4PGCA

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgn(3,5-diiodotyrosine)pal
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 68
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pgcA01
1KLGB 3SGKA 1G7PB 1R6VA 4P23A 4Z7VF 1LO5A 3D9AL 5D2NC 5ESQB 3WFHB 3RWFA 4NQCE 2Z4QA 4XC3H 3X3GH 1CFQB 4IEFB 1QFUL 1WT5C 3RI5K 1FL6A 2FJGA 1JPST 2V5SA 2XQBL 5C0FB 1OGAA 1M7IA 4KV5F 4LKCB 3ILPA 3V79C 4LCCB 3ZT6A 3RKDC 4GKSA 3WHE1 2YMXH 3ROLA 1IEBB 2BOCB 1GPOH 4XC3L 3X3GL 3FFCE 5I1GH 1ZHKA 3OR7B 4Z76A 3FT2A 1O7SA 4IM8A 4Z7QF 2VIRB 3QNXB 1WF5A 3FO1B 2EDOA 4XWOD 5KVDH 4G7VH 5LBSH 5J57B 4GOSA 4OIAA 2YMXL 4WV1C 5IM7A 5I66B 5DZOA 5T5FH 1AI1H 5I1GL 2NXYB 3TZVA 4MB3A 1IAIH 3VGEA 2CLZA 4FXGB 4JHAH 4YEFA 1FYTA 2GT9A 1R3KB 4LARL 3ZL4H 5KVDL 1U2CA 3NIGF 3U0PB 3D3VB 1OWRM 5LBSL 1R3JA 2YD9A 5AUMB 1NBVH 4JPVL 1LNUB 3VGHA 3DROB 4JCMA 3WSQH 2DQHH 3LH2H 3NN8B 4U6XB 1UWXH 3VRJA 1QG3A 4FZ8H 4JHAL 3WUWG 5IVXF 4PB0H 1WISA 3RWIA 4PJ5D 3ZL4L 2IG2H 1QSZA 3BGFC 4N0UA 4NKOA 1KTLB 5HHOE 4EI5B 5GS1B 5E94A 5DC4B 5GIRA 3QQ9C 2AJYL 3SDXA 2DQHL 3WSQL 3LH2L 5IJKC 1VFAA 3QRGH 4FZ8L 1U3JA 4OCNC 1N5AB 4OIBA 4PB0L 1AGEB 3LSOA 2BNQE 2IG2L 1CDBA 4QRTB 5CLWA 5TE4H 3HG1B 3D85A 3VD3A 3AU1B 3CFKB 3IFPA 3D39A 5BZDB 4QOKB 3HZKB 5IB3B 2EC9U 1ZA3B 4GFTB 1HQRA 4OUUB 5FYKE 4C56A 2GY7B 3MRGB 5TE4L 3VXRD 3HS0B 2BXYA 4P99A 3RL1B 2H8PB 1S7SB 4OQTH 2D7OA 3V95A 3HNVH 2A6DB 2I25N 2BHZA 4ZDHA 1UZ8A 4GW1B 1KLFA 1KNOA 1G9NC 4FTVD 4JGMA 4HV8B 5D2NB 3IKKA 1MCNA 4L3EE 1A64A 4PJ5B 3FO2A 1AGBA 2DN7A 4H0HB 4R7DB 1B9ZA 2AXFA 2R0KH 5ESAB 3SJVA 3HNVL 4KGJA 3MCLH 1IGMH 1YY9C 1ORSA 4L8DA 1CTNA 1RFDH 4HJJH 5D7KD 3D69A 3TPUA 1TETH 4HF5H 1UM4H 4KJYA 4DKFH 3QUMB 3UROR 3O11B 1J0YA 2GJ6A 3MRDA 3WCYA 2RHEA 4YGVA 3NH7H 4KMLB 1FO0B 1BJ8A 2CRMA 1IGML 3GM0A 4JLRA 1RFDL 3LKQB 3MRCB 4NKDB 4HJJL 5GSRB 2DL2A 1IGYB 3SGDH 4KK5D 3DUHA 5FM5O 3EDFA 4WV1B 4PS4L 3O41B 4DKFL 3VXRB 1INQA 3U36B 1UH3A 5T3ZH 3OV6A 3RY6A 3BRDA 3CX5J 1WV7T 3MUGA 4KROD 4X7TB 5EIQA 5FYKU 4ESKA 1IGTB 3KPLA 3ULVH 3HNSH 3OX8A 5CKGA 4UBDC 2Y5TA 5EA0H 1J1PL 3KPPB 3OGCB 5C0RH 4MQ7B 4ZYKA 3ILQD 4PJAE 4TQEH 5CWSA 4KXZH 1NCDH 2FL5B 3JXAA 5F1SA 4LSUH 5T3ZL 1S9VB 4DFIA 3DX9A 3VFVB 4LGSB 4O02H 1WFUA 1O7VA 4N68A 4JAMA 4GG6F 1BX2B 3IDNB 3SKJH 3RVWC 1KTRL 1V3MA 3MRJB 3BGFB 1F45A 4LEXH 1KB9K 4TUOB 1YN6A 5EA0L 2JB6B 1A7PH 1YY9D 4E42A 4TQEL 1MUJA 4KKAD 1EPFA 1NCDL 3TH4T 1JPTH 4LSUL 4AY0A 5GGVH 4O02L 1NFDA 1UQSB 5FDWA 2F54E 5IQ9A 3LN4B 3SKJL 4RAUB 4LEXL 3K80A 3MV8D 3T4AA 1CS6A 3FO0H 2OBGA 1A7PL 3ARBA 4EDXB 3H3BC 4FQCL 1RK0A 5BZWB 2Z31A 1JPTL 4CU6A 3ABZA 4XP6L 1XIWA 4V1DA 4P2CG 3QPXH 4FG6D 1I7TA 1BFOB 3TBYB 1G1YA 1D3CA 2IPUK 5FV1L 4KUCD 1AIFA 1N64H 3LZFH 2GSGB 1J0KA 5K33A 1QLFA 3C60D 3BP5A 4Z7UB 5IT2H 5B39G 2AJ3A 4PG2A 4ZOCA 3U4BH 4ETYA 3QPXL 3S37L 5J1SC 3KLSA 1CDJA 1CGVA 1N64L 3LZFL 1MLBA 2CDFA 3RVWD 3HHRB 4J4PD 4GXUM 1FHGA 1T4KB 1YJDH 5IT2L 3AXLB 3U4BL 2KKQA 5FHBH 2D7NA 4PRIA 5F7DB 2VO5A 3RZCD 4WRLA 1J86A 2JCCF 3V7AG 4BA8A 3SKNB 1CLZH 2AI0H 1HSAB 3ZDZE 4PJBE 2R2HA 1NH6A 1RZIA 4K94H 1JZ6A 4XNXH 3MV8B 3CXDH 1J8HA 1KT2A 3RGVD 3UTSD 3MRPA 5LWYH 1F58L 4JM4H 2YKLH 3JZ7A 5FHBL 5CHNA 5GRVL 5JIPA 4OKVB 2UYLB 2X05A 1NBZB 4Y4KC 2AI0L 3M17A 1JYNA 4E0RB 3HE6A 1JZ2A 4XNXL 1QO3B 5D7IF 3CXDL 2FJFB 2Z93B 5J1AA 4S1SH 2GAZA 1DN0B 2ZWLT 4N1EA 4KRPC 2ZUYA 3LQAH 4JM4L 2YKLL 4NUGH 3C60B 5F9AC 1JWMB 4I77H 3G6DH 5BRZA 1WIOA 1YPZA 4NQXA 4Q9RH 4AIXA 4RDQG 3KPSE 2V17H 4XAKD 3HAEA 1NEZG 1SQ2N 3KXFD 4OZGA 4D2NA 2R23B 4LSDA 3DHJA 2EKJA 2CLRA 2FIKA 3LQAL 1HH9A 4OZIE 4NO5A 2I60H 3RWEB 3TYFB 1JGLH 3G6DL 4DN3H 1LE9B 4Q9RL 1QLRB 4Y1AE 3DIFA 2PO6C 4G6KH 3IDJA 4HWZA 5E8DL 1MHCB 3TFKC 2EIZB 3M45A 1V05A 1YNLH 5DK0B 4MQXC 2I60L 3S5LB 5BQ7B 1JGLL 5BVPH 3TBSA 3UTSB 4DN3L 2LTQC 4NQED 1TQCC 1FNEA 1LEGA 4MWFB 5C09B 3B9EA 5D6CB 1AD9A 5GQBA 5C08D 3GMQA 1YNLL 4OGAC 5E5RB 3GEWB 1CI5A 4LQFH 4ZS7H 7FABH 1WCBA 3BMVA 4U05A 1A4JA 2E7MA 2J12B 3QPQC 3S97C 1HHGB 3IS1X 4XMKH 1T5WA 1R3LB 5FKAA 3O81A 3RKPA 2NTFB 4KRPD 3VXUA 3ARTA 1A1OA 3HFMH 4GJTB 3KPRB 3KXFB 2CUIA 4ZS7L 1A7RH 7FABL 5KN5A 5ENWA 1J18A 5JHLH 1UACL 2GFBA 3DRTA 1N8ZA 3MMEA 1UM5L 1IC4H 3BN3B 5SWZE 2Y7QA 2HG5A 3I2CH 5KS9B 1HNGA 4L5FH 4JKLA 2XZAH 3HFML 3KPQB 4PJFE 2VLJD 3DXAE 1T20A 1U8HB 2IFFL 1BD2B 3V9FA 2ITDA 1HILB 2PO6D 5TJWK 3MOBH 5DURD 5JHLL 3TFKD 1XF2A 1IC4L 4BSWB 2UY6A 3PABA 1F6LL 3FAXA 4OZFB 4NQEB 3I2CL 2Y4SA 3BQUA 3ISWA 2XZAL 3SGDI 1L0QA 2EYRB 4DGYH 4F33B 3DVIA 4M61B 5C08B 3UYOD 4YFDB 1Y6KR 3BE1H 4NT6B 2GJZB 4LIQE 4Y4KB 3WMSA 3WNMA 4DUVA 1SJHA 2CDGA 1Y0LA 3CFJB 2ENYA 4G8FA 4JO3H 1Z9OA 5AYUL 2EDNA 5DHVA 3QDAA 5GRUH 2CIIB 2C4XA 1T7ZA 4DGYL 3BGAA 3QPQD 5IBLC 4KRPB 1JFMA 5IKCA 4LLAA 2Z8VC 4JFZH 5DJZA 2IBZY 1DQJA 2E9BA 1DANU 4KXZI 3WIHH 2YUWA 4P2YA 2VLLB 4XB8A 1WFOA 3S3SA 4MD5A 1HI6B 5ALCH 3OBAA 4JO3L 2XACC 1T21A 3SPVA 1ODAA 2J7LA 4WW2F 3B6SA 4JFZL 4GRMB 1LD9B 1QEWB 2JE8A 2VLJB 5F8QC 5DVMA 3WIHL 1EV2E 4DCQB 3K8LA 1SJEB 2LFGA 4YHNA 1RSFA 2PO6B 4FFVC 5DURB 2DLTA 4M9OA 5T1KB 4HX1A 2MTPA 4PFEA 3FQTA 2E27H 1CDIA 4LDLB 3MUY1 4K9EH 1ORQA 1A9EB 5HI5C 2B1AH 2GQHA 1TQCB 1FG2B 4U6TA 3NIFE 4FQXA 5JPMA 4JPIA 3V6OA 5D9SA 4C55A 4YHLH 1CLOL 3S7GA 4HUUA 4DZ8B 1PY4A 1C16A 1XF3B 1P1ZA 2B1AL 2W0FB 4TNVF 5INCB 2NY2C 2FHFA 4HS8H 2B2XH 3ZTJH 4Z77A 1EAJA 4C4KO 3O2DH 1NDMB 3BZ4B 4YHLL 5IBLD 5I1JH 1KJ2B 2AJXH 5DQJB 4M62H 3RZWA 3SGJA 3MLTA 4WTZA 1CG9B 2HWZL 1QSEB 1ED3B 3AS3A 3NTCH 3UAJC 4HS8L 2B2XL 2R9HC 2XYCA 3O2DL 1BVLB 5I1JL 2DMBA 4ETQA 3QUZA 2DKUA 5E7BA 4ZUWB 3L9RB 4TPRH 4M62L 1GH7A 1SJVA 5JHDE 1WUNT 5EU4B 5SX5K 1FSKC 2VSDA 4MNGB 4U31A 2BJMH 4PJHE 4CN4A 2X4QA 4S0UC 5IBTL 1E4XH 5KSVB 2Q76B 1CD9B 2P4AB 5HI5D 5ISZA 1X3DA 3DX7B 2ED8A 2VDPH 2V7NB 5C0DA 2Q20A 1M6OA 1U8NB 4G7YL 4MXVE 3EOBB 5MERB 1U8KB 5HHXH 1IAKA 5L7XH 4C83A 4APQC 4P2RA 4RMUA 2BJML 3PG2A 5B38B 4IDJH 1E4XL 4HKXB 1M05B 4WO4A 2BMKA 2EDFA 2V2XA 2VDPL 3O6LH 4MJ5A 3ARFC 5I17A 3B9AA 4NQVA 4XTRC 3RNKA 5B3NA 3TPKA 4PJ7E 3K4DA 1XT5A 2VJXA 1K3ZA 1T2QL 1FZMB 2AEQH 5T5NG 5L7XL 5DO2C 2VLMD 5CGTA 3RAJH 2HMIC 3I50L 1R5WA 4IDJL 3G5XB 1ND0B 2LABA 4U1SB 5F8RC 3O6LL 1T22A 3HCVA 4PBXA 5J6GB 3P0GB 5JR1H 2X4PB 1JGUH 3MFFA 2BSSA 5KSAA 1EK3A 3IJSB 3VA2C 5IK3A 1IFHL 3V8OA 2AEQL 2EDBA 2IANA 4J8RB 4BH8B 3RAJL 1D5BA 3P4OB 4YDVB 4KKCC 5BS0B 3EHBD 5IV2A 5IB2B 4PJ8A 1MEXL 4Q97A 4HUKB 5J3HC 4K71C 4R7NB 4Z7VE 2JTDA 1S7TB 4ODWB 5JR1L 1JGUL 5DEFA 3LPGA 1IMHC 2FX7L 4PJEB 1DVFA 3MLWH 2HAZA 1EO7A 3TN0C 1D7FA 1W72A 1YEIH 1U93A 4KV5E 2NXZC 4HGKC 1ETZB 3P2TA 2P24B 4ZPTB 2FLBT 3MRBA 4FQ2H 5EUKA 3P0VL 4QT5B 5ID0A 3KWWB 4APQD 2VLKE 3JWNC 5HHMA 3MLWL 3P9LB 4YE4L 1HDMA 2XT1B 4Z7QE 4OFDA 1YQVH 3UEZA 4P4KD 5E70A 4BSVA 4OF5A 5HYJE 4XTRD 3RBSA 5IMMA 3OTTA 4NN5C 4X9HA 4FQ2L 3U30B 5L6YH 3ZE2F 1KPVB 1KPUA 2AK1L 4RBPH 5KG9A 3IRZA 5IVOA 3P9WB 5FO7A 3ARDC 4POZC 5EUOA 2A38A 3KYNB 1YQVL 3AS1A 2X7LA 5B3JF 1J1OL 4LNRA 5DK2B 3HE7A 1IAIM 4OGYH 3NIGE 4ACPA 5L6YL 3V6ZB 3E2HA 3O3EA 3OKNA 4JM2A 3F12A 1CICA 4GMSH 4LF3B 4K3DH 1FSKB 4L4VA 3N9GH 1F42A 3B3IB 3EOYG 1CGUA 1JWSB 4NQTA 2MKLC 4P5KB 5J3HD 4JFYA 4YDKL 5IVXE 4ZUUA 3LEXA 1F4WH 1K4DA 4OGYL 3C08H 4KZDH 2X6MA 2P8MB 5KSBB 4JO2H 5AZ2L 3VFUB 2WP3T 5F1OB 4HUWB 2H6PA 4PIRF 3AAZA 4QKXB 4GMSL 2A6KB 3OB8A 4K3DL 4O5LH 2NXZD 1LDSA 4U3XA 3N9GL 4FQHA 4APQB 4OLVH 2FGWH 3GMRA 3BUYB 4ZOBA 3C08L 4KZDL 4NNXA 4JO2L 4RQQA 1OD9A 3MV01 3ARFB 3F7YB 1D5ZB 5EU6D 4ZTOH 5GS2D 4GRWB 4HGMA 4O5LL 2JJTA 1DUYA 4ODUA 4PJXE 2BC4B 1VACB 1I8IB 3PDGA 1OSZA 4X98B 4HS6B 4YEEA 5DD5H 3U7WH 1CFTB 4P2OA 1NUDA 4NM8H 1A6VH 2VZ1A 3X17A 3S88H 4ONHA 1I85C 2W92A 4ZTOL 3JWDH 3ZZ1A 4Z8FH 4HFUH 2DLEA 4PV9A 3OKEB 5DSCA 5GGRB 1X6NA 4PGBB 3HAEG 4JANA 1AQDA 5L9DH 1KG0A 1KTDB 3U7WL 4K71B 2I26N 3LEYH 4NM8L 1A6VL 3MJ9H 5C0GA 1LE5B 2XOTA 4L8SA 5FECA 3JWDL 4LHJB 4RNRA 3IJHA 3QULB 4RMWA 4OCRH 1QPPA 2IPTH 3ARZA 2EDQA 3LN5A 4Q7DA 4PRAA 2NXZB 6FABH 4KUCF 3S36X 4E5XA 5GS0L 4HUXA 2EO9A 4XPFH 3LEYL 2UV3A 1RZJC 3MJ9L 1FAIH 3EDJA 1V7MH 1JGEA 4LVHC 3W0WD 5HGAB 2VR4A 1EEZA 2IPTL 6FABL 1SYVA 1MHPL 4WHYH 4XPFL 3U46A 1URLA 3VGGA 4NN5B 2B4CC 2ZUSA 3B2UD 1IQWL 1ZT1B 1FAIL 3OR6A 5E00A 3QDGE 2CLVA 4HXBH 5JO5A 1I8MB 2FNBA 5D4QA 1OM3H 1MVUA 3NVQA 3ARDB 4PGEB 2CKNA 2H1PH 4D9QD 1BJ1J 3PDOA 1MJUH 3WHXA 3QCTH 1CGTA 5JOFA 3RIAF 2HT4C 1JI2A 1BIIA 4WJ5A 1FIGH 2BY3A 4ZO7A 4HXBL 4LAQH 4AK1A 1E4XI 2IH3B 1JHLH 4QXTB 5LGHH 3O6FD 1WBZA 2HVKA 4F8TA 5DMYA 4A6YB 1T04B 2H1PL 3AY4C 1G6RB 4GG6E 1MJUL 4G8GA 3QCTL 4QO1A 1LVEA 1RJZB 1MIMH 3CMGA 1X44A 1AXSA 3WE6A 5J9PA 1FIGL 3NZ8B 2GK0B 3FT3A 5EZIH 2F5AH 2FWOB 4LAQL 1FJ1A 3P77B 1E4WH 1JHLL 2HFFB 5MENE 2YPKA 3NGBC 2VZSA 3W0WB 2XWTB 2QQQA 4XGZB 1WC7B 2A77H 3BKJL 4HIXH 4CBPA 1MIML 1QNZH 2G5RA 4ZAKA 2XN9E 5ALBH 5JA8B 1N2RB 5C6TH 4JFDB 1BM3H 4GT7A 5D1XC 2F5AL 5EZIL 4HEME 5DYOA 1AXTH 3WUWB 2W0KA 3L5HA 3C8DA 4I18C 1E4WL 5DHYA 5C9KA 1HCFX 4N8VA 5FA4A 4HT1H 1UZ6F 3CSPA 1DLHB 2FEEL 3L7EA 4OKDA 4QY8A 5AWNH 2A77L 4HIXL 1UJ3A 5ALBL 5C6TL 3LQZB 3QNZB 2WZPD 3LKOB 1BM3L 1QRNA 1KYOK 1UB6A 1G0DA 1LDPH 3DUUB 1MWAH 1QBBA 3PUCA 4NHUB 1S7RB 4R26H 4HT1L 3V5HB 1JWUA 4JFFD 4WFHE 4MCYB 5GHWH 5AWNL 4U6VH 3BPLC 3X12A 1HXYA 2ZCHL 43C9B 3HUJA 1F02I 1AJ7H 1LDPL 1MWAL 4AEHH 1WWCA 2FZ3A 4LPXA 4R26L 1OSPH 4M1DH 4PR5B 5C92A 3KR3H 1OAXH 4U6VL 2HLAA 1KV3A 2PETA 2JCCE 3MJ6A 5F3HA 3U6RA 4ZXBD 1YQ2A 5DK3A 4KVNH 4G6AC 4Z5RB 4LVHB 1A1NB 4Y4FC 3QG6B 5H2BA 3RIFK 4R4BA 4AEHL 2XKSA 1U2HA 1OSPL 3SE4C 1W0WB 3BAEH 4R8WH 3KR3L 1IEHA 1OAXL 3BJ91 2HFEB 1KLUA 1G7IB 5C8JA 2DICA 5EU5A 4FZEH 4ELKA 4RGMC 2YWZA 1MCKA 5CGYC 2KQMA 4KVNL 1CD8A 4AQ1B 5D7IE 2E6PA 3MV9B 3HZMA 1A3RL 3IF1A 4LKXB 5LGKA 4XP1H 3VXMB 3WFCL 4R8WL 3X3FH 1WZMA 5BJTB 1LQSR 1EHXA 3WN5A 5AEAA 4JFFB 1XGTB 4R4FH 4FZEL 4G42B 2ZOKA 3D18B 4JKKA 4XZUA 3DGCR 1QSVA 4G9FE 3VXTB 1ACYH 3C87A 2R4SH 1RK1B 4XP1L 4EKXA 4QRRD 1PG7X 3X3FL 5FUCE 1S5HB 4R4FL 1AE6L 1NC4A 2VE6B 1RZ8A 3ZMRA 2P5EE 4HQQH 2ZPKH 2FX9L 3RTQD 1ACYL 1QZ1A 4CNIB 5DD1L 2R4SL 2KDGA 1MCPH 3NGBB 3BD3A 3JV6A 4IIQA 3PGFH 3QIWA 4M1GH 1N6QH 4JDVA 4G6AD 1MFNA 4ZFOB 3WJJC 4J7RA 2DI7A 4HQQL 3T77A 5D1XB 3QQ3B 5D7JA 4I18B 4X0KA 3NCYS 5T1MB 3GJFA 1MCPL 2QSTA 1NAMH 4GO6B 4CU7A 3H8NA 4S0SD 3BYTA 4M1GL 2X4RB 5D5MB 1RPQA 1N6QL 2O5ZL 4X6CA 1IQDA 4KHXH 1XH3A 2BFVH 1WEJH 2GTWA 4ELMA 5JPNA 3ULUC 1NFIB 1WZKA 3MRIB 4GW4A 3QCUH 3PE9A 2C9AA 1NAML 4NCC2 1Q9WA 3H9SD 3EYUL 4NQDE 3LRHA 4UOW1 5L2JB 3BPLB 3QWQB 1AP2A 1CN4A 1XR8B 4LCWB 1BZ9B 4KHXL 4YR6B 4I2XA 4P5MB 2BFVL 3KNBB 1WEJL 1QD0A 2DI8A 2CKBB 5I1DB 1F8TH 5DGRA 3QCUL 2NY0C 5BOPA 4JQXC 4CVZA 2ADIB 1PKQA 2GITA 3GRWH 3F62A 1VKXB 3DMMA 4RFEA 1EAPB 3GK8H 4R4ND 1MCEA 3DLQR 3PQYA 4FMFA 2R56H 4M7ZC 4OFVA 5B39B 1F8TL 4PRHA 4OQTA 1CTOA 1G6VK 3NIDF 3MGTA 4H8WH 3EYSH 1VADB 5DD6B 1L8JA 3GRWL 2YD2A 2OJZH 2A1WH 3GK8L 3C6SA 1ZK9A 1FVDB 4RGMB 3JV4B 3IVKB 2HRLA 3GGWB 5DRWA 2H3NA 2IBGA 2R56L 1WWAX 2P8PA 3A6BH 1W0VA 3SGKC 4H8WL 3EYSL 1V3KA 2BOBA 5GGSY 3KG5A 3OG6B 2OJZL 1CD1B 4X4YA 4JFOA 2FB4H 2PCPB 4PJIB 2W9EL 4TSAH 4NO2B 2PYED 1AD0A 5DA0B 3WFDH 3QXTA 2C1OA 1N7MH 3A6BL 3R8QA 3RWCB 5IFJB 2I27N 3DRQA 2Q8AL 1DDHB 2XKNA 4FQLH 4EIZC 1U58A 1UVQA 3WNPA 4KKLD 2ICEB 2FB4L 4JPKH 3WL9B 1MVFA 4TSAL 1A21A 2FEEI 5E6IC 1H8NA 5GGTA 2DJSA 5AZEH 3WFDL 3ZYJA 4OV6F 1N7ML 1YMME 2CIKB 2C3XA 1JPFB 4JFPA 1NEZB 4I5BA 4ZOEA 4X7DC 3L7FB 3R06B 5FUZH 1RZGB 2IPKA 4JPKL 3TT1L 5DS8B 2YOCA 4WWKA 3L6FA 3O3DA 1KENH 5D7LD 5ANME 5AZEL 5C9JA 1TZIA 1X7QB 1CDHA 4N1CA 1MI5A 5EIIB 1WZ1H 5EOCH 2NY1C 2IALB 4MX7B 4OM1L 3ZKMD 4QRSA 2GTZA 5JQ6H 4JFEE 4S10A 5CD5C 5FUZL 2ITCB 2W1NA 4ORGA 4E41E 5IMLA 4G6JH 1XR9B 1KENL 1S9XB 4F9LA 4P23D 1BBJB 1T7YA 3EYFB 3L3DA 3T0EA 2PYEB 1WZ1L 4K2UH 4MGXA 5EOCL 5JZ7C 2D0FA 3H2WA 5GRJL 5KSBF 5MI0C 5GJSH 5MEOA 5JQ6L 2DLHA 1OGAD 1BEYH 3TVMA 2V5RA 5HPOA 3RNQB 1D6EA 4JG0H 3DBXB 4LVNC 3BKMH 5IB1A 1JF1A 3ARYA 3PP4H 5EC2A 1E27A 4PRDB 4HDIB 4YHIA 2NY0B 1NLDH 2MCPH 3ZLQC 4AIZA 3C09C 5GJSL 3ARQA 1ONQA 2NY5H 2CRYA 4P9HC 4G80B 2ARJB 4OCYH 4JG0L 5E2WH 4M7ZB 4LLQA 1AGFA 3PP4L 4HC1L 1HXMB 5CZXC 2B1HL 3VFPA 4XVTH 3MZGB 1OAQL 2BVUA 1NLDL 4YIQA 2MCPL 1JPGB 4NRZB 1NGYB 1NGWB 5D7LB 4PY7B 1LK3L 1ZA6B 3EYOA 3VFSB 1C5DB 3TZVD 2VUOA 2H32H 4RGNC 2NY5L 5LXGH 3KAAA 1FYTD 1WBYB 4IOIB 4OCYL 1N6VA 5IMOA 4F7EA 4O2EB 3VRIB 4JRWA 2NY1D 3RVUD 3MBXH 4CVXB 4LOUD 5C0NC 2AV7A 5LXGL 2Z4QB 4PJ5E 3LVEA 4EUPH 1FL6B 2FJGB 3VMOA 5TGBB 1OGAB 5GPRA 4W6WB 5C6WH 3ILPB 5JZ7D 4OF0A 2BVOB 3T8XA 4WUUE 2CGRH 3MBXL 4TVSa 5A43C 5E2TH 1C1EH 1EDQA 4GKSB 4X99A 4JRYE 2KPNA 4U1NA 2YBRA 1OB1B 1ZHKB 1QR1B 2Q3AA 3QXAA 5E6IB 5HGGS 2EE2A 5GRYA 2W9DH 3D85D 2V2WA 4F37K 3D39D 1TVBB 3GZKA 3FQUA 4S2SA 2E8YA 5IM7B 2XTJD 4Q0XH 4HKBA 5CZXD 3TZVB 3VXRE 4C56D 4X5LA 1GHFH 4XPGH 3Q2CA 3K3QA 3CC5A 2CLZB 5DI8B 3F7VB 1FYTB 2W9DL 1JZ3A 1A2YA 4RGND 2DQEH 1DZBA 1FGNH 3VI3F 5K9OB 1R3JB 2NY1B 5C0BB 4HPYH 4UINL 1LP9A 4JDTH 1FZOA 2EDKA 4KQ4H 4X5XB 4FTVE 5IMKA 1KJMB 2A6IA 3VRJB 4HCRA 4OLWH 3T2NH 4U6HA 1GHFL 2DQTH 4XPGL 4CVWA 4KK8D 4LLMB 5C0ND 5SWSA 3RWIB 4YHZH 1A6AA 4XBPA 1BQSA 4ZQKA 1RD6A 2DQEL 3LKSB 1FGNL 3BISA 4N0UB 4NKOB 1L7IL 1T03L 4WI7A 3ZE2E 4F7CA 5FKPA 4HPYL 4LLUA 5MI0B 4UU9A 3SJVD 3FONA 5GIRB 5F88A 4N0CC 4KQ4L 2R0WH 4LASH 1OPGH 1VFAB 2JK5A 2DQTL 4LVNB 1J9CT 1TJGH 3BPNC 4PP8C 5B3JE 3IETA 4IRJA 4YHZL 3L5XH 3LSOB 3SE3A 4LLVA 2GJ6D 1M7DA 3CZJA 4RMVA 3D85B 3V4VH 3C09B 1S5IH 5D1ZC 1JI1A 3P30H 2WWMC 3D39B 2X1QA 3ARBC 2R0WL 1RV6X 3GSRA 1TJGL 3OB0K 1CXKA 1HEZB 1HQRB 2C3GA 4MB4A 1Q94A 3S3JA 1XIWC 3L5XL 3W81A 2V5YA 4UT6H 1M71A 1PZ5B 3LEVL 1NL0H 3EIFA 3T4YA 1S5IL 3WFBH 4RGNB 4R3SA 4Y4HA 3SKMA 3QUXC 2YUZA 2G60H 4ZDHB 4XHJD 1UZ8B 1W0YT 5EG6C 3F6LA 2NPLX 4UT6L 2NY4D 4W4OA 4YFEA 4GAGH 3FO2B 5DJ2A 3ZSSA 1AGBB 5DF0A 2VL4A 3RL2B 2P48B 3NACH 5FA3B 2CRZA 4KI5D 2G60L 2V9RA 4AENA 1C08B 3IU3B 4L8DB 2ZCKH 1DBML 1KXVC 3D69B 3TPUB 5FEBA 4GRLC 4GAGL 1PZUB 3GMMB 1QRKA 4KJYB 5DJAA 3ZO0A 2GJ6B 1JMXA 3MRDB 3NACL 4YGVB 3OXRA 5H37G 1P6AB 4HKZB 5GGRY 3Q0HA 4JLRB 4MD0B 5D1QC 4MJIE 5EN2A 4I0PC 1IKFL 1NUGA 2WWMD 1R5VB 3RHWK 3ARBD 1EO8H 2NW2A 2VTFA 2Z31D 5J8OA 4TUJA 3SBWA 1QQDA 3HE6C 3ZYIA 3I6LD 1WFTA 1KBGH 2X4TB 1XIWD 4V1DD 4PGDA 3FHQA 2I5YH 2E7LC 4MQSB 3MACH 5ICZA 2ZUVA 2E9JA 2EE3A 3MUGB 3KPLB 5DJCB 2NCMA 1EO8L 1EZVY 3OX8B 3T0WA 2AVGA 3RJDA 4KTEH 3S35H 1MQKH 1KBGL 4M9PA 5IUSA 4ZYKB 4KRMB 3TGXA 5CWSB 4U4BA 3DX9B 3MACL 5ESQA 2W0PA 4K7FB 1AO7B 2LVCA 2EDLA 3GFUA 4KTEL 5C0FA 3S35L 1MQKL 5E5MA 4LKCA 4E42B 4LCCA 4YBQC 1MUJB 4IMKC 4UILH 3BPNB 3J7HA 1AR2A 4PRID 1NFDB 4RZCA 5LGJA 5IQ9B 3B5TA 3U9UA 3PV6A 4ZTPH 1FVEA 1J8HD 3T4AB 4H20H 5D1ZB 3VGDA 2ED7A 3EDEA 5HSFA 2JJWA 3ARBB 3VWKC 2P5WB 2AJVH 3UTQA 1Y6NR 4UILL 3FO1A 1JE6A 2XG5A 4FP8H 1XIWB 4V1DB 4BFEA 5I66A 4LPYA 4H1LH 3HE6D 4ZTPL 4XNMB 4NO0A 4H20L 4R96A 4OBSA 2YA1A 4FXGA 2J8HA 5CJXA 5F70A 4BH7A 3FRPA 1FYHB 2AJVL 3QUXB 3F7PC 4GAYA 3D3VA 4FP8L 2Z92A 4U7SA 2BCKB 5A2LH 1MCQA 5AUMA 5BRZD 4XAKE 2AJ3B 4MHHG 3KXFE 3IAQA 5LCVH 4Y19B 3NN8A 4U6XA 3DVGA 4X80L 4I4WB 4RFNC 4ONFL 2EDWA 5FM4A 1MLBB 5IBUG 3FAWA 2CDFB 1ZTXH 1UZ6E 3UXFA 5IWLA 4F57H 4EI5A 1YEGL 5LCVL 4PRIB 1GRWA 1XF5A 3QISA 4QXUH 3TCLB 4GRLB 2Q6WA 1ZGLM 1N5AA 5DT1L 4C4KT 1UM6H 1J8HB 1AGEA 4P59L 3BQUC 1QFWM 2BRRH 1ZTXL 4QRTA 4NQEE 3HG1A 1KT2B 4F57L 1QTYT 3MRPB 3PWPB 3AU1A 1JVKA 5D1QB 1BQHA 5FHAH 5CHNB 3CFKA 5C08E 4I0PB 2ADJA 5LG1A 4QOKA 4QXUL 3HC0B 3HZKA 5IB3A 3M17B 1ZA3A 5E8OB 3HE6B 4OT1H 3TWCH 2R2BA 4LLWB 4QXWA 3MOQA 2BRRL 5J1AB 1YC7A 1G9MC 2GAZB 3DETC 4NBZB 4DZBA 3MYJA 3WS3B 5KAQG 4YXLH 3TT3L 3M8OH 2F8VA 2XQYK 3O2WH 3QUKB 4QHLB 4NQXB 3U79A 3VXUD 1MNUH 2OI9C 4HUVB 3HAEB 2JB5H 4GW1A 1WQVT 3B4NA 4JJ5A 4OZGB 4PJIF 5FO9B 1FH5H 3CFCL 2R1WA 2CLRB 2FIKB 4YXLL 3QDMB 3FO9A 2Z91A 3M8OL 3ZDXF 4HKJA 5E6ZA 3O2WL 1WT5A 4G43B 5ESAA 3BN9C 1MNUL 3VJ6A 3IDJB 4HWZB 1P4IL 4XPTH 1FH5L 2JJUA 3W5MA 1CE6A 3DHMA 1IGFL 1MHEA 4RDQF 4B7LA 5ERWA 4PPTA 3BQUD 4FQXC 1FO0A 1YDPA 2DKMA 3V6OC 3MRCA 3VWKB 3GMQB 4YBHA 1IGYA 3WIIL 5KVFL 2RJMA 2IC2A 4WV1A 1WCBB 3O41A 5J89A 1FGVH 1EA9C 1MAKA 1T5WB 4UV7H 2IGFL 3DETD 4P3DA 1CXIA 4JHWH 1IGTA 1S9KC 1A1OB 2X1PA 5I18L 1NANI 5KN5B 1CL7H 4MQ7A 3QHFL 1FGVL 3SY0B 3KPNB 3DRTB 4UV7L 1N8ZB 3MMEB 4RFNB 1WSST 2YEZA 2Y7QB 3LHPH 3IFOA 1DUZA 3CK0L 4JHWL 1AKJA 3D87B 3QRFM 4FFZH 1KC5H 1KB5B 4OCWH 4CN1A 1T20B 3CFIC 3BN9D 1CL7L 5DMIH 4BFGA 2ITDB 4LCUA 2JB6A 4PP1D 2H41A 5IJKA 2DQUH 2FHCA 3CH1B 4EDWH 4WEUD 4XBEL 1XF2B 3PABB 2LQRA 2EC8A 3LHPL 2CXKA 4XCEA 5I1AA 2IAMA 1XGUA 3LN4A 3BQUB 2C4FU 4RAUA 1PGRB 1KC5L 4OCWL 3AMLA 5DMIL 4FQXD 4OF6A 4EDXA 4EDWL 5BZWA 2CRIA 2CDGB 4YPJA 5E1AA 1MHHB 4G8FB 2J3SA 4BSJA 3BH8A 5BO1H 2Z8RA 5DHVB 5E99L 5ADOL 9CGTA 4WO4C 1BFOA 3TBYA 2AAVA 5IKCB 1OTTC 5DJZB 1LEKA 2R1XA 2QR0A 2GSGA 1U6AH 3AC0A 4OLYH 3VXPA 4GKOA 4Y2OA 2MWCA 2OI9B 2VZOA 3L1OH 5E08L 2FD6H 2OTWA 3QUMH 5BO1L 1T21B 3OHXB 3W39A 3SPVB 3NIDE 2XZQH 3W2DH 4PLKC 5C6PB 1UWXK 3B6SB 1REIA 2QEJA 1CU4H 4NDMA 1Z6JT 5HI4C 1U6AL 4WEBL 3QUZD 4OCLC 5TE6H 4OLYL 4YHNB 3VD9A 1JL8A 3OKKA 2FD6L 3GKWL 5IHBA 3QUML 1RUKH 5M7QA 4N5EA 1N0XL 4KJPC 3TNNB 5F7DA 2XZQL 4I0CC 3BZFB 1RHHA 4XWGH 1HSAA 2W59A 1ORQB 3EYQC 1CU4L 4OZIA 4IOSD 1R3IH 3L5IA 4N9GA 4JGJA 1SYSA 4MVBC 4WI5A 1X4YA 5TE6L 2CR3A 4KWUA 4FQXB 4RFOH 3S34L 1Q1JH 3IYLW 5ISZD 3BMWA 2ICWI 5D96B 4QXGH 4OKVA 4HUUB 1K5NB 4XWGL 1XGQA 4GUPA 2WLZA 1BAFH 4TUKH 1P1ZB 5F7EH 1R3IL 3ES6A 4JFXA 4R9HA 3WBDA 4P2RD 1ZANH 1UKTA 3T08A 2VDQH 1DN0A 1T5XB 3D0LA 4WO4D 1CIDA 1Q1JL 4JFQB 1FFNA 1NAKH 1OTTD 4QXGL 1JWMA 2K7PA 5I8KH 3MUJA 2YUXA 4TUKL 3MLTB 1H3UA 5F7EL 3JV5A 3MSPA 3IDIB 2VDQL 2DQGH 3MUHL 2VZTA 3JUYA 3SDXF 3AVEA 4KAQH 1KEGH 4ETQB 3GO1H 3RWEA 1NAKL 3TYFA 4Z7WA 1DTUA 4NC2B 3UBXB 3HE7C 1V3JA 1JPSH 3PHSA 4RMQA 5FYJD 3E2HC 5KSAD 1X5YA 1QLRA 2VDNH 4S1DC 3VFNA 3QA3A 2IAND 4HXAH 4AEFA 1CICC 3SOBH 2DQGL 4PJ8D 1KIQA 3MCKB 1KEGL 2Y72A 2X4QB 3S5LA 3MLSL 5CBEA 3TC9A 3SDCA 1JMZA 5ISZB 2F5BH 4DGVL 2VDNL 1DVFD 2WINB 4MWFA 1G9NH 1M6OB 1NUFA 5C09A 4CMHC 1J1XH 4HG4J 3DWTA 2C3VA 4BM7A 5F9OL 1IAKB 3DYMA 4X6DA 3NOIA 4P2RB 1JK8A 3UTPD 1PEZA 2WBWB 3ZKXC 4UNVA 1GXEA 3QXWA 1H15A 4WO4B 1FFOA 4H5SA 4QHUB 4XCNA 5IOPA 1MFEH 1HHGA 2F5BL 4F8QA 2V2XB 5HHMD 4I48B 5DGQA 4MJ5B 3STZA 5I17B 4NQVB 4UQ2B 1G9NL 2APFA 1J1XL 2OL3B 4HAFA 4RMTA 2JJTC 4CAGA 3A67H 4JVPA 1NMCC 4MJ2A 3BOVA 3KPRA 1R5WB 3I6KB 1VFBB 1MFEL 4P2OC 2E8ZA 1EFQA 4XX1G 1YY8B 3VXNB 1T22B 3HCVB 1AY1L 5KVMC 1A6WH 1F2XK 3MUZ1 3MFFB 2BSSB 1U8OB 1U3HA 5IK3B 5KS9A 3A67L 1JTPA 2QL1A 3KPQA 2IANB 3HE7D 1KN4H 2F58H 1D5BB 3P11H 4KPHH 3HI5H 4WI8A 1BD2A 5DJ6A 5IV2B 5I1LA 4S1DD 4JM2D 5EBLA 1RZKH 1CICD 4CL7A 3MRFA 4L4VD 4CJ0A 1A6WL 4L8SC 4XT1C 1FNLA 2QHRH 5JW5A 1EGJA 3L3IA 5HDOA 2X4OA 5C0AA 1TTGA 1KN4L 2EYRA 2F58L 1NCCH 3WV0A 1W72B 3P11L 3BXNB 3HI5L 4KPHL 3U9PH 5GZNC 3GSNB 3G08A 3CLFH 1RZKL 2UZIH 3MRBB 4Y4KA 5EUKB 2I9TA 3CAFA 3EW3B 5MEPA 3RUGA 1U8LA 4OI9A 1MIEH 5CMAA 4FFWC 1HDMB 2OJEB 4LFHG 1NCCL 5B8CC 1UYWL 3U9PL 2NY7H 5EU6E 5TQ2H 1CL7I 1F11A 3CLFL 3G9VA 3VFTA 3ZTJG 4O2CA 3BPCB 1ZLSH 4RMSA 4KI5F 2VLLA 3GB7B 3BT2H 2L7UA 2N4IA 1MIEL 5D2LB 2NY7L 2X7LB 1DQLH 4P2OD 1NGPL 5TQ2L 2DOCA 1BQLL 1NFDF 2AK4B 3FRPG 2XNAA 3HE7B 5A40E 1FNGB 1ZLSL 3E2HB 3VI3E 4G5ZH 1C12B 1JTTA 4Y2DC 1VDGA 5C3LD 3BT2L 4WDIA 2CR6A 5HVWA 4ERSH 1CICB 2BSED 3THMH 2DD8H 3QNYA 5EOTB 4L4VB 4RX4A 5GRVK 5T1KA 3H7LA 2UY7A 4XBGA 1DQLL 2MPAH 4JFYB 1BZ7A 2BXZA 3D2UB 4ZUUB 5CJBA 1K4DB 2UZYB 1NGZA 4G5ZL 4NHCH 2J4WH 4UNUA 4PV8B 2H6PB 4CMHB 3GDBA 4ERSL 3AAZB 4LSTH 3THML 1LQVA 5GZND 2DD8L 4FQHB 4DZ8A 2VXUH 3QWRD 4F80A 4U49A 3VE0A 4HLZH 2MPAL 1XF3A 1DSFH 3ZKXB 3GMRB 2W0FA 5TFSL 3P4MA 4NNXB 4RQQB 5EBMA 4NHCL 4X6FA 4JZJC 2J4WL 1MCLA 1CR9H 4X6EA 1GZPA 3BZ4A 3DUSB 1BQHG 5E24E 4P46A 1VERA 1SJXA 3OAUL 1KJ2A 1MFDH 4LDEB 4ODUB 1DUYB 3OG4B 2BSRA 1NMCB 5DQJA 2MMXA 3L3KA 4OZFH 1QVOA 1OSZB 1WVZA 1CG9A 3B5GA 1QSEA 1ED3A 1UJ3C 4P2OB 5C2UB 4NC0B 3MRLA 4D9QE 5DMJB 1NQBA 1MFDL 2GW5A 2R4RH 4U1MB 4ZUWA 4N0YH 4PV9B 2YN3A 3VG0H 3N06B 1I9JL 4Z78A 4JANB 3MBEA 5BMFH 1A4KB 1BLNA 5E1HB 3S4SA 5I1EL 3IB4A 4O4YH 1PY9A 2GSIB 1P7HL 1QSFB 4L8SB 1Q72H 5FECB 4RNRB 2R4RL 3IJHB 4N0YL 4G8GD 5FGCB 1YECL 3DX7A 1RUML 4PRAB 5BMFL 4E5XB 4QTIH 4HUXB 4O4YL 4RAHA 1U8KA 1A5FH 2K9UA 4LK4A 4OV5A 1I1AA 1Q72L 1YPZF 1JGEB 1R24B 3T2QA 1XGRB 3LS4H 3FMGH 3F58L 1Q9KB 5B8CB 2HA1A 3OMZA 4ZAKD 1SYVB 3NABH 3N0PB 5SWQA 4QTIL 3JTCA 3U46B 2F74A 2Q1EA 3ERYA 1A5FL 1I3UA 4M7KH 5DEGA 5FIEA 3OR6B 1HE7A 2WV3A 2CLVB 3LS4L 4Q6IA 3FMGL 4XPAH 5JO5B 1MVUB 1WITA 3W5NA 2F53E 1KTKE 3NABL 1QRND 2X4PA 3PDOB 3IJSA 5JOFB 4LDOB 4Y2DB 1IILE 1BIIB 4JFFE 4WJ5B 3MLPA 1MCSA 5DJ8A 3P4OA 3RPKA 2VABA 3ESVF 1PKOA 2R0LL 1D5IH 4NQSA 2KH2B 4NZRH 3QH3A 4WGVB 4XPAL 3WHE0 5BS0A 5CGMA 2AV1A 1S7UB 2GK2A 3IDMB 1KXQE 3VG9C 1S7TA 4ODWA 3RWGA 4G8GB 4PJEA 1UT9A 1DBAH 3IXAA 5J9PB 3FT3B 3FTGA 1D5IL 4K3JH 4NZRL 2YXFA 3IDGB 2O26U 2P24A 4L9LA 2AXGA 4ZPTA 2DQJH 5D93C 3Q6FB 4QT5A 4PRPB 4IIQC 3TH2T 3QIWC 1FBIL 4OFPA 1DBAL 3P9LA 4JZJB 3I3DA 3CU1A 4ZOAA 4HPOL 3EJYD 4K3JL 1G7LA 2DQDH 2DQJL 1U8JA 4OFKA 1D9KC 4HEPG 4ZO6A 4KDWA 1YYLH 1KPVA 5DQDH 1FC1A 4QY8B 5K9JH 3SKOA 1UJ3B 1KIUA 1NGXB 4LP5A 1UB6B 5BVJA 3L3HB 4Y16C 1X6LA 3TF7C 5DK2A 3W9DB 2DTMH 4J1UB 3V6ZA 4PJXA 1JWUB 1YYLL 5E9DE 5DQDL 5K9JL 1HXYB 1SM3H 1CK0H 4HJ0D 3HUJB 5H35A 3KYOB 1HYSC 3B3IA 4QRRE 1BF2A 3CDGA 4P5KA 1CVRA 2EIEA 1G1CA 2FZ3B 1IT9H 1YN7A 2DTML 2QBWA 5T33H 1NC4D 1QFHA 2HLAB 3G6AB 3WFZA 1SM3L 4N90D 1CK0L 5FGSA 5H94B 3JV0A 5F3HB 2N1KA 3U6RB 4Y5VC 4MJ6A 4X7CC 4FRWA 3GBMH 5H2BB 4OQ1A 1IT9L 3QIWD 3EJZC 4K7PY 4JY5L 4OCMC 1B90A 1IGJB 2WQ8A 5I30H 3ARFA 1K3IA 1KLUB 2AQ3A 5C8JB 2VQ1B 3G5ZA 5EU5B 5D7JD 4HIJB 4BK5A 1QA9A 5BXFB 5A2IH 4ORZC 4MB5A 3LKNA 4PJCA 3GBML 1I8IA 3FQWA 4EJ1C 3SEPA 5CSGA 2QJDA 4YQXH 3V7AE 1XGYH 4Y5XC 4CRPA 1Z0NA 3QFJB 2DM7A 1EFXB 2ZOKB 3H9SE 3OKEA 4BJLA 3MRNA 4XZUB 3QWOB 1XMWA 4PGBA 4JHZA 4PJIE 4KKBD 4L4TE 4WFFD 1KTDA 4J6RH 2PW1A 1BFVH 4HBCH 3VG9B 4YQXL 1LE5A 1CZ8L 1OF2A 1XGYL 3UC0H 3ZDXE 1NC4B 4B41A 1RZ8B 3TN0A 1I1CA 4RISH 3HRPA 4W70A 5D93B 3GHBH 1BFVL 4MQTB 3DMMD 4HBCL 4IIQB 3QIWB 1BFTA 3FQRA 1FNAA 3ULVC 3PQYD 3UC0L 5I8OH 4Y8DC 1PX3A 4PRHD 4V3EB 4QRQA 1N26A 4X0KB 4GQPH 3WKNA 2OP4L 5C07E 1D9KB 3GHBL 1ZT1A 3G5YA 4M6MH 5HGDB 4QRPA 4I3RH 1DQDH 1Y18B 4X6CB 5F7FA 1I8MA 3ARDA 4PGEA 1XH3B 2HT3D 1CFNA 1T3FB 4R0LC 4ELMB 2GTWB 5JPNB 1LEIA 1I7ZA 4GW4B 3SKUD 1ZHBA 4M6ML 4QNPF 1AP2B 4WHCA 3N1MC 4NWUH 3SO3C 35C8H 4IBLT 4I2XB 5DQ9A 1Z5LA 4Y88A 3HI1A 3U4EA 4HK3N 4OCSL 2JKXA 1J0ZA 4ZFFA 1KELH 1RZ7L 3WNLA 4CVZB 2OM5A 5IB5B 4OLXL 1CDYA 1D5XB 2ESVA 1PKQB 2GK0A 2GITB 1ZLVK 4NWUL 1FIEA 2HLFC 4RFEB 3P77A 35C8L 2AEPH 2HFFA 3PQYB 4AEIH 2XWTA 4OM0H 4ZS6D 1KELL 4I13B 3PHOA 2EDHA 3ULVD 3QIUA 4JFDA 1BPVA 3VA6A 4RWYH 4MA8L 2EXYC 5D7LE 1A8JH 2H2PD 3KYAA 2O61A 2HJFA 2UWEF 4M7LL 4WWKD 4AG4L 1A0QL 2AEPL 1CT8A 1HOCA 1ZVHA 3MLYH 5DRWB 2F8OA 2H3NB 4AEIL 1MI5D 2OR9H 5DZLA 5I16A 4RBPK 2P8PB 1HHIA 3OPZH 1W0VB 3QNZA 1YJDC 3O3AA 2NY6C 4RWYL 1I3VA 3AROA 1DBBL 1I85A 2BY0A 3P0YH 3DUUA 4Y5XB 4NHUA 4X4YB 4NRYB 4JFOB 3MLYL 4L3CA 2OK0H 4K94C 3T0ED 2OR9L 2DYPA 1AD0B 1GGYA 2GIYA 1OGAE 2C1OB 3OPZL 43C9A 1CBVH 3SCMA 5TDPB 5GS2H 5C0IB 2EYSA 1P7QA 3TVMD 3P0YL 3GSWB 3DRQB 2VRAA 2XKNB 1EUUA 1U58B 4TTDD 1UJTA 2OK0L 4PR5A 4IRSA 4XP5H 1K85A 4PGJA 1CBVL 4RIRB 4MDJB 2HLFD 1A6UH 3LQAC 5F93C 3Q6GH 4JFPB 4OD3H 1QHPA 2D7QA 2IADB 3FOMB 2VOTA 4WNQA 1F00I 3R1GH 1W0WA 1PG7H 3O3DB 2HFEA 3D48R 5EUOF 1TZIB 1G7IA 4IHOA 2EXYD 3HTLX 1MI5B 1A6UL 4A6YH 3Q6GL 4HS3A 4ZFZA 1ZVYA 3DSFH 4QRSB 3QUYA 3ZE0F 4JM2F 1TQBC 1NC2B 3MV9A 4ORGB 4KHTH 3RA7H 3R1GL 3VXMA 5IMLB 1PG7L 2NY6D 4NNPH 5BJTA 1N59A 4OTXL 1UG9A 1GAFH 3L3DB 1TTUA 4XP9H 3D18A 4A6YL 3MNWB 2QKIB 1G6RL 1NCBH 5TF1H 2W91A 4OD1H 5EB9A 2CK0L 4JZOB 2Q86A 1CXLA 3HC3H 3PWNB 3MODH 4KHTL 3S96A 4JO1L 1D6EB 3RA7L 2EC9T 4WI2A 2EH7H 3SDXE 2RAMA 1I8LC 3V6FB 5IB1B 4NNPL 3TEUA 4IRJC 1E27B 1S5HA 5ESVA 1GAFL 4JRXB 3SE3C 4XP9L 1YUHA 2R2CA 5HHVL 5AD0A 4AIZB 2OSLA 2DRUA 1NCBL 1O0VA 4OD1L 1ONQB 4NIKB 4W4NA 3S4SG 3HC3L 3D39E 4FXKA 2EH7L 2FEDC 4P2QE 1DE4A 1E0OB 3EAKA 4TRPH 2XTJE 4YIQB 4TNWF 4C56E 3EYOB 5D1XA 1I1FA 1PVHA 4RGNE 5E4EC 2X4RA 5D5MA 3STLA 4TRPL 2XPGB 4KDTC 4LSVH 4ZO8A 2EXWC 2ATKA 2NY6B 4W4OC 2NW3A 3UP1A 2OTPA 5GRZA 4DQOL 1NLBH 1NFIA 2AV7B 1DLFL 2QV2A 5T1DL 3MO1A 3OWEA 5SWSD 1RZJH 1IZJA 2VXSH 2CMRH 3K2MC 3RPIB 1F13A 3PWVA 4GW5B 3SJVE 4ZUVB 4LCWA 1JGVH 3T8XB 4LSVL 4PTUA 1G7QB 2G2RA 5KOVC 4GMTL 1IGIL 3TPUE 3BZDA 5EWIH 4FN0A 4U1NB 5DVKA 2KZWA 2B4CH 5MP6L 4DOHE 4IRJD 1RZJL 3UTZA 2VXSL 2CMRL 3PGDA 3EO9H 2GJ6E 4XH2A 5F96H 1A14H 2VDLH 2W0LA 4DUXA 1A3LH 2NX5B 5DR5L 5F9WC 1YNTB 4O58H 2C1PB 1NMBH 5ETUA 32C2A 2A9MH 4CGTA 3FQUB 4NWTH 3OKDA 4M3KB 4Y4FA 2B4CL 4NYLA 4NGHH 1MRDH 4YWGL 3NCBB 4XPBH 3EO9L 5F96L 2IQ9H 3CC5B 5DD6A 2VDLL 3ULSA 1A3LL 3IS0X 3MQIA 4O58L 4Y4HD 1YMMA 1NMBL 2A9ML 3IVKA 5DJ0B 2HT2C 3GGWA 1OOAA 3BHBB 2LE9A 2KUTA 1LP9B 3EO1A 4NGHL 1FZOB 1MRDL 5IMKB 1TQBB 2A6IB 3QYCA 5TQ0H 2VB5A 1BVZA 4U6HB 1B4RA 2IQ9L 3HMWL 2EXWD 4JKWA 3SDDC 2M2DA 1FL5B 3HB3C 3IU4H 1DEDA 5SWSB 1A6AB 1HWGB 4XBPB 3PWJB 4YXHH 4K9EC 4PYGA 2FIRT 4KI5E 1AC0A 2PCPA 4F7CB 5FKPB 1ZLUK 4CMMA 4LLUB 3FONB 5F88B 2NYYC 2DQIH 4JFEA 2J6EH 3BPOC 5CSBA 3V0VB 2C7UA 4E41A 2ZG3A 4UQ3B 2B5IC 3IETB 4IRJB 1DDHA 4YXHL 3BWUC 2EH8H 2YC1A 3VWJC 4IRZH 5DJDA 2BDNH 4GKNB 4LLVB 5CIPH 1WFNA 5I1HH 4ONOA 3T1FA 3A6OA 5ILTH 4ZFOL 2DQIL 2J6EL 3PWLB 5I1IH 1JPFA 3GSRB 3PDDA 1RUPH 2QSCH 1NEZA 2EH8L 4PGZA 4IRZL 3WJJA 3KLAA 2BDNL 1M71B 1FV1B 3R06A 4V1DE 5L2KB 2CD0A 1U95A 5I1HL 3CFBB 3ZHDA 5ILTL 4Y4HB 3ELAT 4JZNB 3SKMB 2Q3ZA 1SY6H 5E4EB 3MA7A 2X70A 4DW2H 2BSTA 2DLFL 2ARWA 1I9IH 2IALA 5F7HA 2QSCL 2HT2D 5F3BA 2CJUH 3ZTNH 4XCYB 2ED9A 1RZFH 2YHGA 3CDYA 2C3HA 1FNFA 2VL5A 5DJ2B 1T0MA 1P2CA 2Q87A 1SY6L 1BBJA 3EYFA 2YA2A 4HWBH 3LKRA 4DW2L 4AENB 3VW3L 3UJTL 1I9IL 2CKBL 2X09A 5E95B 3SGEH 2OQJB 3NCMA 3ZTNL 3NA4A 1I3RA 3RNQA 2NYYD 4M02A 1RZFL 4PRIE 5IG7A 3S9DB 4KJWD 3P73A 5DJAB 1FFQA 4NNYB 4JPWH 4Z9KB 4NQCB 4PRDA 4JQXA 1YEEH 3ARGA 2J8OA 3OSKA 3OXRB 1J8HE 1YC8A 4HWBL 5FAAA 5TE7H 5I2IB 4IOFD 1J12A 4LFHD 2HTLC 3ZHKA 4DEPB 5FF6A 5EN2B 2QTEA 5F9WB 3VFWB 1EX0A 4G80A 1MRFH 4WUUA 4DKDC 3O9WA 2X4NA 1IC5H 1F3DJ 1CVSC 4JRYA 1JP5A 5I1KH 1HXMA 3UDWC 5DFVD 1YEEL 4PGDB 2Y36H 4NRZA 5TE7L 1NGWA 2ZUQC 3W82A 5ICZB 4NO0D 2IPUG 4LSQL 4WWID 1IEAA 2O5YH 1MRFL 5EZLB 2LAAA 3PL6A 4PG9A 2MOVA 2X2YA 5BRZE 4I9WE 1IC5L 1YPZE 2VXTH 3D3VD 4O2EA 3WIFB 3VRIA 5E8EA 3DJ9A 3WO3B 4CVXA 3RWJB 2Y36L 3SDDB 5FYKD 3FCTB 2V7HB 5FOJA 4FFEX 2O5YL 4CVUA 1BJ1H 4MD4B 1S9WA 1XFPA 1BWWA 5TGBA 1H3WM 2VXTL 3GMPA 5CBAB 5E5MB 1X5XA 4OGXL 4EI5D 2BVOA 3BPOB 4RZCB 5HYQA 5LGJB 5EC1A 2B5IB 3VWJB 3U9UB 1OB1A 3PV6B 4X4MA 1FVEB 2P7TA 1QR1A 2MQ0A 4LLDA 2D9CA 5E6IA 5CCKH 3DI2B 5HHOB 3HG1D 4JO4H 2B39A 4MDIB 4LARH 3UTQB 2HTLD 3ROOA 4UTAH 1TJHH 2FR4B 1TVBA 4QOKD 1DJSA 4JPVH 4V2BA 1U42A 2BNQB 3QAZB 4K07A 4X6CF 5IB4A 1IL1A 3X11B 5I73C 4NO0B 1Z0MA 4R96B 5CCKL 5DI8A 3F7VA 4JO4L 4BH7B 4A2LA 3L3GA 4XI5C 3CVHH 4GAYB 1TJHL 4UTAL 2Z92B 3VXUE 2UVFA 5K9OA 5C0BA 5A2FA 3K4AA 2P1YA 1GZQA 2AJYH 4X5XA 3W11C 1KJMA 3DVGB 3KDMB 3O2VL 2AKRB 2PF6A 4LLMA 2DIAA 3CVHL 4HIEA 3LKSA 4Q9CA 3H42H 4MAYC 2IJ0C 4XNZC 3SQBA 4CW1A 7CGTA 1XF5B 8FABA 1K8DB 1LO4H 3WXWL 3GBNL 2Q6WB 3RKDD 3W9EA 4PD4J 2B0SH 2IAMC 3K4ZA 1B0GA 3BIAX 3G6JA 4RAVB 5LKNA 5C2BH 1MJJB 3T2OA 3P40A 3H42L 3MPCA 1YEDA 4OCXH 4PY8J 1PW3A 5SX4H 1BQHB 4GSDH 4DAGH 2ADJB 1EMTL 3RY5A 1LO4L 3FB7B 1NCAH 1HEZA 1G7JA 2B0SL 1PEWA 2R2BB 1FLRH 4DVRH 2R1YA 5C2BL 1PZ5A 1T7WA 4DZBB 2J2ZA 2ZUQB 3MYJB 4OCXL 1VSCA 4GSDL 1X5KA 4DAGL 4MJIA 1Z3GH 2J5LC 2JJSC 1NCAL 3JWDC 3Q3GA 4PJDE 4JJ5B 5CP3A 1FLRL 3D5OF 3P3YA 4JN2A 3O4OC 5DMKA 4DVRL 3W11D 2R1WB 2H26A 4UTBL 3IAPA 1UKQA 3FO9B 2Z91B 3FB8B 1HK6A 1R0AH 3RL2A 1ADQA 4HKJB 1Z3GL 1DR9A 4W81A 5FA3A 1AKJD 1C08A 5I6XC 3IU3A 3C8KA 4LPVA 3VJ6B 3V7MA 4N5EC 1HQ4B 4WVRA 4ODVL 4PJAB 5KAQF 4LEOA 3QQ9D 1CE6B 4O9HH 4YDJB 1MHEB 3GMMA 4PS4H 1VCAA 1R0AL 4NO3A 1X5FA 4M43H 5ERWB 2NY3C 5IHZB 3ULVF 2IAMD 1IC1A 5K9KB 3NCCB 4HKZA 2VSCA 1UWEH 3REVB 1L0YA 2D4DA 1YDPB 5GGUB 4MD0A 1N4XL 3V6OE 1CGWA 1R5VA 4NC1E 1EXUA 4O9HL 1P5UA 1WCQA 1J1PH 2F54B 1F5WA 3N85L 3CU7A 4JN1H 4M43L 4NRXB 2X4TA 4WCYL 4NJ9L 5I73B 1UWEL 4H1LG 4LCYA 2CXGA 4P3DB 4Y5YC 3E0GA 5DJCA 5HHPA 3BZEA 3ARWA 1GGCH 4JN1L 3TYGH 5BW7C 4PP2B 4HZAA 2UUDH 3QIBA 2YEZB 3SGEI 3IFOB 1DUZB 1JF6A 2DJ4A 4K7FA 1E28A 1AKJB 5DLML 1AO7A 4MAYB 1XF1A 3BKCH 2WAHA 3BGMA 4BK4A 4N0CA 1GGCL 4LCUB 4OIIL 4FQCH 3TYGL 3CDCA 4N5ED 3WLWC 4XP6H 3Q5YA 4PUBH 5EULV 4GS7C 3EOAA 1GOHA 1DQQB 1W8NA 4XCEB 5I1AB 2IAMB 5LVEA 1XGUB 3VXSA 3SDCC 3QEGL 2NY3D 2R0ZH 3BKCL 5D1ZA 3L5JA 4QNPE 5ISZE 1HN1A 3VXQA 2P5WA 5AG8A 4YHKH 3ARPA 4PUBL 2YZ1A 1QPXA 5E1AB 3MV7A 1GGTA 1JCKA 4L9DA 5EOQH 3BH8B 3KJ6H 4P2RE 4ZUTB 4KK6C 4XNMA 2BY2A 2R0ZL 3S37H 3OAYH 5DMGC 1LEKB 2R1XB 2QR0B 3ARUA 1MSPA 2D7MA 3QUXA 2J5LB 4YHKL 3VXPB 2BCKA 4F15C 5FUOL 4M03A 2OTWB 4FFYH 5EOQL 3KJ6L 3W39B 1HH6B 4GBXC 4UBDD 2OZ4A 3O4OB 4Y19A 2VAJA 1MRCH 4TVPD 3CX2A 3GJEA 4I4WA 1BZQK 4NDMB 2UWEE 4JQIH 1U3HC 5GGSA 1HYRC 5FYJE 3QI9C 5JDSA 3OKKB 5I6XB 2K3TA 5GISH 4FFYL 3KPSB 5JMRA 1R5IA 1F58H 2IANE 3VH8G 2YR3A 1IAOA 1MRCL 4YH6A 3GHEH 2YPLA 1RHHB 1IARB 3TCLA 5GXBB 4GRLA 1V8HA 3WLWD 4L1DA 4G6MH 1TCRA 4OZIB 2BVQB 4N9GB 1SYSB 2NY3B 4JQIL 4M6NH 2A6JB 3SDCD 5GISL 4Y1AB 1MQ8A 3PWPA 5C0CA 5EDXA 5D1QA 3GMLB 2FH6A 4I0PA 3H6JA 5C09D 3GHEL 3HC0A 1XGQB 4GUPB 1I7RA 2Y6SC 4YDIH 3UTPE 1QLEH 1A7OH 5E8OA 4G6ML 1HKLH 3ES6B 1HIMH 4JFXB 4LNVA 4LLWA 4F9PC 3WEXA 3ECBA 4M6NL 4NM4H 4AM0A 2EKSA 1MH5A 1KSRA 3VDBA 5HHME 3D0LB 4KK6D 1G7MA 2E7LA 5KOMC 4FQ1H 1FFNB 2EE6A 3WS3A 1A1MA 4Y5YB 4R97C 5JW3L 2G9HB 5C0JB 3JTSA 1EIBA 1HCVA 3QUKA 4QHLA 5CP7A 4YDIL 3V8CA 4BFIA 1QLEL 1A7OL 1K9TA 4MXQC 4EBQL 4HUVA 1HKLL 1NBYA 4ODBD 1HIML 2M26A 3KPRD 4M7JH 5FXCH 5E8DH 5FO9A 1ZVSA 4NM4L 3KYMA 4YFLF 3WNKA 3V4UH 2R2EA 5C3TA 1W8OA 4FQ1L 1I3GH 5EUOE 4R6UA 3QDMA 5CINH 3ZE1E 4Z7WB 1OLLA 3CPLA 3I9GL 4G43A 4HH9B 1U3HD 1JUFB 1L7TL 2EYTB 3VFNB 3ZE0E 3EYVB 2PNDA 2MKWA 3CNKA 3QA3B 1BF8A 4M7JL 2F8XC 5ICXA 4IMKA 1BD2D 1UWGH 3FL7A 5DFWH 3V4UL 4X83A 4GS7B 4POYA 4L4VE 1KIQB 5SX4I 1I3GL 1XZ0A 2CO6B 5CINL 5SWZB 5CBEB 5DHXB 3SDCB 5FK9A 5GGVY 1ERNA 2XFXB 3WO4C 2ZUXA 2O5XH 3HC4H 5IW6B 5C0AD 3WXVL 4D8PB 3VWKA 2C3VB 4FQIH 4M4PA 1UWGL 4X6DB 2I9LA 4ALAL 4MJ4A 2YD3A 1JK8B 3TBTB 4Y4KD 4Q9QH 1H15B 1FFOB 4H5SB 4XCNB 5IOPB 5EO0A 1UACH 1UXSB 3STZB 1ZGLB 2O5XL 3HC4L 1UM5H 4P46C 3FT4B 4U1HB 4FQIL 1QP1A 3PHQB 4F15B 2BNRA 3K1KC 5IF0A 3MGOB 3NCJL 4Q9QL 2IFFH 4GBXB 1FVCA 3SDAA 2D0HA 4K7PH 1N5YH 3BJLA 3MLRH 4X8JA 5F7UA 3SY0A 3R0NA 3KPNA 3TBVA 4G9DA 4MMZC 1DEEB 2DM4A 4ODTL 4UOW0 1U3HB 3QI9B 1KB5A 3VXOB 3REWA 3IFLH 3GKZA 5DJ6B 3MBEC 5I1LB 4K7PL 5EBLB 1N5YL 3U0TB 2ZCLH 3MLRL 5TH2A 3CH1A 3TNMA 3MRFB 1RULL 4RX4D 4MQXD 5T1KD 5C1MB 3GIZL 5AYUH 5JW5B 3L3IB 4D3CH 2X4OB 1KB9J 3HKFA 5C0AB 5FCSH 3IFLL 5DJXB 3U7AA 3G08B 4MMXC 4HIIA 1M7XA 2ZCLL 4CKVX 2I9TB 4OGAD 3FHAA 5MEPB 2P49B 1MHHA 3RUGB 1U8LB 1I1AC 4L8BA 2DWDB 4D3CL 5CMAB 4AL8L 4HJGB 2UVEA 3RU8H 2BP3A 4C54A 1FFRA 4R97B 1ITCA 1P6FA 1F11B 3VFTB 4O2CB 4XCFL 1ZGLP 4P46D 2OI9A 3OHXA 4Q6IC 1FNSH 3RX5A 3IDXH 4OFYA 1DFBH 4BKLB 1QSED 3RU8L 3TESA 3I75A 4BQBA 4HIHB 2BVPA 5FYLD 2XNAB 4CN6A 3JTTB 1YEFH 4NKMB 4WDIB 3MROB 1CLOH 4B50A 3QNYB 3TNNA 1FNSL 1X5ZA 3MBED 1B4JH 3T65A 3IDXL 3BZFA 1DFBL 5ACMA 4XBGB 3LV3A 1BZ7B 1NGZB 2LTQB 4G8GE 1YEFL 1XCQA 1WZLA 3WO4B 1LMKA 3NA9H 5JHDB 1EH9A 2R8SH 4L9LC 1B4JL 1K5NA 4NSKB 3MFGB 3ETBF 4Z95H 4M7LT 3VE0B 1VPOH 1IBGH 1EJOH 2HWZH 3P4MB 1I1AD 5EBMB 1CFSB 4X6FB 1T5XA 4LCIH 4X6EB 4YBLC 1GZPB 2VZUA 3NA9L 4JFQA 5FB8A 4P46B 1E6OH 4U1IB 3MRMB 2R8SL 1RURH 2BSRB 4Z95L 3EZJB 4N0FA 4EOWH 3IDUA 1VPOL 4DKAA 3L3KB 1QVOB 1V7NH 1IBGL 4MSWA 1EJOL 2GKIA 3IDIA 3M1BB 3QEQA 3N1FC 1Y6MR 4LCIL 1FL3A 3MRLB 1QRNE 1E6OL 3I3EA 1RURL 4PJ7B 3UBXA 5IBTH 3HPJA 1CQKA 4EOWL 4EN3A 3QB7C 3QDJA 4OLZH 3ALWA 3HPLA 4XXCA 1V7NL 4Z78B 4XXDA 3MBEB 5DHVH 1BLNB 4OF8A 4G7YH 3S4SB 4FFVD 1G9MH 2APXA 4LSSH 5BS0D 4FQQA 4U1LA 2NY5C 3MCKA 2V2TA 2VISA 1MY7A 5F1KC 5B22A 4XC1H 2RR3A 2XG4A 3QFDB 5MEQA 4OLZL 2WINA 4TNVK 1FQ9C 4X7FC 2KL6A 3TCXA 1G9ML 4LSSL 4K23H 1T2QH 4OV5B 4NCDA 4CADB 1J0JA 1I1AB 3I50H 5JORB 4XC1L 3NBNA 1FZKB 5HJ3B 4QHUA 2AJZA 2NY2D 2LU3A 1NDGA 1ZT7A 4ZODA 1HINH 4I48A 5SWQB 1MAML 4UQ2A 2D7PA 3FN9A 1QBAA 1I8KB 2OL3A 2F74B 4WI6A 2E9WA 1IFHH 4K23L 4J2XA 5DEGB 5ID1A 1E4JA 2A73A 3IJYB 1B3JA 4Q6IB 3RX8A 4KY1H 5D71L 3I6KA 1MEXH 1VFBA 4KZEH 1UCBL 1YY8A 3UAJD 1HINL 3VXNA 4XP4H 2R9HD 3FN0L 3TA3C 1JNHA 5C7XL 3LKPA 1U8OA 2FX7H 2CUMA 1MCIA 4LPWA 2FO1A 1MCDA 5DJ8B 2FDBP 2VABB 4NQSB 3QH3B 4KY1L 5J11C 2AV1B 4KZEL 1QFOA 1VEOA 5KSUA 3P0VH 4XP4L 1ZLWH 5E56A 4PRBA 3RWGB 3DARA 4MVBA 1UEYA 3HR5B 1P5VA 2D7TH 3IXAB 4YE4H 1ZLVH 4YX2H 5CEZD 3BXNA 3GSNA 3FTGB 2VUYA 3FJTA 4N90E 1WK0A 4L9LB 2AXGB 4P49A 5IESH 4V2CB 3DURA 1UC6A 4F7MB 3HMXA 2AK1H 1KJVA 4F7TA 3L3JA 2NY2B 3X14A 2D7TL 2FX8H 3K46A 4YX2L 2OJEA 4YBLB 3C2AH 1VFMA 2D31B 1G7LB 3ARFD 1J1OH 1KF9B 1LWRA 4LPCA 1H0DA 1T83C 3BPCA 1U8JB 4L1HA 5IESL 3GB7A 3MJ8B 4QF1B 4DJMA 5DO2D 3SKOB 5HD8C 5E7FA 1EEUA 2HMID 3JUZA 2FX8L 1CCZA 1YYMH 4X6CE 5D2LA 1F3JA 3C2AL 5BVJB 3Q5TA 1RIUH 4YDKH 1BMGA 2AK4A 3QHZH 1FNGA 4PJXB 5AZ2H 1C12A 4QEGA 1T6VN 3GMNA 5H35B 5EOTA 2G5BA 1YYML 4KKCD 4R2GC 3CDGB 3VFGH 1RIHL 4I2XE 1RIUL 5CJOH 3D2UA 2A0LC 3QHZL 1H8SA 1YN7B 1L6XA 4O51B 2BY1A 4PV8A 3TN0D 5BV7C 1PKQE 2XXCB 4KKNA 5DC0A 4H25A 1CXFA 2YPVH 3VFGL 4MJ6B 5CJOL 2OL3L 5EU7E 5FYJH 5A3IC 4Z7UF 2ZKHL 4PRHE 4MNQE 2FHBA 5ACLA 3QIUC 5E5UB 3DUSA 2X1WL 4UT7H 3KHQA 5EBGA 3G5ZB 3LOWA 1QA9B 1VHPA 2YPVL 5DUMH 3LKNB 4PJCB 3U1SH 5FYJL 3L5WB 3FQWB 4EUPB 3LN9A 5JXEC 1UA6H 1C5CH 3EZ8A 5FV2A 4QRPD 5HD8D 4ZSOE 4Z0XB 4LHQB 1W72H 3CZFA 4KMTH 3ARDD 4HFWB 4POZD 4UT7L 4WFGD 3TA3B 2VNCA 4ZPVA 1OVZA 4U1MA 1XEDA 1KCGC 3BIBX 3B9KC 2X5PA 4S0TD 1B6DA 3MRNB 5DUML 3U1SL 1II4E 2VWEE 1JRHH 5J11B 1A4KA 1C5CL 1UA6L 3QDGB 2M8XA 2CDEA 5GS0H 2PW1B 3SCMC 1W72L 2GSIA 4KMTL 4R2GD 2F53A 1OF2B 1QSFA 5I19H 4L8CA 2WANA 2D0GA 2QHLA 1T1XA 3LD8C 2HP4A 3QEUA 1INEL 2A0LD 3TN0B 1AR1C 3QXDA 1MHPH 4IRSC 1JRHL 2ESVD 3H9ZA 4I8DA 1TFHA 1IQWH 4XRCA 3FQRB 5I19L 2DBJA 1R24A 5FUCC 1GC1C 1XGRA 4LRNH 1IVLA 2AS5M 1QYGH 1Q9KA 1WLHA 4P5TC 5B8CA 4S1RH 2DM3A 4QRQB 3QIUD 4JFDD 4J3SA 3T0DA 4G6FD 4ONGH 2VLRA 4K3HA 4Z7WF 3V5DB 5MENB 3G5YB 3QZWB 4DUWA 4QRPB 4HLJA 3QUYC 4DN4H 5L8LB 4LRNL 1L9MA 2E6JA 3DX6B 1QYGL 2HTKC 4S1RL 1CFNB 1LEIB 1I7ZB 1H3PL 1O5DT 2OR7A 4ONGL 4P4RA 4EVNA 2RFXA 4U1KA 1ZHBB 3AREC 4Y2DA 5DC9B 1J5OH 3T0EE 3N50A 2BNUA 4DN4L 3KGRA 5CIPA 1T0NA 1Q0YH 2DYPD 5I76A 3MGAA 4R2GB 5DQ9B 1Z5LB 2PYFA 1S7UA 3HI1B 3IDMA 3U4EB 2JELH 4WEMB 4X6DF 3SCMD 3WDIA 4D0DA 2MCG1 1P7QD 4ZFFB 3BKJH 3H7BA 5FGBA 4PJ9C 2ESVB 1J5OL 5E9DA 5BV7B 3MLZH 3IDGA 1Q0YL 4IRSD 4A2MA 3Q6FA 5F72S 4D94A 2JELL 4PRPA 4O2FA 4K55A 3UTTA 2EECA 3PHOB 3INUH 3QIUB 5IEHB 4G6FB 4JZJA 2Q7YB 3MLZL 1T66C 2HJFB 4K3EH 3AGVA 2O61B 3QJHA 4EI6A 1CT8B 2EDXA 3C5JA 3OAZH 1HOCB 3ZHLA 4QGYA 2JCCB 1QBMH 5KS9F 3TLRA 2PW2B 5I16B 2DLIA 4KUZH 3RIAK 1HHIB 2ZCHH 3INUL 3QUYD 4ZO9A 3O3AB 1NGXA 1FDLH 2HTKD 3L3HA 2V9QA 3MV9D 4K3EL 3VXMD 4UV4L 3B9KB 2DKSA 3C2SA 2OYPA 1TLKA 3BEWA 1S9YA 1NMAH 1ZLUH 3W9DA 5JW4R 4J1UA 4L3CB 1QBML 3BP4A 2DYPB 4KUZL 2HT4D 3LMJH 3KYOA 3SCMB 1JF5A 2EYSB 1P7QB 1FDLL 5HYSA 2VKWA 2EDDA 3K2UL 5M95B 3LD8B 3H3KA 3RUGF 1PQZA 1NMAL 4PD4K 1T1YB 2X1OA 1GOFA 4IRSB 2WW8A 1UCTA 2AEWA 4ZNEE 3G6AA 4G9FB 3LMJL 4X4XB 4L4TA 5H94A 3VU2A 3KPOA 3UYPA 4WW2C 2W65A 5EZOH 3C9NB 4BQ6A 3E3QA 4P5TB 4J3WA 1A3RH 1IGJA 2AABH 2DBLL 2P5EB 3HLAA 4WNQB 3WFCH 4YNYA 2ZSVA 4IHOB 5DVOA 5D1XD 4B5EA 2VQ1A 1GJIA 4PGCB 1F6AA 4HIJA 5BXFA 4HS3B 4ZFZB 5EZOL 3QUYB 5J13C 3DI3B 5I75C 5E2VL 4U0QB 5FFLA 2AABL 4J3TA 2QQLL 2V5MA 1KCSH 1G7HB 2Z35B 1N59B 2HH0H 1AC6A 2DTSA 3NCFB 5K9QG 3ORJA 3QFJA 2VDMH 3CSBA 5SWSE 1AE6H 5C07A 3AREB 1EFXA 4Q74A 3QWOA 2FX9H 1QOKA 5IW1A 3LIZH 1PYWA 5LJYH 4N0RA 2Q86B 5DD1H 3S96B 4LCWD 3QSKB 5JW4Q 3RVTC 1KCSL 1SHMA 2HH0L 3I3BA 5ESVB 3UBXG 2VDML 2BERA 4PJ9B 1YUHB 5AD0B 2OSLB 4MA7L 4H1LB 4NQDB 2ICWB 3VRLF 3OKMB 3V52L 3LIZL 1JGDA 4JGUA 3K8MA 4U2YA 5JW4N 4FXKB 1DE4B 1CE1H 2O5ZH 1OARL 1KUMA 3EO0A 3RI5F 3N1GC 4Y4FD 4G59A 4OZHA 2EDYA 2JLLA 4ODHH 1I1FB 2EICA 5GRXG 2JJVA 4LSPH 1D9KA 1UEMA 1LK2B 1HHJA 3EYUH 3DGGA 4XWOC 3CX5K 5HGDA 1CE1L 1YMMD 5CGYD 1Y18A 3STLB 2IBZX 2ATKB 1U8PB 2NW3B 3BD5A 1T3FA 5F7KC 2VDRH 3T3MF 4Y16A 4ODHL 3AUVA 3TF7A 4WIQA 2WQRA 1JRHI 4OF3A 3MO1B 5EH1A 4LSPL 2XZCH 3C5SA 3MCG1 3PWVB 1A7QH 4MNHB 5JUEH 4PTUB 2G2RB 2KBGA 1I1YA 1K8IA 2VDRL 4JFED 2DJUA 3RVTD 3X13A 1VGEL 4E41D 4LGRB 2M1KA 3UTZB 2JIXB 3PGDB 3ARGC 2XZCL 4XH2B 5IB5A 2YWYA 1D5XA 1YZZA 1A7QL 2J8UA 5I8CA 1S7QB 4U0RC 5JUEL 4YZFF 5ELIA 5ETUB 32C2B 2AERT 4Y5VA 4WW2B 3R4DA 3O9WC 2A83A 3OKDB 4TN9A 4Y4FB 5I1CH 1NJ9A 4NYLB 3BW9A 3S3PA 4QTHA 1RQ5A 5H37H 3VFRA 1DP0A 3ULSB 1HSBA 1Q0XH 1ZSDA 4XX1E 1J0HA 3ARSA 1YMMB 3S35X 5L88H 3PL6C 3K81A 2W9EH 5J13B 5I75B 2WIMA 5I1CL 3EO1B 3D0VB 4YC2C 3VH8B 1WAAF 4HZLB 5DUPH 3QR2A 3ARVA 1GPOL 3O4LA 5D6DC 1UB5B 1Q0XL 2Q8AH 4HWNA 4Y5XA 5ANMB 3TJEH 5DRZA 3ULUD 4HW6A 4NRYA 3NCEB 5L88L 4PJEF 4CMMB 2P8LA 4KQ3H 1EBPA 1I7UA 3SE9H 4XNQB 4G7VL 4X4ZA 3VI4F 1NKRA 5DUPL 4JFEB 1L6ZA 1ZHNA 2C7UB 5TDPA 5T5FL 5C0IA 1AI1L 1KYOJ 4E41B 3GSWA 3KS0J 3TJEL 3GJFH 1IAIL 2RCSH 2YC1B 5DJDB 5HVHC 4FNLH 3CSYA 5E03A 3TT1H 2NY0D 5EO9B 2PTVA 3PNWA 3ARGD 4KQ3L 3SE9L 3T1FB 5TDOB 4WU5B 1NBVL 3MLUH 4RIRA 4MDJA 3RWHA 4WUUD 4BZ1H 4OM1H 1TZHA 1P9MC 2IADA 3O9WD 4PJGA 2RCSL 3FOMA 3KLAB 3MRRB 4JRYD 4FNLL 3IDYC 5F6HJ 1U95B 1JZ5A 2FJHA 1U8IA 2OMNA 1CFVH 3MLUL 3DO7A 1JHTB 1PJ9A 3MA7B 1ZT4A 2X70B 2BSTB 4KK5C 5L8JB 2F19H 1WGOA 4LHUA 4BZ1L 3D3VE 4P2QA 1T1WA 2J1KA 3PL6D 5GRJH 3QRGL 2YUVA 4HWUA 4PJXF 2FYYA 5F3BB 3G04B 3RWDA 3T04D 1NC2A 1NPUA 4R0LA 2VL5B 5IVNA 1T0MB 1P2CB 1CFVL 4E9LA 4KROC 3LKRB 2HN7A 3MNWA 2F19L 2QKIA 1VEPA 2PN5A 4JZOA 1I3RB 3I85A 3HR6A 3ILQC 3PWNA 5IG7B 2HKFH 3T0BA 5EU3A 4P48A 1J8KA 3P73B 2I07A 2X9YA 3V6FA 4HC1H 2B1HH 4OGZA 1OAQH 4JRXA 3WS6C 4ZG1A 3ARGB 4HBQA 4HGWB 3IT8D 1LK3H 4U0RB 4OQTL 3HG1E 5FF6B 5E6ID 1X5LA 5A16A 4WUUB 2OCFD 2HKFL 4KDVA 2ATPB 4GRWF 4KKAC 3O9WB 3ZT7A 1SVZA 2VKXA 4QOKE 2X4NB 2NNAA 4JRYB 2QADC 1GIGH 4XAWH 3CXHJ 2P42B 3BDXA 4PJCF 1KCVH 4NKQB 2DIBA 5J0BA 2FGZA 2ILLA 2R0KL 2HFTA 4MCZA 1KPRA 1IEAB 3MCLL 2DQFB 2DQCH 3VMNA 4JVWA 3DYPA 3PL6B 4PG9B 3HRZA 1FLTX 5IVZA 4YC2B 1GIGL 4DVBA 4XAWL 4FA8A 1AQKH 1TETL 2H9GB 1TVDA 2XPGA 5E8EB 1H5BA 2YN5A 1KCVL 4HF5L 5C0BD 1UM4L 5I8EB 3GSVA 4FG6C 5CD5D 5HDBF 5DD3H 5GGTH 3CUPB 3DX8A 3NH7L 5D2NE 1RZKC 3PP3H 3D6GA 1JIBA 2DQCL 2GI7A 2FRGP 1S9WB 3RPIA 2FLRT 3RX7A 3WLBA 1BECA 5CJ5A 3C60C 1IKNC 4GW5A 3GMPB 5D8JH 1AQKL 4ZUVA 4ZD3H 1FCCA 3QEHB 4OD2A 1G7QA 4FTVB 1MOEA 1OL0A 5DD3L 3H9HA 5HYQB 5GGTL 2WBKA 5EC1B 3P4LA 5EIVA 5HVHB 4OI7A 5F7YC 2P7TB 4FHBD 4LLDB 1LO3H 5KVGH 3ULVL 4J4PC 5D8JL 3DYOA 12E8H 3UYRH 3HNSL 1XCTB 4ZD3L 2NX5A 4RGOH 3ROOB 1YNTA 5C0RL 2C1PA 3RZCC 2GHWB 3KLDA 2NZ9C 4UINH 1P4LA 2IMNA 3QDHA 2QADD 1D5MA 3IDYB 5IB4B 1IL1B 5T3XD 4U7KA 1LO3L 5KVGL 3OGOE 3UYRL 12E8L 3RGVC 4NUJA 5MHSD 3CVIH 3L3GB 2GCYA 4RGOL 3GUTA 1L7IH 1T03H 4MJID 2ICES 2XQYG 5DJ0A 5SV3A 1SBBA 3BHBA 3RVXC 3JVGC 5F9JA 1GZQB 5GGVL 1P84J 2YSSB 2ZG1A 4DK3A 3DV6B 3CDFA 4KGLA 5LAXA 2ZZUT 3QIBC 2XZZA 1FL5A 4BQ9A 3CVIL 3ZYZA 3FO0L 4HIEB 3PWJA 4KROB 1ZWIA 2C4FT 4KU1A 4Q9BA 5AAWA 3OJDA 2VXQH 4CW1B 3EGSB 5D7KE 1OGTB 3O6MH 3NFNA 8FABB 1EBAA 3V0VA 1I8LA 4N5UA 1KIRB 5HTSA 3GSXB 3W9EB 4UQ3A 3EBAA 1B0GB 3G6JB 4FABH 3QCVH 4GKNA 2DDQH 3LEVH 4HK3J 1XF4B 5HXMA 1YEDB 2VXQL 3QXVA 1RUQH 3TV3H 3O6ML 1IM9A 3PWLA 3T0VA 1GGUA 5HYSG 1G7JB 2QADB 2NZ9D 4X9FA 1CGXA 3U0WH 4FABL 4IMLA 1PX4A 3QCVL 1FV1A 2R1YB 3PF2A 2DDQL 5L2KA 5EPMB 1HHHA 1T1ZA 5F7NC 1S8DB 3JBG7 3CFBA 1RUQL 4HMEA 2MFNA 3TV3L 4JZNA 1YJDL 4MJIB 3LRSA 4K8RC 3FRUA 1OTSC 2IWGA 3Q3GB 3HNTH 1DBMH 4Q2ZB 3U0WL 3RVXD 1CLZL 4KDTA 1IAII 4JN2B 1L9NA 4Z7UE 4XCYA 5DMKB 1E4KA 3MRHB 2C26A 4K94L 1ZHLB 4JDZA 2H26B 1IM3B 1NANH 1H3GA 3QIBD 5LWYL 4BFBD 1DQMH 2A2QT 3C8KB 1AO7D 3HNTL 2LU4A 2G75B 2OQJA 3MX0A 3BD4A 2UZXB 1IKFH 4LEOB 4N0CD 3FFDB 3F7RA 3VDCA 2X40A 1JN6A 4S1SL 4NNYA 4NO3B 1KIPA 4NQCA 3MV8E 4UDUA 3VXSD 3AM8C 4NJAH 1DQML 4NUGL 3WD5H 5I2IA 4I77L 1U8QB 4AEEA 4M4RA 2P43B 5D1ZD 4MA1C 3VFWA 2V17L 4KI1A 4HCRH 5HDLA 3RZCB 4HUNB 1EXUB 2XWJB 2P5WD 1F2QA 2L0DA 5F97E 3D25A 2SEBB 5JQHC 3BEVA 3WIHA 1HKFA 3MV7D 1UENA 2D03H 1UGNA 1RI8A 3FFCA 4NJAL 1RIVH 3WD5L 4LCYB 3RGVB 1TTFA 4HCRL 4G6KL 5EZLA 5HHPB 4U7MA 4K8RD 1ES0A 3QUXD 4EXKA 3BZEB 1OTSD 3WIFA 2L7JA 4D0CA 1T89C 4KMQA 3SE8H 2D03L 3RWJA 1RIVL 3SDDA 4TVPE 4JQVC 4Y19D 3QIBB 3TBWA 5BVPL