1M7OA 2ZZ2A 1A53A 4Q33A 2I1OA 2WNZA 1VR6A 4AF0A 1T99A 1FWNA 4E2BA 2G5WA 3C2FA 3DBPA 3I7SA 3QRHA 1R2TA 4H3DA 5E0KA 2EGZA 3GK0A 3L21A 4O19A 1O4UA 4BK9A 2DORA 3QSRA 1QO5A 1WX0A 1H7RA 3W2MA 3O6YX 4Y6GA 1DJQA 2PRLA 3IGUA 4NX5A 3W6YA 2DP3A 1OK6A 4UFLA 2VFFA 1KW1A 4WXYA 1TPEA 3GDRA 3ABRA 3UWQA 3NQDA 1OYAA 1S5WA 2CLLA 4FF7A 5D2YA 3A21A 3BW4A 1F74A 3EXSA 4JR5A 2ABBA 1VH7A 2WV8A 5CPOA 1WDWA 3ABOA 5D03A 3M5VA 1OABA 5HWNA 3NQCA 4IMFA 3MUXA 3DFTA 5AYYA 3EWZA 4K7YA 3NL3A 1AK5A 5F4XA 3PG8A 3HPXA 1VRDA 3MI6A 3RU6A 3W7RA 5K7JA 1NF7A 1B4KA 1YDNA 3G1SA 4N4PA 1LLZA 3NOEA 4IOTA 2DZXA 1XUUA 1KTCA 5KSWA 5D2XA 3LI0A 1JVNA 3QW4B 3EKLA 1KFKA 1OF8A 4CNOA 3IRDA 1C9DA 4RV8A 2V2HA 2VFEA 2D73A 3W7LA 5G2IA 4JIQA 3MBDA 4A29A 1TO3A 1ZAJA 5AC8A 3GLCA 4JGDA 1VYPX 3ZS4A 4HT3A 1SR9A 3QYQA 4RKAA 4Y96A 1YXDA 4A2RA 2V2DA 1AW5A 1OX4B 3LERA 3QC3A 2A4AA 2I14A 3G18A 4O1CA 3W7OA 1TJPA 3C8FA 4UTHA 4FEZA 2RDUA 4FB7A 1F76A 1THFD 2C15A 2TPSA 1K7XA 4TMBA 4JICA 3MWAA 5I3GA 1GVRA 3W1QA 1K02A 1VHCA 2HS8A 4AWUA 2WNNA 1IXPA 4AHPA 5BOOA 1O95A 1RQHA 4E38A 3TUUA 4UXDA 3WK2A 3LCLA 1DQXA 1FX6A 2GOUA 1YDVA 4ZMGA 4AMAA 2E6DA 3NO5A 3TAKA 5K9DA 2HSAA 2JKAA 4GBUA 1IXNA 2P1FA 3MBFA 4NJIA 4Z1DA 4UMBA 4BF9A 2NZLA 3HBLA 5A5WA 3CQ0A 4IXHA 2QCGA 1TV7A 3WFAA 1TPVA 4LC8A 1KFJA 1XI3A 1DORA 2BSLA 5FF2A 1KLZA 3N9RA 4O15A 4QSHA 1B57A 2NX9A 3BPWA 2CU0A 3RMJA 3U2OA 3W2UA 1AL8A 1B9BA 1UASA 3GAKA 1KBJA 2TRSA 5HUOA 3PBWA 3SZ8A 4IMDA 3CEUA 2G97A 5K4XA 4E2DA 1RQEA 4WOQA 3LXBA 4GNJA 4UTLA 3PUEA 4NJGA 4OE7A 1TPUA 2RDWA 5G5IA 4BI5A 1A5SA 1VLIA 4UTMA 5LKYA 5AHIA 3NVTA 1IF2A 1T96A 1TSIA 4H4IA 3TW7A 4UTWC 3LOTA 2J88A 1LDCA 4IMCA 3CM4A 4LT9A 3LHYA 1DQWA 1QR7A 5ABTA 1ZY9A 1EP2A 3W73A 2CLKA 5KTLA 1I8JA 2E6FA 4MY8A 4NJHA 4TO8A 2Y7DA 5AYZA 8TIMA 3C2OA 5LGXA 4Y9AA 1P0NA 1U83A 2A1YA 3G0XA 4NJJA 2VFHA 1LOLA 4YCPA 2YGYA 1W3TA 1MEIA 2P10A 3BO9A 3C61A 5DCDA 3C52A 1KFEA 4TX9A 3TFXA 3GR8A 3H53A 1J5TA 1K8ZA 3OVQA 2W79A 2RKXA 3LHZA 2J9YA 2VFDA 2CLIA 3HMJG 4JTIA 4AWSA 4A3UA 4CCEA 5AHNA 1JUEA 1OFOA 4UUIA 3TKFA 1GG1A 2BX7A 3NL5A 3CIXA 1Z44A 1YPIA 1XBZA 5LNWA 3NQ2A 2Q3OA 1GYLA 5I3FA 2XN2A 3NYZA 5FEXA 1AW1A 1P1XA 3R12A 4IX2A 4FNTA 3EWYA 2FLIA 3EX1A 1OYBA 4PA8A 1FWWA 1XUZA 3CHVA 3B05A 3NQVA 4MZ8A 4UCGA 1FWTA 5CKSA 1ZCOA 4EVZA 5D37A 1NSJA 2QCLA 1ZNNA 1DL3A 1L2UA 3QW3A 5CG7A 3S9YA 2OT0A 4N9DA 4QISA 3L0GA 3KHJA 4ZQOA 3S6DA 1W3IA 2ZRXA 5HULA 4X2RA 4XWUA 3NDOA 2OCZA 4X22A 3M9YA 5CGQA 4MKNA 3G1DA 2AQWA 5CPMA 1XDLA 1D3HA 3F4NA 3LLDA 4OWGA 2ZRZA 4L4LA 3TMLA 1VGAA 5EMUA 4MFDA 5EYWA 5CZSA 1KFBA 1FCBA 2E5DA 4P2VA 3CWOX 2Y7EA 5AHMA 4M5PA 1G4EA 3UPWA 3W74A 3HOJA 5GVJA 2B7OA 1OF6A 3D0CA 5AN7A 3PUOA 3S5OA 1JUKA 3B03A 4BWLC 1W37A 4JXCA 3A22A 3HGRA 4M6PA 1H1YA 5KINA 2Y7FA 3G1VA 4Q32A 1Z41A 2FJKA 4JEQA 4OU1A 3C0JA 4PL2A 3W76A 5H2ZA 1JRBA 1S3HA 3JR2A 2ZZ5A 2X1RA 3KVMA 1Y0EA 5F2GA 3P8IA 4DF1A 4K7VA 1TYGA 3TSBA 3B06A 2Q8LA 4Q4KA 2AGKA 3QMRA 1JJKA 1K8XA 1WQ5A 3T40A 2ATSA 3PB0A 5C55A 1KTBA 1H62A 3BW2A 5AC7A 3F1QA 1M6JA 4K8HA 4MZYA 3I7QA 4LV9A 1DJNA 4R34A 4BI7A 3FKRA 3W7QA 4HN4A 3STEA 2H90A 4Y90A 4UFHA 1XFBA 4FNSA 3M47A 2ZA1A 1GYNA 4HKPA 3W1NA 4QJ1A 3KOFA 1BWKA 1X1ZA 4MFEA 4CCCA 4UR7A 2H3DA 1X8FA 5CZJA 2Y62A 3FA5A 5BNKA 2XN0A 1H51A 4QIUA 4HPXA 4O8RA 1SZGA 4MOZA 3B0UX 3NQEA 1JCMP 1WOBA 3L66A 4JX4A 4UTKA 3QPYA 1IXOA 1YXYA 4JX6A 2A5HA 1LOQA 4FO4A 3GIYA 2GVLA 2X30A 2E6AA 1D3GA 3W7DA 2WPBA 3TQ0A 3UWYA 1ZHAA 3UY7A 3VCRA 4IWWA 3MI3A 3CTLA 4NUWA 1KBIA 1GEQA 1R30A 3QQ0A 3NR0A 1GJPA 3EB2A 2QF7A 3G3DA 3ZWSA 4XBKA 3OA3A 3F4WA 3I7RA 2ABAA 3S5YA 2ATMA 1H7XA 1OVDA 4RR4A 3PVFA 4ORMA 3E9AA 3LCGA 3G1AA 4JYEA 3H54A 4TMCA 1QPQA 3S1VA 3IIXA 3DGRA 2KZHA 1OX5A 4QM1A 2YCEA 1PHWA 3TIMA 3GXPA 5C54A 4BWLA 1S5VA 2PRHA 3NQ6A 4K38A 2QDGA 1LP6A 3NPXA 1OFRA 1TPH1 1G4TA 1HFBA 5KZMA 2F7FA 1X1OA 1WAUA 3CLMA 1C8VA 4Z1BA 5J5RA 4WY0A 3RFAA 3INPA 3T4CA 2NUXA 1AL7A 1XBVA 1XKYA 2E77A 4XZ9A 4WD0A 1MO0A 2QCFA 4N2YA 1O5KA 3UZ5A 1QPOA 3DENA 3P74A 3DFNA 3TJXA 3PB2A 3TA6A 1Q6RA 1XBYA 3WJXA 3O1NA 3FOKA 3VI2A 3LV5A 1VCFA 1H7WA 4Z08A 3C2VA 3AJXA 3V75A 2PRMA 4UMAA 4RZ4A 1EP3A 4JYFA 4OV9A 5F1UA 1KM5A 3NA8A 2CLMA 2DZPA 3T55A 3H55A 4HNTA 2DJXA 3BLEA 4BR1A 1DHPA 1SUXA 5FF4A 1KM3A 1QPRA 3EWBX 3CU2A 3SJ3A 4K36A 3PR2A 1TJRA 4KWWA 1EWDA 5CZTA 4NQ1A 1L6WA 4BFAA 5HQEA 1SSDA 3EWXA 5D2VA 1G4SA 4JX5A 2XN1A 2CZDA 3HIJA 3LX9A 3WK0A 4UTJA 3W3OA 3M41A 1OYCA 3M1ZA 1TTJA 2ZRVA 1GVOA 2YXGA 1ADOA 2VEPA 2ZZ6A 3DZ1A 4NXSA 3QPZA 2BWGA 3NQMA 4O54A 1YTKA 2YYTA 3RK8A 4NX0A 2C13A 3UD6A 3G24A 3TQVA 3N73A 4FNUA 5DBUA 4FXSA 3B8DA 2OMAA 1YYAA 2BXVA 2GUUA 1TV8A 3HQ1A 5LNVA 1QWGA 3LV6A 5CSRA 4JTFA 1Z48A 2ZFAA 3DFQA 1K7FA 1JQVA 3LRKA 4ZL1A 3UYCA 3GZ3A 4O11A 4RZ6A 2JGQA 1I2QA 3PC0A 4N6FA 4YCOA 3KX6A 3P5YA 4N9BA 2QCHA 2JBMA 2VENA 1H60A 5LHEA 3P8JA 1E51A 1PV8A 4GUFA 4JTEA 3ZFHA 3W1AA 3TJLA 1YTEA 4ICNA 2NWSA 1SO6A 3SECA 2B0MA 1G4PA 5K3VA 1KM2A 1TB3A 2E1DA 2JKEA 3W1PA 4CCDA 2O7SA 2CW6A 3HG4A 3T7VA 3A24A 1EA0A 4WQ6A 3S8HA 2R94A 3MI2A 2ZZ1A 4CNNA 3A5FA 1UJPA 4CNPA 4LW7A 3NQ7A 4O50A 5DCEA 2R91A 4JTTA 1SZNA 2X1SA 1K03A 4YXGA 5CPLA 1DBTA 1WBHA 3SW6A 3O06A 5K2ZA 5IBXC 3W7IA 4IMGA 5TIMA 3NGJA 1UBSA 1F05A 4C1KA 3LGEA 2WSQA 3OHIA 3SSJA 1NF0A 4LVDA 3G1FA 3GB6A 3PBYA 4W9TA 3L5LA 5FEWA 1Q6LA 3RF9A 2A2IA 4FIRA 3CIWA 5MHBA 1CW2A 4A22A 2H8ZA 4MZ1A 3EX3A 3W1UA 3W7MA 3P5ZA 1BTMA 3I65A 3DFSA 1RZMA 4O13A 5T26A 4LWWA 3PG9A 2ZCGA 1LOSA 2E5BA 4Z1CA 5FF7A 1JR1A 1TTPA 1ZAIA 3IV3A 2BTMA 3LM7A 4AVFA 4FNQA 3STFA 4KFNA 3GVGA 1EUAA 4XKYA 3SI9A 5C5YA 3W7GA 2QUVA 5TBOA 3BVJA 4DELA 3E12A 1N55A 1SO3A 1FUYA 2QDHA 4AB4A 5BMWA 4UFJA 2J24A 5D32A 4YMZA 3W23A 3DXIA 2G96A 2QCDB 3MYOA 3NZ1A 1R46A 5DY2A 1OG0A 4I7WA 3MHUA 4K8EA 5F2MA 2Q3RA 5D04C 1V5XA 3EXTA 1EUNA 2Y61A 1JCNA 4MY9A 2W0UA 3KVJA 2Y7GA 2WQPA 1FBAA 5E1QA 4A21A 4Z1AA 3W2LA 1WYIA 1I2RA 3LDVA 2Y89A 2XFWA 1SZFA 4MIMA 2QUTA 3BGJA 5DBTA 3NL6A 2ZA2A 1WBJA 3OIXA 4DF0A 3QQ1A 3NXFA 3YPIA 3O07A 4NNBA 5J5DA 3NPUA 4JYDA 4KKXA 4K6AA 3WJYA 3UWZA 3QEZA 3A5VA 4GC4A 2B7QA 1NAL1 3S5ZA 2W6RA 3GNNA 3G1XA 1TRDA 2EF9A 3MYPA 2VFGA 3A9IA 3G8EA 5I3HA 5HINA 2YDAA 5IM51 1YDOA 4IGHA 3RNDA 1SU5A 3E02A 5G4WA 3NM3A 2Z6JA 3LCWA 1MSSA 4MJZA 4MYAA 3DKJA 5D30A 4QNEA 2Y70A 4BI6A 4DO5A 5KZDA 3O15A 1VYRA 1H5YA 3L2IA 5D05A 3CWNA 2WKJA 1JCYA 1VQTA 4IX0A 3N34A 1JUBA 1H63A 3LI1A 4XKYB 4LS0A 4GRSA 4ADTA 5HUPA 4NZFA 1KLYA 4UTTC 1MZHA 3UXAA 2DZWA 4O52A 1SZEA 3HO8A 4LU0A 3F03K 2VEMA 3L5MA 4JTSA 2WOQA 4MY1A 4D2JA 4AEOA 1F73A 1L6SA 1VZWA 2RHGA 5LSMA 3N3MA 2E6YA 4LVBA 4IXXA 1KTNA 5AYXA 4QITA 3KRZA 3KRSA 3DFOA 4UNKA 1EB3A 3GR7A 4OGZA 1UB3A 2NLIA 2LLEA 3G22A 3LBMA 3KFTA 4KFOA 5U7SA 4E0CA 3MP3A 4XQ6A 3SR7A 5F4WA 4HIBA 5HR7A 1S5TA 4JDYA 5D2TA 1FXPA 2H8XA 3U8GA 1OJXA 1Q6OA 3MW7A 1Q6QA 3DU0A 4YWIA 5DLCA 2NWRA 3G1YA 1A50A 2DZSA 1PS9A 2YX0A 1XBXA 4RK8A 3IIVA 3VE7A 5D38A 1TRIA 3BGGA 3BARA 4YLWA 1W5OA 3RLUA 3STCA 3M5YA 4UTIA 3LCHA 2ZRUA 4ALDA 3LTYA 2YSWA 2NXIA 1AMKA 4RX0A 2BZNA 2EKCA 4MLJA 4OBTA 3W75A 6TIMA 1TV5A 2NXGA 1QOPA 3E49A 4I9AA 3NQFA 1EIXA 3T44A 3L9CA 3FJ6A 4ORIA 4UFMA 5I3KA 1JCLA 1VS1A 4UFIA 3LLFA 2C3ZA 4M7SA 1CI1A 4ZQNA 1PVNA 4WX2A 3N19B 4OV4A 2YFNA 4ZQCA 3C2RA 3EX4A 3FFSA 4CLMA 5D02A 3C3NA 1R2SA 5HMSA 3PY2A 3TV8A 5DCBA 2QEZA 1VYSX 3N2MA 3MHFA 3NM1A 1VJIA 4GXMA 3B4UA 1PE1A 5G1YA 3G8RA 1M7PA 1J2WA 3QZEA 2A0NA 3W70A 3PULA 3NZRA 5U4NA 1ML1A 1FWRA 1NFBA 3GKFA 4LUIA 5LNUA 1GVQA 1U5JA 3DI1A 4IPIA 3UPBA 1JCJA 5LZLA 2CFFA 3VNDA 1KV5A 2ZTKA 3ZR4A 1GG0A 3W1XA 4DPQA 2VOMA 3FYOA 3VE9A 3W7EA 1TREA 5LNSA 3IVUA 5CSSA 1QOQA 1K7EA 2IQTA 1MXSA 1GOXA 3QH2A 3CB8A 3TC7A 3P82A 4S2CA 2J27A 5DN1A 4M19A 2ZZ3A 2TMDA 3L65A 4AWTA 3Q2DA 1F6KA 1LBMA 3FLUA 3GXTA 3Q94A 1D9EA 2QUUA 4DPPA 4WY0B 3WJWA 4LRSA 5LGZA 2C6QA 2WJZA 3UWWA 3IIPA 4NU7A 3NNTA 1JULA 2NXHA 4O4WA 4PL1A 4LUJA 2A21A 1GPWA 4TIMA 3MJYA 3C6CA 4UMCA 1B3OA 1Q3NA 4MVAA 4JIPA 1DOSA 4LY8A 1PCWA 1K8YA 1TCDA 3W7PA 5CPNA 3FKKA 3PM6A 2NV2A 3I6RA 3KVLA 1O5XA 4JD4A 3NAVA 1A5CA 4MLRA 3PBUA 3EWUA 4GE8A 3W88A 5FF3A 4O0KA 2ZTJA 1ZAHA 3THQA 4NXKA 1I2PA 3IGSA 1X6UA 5G2WA 1MEWA 1LBFA 3VKJA 3OBKA 5IBXA 3FEMA 3M6YA 3R5EA 2GJLA 3TX9A 3O8AA 1H50A 5FESA 4AH7A 4POCA 4O14A 4FXRA 2CZFA 1KFCA 3P81A 1EX5A 4DF2A 2GQ8A 3SY5A 3TNOA 1RD5A 3CEPA 1O94A 3W7KA 1VLWA 3CT7A 1T8XA 3TR2A 4HPJA 1HG3A 5DELA 4JS3A 4R7JA 4GUGA 4GUIA 3LHUA 4N02A 1OFEA 2FB2A 1LROA 3EX6A 3NQ8A 2V8ZA 5BMXA 4IQLA 3NPWA 4AXKA 1R2RA 2VC6A 3R8RA 3BW3A 4XBSA 3TE9A 2P0OA 3OVRA 3PAJA 1TPWA 2QCCA 4WUIA 2ISVA 4FIQA 4EF8A 2V30A 4JNMA 2V82A 5SWUA 4QQ3A 1G7VA 1ME7A 2WNQA 4ADUA 4A2SA 4S2BA 1FCQA 1TTQA 3R13A 4PTNA 4AHQA 1HO4A 3B0PA 1LBLA 3M43A 1FCUA 3FJLA 3EKZA 1HTIA 1RV8A 1TPB1 5DXYA 3KRUA 1OFBA 2G95A 1T0OA 5AHFA 1B4EA 2ZBTA 4LS1A 3SFKA 2A6NA 1TTIA 4FX7A 4O1DA 4JTJA 2JGYA 1YXCA 3O16A 1UCWA 1OFQA 4OT7A 4O28A 2Z0IA 4WY0F 5KITA 4LOCA 3G3MA 3QM3A 5HNRA 1CX9A 2VEIA 5FEPA 2HTMA 2QR6A 3I68A 1P4CA 3KXQA 1RQBA 3TROA 1TIMA 2CZ5A 5EKYA 4LVAA 1EPXA 2ZZ4A 3HPSA 3QF0A 1I2NA 1W5PA 3SIZA 4ADSA 3BV4A
chains in the Genus database with same CATH superfamily
4HSNA 2OX1A 2ZRWA 4F8XA 4GY7A 1KA9F 3GDTA 3WLKX 4J3ZA 2C16A 5TAOA 4C91A 4K39A 3MZ2A 3W2KA 3UQNA 3DDMA 1EJVC 2C0AA 5HA7A 4GUHA 1JYNA 2VUNA 4HNCA 1JDDA 4C7GA 1H7OA 3M16A 3PWAA 2G3FA 1J6OA 1KV8A 1FWSA 2FFIA 5HNTA 2PD5A 2DSZA 3S1XA 3RMEA 4D72A 6REQB 2YR1A 3KCLA 1TX2A 1OD8A 3LRLA 4TVUA 1H41A 2C1HA 4IFKB 1GOIA 4KT2A 1HUVA 3CPRA 4WHBA 3V5FA 1D8CA 1XYCA 2GZXA 2WSRA 3USBA 1F3WA 4DJFD 1N8IA 4DO6A 1GHSA 4E5TA 4IIBA 2RJHA 3BOXA 2Y63A 4OQVA 3GHRA 2ZUMA 1V7YA 3R79A 3GW3A 1XXXA 3NEVA 3KCOA 4DNMA 3KOZA 2NUWA 1TJ2A 1KM6A 3W25A 4H8HA 3UCDA 1J0HA 2P5NA 3WK1A 2ZUNA 1QNOA 1TFVA 2VDIA 3CUHA 2YZ5A 3MMWA 4LUSA 1T40A 5I3IA 4IUOA 2BVWA 3RLVA 5F1VA 3H2CA 4B4FA 3CC1A 3ITOA 3PBMA 5FI8A 1I45A 1SO4A 1QI3A 4O57A 3OGSA 4HPNA 4E2VA 3W9ZA 2GPTA 1QAPA 3DN5A 4NT0A 1TQXA 3BLFA 3Q37A 4RDVA 1UA7A 3NSXA 2QPXA 1JEZA 3OGVA 1EBHA 2UY2A 2YW3A 4OHQA 2RDTA 2D69A 1GWJA 1PKYA 1Q4WA 4PRRA 2JF7A 3KAOA 3CL6A 1J12A 3BCFA 3ZSTA 5FSEC 1FDJA 1GZ1A 1PUDA 4BF7A 1SJBA 3RCYA 7REQB 1QDSA 4XVEA 3UT0A 4DEFA 2ACUA 2P53A 3WMSA 3V1PA 4C90A 1TG7A 1XLDA 4M1RA 9CGTA 2C7FA 4XD3A 3PPHA 2A85A 1GW1A 2VOTA 2GWGA 4EPBC 5EL1A 1N8FA 1ALDA 1ZLPA 5HNNA 2OOFA 2QAPA 3W2NA 3TWAA 1LRNA 3BH4A 3HPZA 3WLTA 3VDAA 3NUKA 4H04A 4RNJA 1GVSA 4QAWA 2ISSA 4M56A 1VC4A 3BWWA 3ZJ6A 1IZCA 5G1TA 3FW6A 1W5NA 3DH7A 4O4VA 3ONBA 4YPJA 4O1AA 2FTWA 4HHPA 1JQXA 4LQ1A 1MW2A 3R8HA 1XISA 4V27A 5BZAA 2J9XA 4QFUA 4O0ZA 1DE6A 4LPCA 1B1YA 3SUWA 3UERA 3P67A 4LC6A 2X2GA 3EDDA 4ENLA 4C6BA 3QV9A 3UXDA 3W84A 3HG3A 5KMYA 1HIZA 1XIEA 3QXBA 3DYMA 3MY9A 1GPFA 3F2BA 5BW6A 1PIGA 3ANYA 4IH3A 1EKOA 3QFEA 2OO0A 3CQIA 1RK5A 1CGVA 4EWND 3M0XA 1G9HA 3HA1A 1E6QM 1H3GA 3TSMA 4WDWA 4PYSA 1VFTA 3GAYA 1VFUA 1SW7A 2A3BA 4I8DA 5LYRA 1O5QA 4HBKA 4P5UA 2O7QA 2G8ZA 1PCKA 4GWEA 4C1LA 3VNKA 1KM0A 3Q58A 1TVLA 1LYXA 3TW6A 3GNDA 4PCFA 3LHWA 3HFYA 5H8UA 1C8YA 1YW1A 2VJXA 3ZWTA 1ZJIA 3AUJA 3GG8A 5EPDA 5IXEA 3CV1A 4AD3A 1IGSA 4Q7IA 3QMSA 2V67A 1W56A 3VM5A 1TX0A 1ITQA 5HWJA 2UY3A 1MFUA 1PX8A 2X16A 3RILA 1IIHA 4IGSA 5MKGB 2VWSA 3DKLA 1ZS2A 4H41A 2J7DA 4UTWA 5DY3A 4BQ4A 2OJPA 3VU2A 1MMFA 4TU1A 3GHUA 3LY0A 4JTLA 1HKVA 2PC8A 4YHGA 2YBUA 3H2EA 2DIKA 3LU2A 5EY5A 2YDQA 1GTEA 4RLIA 1SMDA 3UZJA 3MUAA 1K77A 2QCMA 1XL9A 1UMYA 1YNQA 2VRQA 3GXNA 4A4AA 1VCVA 3CT2A 3L0KA 5AB3A 5F4SA 4U4MA 3SRDA 1W1YA 5EBUA 3P61A 1JI1A 3HZ3A 4DJED 2BY0A 3FS2A 1XLIA 1XV8A 1OT2A 1IEWA 1WOAA 2E8ZA 1N82A 3SDOA 2PWFA 3LQLA 4GX9A 1GW9A 3W87A 3M6DA 3OW1A 3W72A 4DI8A 1RPXA 1E40A 4NAFA 4AHOA 2WBGA 3BAIA 2F84A 1UMLA 1Z42A 4S3EA 1UWUA 3DHFA 3FCPA 4I6KA 3T0AA 4UTFA 4E6MA 2X0SA 3GYEA 2JK2A 5GNZA 2WZMA 4QXIA 3SUSA 3EGJA 1D8WA 1A5BA 3ZT6A 1VHNA 3GVQA 3HGJA 1LLWA 3ITGA 2BOGX 2X2YA 3ATYA 3KVKA 4A8RA 1XSJA 5HJXA 1VCGA 1S3TC 2QUMA 2IKIA 1TR9A 2A6LA 4I9MA 2FDMA 3RR1A 1R0MA 4URIA 3IGHX 5AHLA 5D8WA 3BDKA 4DAIA 1WA3A 3CB3A 1SJAA 1XDMA 1H1ZA 2E0PA 3FAWA 3VILA 3BAKA 1UBPC 1DP0A 1PHQA 3N6JA 1RJPA 2POZA 3MA8A 4YS1A 4E4PA 1X7FA 1W1IE 3HQOA 1UZDA 5F2LA 3HFTA 1VIZA 3W07A 1RR2A 1U5VA 2HXTA 5A8QA 2W92A 1WP6A 2E40A 4H2HA 2BHYA 3BAYA 1ZALA 2J8GA 3IJIA 2QYGA 1IT7A 2VTFA 1XF0A 1M03A 1W17A 4WDXA 4JKMA 2DZTA 3BG5A 1G67A 4HNOA 1QNVA 1CDGA 1R9ZA 4GCAA 1YLVA 1LCOA 3LYEA 4EIVA 1YBQA 1SQ7A 1XR2A 2CESA 3LCXA 2HNHA 5G2HA 4GBDA 1XFCA 1CLKA 1XCFA 1KXHA 2O4QA 5A8NA 3O05A 3AS0A 4O16A 1I9CB 4B3ZA 1O60A 2ACQA 4TR9A 4PMOA 3VK5A 4LVGA 1BF6A 2CLEA 3WNNA 1ME8A 5C2XA 3URBA 3ATZA 3IS4A 4O18A 4HYWA 4MWAC 2QCNA 3MU7A 1HL2A 2WO5A 1L8PA 3TYDA 1QO2A 4CQ8A 2VGIA 1VF8A 1RLCL 4CQBA 1R3TA 3O6DA 3DFHA 2V5LA 3TJ4A 2O9OA 1B3WA 4AF0B 3OLGA 3MUY1 1M7OA 1A53A 1R6WA 2X40A 1FH7A 2I1OA 3E1F1 1NQ6A 4AF0A 1T99A 4GY1A 3ITTA 4FLQA 2E3ZA 2WMFA 1K9EA 1R2TA 3WCZA 3L21A 1QOXA 4NYYA 4BK9A 2DORA 3QSRA 3CTTA 2DW6A 5HANA 3O6YX 1NWRA 2PRLA 3T6CA 3OIHA 3W6YA 4QG6A 2OXNA 2DP3A 3VIGA 1OK6A 4UFLA 2VFFA 3GDRA 3UWQA 1YKWA 1ZP3A 3EMZA 1F74A 2GK1B 2FVLA 1I75A 1VH7A 3DX5A 5E6ZA 2WV8A 2Z00A 4C6FA 3R0DA 5HWNA 5E70A 4CU8A 4DXXA 2GYIA 3WQPA 4IPLA 3AHTA 3W7RA 4PUKA 1NF7A 1YDNA 4LAOA 5K7JA 3NOEA 4IOTA 2NT0A 4I5RA 5KSWA 1KFKA 2VFEA 3W7LA 5G2IA 3GM8A 4JIQA 4GK8A 1J0KA 3BJSA 1OGBA 2V3DA 1R7OA 3VNMA 3ZS4A 1QW7A 2C79A 1XYLA 2PTXA 1F3EA 1EO7A 4C6DA 1AW5A 1WUFA 1US3A 4AY8A 4RDYA 1LQAA 3H26A 4FB7A 2R6OA 1THFD 1K7XA 1BG9A 1V6WA 4TMBA 1SYTA 4F9DA 3ZXWA 3PAOA 4FP1A 3MWAA 4F0KA 1UD2A 4H6QA 4AWUA 1TA3A 2Y5EA 1TELA 3C0LA 4AHPA 1A3WA 2JIEA 1IWPA 3AHZA 5C8BB 3TUUA 1C7SA 4R3UA 5A2CA 1RJQA 2GOUA 4BHYA 1LQ2A 2CC0A 4WSJA 1YPXA 1HVXA 1IXNA 2P1FA 4NJIA 4AIOA 2I5IA 1CXLA 2JALA 5A1AA 3WFAA 1LJYA 1ZTVA 1TPVA 3L4YA 1E6ZA 3WQEA 1JPDX 2R24A 5A2AA 2QQ6A 2BSLA 1FP8A 3N9RA 4O15A 2ON3A 4QSHA 2FH6A 1CIUA 5GPRA 2ZUSA 3BPWA 1AL8A 1G5AA 1B9BA 1O6IA 2W9MA 5IHSA 3LZ5A 1Z9AA 2VDGA 3SZ8A 1V3JA 2G97A 3CEUA 5DRCA 3TP4A 3FGCA 1J0ZA 2RDWA 5G5IA 3VX1A 2BXYA 1GOWA 4W87A 4EXQA 4E8DA 5LKYA 1BG4A 3NVTA 4H4IA 3G5EA 3AYTA 3U4FA 2JFEX 3VOJA 4WJ8A 4UCFA 4DX3A 1B0IA 3CL8A 4LT9A 4CD7A 1W1A1 4UWMA 2EEXA 3VDGA 1C92A 1ZY9A 1TKKA 4MY8A 8TIMA 4DJEA 1MQPA 3OP2A 4REQA 1LT8A 2VFHA 1A0CA 1W3TA 3C61A 2ZXDA 1J79A 4TX9A 1XLGA 3GUWA 3MMDA 5JMUA 1FKXA 3H53A 1J5TA 3OVQA 2V3EA 2OOGA 1QT1A 1BYAA 2HVMA 3QOKA 2J9YA 3HMJG 3E0WA 1EC8A 4CCEA 3LPFA 3NL5A 1JF5A 4IG2A 2YA0A 1Z44A 4HPHA 2PTWA 4WKHA 5LNWA 1KGWA 3WQOA 1H1NA 3A47A 4JL2A 3N6HA 1ONEA 1P1XA 3R12A 4YTSA 4FNTA 1KCZA 3C86A 1SGJA 4QLLA 4M24A 2NQLA 2FZNA 1VJZA 3MVTA 2JQXA 1QI4A 4KCWA 4WGHA 4EVZA 3UYIA 1HZYA 2QCLA 3QW3A 5CG7A 1KBKA 4N9DA 2P0IA 4RDZA 1EQPA 3TWBA 3RCMA 1SFSA 5HULA 2PF8A 4MKNA 2ZUWA 1V08A 1XDLA 1Z32X 1D3HA 3F4NA 2ZRZA 5EMUA 1GOMA 2V63A 3G2GA 8CGTA 2CZVA 1NARA 1C8XA 3G1RA 2Y7EA 2V68A 4JAWA 4XISA 3P3BA 3VIJA 1V0LA 3M0YA 4PUDA 3BLOA 2O9TA 2HVNA 3PUOA 3S5OA 1MWOA 1SM9A 4FOUA 4R7WA 3VD9A 3AALA 1E1CB 3FK4A 4JXCA 3RPDA 1JDFA 1E70M 4GQGA 3EWDA 3G1VA 4EANA 1Z41A 5AVHA 1BWVA 2GDUA 1OZQA 4MB3A 3C0JA 3W76A 4ZODA 1S3HA 3E5BA 4WK9A 3WX7A 4K7VA 1TYGA 1AJZA 3H2NA 3WUEA 3B06A 4CCZA 4NYUA 1JJKA 1K8XA 4ZR8A 1V3KA 3WF0A 1H62A 4W8BA 1DJNA 4GZEA 4BI7A 3U7BA 3W7QA 9XIMA 2XVGA 4UFHA 2D22A 2DIJA 3AMGA 4KESA 2VZOA 1BSLA 3OYZA 3ZOAA 1IT0A 1EJUC 3MCOA 3W1NA 1GYNA 1AQ0A 3EOOA 4UR7A 2H3DA 1X8FA 1JD7A 5BNKA 3C8NA 2XN0A 1Y5WA 3QR3A 1R86A 4QIUA 5D9OA 4QHRA 4HPXA 5B80A 5C71A 3B0UX 2PWVA 3NQEA 1W3JA 1WOBA 3U57A 4JX4A 2QUNA 4P7NA 2JEQA 4GG9A 1U30A 4JX6A 2BOEX 2WC3A 2IQDA 2QVHA 3RU8X 4K1WA 3GIYA 2X30A 5FJOA 4XO7A 3ARPA 1D3GA 3OLDA 4IM4A 3W7DA 2QDEA 3UWYA 4CNTA 3FN9A 1O1ZA 4QJ4B 3QQ0A 4IFRA 1WKYA 3NR0A 1ELSA 3EB2A 1M7XA 3W38A 1O5RA 1HNYA 2ABAA 3S5YA 5E9AA 3VD4A 3ZIZA 1GOKA 1H7XA 4RR4A 5GJNA 1TWIA 3H54A 2PF0A 3UA4A 5ABFA 1QPQA 4NASA 1JZ2A 5C9ZA 1UIPA 1HJUA 4QM1A 4RE3A 4W7VA 4B9ZA 4J40A 3R11A 3TIMA 1E6NA 3AYSA 2QDGA 1EH9A 1OFRA 3H4XA 4Q8VA 1MZRA 5KZMA 4RDWA 1WAUA 3ITYA 1F6YA 4KWUA 2IKGA 1XBVA 4NP7A 3RUBL 1F3XA 4A8LA 2WYSA 4H8UA 2GJRA 1O5KA 4UQAA 2CHRA 4K2SA 3DENA 2OVLA 4GVGA 3TJXA 3PB2A 1Q6RA 1VBGA 3WJXA 4F2BA 1E15A 4Z2IA 1B54A 3LV5A 1UD4A 3WMBA 2GJXB 1JFXA 1U2YA 4HU0A 2WVTA 1EP3A 4JYFA 1KM5A 3T55A 5C7VA 4L4PA 2DJXA 4BR1A 1DHPA 1SUXA 4P7OA 3EWBX 1DJHA 3UU0A 3EKGA 3QYSA 2YA2A 3WQGA 1CTNA 3WBEA 3U2EA 4EXBA 1C93A 4GZJA 1SSDA 5D2VA 1G4SA 3WK0A 2XSBA 3W3OA 3M41A 3VO0A 1JZ8A 2EXOA 4PMYA 3M1ZA 4BEQA 1FWEC 4LAMA 1XLCA 4NXSA 3S9ZA 3ARRA 1YTKA 4DI9A 3B9NA 3CZ8A 3TQVA 3AIRA 5DBUA 3N2CA 4J3UA 5HNUA 1YYAA 2F61A 4XD6A 3HQ1A 4JTFA 4X61A 3WNKA 1JQVA 3LRKA 4ZL1A 1FWBC 3UYCA 3VIIA 1I2QA 2IXVA 3AIWA 4N6FA 3P5YA 4NG3A 5AZ0A 1E73M 1U1JA 2ASHA 2PDMA 4GUFA 4ZTYA 3TTOA 3ZFHA 2WXDM 2Z7KA 4ICNA 3KWSA 3OYXA 4HZ8A 5K3VA 5C9UA 5FD0A 3WYZA 2JKEA 3WQ4A 3KL5A 3SRHA 3HG4A 1TA3B 4LEFA 1CGUA 1XH2A 1TR1A 2H9AB 1BQCA 2QGYA 3S8HA 3ZYZA 4CNNA 3APGA 1VBJA 1IQ8A 3E6EA 4P8VA 1EQCA 5LIXX 1ODZA 1GVIA 4JTTA 3T08A 1J18A 2VCCA 3OODA 3SW6A 3F4DA 3NFUA 4AZCB 3NGJA 1KCLA 3GC4A 2BFGA 3OQEA 4O1FA 1F05A 3M0HA 4C1KA 2VD9A 2WSQA 5E0CA 4XD5A 3AIEA 3SSJA 1W8GA 1LWJA 4GQBA 3PBYA 3FYYA 5I6SA 4XB3A 3KBSA 4MUPA 1FOBA 3RF9A 2A2IA 4GFIA 4FIRA 3CIWA 4F2TA 2WHKA 5MHBA 1CW2A 3PFRA 4Z2KA 3WZ0E 3P5ZA 5T26A 1UROA 4O13A 1E9ZB 1OIMA 3NOYA 1V77A 4HMCA 3PZMA 2HBVA 2E5BA 4Z1CA 3AWNA 3IV3A 2J77A 1SVDA 4FS9A 2R1LA 3SCOA 4LALA 3W7GA 4L9XA 2QUVA 3GQYA 3M46A 3BVJA 1N55A 3ABXA 1US0A 2CBUA 3JZEA 4JQ4A 1DJIA 4YMZA 3W23A 1WPCA 2ZXAA 3MYOA 1OG0A 3RG6A 3FDGA 4K8EA 2Q3RA 1CCWB 2VQUA 3RM8A 1R8LA 1KC7A 3STPA 3UVIA 3CO4A 3KL3A 3FXYA 1XWYA 5E1QA 3W2LA 1I2RA 1KO0A 3BGJA 5DBTA 3OIXA 3VMNA 3T0CA 1UD5A 4Y9MA 2ZX5A 3O07A 4X60A 4JYDA 4KKXA 2A3AA 3WJYA 4GACA 3QEZA 1QI2A 2EG6A 2ZIDA 2W6RA 4ZB0A 2EF9A 3MYPA 3RXZA 1OCQA 2NQJA 5IM51 1UQZA 4IGHA 1SU5A 3NM3A 2Z6JA 4GI6A 3NDYA 4MYAA 4GO9A 2X7VA 3DKJA 3TVAA 1OT1A 3O15A 2AOSA 2QGHA 1X97A 5D05A 3RLGA 3ZJ8A 4DJFA 1E1CA 4IX0A 1JUBA 2WMHA 3K8LA 3H21A 1KLYA 2OU4A 4MMWA 1T7LA 2VD8A 4AEEA 3HO8A 4AY1A 2VEMA 4D2JA 4WKFA 1L6SA 4IIHA 4WDTA 2RHGA 3BGAA 3N3MA 4IXXA 3NGFA 5AYXA 2VR2A 4M80A 3ZO9A 3KRSA 1AH0A 2J74A 4UNKA 3PJUA 4H8NA 3GR7A 1YMYA 2LLEA 5HQLA 1F07A 3LBMA 4HJWA 4KFOA 4E0CA 4XQ6A 5LIYX 3PZQA 3T05A 1KXVA 2HK1A 4JDYA 4M51A 3ZR6A 3CPUA 1ITCA 4YWIA 3DU0A 2NWRA 4L56A 3G1YA 1JYWA 1FRBA 1A5KC 2FZ8A 1XBXA 4EACA 2QIWA 4YLWA 3AFBA 4UTIA 1TWSA 3DG6A 4GYFA 2ZADA 3W82A 4PCPA 3WQ6A 2XYLA 2NXIA 4KMQA 3GC5A 2EKCA 4LCQA 4MJ2A 1XRSA 1TV5A 1ZPTA 4XV0A 1DWAM 3NQFA 1PKLA 3T44A 1GVYA 4XVDA 4B5UA 1VS1A 5F7UA 3L4TA 4UOJA 5JH1A 2XM1A 2MANA 3EMQA 1B2YA 2C3ZA 2Z27A 4Q4PA 1CI1A 3PPCA 1XSKA 1V02A 2YFNA 3APYA 3FFSA 5FJIA 4DZIA 4CLMA 5D02A 1LQ0A 3MKVA 4NRRA 3FJNA 2EBNA 2BHZA 1EYWA 1RH9A 5BOEA 2YCKX 3CUXA 3ZQ9A 2UZ9A 1KBLA 1GJUA 1WZLA 4CNSA 5G1YA 2W91A 2A0NA 4FSAA 3W70A 4DWSA 3PULA 4QCFA 1WKDA 1NFBA 4LUIA 4RE4A 3ISIX 4IPIA 3VX0A 3ZR4A 1GG0A 3VE9A 1MXDA 4IMAA 3WD4A 3N4FA 1AQMA 3IVUA 1QOQA 1M41A 1S5MA 3WQDA 5DN1A 2ZZ3A 2PPGA 3KCJA 2G4FA 1IE7C 3BUVA 2QUUA 4DPPA 4WY0B 4LRSA 3ARQA 1L6GA 4GQQA 3IIPA 3R0KA 3VCCA 4PUJA 4KERA 5A6BD 2P76A 3RM9A 1B3OA 1Q3NA 1OEPA 4MVAA 3B4YA 4JIPA 4CU7A 1K8YA 4PMXA 3W7PA 5IOBA 3N13A 3VUPA 2NV2A 3KVLA 1RUSA 3ALGA 5CBJA 3TYEA 4MLRA 3EWUA 3W88A 5FF3A 4NXKA 1P6WA 5DFAA 1I2PA 4C6CA 1X6UA 2DV0A 2V38A 1LBFA 1MNSA 1XLKA 1A47A 5IBXA 3ES8A 1GHRA 3GTXA 3KBWA 3R5EA 2GJLA 4G8TA 1NP2A 1NWTA 2F9RA 3WH8A 4I9TA 4DF2A 4CD6A 3BOLA 1B3YA 3CT7A 4NKCA 2DT0A 4CQCA 4HPJA 2PWDA 2DSVA 2VI0A 3LHUA 1J8VA 4IQLA 2QZRA 3QTPA 2WZTA 3BW3A 3OVRA 4WUIA 5HQMA 4OKDA 4GX8A 3R6IA 1G7VA 1XS2A 3U5YA 1E55A 3R13A 4PTNA 1HO4A 4U5IA 4J3XA 3M43A 3ZLHA 1W32A 1HTIA 2C91A 3BC9A 3KRUA 2BVDA 1K9DA 3O3RA 2G37A 1RXOB 2YL5A 3VOGA 4JTQA 1LUCB 2IS7A 2VP8A 2OYMA 3SFKA 1F4HA 1J93A 2QNEA 2YXXA 1X6LA 1A80A 3G3MA 4S23A 1TE1A 1CX9A 2HTMA 3I68A 4W8LA 4Q6XA 2GLKA 1RQBA 2FMNA 4D6JA 1DWFM 4LVAA 3HPSA 3UXIA 4ACZA 4KW2A 1W5PA 4B2DA 5LA0A 3BG3A 3VFLA 2ISWA 1QPNA 5TNVA 5EB8A 1TVNA 4GGBA 1ZBKA 4XAPA 2HZGA 4JY8A 1UZ4A 3JS3A 4KCUA 2ZYFA 3CAKA 3N14A 2FTYA 3PUGA 3VOCA 1QFEA 1V0KA 1POJA 6ALDA 4GHRA 3U6WA 1JYVA 4O10A 4QS6A 2XZ9A 3E96A 1Q6FA 3HN3A 2Z7GA 2PA6A 4XTIA 1DWHM 1YTDA 3TDFA 3WBWA 3F2CA 1X98A 5TF0A 3WN6A 3TYBA 1FDZA 5KEZA 3CV7A 3VYLA 3IPWA 2Y88A 4NY2A 3FNDA 1HL8A 3SIMA 3BLKA 4MUZA 2V81A 2OEKA 1PZ2A 4U28A 1UP0A 3QY8A 5BCAA 4AAJA 3VOFA 5CBIA 4XTDA 3EWWA 3GW0A 4IPJA 4X2PA 2EJAA 2J9ZA 5A6TC 2XFFA 3B8VA 2DZUA 1W8SA 2IW0A 4GVHA 1S1RA 3W2JA 1R9YA 1XGDA 1XRFA 3W7NA 4DM2A 3N2OA 3QZ6A 4NJKA 3PUDA 1CWYA 2R8WA 4HZ6A 5L9FA 4MYXA 5DO8A 4AZBA 4U3CA 2VRKA 2OWWA 3OBEA 2Z1KA 1R3RA 3GC2A 1IZJA 3K4AA 5EA9A 3BZGA 2PP0A 4C6PA 2AKZA 3DFPA 3N2XA 4DQWA 3BANA 1J11A 4WSKA 4W8AA 3W7HA 3SGZA 4Q8OA 1ISWA 1QNRA 5HWMA 3O6CA 4I90A 4LUTA 1EP1A 4CGTA 3H12A 1UWIA 3NSNA 2ZDSA 3W6MA 3P93A 3WY1A 3I6TA 2DH3A 2V69A 2ISFA 3SQLA 3G0UA 3DHPA 1BAGA 1UOZA 1Z3NA 4Q8PA 4P61A 3TC3A 2GVGA 4FF5A 4P8UA 3S5NA 3I4EA 3S46A 4CD8A 4GVFA 3QGKC 1FCVA 2MUCA 1NQKA 5HMDA 1Z89A 3FIGA 4ZVJA 2VXNA 3WBAA 3HJEA 1BVNP 4IJCA 4GOAA 2FHCA 4XZHA 3U48A 1H5VA 3WMLA 1M68A 4QSFA 4GZIA 3S5SA 1LRTA 3H24A 1XLMA 1X96A 1B3XA 5BRBA 3LHVA 4TOQA 4Y8EA 1A4MA 2IXUA 4PFMA 2BNJA 5JIPA 3K30A 3F5LA 2W61A 3WQ5A 1XYZA 1E4IA 4EF9A 1GORA 4RXGA 3OZOA 4O1BA 5BXTA 1L9WA 2PUZA 2YYUA 1HJQA 1EEPA 4KGJA 1JPHA 5JQ9A 3HG5A 4PZVA 3W1MA 3E0VA 4F2UA 1N2VA 2E09A 3CWHA 2Q71A 3W7CA 4L80A 4NF7A 2A3CA 3S1UA 3AUOA 2P88A 1BSIA 4U10A 3TXVA 2WSYA 3WEZA 3B0XA 4GKLA 4K37A 5DMMA 2HWGA 5GNYA 4HD5A 1V6XA 2E68A 4MDOA 2EJ1A 1E72M 1N7KA 1ZJBA 3H4WA 4N4QA 1TMHA 1VAHA 3N29A 1JD9A 5IFTA 4FOKA 4KCVA 4KCTA 3HQNA 2D2JA 3OPSA 4HNUA 3P84A 4H9MA 3A64A 1RCQA 4L4MA 3ENLA 3N9SA 3WSUA 1J5SA 1TZ9A 2GQAA 3GWQA 2WKGA 3UA3A 4ACYA 3JRKA 3B0VC 3I3BA 2B7PA 2WCSA 1CXKA 1BKSA 4RJEA 1ZU8A 3KHDA 4QBXA 1ISXA 3CHEA 1Z6KA 2A3EA 3NQGA 3WK3A 2Z28A 2OQLA 4JTGA 2QCEA 3V7PA 2YLAA 4GVIA 1U22A 3KDNA 2PGFA 3P60A 3QKZA 4LF1A 5EMKA 2WPGA 2R14A 3M7WA 1UWQA 2PCQA 3P80A 4X9SA 1ICQA 4PB4A 4UR9A 4C1NA 5BROA 3S9IA 3OTRA 4B3KA 1C3FA 3VIFA 2FZ9A 4JHOA 5D09A 4GI8A 5T8GA 1E3ZA 2CBVA 3L0NA 5CGTA 4F0MA 5FAJA 5AECA 2X1TA 4UIOA 2YBTA 4YVVA 1VBRA 1FWGC 3PZOA 1E1FA 3SCUA 3AO0A 1K4HA 2VKZG 1XH0A 4AZ6A 1SO5A 3N12A 4OBSA 1SSGA 3K1GA 4HMEA 3CUJA 2C18A 5EGRA 1HKKA 1OWQA 3WLNA 4JN6A 1MUWA 5A69A 3XINA 2XFRA 5H91A 3TMQA 2VEKA 3WH9A 1G6CA 4LYRA 3EX2A 4QNWA 4LV4A 4YTQA 1JF6A 3GKAA 2ZWZA 2B31A 2X0HA 1I4NA 1G94A 4PBEA 1A3HA 1K1DA 1VEOA 3PS7A 4N6EA 1IZKA 3P62A 4XD4A 1W1ZA 1CZ1A 4L9ZA 4GH1A 2ZUVA 5E93A 2C14A 2V5DA 5D33A 4JTDA 2CXGA 2V0TA 2WCGA 3UG8A 4H00A 4MJ4A 4D8LA 3OEXA 3VC5A 3UFYA 4B3LA 7ODCA 3GDLA 2Z1SA 2HE5A 1AH3A 3LNMA 2VR4A 1Z7AA 2NV1A 1LTDA 1FXQA 4YL2A 3UP8A 4B92A 2CZEA 4WZHA 3PANA 4JTUA 1UWTA 1H4PA 3LUTA 2WWDA 3AMKA 4L61A 1VFFA 1E56A 4D8AA 3FXGA 2WMJA 3BSHA 4KWOA 1HKWA 3U0HA 4RXFA 1LZOA 3WNLA 4D6CA 4IMEA 1RP9A 3SGGA 4Y8FA 4LX4A 1YADA 3C4UA 3MO7A 3VZXA 2UBPC 2W4XA 1BXNA 2TAAA 1Q63A 4UQ9A 3WBXA 3A4XA 3CH9A 3QHNA 3UWVA 3ZSSA 4HA1A 2V2CA 3R0UA 2CNCA 3POCA 3K5XA 3WLPA 1FWDC 4G9PA 5HPOA 1R47A 5JU6A 1SMAA 1TJ1A 3MSRA 2VELA 1L6FA 3KLLA 2EPHA 2AAMA 1HX0A 5CEWA 4KF1A 2C1GA 3WD2A 1DPMA 6CGTA 1E71M 2FPVA 1KM4A 1ICPA 3ZR5A 1HQTA 3WJZA 4ZO8A 3SUTA 1AD4A 3CK5A 1ADDA 2PDBA 2ZVRA 1HJVA 3LHTA 4PH6A 5CC3A 4EAYA 3W26A 3WQFA 4QGCA 4KWVA 1T41A 3VVGA 3VNLA 1JCXA 4AYGA 1RHCA 1NOWA 2JKPA 5HJLA 1OFPA 3VNJA 1C90A 3U9IA 5I3JA 3EZ4A 4PRWA 3B40A 3FEQA 3PZNA 3TXZA 3UPMA 1DVJA 3V0UA 2HBXA 1KR1A 1GVFA 1S5NA 1XQKA 4MF4A 2QKFA 4GMEA 3UZYA 1ZFJA 6XIAA 1ZQ5A 4W7UA 3N1AA 3OBAA 4MB5A 1VR6A 1ZL1A 4ZE5A 4E2BA 3C2FA 4J7RA 3L2MA 3N2TA 3IK4A 5DT7A 4H3DA 3MC5A 3E2SA 3GK0A 4J2PA 1O4UA 5BWAA 1NY1A 1QO5A 3NSMA 1WX0A 1KB3A 3W2MA 4JTCA 1DJQA 1QASA 1TV4A 4NX5A 3T9PA 2WWCA 1KW1A 1VJSA 1TPEA 3PPGA 5J8LA 1A0EA 3SBFA 3ABRA 2ZUUA 2ZWYA 3A3HA 1IWBA 4KRUA 2XFYA 5AKQA 4ZOBA 1KRCC 5D03A 3M5VA 4JFSA 1FHUA 1OABA 1B90A 3TQPA 4IMFA 2XJ7A 5AYYA 3VGBA 5D9PA 4LB3A 1AK5A 4FXFA 3PG8A 3HPXA 1JPIA 3RU6A 4N4PA 5CC5A 4C5ZA 1XUUA 3DHUA 3LI0A 3QW4B 1OF8A 3ICJA 1Q7ZA 3KW3A 4RV8A 2QV5A 3MBDA 1ZAJA 1VBHA 1H09A 3DG7A 5AC8A 1XD1A 4LANA 1VYPX 1Y7VA 4HT3A 1SR9A 5M3WA 1YXDA 1E6XM 3H22A 2VMFA 1TJPA 1UWRA 5A8MA 1X6NA 3WO8A 1F76A 1LLOA 1OD0A 3GU9A 3GYCA 2TPSA 3NQBA 2BXZA 2QXWA 3KOWA 2XINA 3ORWA 3W1QA 3ARZA 1K02A 2YBVA 1VHCA 2HS8A 5LIKX 5C2CA 3OQ8A 2PDJA 5BOOA 1O95A 4LUYA 1TMQA 4G2DA 3VNYA 3LZ3A 4NZCA 3LCLA 1DQXA 3ITVA 1FX6A 4S38A 4ZMGA 4AMAA 1NFGA 2ZC1A 3U5UA 3ECQA 1Y65A 1JAEA 2VL4A 2REQB 3CHFA 1O66A 1A49A 4IXHA 3ZM8A 1TV7A 3NYDA 1M65A 1V3IA 1DORA 3S2MA 3V5CA 3AAMA 2G3NA 3PWIA 1KLZA 1CGTA 1P7TB 2G41A 2VT0A 3RMJA 3U2OA 3W2UA 3FSUA 3H7VA 1UASA 1SJCA 3BAXA 3G6MA 4QQUA 3PBWA 4WOQA 1QATA 4GNJA 4UTLA 2DT2A 4BI5A 1A5SA 4GI4A 1VLIA 2CHNA 2VCBA 4UTMA 1TSIA 1KRAC 2FYMA 4UTWC 3GO2A 2J88A 4IMCA 4QCEA 1RLDA 1BVWA 3T2OA 3CL7A 4D6GA 1V6TA 1XLFA 2I16A 2E6FA 4KBXA 3UETA 3Q67A 4DLMA 4PMUA 4Y9AA 4KEMA 3NWRA 3G0XA 3MV11 4NJJA 1LOLA 4YCPA 3REQB 3KTXA 5DCDA 3O0FA 3C52A 3D5HA 4J1OA 4GI9A 3GR8A 4ICMA 4AW7A 3RRAA 2W79A 4LAUA 3QLLA 4HZ7A 4JIIX 2NLYA 2WLYA 3AMCA 4S3DA 4A3UA 2DT3A 1ENUA 1JUEA 1OFOA 2ZX8A 1D2KA 1TE6A 1J0YA 2PDCA 3A4WA 1AVAA 3CIXA 1YPIA 3COTA 2C71A 2DSWA 3NQ2A 2YB1A 2F6XA 1GYLA 3PZ9A 4QDPA 2XN2A 1ZCCA 2YL6A 3AQUA 3EX1A 1K70A 2VO5A 1SJDA 3MSYA 3ANUA 4MZ8A 4UCGA 5D37A 4O1EA 4JN8A 1HXJA 3L0GA 4ZQOA 5DF0A 2J4GA 3S6DA 1XIDA 2IPGA 2PP1A 3NDOA 4X22A 4IL2A 3M9YA 5CGQA 2AQWA 5CPMA 1EJTC 4OWGA 3LLDA 3MB9A 3W02A 5EYWA 1EJWC 4V2XA 1KFBA 1FCBA 3VOHA 4P2VA 3EB3A 3O6AA 2DVUA 3UPWA 2XTKA 4GD0A 3W74A 5GVJA 1OZMA 2B7OA 3S83A 2NVDA 1OF6A 2WSPA 4DJEC 3D0CA 5AN7A 2G4JA 4BWLC 4DZAA 1W37A 4BEUA 4DWDA 5IFPA 3HGRA 1FVPA 4F3HA 2DVTA 1I6NA 2FJKA 2PP3A 2PDWA 4B90A 1OADA 5H2ZA 5ECUA 3GTFA 3WMCA 2X1RA 4C7FA 3P8IA 4F0RA 1BYDA 4QP0A 2AGKA 1WQ5A 2BY1A 1KTBA 3NIYA 4PULA 1U5HA 3BW2A 2HISA 7ENLA 2Z1WA 2RUSA 3FGCB 3FKRA 2J62A 2XIQA 3ITLA 1JPMA 1XP3A 2H90A 1NTHA 1GZJA 1XFBA 1UJQA 3URAA 3H7RA 1AMYA 5EBAA 5A2BA 1PAMA 1M9HA 2ZA1A 4QJ1A 3WDHA 4P8XA 5I78A 1HKMA 3GTIA 5CZJA 3PPFA 1H2JA 3RIKA 5A6BA 1W9DM 5BRPA 4JFTA 3M0LA 4O8RA 1SZGA 1IEXA 2X05A 1RCXB 4I5UA 1UPPA 1XLHA 1RBAA 4UTKA 3QPYA 2A5HA 3EBVA 2A79A 3M07A 2E6AA 1OC5A 5I09A 1XYFA 4JCLA 1ZHAA 5BXPA 1CT5A 3UY7A 1PTAA 4OFCA 3CTLA 4NUWA 1Z8AA 1KBIA 1R30A 1GJPA 2QF7A 3ZWSA 3MDUA 4XBKA 1UWAA 3N6QA 1EGVA 4PGLA 4UQDA 1OVDA 1E5JA 1RJRA 4US6A 4ORMA 3E9AA 3LCGA 3G1AA 3G77A 2Q02A 3DGRA 1OX5A 2W66A 1Q66A 5CJ5A 1VP5A 3GXPA 4BWLA 7CGTA 1W3KA 2XVNA 2EPLX 1TPH1 3PTMA 2XSXA 1HFBA 2AL1A 4DN1A 2XM2A 3CLMA 4G1NA 3K8MA 3INPA 3RFAA 3T4CA 2NUXA 2DGAA 4I6VA 2AAAA 2E77A 2DQXA 4XZ9A 2NVCA 4WD0A 1MO0A 2CHOA 4EE9A 4AWEA 1FP9A 3IJ7A 3DFNA 4OJYA 3O1NA 3WKZA 5I02A 2ACSA 3VI2A 1BVZA 1VCFA 3C2VA 5JXQA 1TMLA 4E3TA 4UMAA 4HK5A 1ZB5A 3TLQA 3SEPA 2DZPA 1CXEA 4HNTA 5GQBA 4Q7BA 4W89A 3GU2A 1H49A 4PTDA 3SJ3A 1QK0A 1TJRA 1PSCA 2NQZA 1HP5A 4CEXC 4BFAA 1DJXA 3ITCA 4ICCX 1VFLA 4JX5A 2NV9A 3IARA 2CZDA 3LX9A 3AS3A 3CHDA 1OYCA 1C91A 1PBGA 2XWEA 3NZPA 3UJFA 1TTJA 1DQUA 1XPGA 2YXGA 4C5YA 2ZZ6A 1F61A 2Y8KA 3QPZA 2BWGA 5CLTA 3VKBA 4O54A 2C13A 3UD6A 3GD6A 1WUEA 1FFQA 2IUZA 2BXVA 2GUUA 1WO2A 1TV8A 5G4HC 4HN8A 7TAAA 5CPQA 5LNVA 3LV6A 3BLLA 3DFQA 4U3AA 3MUZ1 4RZ6A 2JGQA 4L1WA 3PC0A 1CXFA 3FA3A 1V51A 3BV7A 1UKQA 4ZBCA 4N9BA 4ZOCA 2VENA 3SRKA 3P8JA 3UCCA 1PV8A 4F0LA 4JTEA 1E9LA 1ESWA 4JNYA 1YTEA 5H8MA 3SECA 2B0MA 3EA1A 1KM2A 4TVDA 4ATDA 2Z29A 2E1DA 3CASA 4CCDA 1O1HA 3CPGA 4NL1A 1UR0A 2GOKA 1EA0A 5BU9A 3MI2A 3LG3A 3GXMA 2ZZ1A 1HKJA 4CNPA 3NQ7A 2NQ9A 1XG3A 4JEJA 2J7FA 2YCIX 4Q7NA 1RD6A 4O50A 2EKGA 4AYSA 2X1SA 3SCWA 3W01A 3W27A 1H11A 1E0TA 3QR0A 2E28A 3W7IA 4IMGA 2HJPA 1UBSA 1S38A 3RJYA 1ZGDA 1GK8A 4CVUA 2DEPA 4YTUA 3GB6A 2QPSA 3VGEA 2CBIA 3CUFA 4L64A 1TCMA 4F9JA 8RUCA 5JVLA 3T4WA 3KL0A 4MZ1A 2ACRA 5CLWA 5DMYA 3I65A 4E2OA 2VGGA 2PDYA 2HNEA 3PG9A 2NQ5A 5FF7A 1JR1A 4AZGA 4HHLA 4AVFA 4FNQA 4KFNA 3GVGA 1JXKA 2YCJA 1EUAA 4XKYA 3SI9A 3WLRA 5C5YA 2CYGA 1XCXA 2J66A 3PZTA 4DELA 2VEGA 3E12A 1SO3A 2OWCA 2QDHA 4AB4A 4XIMA 5BMWA 2J24A 2WMIB 4EAMA 2G96A 1NOUA 4CN1A 2XPKA 2XVKA 4P7QA 3LNPA 4TTGA 6TAAA 5EU9A 4ZXLA 2QLYA 5XIAA 3CZGA 3BSMA 5F2MA 3WH5A 1EUNA 2Y61A 5RUBA 4PCNA 2Y7GA 3UG4A 1WDSA 4ZSUA 4A21A 2ZKMX 3JZUA 3LDVA 4TV6A 2XFWA 1SZFA 3MDWA 1A5UA 4MIMA 4BA0A 1XYAA 4C6MA 3NL6A 4IGNA 4GIEA 3QQ1A 3NXFA 3YPIA 4NNBA 3AS2A 3UWZA 4HA0A 2QMJA 3A5VA 3CMFA 3WDQA 4GC4A 1NAL1 2Z25A 2E9LA 1EDGA 4HTBA 3G1XA 2OQYA 3RNDA 5G4WA 1P0BA 3LCWA 5AYIA 4GYPC 4GQ0A 4UQCA 5LIUX 5T9CE 4HOXA 1E9IA 1VYRA 8A3HA 4XZIA 4XKMA 1DJGA 4HU8A 2WKJA 2PWUA 3GSMA 4S3GA 5D4YA 2DUZA 4XKYB 4LS0A 4ADTA 4CQDA 5HUPA 4UTTC 5CC7A 2O9PA 2DZWA 4O52A 4BQ2A 4H7CA 4E4FA 4B5TA 4R7OA 4QDWA 4OUIA 4AEOA 1F73A 2HK0A 4F48A 1VZWA 3ZZ1A 1UP2A 5LSMA 4QITA 3S6TA 3BZJA 2IMRA 2IPFA 4KEUA 4KS0A 1UB3A 4UQBA 3KFTA 4IG2B 3MP3A 1WXZA 1FWIC 3EDFA 4CN4A 4HB7A 3KTCA 4EKJA 1DJZA 1OC6A 1OJXA 3PJXA 1UC5A 1A5MC 2VC5A 2QF8A 1EDTA 1I60A 1EJ7L 4NIRA 2YX0A 3N9KA 4RK8A 5D8ZA 3VE7A 2WSKA 3CLWA 4MB1A 3BGGA 2GSJA 3MCMA 4E8CA 3ZVIA 1ONWA 3MUIA 3WD3A 3STCA 5M5DA 4KH2A 1KD0A 3H2AA 2R1NA 4HCDA 4IGMA 1KXQA 2YSWA 3GFYA 2V5JA 4RX0A 3B9EA 3RCNA 1XLBA 4OBTA 4GIYA 4CNUA 3KUMA 1LL6A 4JFUA 3E49A 4I9AA 2YA1A 2FJUB 1JCLA 3WF3A 4S3CA 2VWTA 1JZ5A 3LLFA 1XW8A 2OLHA 3B9AA 4M7SA 2VGBA 1FHLA 1BD0A 2D3LA 1PVNA 4ZQCA 3HPFA 4PB5A 3EX4A 4AZ7A 3DC0A 1FFRA 3C3NA 4J27A 5AC4A 1R2SA 4HPGA 1AJ0A 3LMYA 5HMSA 3T0TA 3TV8A 1QK2A 3WF4A 3N2MA 1QW9A 2FZMA 4QE5A 2Y4SA 2PGRA 1PE1A 3K4DA 3G8RA 1J2WA 3QZEA 1LT7A 2FGZA 2XVPA 1ML1A 5LZLA 5CAKA 3VNDA 2ZTKA 3DGBA 4YVXA 3FYOA 2KAUC 3VC6A 4D8ZA 4ILSA 1HVQA 1NP0A 4HOWA 4RZBA 1K7EA 1ONXA 3TR9A 1PWMA 3MKCA 3CB8A 3SQMA 4AWTA 1BQGA 2PTDA 4KEVA 1LBMA 3FLUA 3GXTA 3Q94A 3THUA 4B5XA 5FAGA 3WJWA 3IACA 3HPAA 5EMYA 2WC7A 5I79A 3GY1A 3K4WA 1REQA 5H1WA 3J7HA 4W93A 4XZWA 4PMNA 1UZHA 2YCLA 3K8KA 1PCWA 4LUSB 4UOZA 3AYRA 3NCOA 4KIEA 3D46A 3FKKA 3I6RA 2J79A 4NI8A 2X0YA 3QPEA 3NAVA 1A5CA 3PBUA 1RALA 2XHYA 3L23A 3THQA 3JVAA 1VPQA 5G2WA 1MEWA 2CITA 2WVSA 4C6JA 3VKJA 3FEMA 3M6YA 3BMVA 5TD4A 2WZEA 1H50A 2A3HA 3VPLA 4FXRA 4B5VA 1T8QA 1CEOA 4KETA 3SY5A 3TNOA 3CEPA 3U3HA 3L7RA 1IR1A 4D1JA 4KIRA 1HG3A 2HE8A 1KWKA 4AIEA 3EX6A 4JQ1A 3GBDA 3NQ8A 5BMXA 4AXKA 1R2RA 2VC6A 3WQWA 4XBSA 3WNPA 3AXHA 2P0OA 3OZPA 4EF8A 2ISVA 1BXCA 3AMLA 3F5JA 4LH8A 4ROQA 4Q8WA 3A9BA 1VFHA 3FJLA 4RW3A 3AIUA 3ARXA 3TN4A 4AD4A 3ARYA 4LS1A 4JKLA 2W67A 2PDNA 3R25A 1KR0A 1UR2A 2JGYA 1YXCA 1PYFA 2DUXA 1E43A 1GJWA 3I6EA 4OT7A 4O28A 4LOCA 1E0XA 3QM3A 1A0DA 2VEIA 2C8NA 3DIPA 2QV4A 3EOEA 3PJWA 4X0NA 1QNQA 1RK6A 3TROA 2WNWA 3BJFA 2J78A 4HK6A 4BQ5A 1O12A 5EKYA 4GA8A 5LA1A 3PFMA 1W1PA 3V35A 2WZHA 2ZZ4A 2AKMA 4NZ1A 3PTQA 3ME3A 3SIZA 3RPTA 3BV4A 3B8TA 1J10A 1KFLA 2Y6ZA 3TW9A 1C9WA 1S2AA 3MCNA 1TPC1 1DWIM 4DXVA 1UR3M 3R89A 4I8YA 1YRRA 4ZB5A 2ICSA 3EAUA 1FH9A 4ZZ9A 2MNRA 2RDXA 3H2OA 4UTUA 2BGQA 3H2FA 3NURA 4L1GA 3LMZA 1G69A 1BEUA 3T0DA 1QI5A 4JDBA 5CZ0A 1EWEA 2CPUA 4V33A 3UBPC 4IP7A 4O17A 4CQAA 1AD1A 3A6OA 3M44A 4P8WA 4PUMA 3GX9A 4UNLA 5AOUA 2C19A 1JDCA 1DIEA 2BB0A 3GDMA 4MWAE 3SB0A 1HL9A 2J25A 4PEKA 3C0QA 3ABZA 4LRTA 4LVFA 1RPKA 1M5WA 3G1HA 1WZKA 3TAOA 5I3DA 2INEA 4I5XA 3TK7A 3IJDA 5FKYA 3MJMA 2XIBA 1PIFA 2YB4A 3T07A 3QMTA 1JGMA 2OKOA 4TTUA 3THAA 1GT8A 3IEBA 2PDPA 4PFHA 1GOQA 3MP4A 3T42A 4M3PA 4X63A 1QCWA 5DXXA 5AHEA 5AC6A 3WNMA 5HPCA 4C6KA 3E5PA 2HMCA 1ME9A 4IIDA 4WXZA 4EOUA 1MW1A 2ESCA 4M6VA 2RFGA 1K6WA 4BS0A 3C3UA 2WLZA 2IQ0A 3IIZA 1UW9A 3HF3A 1ITXA 2AQVA 4QX4A 1V3MA 4FNRA 3GH5A 1TUFA 3VNZA 3AWOA 3STGA 5F2IA 4DUVA 1XICA 1LG2A 3IGXA 1K3UA 1IYXA 3I10A 1TZ7A 1EF3A 4F0SA 3V18A 4AUBA 4XSLA 4DO4A 2FPTA 4ZFMA 1UWSA 3TSDA 4GC3A 4LB4A 3PTDA 1P43A 2ZQ0A 2XIOA 2NT1A 5K9XA 1NEYA 4H9VA 3GHTA 2GQ9A 5K4ZA 2CBJA 2UV8G 4DXKA 3LQGA 3DCPA 2B4GA 2L5HA 2TSYA 3BAWA 4E8GA 4RNHA 2GVEA 4HA4A 3GNXA 2CLFA 4O8AA 3T8QA 4H2CA 3MP5A 3V3WA 2PC4A 3MV01 4PRTA 3W1TA 2J7BA 1IXQA 2VHLA 5G4EA 1HO1A 2F38A 5GNXA 5C2GA 4GNKB 1KNWA 4S1FA 4UFKA 3SCPA 4HNVA 2CWNA 3LK6A 2DZBA 2WMIA 1G0CA 1AQFA 2WHLA 2YPIA 3W24A 4LGXA 2NQHA 5C0QA 1CENA 2J75A 1HF6A 2D0HA 4NZJA 3OVPA 1MW0A 4IICA 3MUCA 3S42A 3LSBA 3TQKA 2Z4GA 2CXEA 1Q6DA 2E9BA 5M17A 4IIFA 4JFVA 1JRCA 1SFJA 3VZYA 4ZO7A 3L67A 2QDDA 1E6SM 3S47A 3BMWA 4CQ9A 3WJSA 1AG1O 2XG9A 3SURA 3UZWA 4BKNA 4X9YA 1AQHA 3FYPA 2XISA 3V16A 2CLHA 4B2DD 3H2MA 3EPMA 3A23A 4B5WA 1W5QA 4FMVA 4R9OA 1YNYA 1F2JA 1LG1A 4MJMA 1Q7QA 5BU6A 2Y2WA 1J0JA 1TQJA 3BLPX 1DKWA 4EPDC 4MGGA 2YCLB 4NSBA 3LBOA 1YEYA 4Q4RA 4IT1A 3D47A 2EQDA 4WJEA 4ML9A 1Q8AA 1QUMA 3R2GA 3KOXA 3LTPA 2GGIA 1H7NA 5E6YA 1WXJA 4IJBA 4HSOA 1QNSA 2BG5A 1Y8BA 3M5XA 1OX4A 4M6QA 4GZ7A 1W5MA 1K6AA 1W3NA 1YQ2A 4M7TA 1B9ZA 3O7UA 4QAIA 3LTSA 2GQ3A 2P8BA 4HCLA 2Z2AA 1OHLA 3C56A 4AZIA 2XWDA 1XIBA 1F6PA 2F6KA 3E0IA 4NNCA 4QG8A 1RA0A 3WLLA 4KFPA 5EMMA 3GVRA 1OBAA 1A5NC 3GTHA 3PZVA 3W7JA 4A3YA 3LPGA 3ANVA 3DEQA 1BFNA 3MKKA 2Q8ZA 4O53A 1EHAA 2OO6A 2GVJA 1TWDA 3MPGA 3TH6A 3CZJA 1ISYA 1W0MA 3E0FA 1GTHA 2FTPA 1PXGA 4DBUA 2XIJA 5DANA 3SN4A 1ONRA 3W22A 2ODOA 1BF2A 4WGXA 3ARVA 2PDGA 4AY7A 3GFZA 2Y5SA 3LM3A 1S39A 2QJJA 2Y85A 2RH9A 4PTWA 5I5RA 1MEHA 1EXPA 1XGEA 5FF0A 3EEGA 3TC6A 3PZUA 3NQAA 5A8OA 3QJAA 3NTYA 3CIVA 3TFCA 3AXMA 3LENA 4FPSA 4RCXA 4V1YA 6ENLA 1ZBVA 2VVSA 1FY6A 4XAYA 3BG9A 3ARTA 1GOOA 2Z2UA 3BTNA 1NVMA 4MKSA 3VIPA 4DBEA 4I7VA 1OY0A 1R3WA 3QR1A 3LBCA 3TYAA 4A3RA 4WEVX 5XIMA 4ZENA 1XYBA 2FQIA 3QVQA 1REQB 3KE0A 1QMLA 4ZCWA 4CKQA 4JTKA 2EPKX 3OU8A 5D2WA 1E1EA 1KQYA 2O9RA 4UOQA 2VRJA 5C6MA 1FA2A 1DYSA 4DLFA 3W83A 4J9JA 3PBVA 3CBWA 1PZ3A 3VUSA 2PDFA 5CAHA 4S3BA 1AW2A 1K9FA 2J6VA 1J4EA 5I07A 4XBJA 7A3HA 2GGGA 3BLIA 3MHGA 4LBRA 2XGZA 5FJUA 3SADA 3HGSA 3NPVA 3UF9A 4GFSA 1ZENA 2WJEA 1RP8A 1QXLA 1PKNA 1LM1A 2BLEA 3CGTA 4HTYA 4Y7EA 2QJHA 1OFDA 4EXAA 4ZOAA 2V9DA 3MWCA 1ZUAX 3B8WA 2RGLA 3FSTA 4PODA 3AISA 3GDKA 4R85A 2PMQA 1CLXA 5FJRA 2Z6IA 3ERPA 3RN6A 2NUYA 4IZGA 2GFTA 3WDIA 3VDHA 1V6UA 3IVTA 1XDJA 3KBNA 3RO8A 3D3AA 4F0HA 3U2ZA 2I57A 4XUGA 4Y9NA 4EPEC 1FQ0A 1SW0A 3LB0A 4XO6A 3B04A 1YPFA 3TJIA 1XLEA 4MTVA 2FFCA 3TCEA 3UEQA 1FDYA 4R33A 1O7AA 2P3EA 1TPFA 1R3QA 3RX3A 1HW6A 2CKRA 2GJNA 1JNDA 2Y5JA 4Z1YA 1OX6A 2E5CA 4MB4A 2EHHA 2PE4A 3I4KA 4ZXOA 5HDRA 1IHIA 4INFA 3FV9A 1KM1A 3UG5A 2DSKA 2NX1A 2W3ZA 3N25A 2VGFA 1V7AA 3UJSA 3C2EA 5AZ1A 3SRFA 4RNIA 2B7NA 1QBAA 3KLKA 2RAGA 3A3XA 4GJJA 4EWJA 4DBSA 4PSPA 4ZB2A 2ALDA 3DI0A 4DVOA 3PN8A 4GNVA 3CXOA 2ZZ2A 3P0WA 2FZDA 3GFXA 2WNZA 1YHTA 1FWNA 4JPGA 3I7SA 4YTTA 1W91A 3GUGA 3QRHA 3WNOA 3WEOA 3F7JA 3AIQA 1WAWA 3WH6A 4YTRA 4ES4A 5LIWX 4DRSA 4Y6GA 1DXIA 3IGUA 2BY3A 4IIGA 1HP4A 4WXYA 1BHGA 2R1PA 2WK2A 1OYAA 1S5WA 2CLLA 3A21A 1K8CA 3EXSA 1CXIA 4JR5A 1KKRA 5KZ6A 3ABOA 2O56A 5DMNA 3NQCA 1SZRA 3MUXA 3DFTA 2GGHA 3RYSA 3EWZA 2I7GA 1XQLA 1EO5A 3RHGA 1VRDA 3MI6A 3GBEA 4FLSA 3THDA 4DO7A 1LLZA 3NVDA 1KTCA 2VCAA 4W7WA 3QZAA 4CNOA 3IRDA 3L2LA 3QY7A 2V2HA 5EFFA 1BYBA 3PTKA 1S2CA 3IJ6A 1PDZA 3KDOA 1RY8A 1W3LA 3ZMRA 4JGDA 4R88A 4ATWA 5C9WA 4A2RA 2V2DA 4Q22A 3LERA 2I14A 5A6MA 3W7OA 5H8PA 3SCNA 3CYVA 5IRPA 1MUCA 5FL1A 2XSAA 3AIBA 2FGBA 4LAZA 5A94A 2WNNA 2D1ZA 3BCJA 3CS2A 1VRXA 3QY6A 4E38A 4UXDA 2DVXA 3FDKA 4CD4A 3WK2A 5JBEA 2OKTA 3IJQA 1V3HA 1YDVA 1FWFC 3II1A 5HAOA 4US5A 1ECQA 3TAKA 3OZMA 5K9DA 4GBUA 2HSAA 4Z1DA 4GY0A 4BF9A 4DB7A 3HBLA 3CQ0A 3NEHA 4HMNA 3P0XA 4AD0A 3RM4A 3MS8A 5AVNA 1KFJA 2J8FA 3W0KA 1MQRA 5FF2A 1OM0A 3CMGA 1ZBWA 2XGIA 2NX9A 2CU0A 3IJ9A 4QLJA 3UVAA 3GAKA 1KBJA 4LNCA 2TRSA 1GONA 5K4XA 3FX4A 3LXBA 5XINA 4AIBA 3PUEA 3CZKA 2I5GA 4IJRA 1HN1A 1V0MA 4J3TA 4Y2WA 5AHIA 4ML4A 1UKOA 1BRLA 1M7JA 1ISVA 2OTDA 4CEUC 2F2HA 3CM4A 3WQCA 3LHYA 4B4HA 1DQWA 4M1BA 1QR7A 3A4AA 3IJLA 4D6HA 5HMFA 2PSNA 3XIMA 2CLKA 5KTLA 1UH4A 2Y7DA 1S2VA 3AI0A 4G56A 3DFYA 5LGXA 2GDQA 2VEFA 4ZOEA 1U83A 1XYMA 3AICA 3UWEA 4QJ3B 1MEIA 3WD0A 3TFXA 2WMKA 3FVMA 1JL8A 4Q8TA 2XH7A 2RKXA 4DJDA 2ZUTA 5I23A 3UJ2A 1Q6GA 2WC4A 2CLIA 1BXBA 3VMPA 4FK9A 3QGVA 4AWSA 4ZO6A 1UKTA 4HMDA 3TKFA 4UUIA 3WUBA 1B3VA 4XAFA 5I3FA 3OA5A 4D6IA 3NYZA 3TTSA 1DE5A 4G6CA 4PR4A 2PCEA 1OYBA 1ISZA 4PA8A 1XUZA 4MNLA 3UR8A 4HSHA 3NQVA 5REQB 1U1HA 3E2QA 3EDKA