4PGDA

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaf
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pgdA01
3RGVC 3MLUH 3QNXA 3PQYA 3BP5B 1A6AB 1WT5C 4FABH 4PLJC 4WVRA 3MRQB 4L8CB 3CXDL 2AQ1A 1BQHB 3O3BB 5GRYA 1HHGA 2C1OA 4MVBA 4LSTH 1RI8A 2CGRH 3QUMB 4JO1H 2ZSVA 2EEAA 2VXVH 4NO5B 5CJXC 5L8KB 3V52L 1CICD 2F8XC 3BW9B 3ZKMC 1I3UA 1U8KA 3RUGA 4WJ5A 4JRYE 1CFVL 1A7PH 5K9JL 3CJJA 4FFEX 5EU4B 4JEGB 4POZC 4Y1AE 1MH5B 3M1BA 1J0IA 2HT3D 5J4MA 4UIKL 5DRZA 4F33A 5KANI 1IQDA 1E27A 1KENH 4QYOB 3KPSA 3FOMA 3BFOA 2WINB 2OL3B 1HH6A 4G6AD 1FZMB 5HYQA 5ILTH 2R9HD 4Q6IA 1TJGH 1N0XH 2IALA 5AZEH 2IH1A 2D7OA 4MSWB 3RFZC 1HIML 2VQUA 4FZ8H 4WW2F 5BW7A 1UB5B 2UYLA 5IBTL 4WEBH 5GRXG 1HN1A 1JPSL 3NCJL 1CVSC 2V17L 3ETBF 2IAMD 1O0VA 1AR2A 3HI5L 2EDQA 4Y5XC 1DCLA 1LK2A 3GMQB 5J12B 4KPHL 2BC4B 5KVFL 2QSQA 4JKPL 4OZ4B 4K23H 3WLWD 2PW1B 5E99L 2DLFL 2B4CH 1WGOA 2YWZA 3HC0A 4UT6H 4Q2ZA 2JLLA 2BVYA 2P5WB 5FUOH 4I0PB 1UM4H 1ORSA 5E8EA 4HFUL 5F7HA 5A2IH 2O61B 1MIML 1FLRL 5EG6C 2ADFL 4RAUB 4EDWH 1LEKB 4B0MM 5HHPA 3U2SA 1XF1A 2JE8A 1CFTA 1OGAE 4PB0H 2J5LB 3MV7B 3KYKL 5GIRA 5JPMA 4LF3A 5E8OA 2P8PB 3KAAA 2XICA 2XTLA 5GJTH 5JPNA 1MRFH 1D5MB 4F9PA 2EH8H 4QRUA 1N3NB 3VGEA 1Z0NA 2WM0A 4ODVH 5DJYB 4Z0XA 1MEXL 2NX5E 4Z7VB 4ZFOL 1A7BA 3QO1B 4X83A 3DURB 2NQCA 1CD9B 2VISB 1CT8A 1T20A 1SVZA 2C5DC 4WWID 4OCRH 4GAFB 4GQ9L 2YUXA 4LRIC 1I4FB 3STLA 3MRCB 3JWOL 3SGDH 4I2XE 2OR9L 1Z2KA 3QDAA 1RURL 4OF7A 3B9KB 4APQC 1FL6A 1UH3A 1FNSH 2EE6A 4HPYL 1GZPA 1VFMA 3TH2T 5F7DB 3W39B 5I19H 4JFXA 5D7JA 4C59B 3GEWB 5F7EL 1J12A 4UIMA 3NACH 4FQLH 3T1WA 1KJMB 4WUKL 4F7MA 2GW5A 3MREB 4LCCB 1GGCL 3GSNA 1A1MA 3STBA 3F58L 2FX9L 4FZEH 4FQ1L 2C3VA 2X42A 2OJEB 1I7ZB 3TWCH 4YHNA 3WE6B 3IGAB 3RZCB 2PTVA 3ZDYE 3VG9B 5IMMB 2I9TB 1I1AC 4HGWB 2H1PH 3NZ8B 4WUUB 2Y6SC 3IDJB 3MMEB 1RU9L 1F45A 1MCWW 1G6RB 3VWJC 4BFIA 4DKFL 2P5WD 3OXSA 3GMPA 3KJ4C 4I0PD 1DUYB 4HT1L 1QNZL 1QOKA 4HV8A 3L5WB 1S8DB 5DMJB 2IFFH 5ICZA 3GMNB 2HLFD 1SJEB 5CGTA 1OD9A 2MFNA 5HDOA 1EHAA 1MFCH 1VSCA 2AJUH 3O3EB 3DXAA 4N0FB 5DEFA 5HVGB 2DLIA 3MV7D 2X2YA 2KQMA 5T3ZL 2F53A 5J6GA 1H8NA 3ARFC 4TTDC 3L3HA 5D4QA 3JWNC 1U3ZA 8FABB 5JUEH 5LQBH 3QFJE 4GAJL 3FQWB 4NO0B 4PJEB 2WIIB 3VD7A 5GS2H 4YUEL 1T21B 1CGWA 3T77A 2WQRA 4NRXA 5F7WC 1DBKH 4RGNB 4EBQH 5I8CA 4ZDHB 3W2DH 4HFWA 1S7WB 4CVXB 5DEGA 4GS7C 1X5GA 4TULL 4NRZA 3O6FB 4PRBA 5MENA 2Y5TA 2XNAB 1UJ3A 3VFUB 1T7WA 5A1AA 3HA0A 4PG2C 3MO1A 5J11B 1M1SA 4HDIA 1CQYA 2R2HA 2DMKA 3IFNL 4N8CH 5KSBE 5F9WB 1AGCA 3MLWH 3ARDA 1EEQA 5KVGH 1AD9B 5CKAA 2A6IA 1ETZA 1IC4L 2VITB 4HZAA 1G7IA 4Y8AA 4DN3L 4PJ7B 1XH3A 2ZCHL 3WXWL 5HHQA 3HC4H 1R0AH 1K6QH 2C1PB 3KDMB 3FCTB 3F12B 4WEMB 3SO3C 2IG2H 2VWEC 1D5XA 1J9CT 4UT7L 2Q3AA 2AJVL 3QDMA 3FQUB 1FIGH 1WJ3A 3NIDF 1GGBH 5D72L 3RZCD 4JO3H 1DUZA 4M62L 2WP3T 2VC2H 1XGPB 5EH1A 1TJIH 4GW5A 3U36B 3CVIH 4WUUD 3HZMB 5E2UL 3NA4A 4ELMF 4P9HH 2XG4A 3K8KA 5I66A 3BVNB 1RIHH 3ZYOA 4HCRL 4X9FA 1KB5H 4IRZL 2X4TB 1BZ9B 3CC5A 2W9EL 3D39A 2J12B 5D8JH 2OYPA 3F7QA 4BQ6A 4OLVH 4NBXB 1TTFA 1MRDL 4LGSB 5FM5O 3U9UA 1ZA6A 4NNPL 2P5EE 4YHYB 1Z9SA 1KV3A 4KQ4H 2XZCL 2QSCL 3QHFL 4GW1A 4UQ2B 4A6YH 2AAVA 3B9EA 3GSQB 4NO0D 3HZYB 4U3XA 2ZZUT 3T0BA 3NIFE 1S7XB 3ZTJH 5CEZD 4PP1C 4ZOBA 3T3PF 5F8RC 4RGND 1G1YA 3VFWA 5IM7A 2VERN 3HNVL 3DRQA 5HHOE 3HMXL 2H2PC 3QQ3A 5I1LA 4WGWB 2HAZA 4M7LT 2RHEA 3HUJB 1TETH 3VRJB 5DGQA 4L3EB 1QO3B 1A7NH 1ZHLA 1C08B 3WJJC 4LLMB 2GY5A 2C4FU 2VXUH 4IMLA 5IUSA 1QFWH 2IGFH 4U6XB 5ESVB 2IAMA 4GQPH 3O6LL 3O3AB 3UBXG 3N1PC 1KCUL 3ULUE 2CSPA 4HWBL 4O02H 3QDJE 5DK0A 1ND0A 4QOKE 4CADA 5TDNA 4NO3A 1DDHB 4LSSL 4MB5A 2X4NB 4LEOA 1T4KB 1XGUA 4HMDA 5AAWA 4R7NB 4DZBB 3WS6A 4IRSA 1WEJH 3NN8B 3OB8A 4OZFA 5F96L 4ZOCA 5JO5B 4PFEA 2XYCA 5FUCC 1RZKH 1Z9LA 1B2WH 4JKLA 4KTYA 4M3JA 4DZ8B 3BP5A 1A6AA 3H9YA 1IT9H 3N1MC 5L2KE 4XWOC 4L8CA 3MRQA 1B0GA 4RISL 5HYJB 1YEKH 1BQHA 3PDOA 1VESA 4S11A 3VXSB 2Y06H 3QUMA 4GW4B 4F7EB 3L5XH 2XXMB 4HWUA 4F37K 4X7FC 5DQ9B 4WIQA 4ZO9A 5FYKD 2GAZA 1ACZA 2WNGA 4JN1L 1CDYA 3VFTB 3I2CH 1HILA 2WWKO 1NCCL 1NGXB 3UYOD 2JK5B 1X5JA 1AGFA 5EU4A 4NT6B 3K2MC 4XP1H 4HXBH 3MYJA 5CLWA 1MH5A 1Q1JL 3T3MF 3LN4B 4RFNC 4Y88A 4QY8B 2KPNA 4D94A 4JRYB 4QYOA 2KZWA 3TA3C 2WINA 3V7AG 4R8WL 1O7VA 3JUYA 4Y1AB 3U4AA 1FZMA 1MVFA 4XNYL 4KHXL 1A5FH 3ZHLA 5DT1L 4MSWA 3SDAB 2R4SH 5D1ZB 5JOPE 3N50A 1NUNB 4IMKC 4L3ED 4K7PY 5KSVB 1UB5A 3DNKA 3WJLA 5EIVA 2XWBA 5E2WH 2X4SA 2EDWA 5INCB 4FQJL 1HDMA 1UM6H 1DLFH 3GMQA 3O4OC 2BC4A 4NN5C 5C07D 4X6CA 1AGBB 1NSNL 4GG6F 4NP4L 4P2OD 2PW1A 1UADC 3VRIB 3CVHB 1MCPL 1GPOL 3VFGH 5EORH 1ZOXA 5MEOB 1LP9F 1HH9B 4JZJA 4TPRL 1A6UL 2CKBB 1LEKA 2X10A 4RDQF 5HYJD 4ODTL 3W82A 3VFPB 1Z0MA 1AXTH 3NGBC 3VXSD 3MV7A 4NJAL 1FNLA 1W0WB 1JPFB 5CIPH 1A02N 4PUBL 4WRLA 3SQOH 1IQWH 4AEFA 1OGTB 4FQIH 1C7SA 1D5MA 3ERYA 3K8MA 5C6TH 1OGAB 1N3NA 1W0VB 1DVFC 4AY0A 1A64A 1DSFH 5DJYA 1WCBB 4H0IA 2VABB 4Z7VA 2BK8A 1PW3A 4GT7A 3R1GL 4TRPL 3KPMB 2VISA 5EU7C 1KTDB 2J4WH 3EIFA 1L4IA 2AXGB 1JNJA 1JFMA 4WV1C 1I4FA 4IJ3B 3MRCA 2NX5B 5GS1B 4JRYD 2FJFB 4PGZA 1EO8L 4YFEA 4NZRH 4Y1AD 5DDHB 3W39A 4JM2A 1C1EH 4JHWH 3DI3B 1Q72L 2G60H 1FNEB 2L4OA 4I2XB 3SDAD 4BH8B 3BO8B 5ESAB 4TOYL 2FSEB 4DN4H 1H3PL 1HSAB 4MZ3A 2Y36H 4KJQC 4V3DB 1JGVH 4K7FB 2OJEA 4KKLC 3QIWC 4UOJA 4LQFL 3WE6A 3IGAA 3W11C 3RZCA 1ES0B 3T0VA 2EDTA 2F58L 4RMVA 4C56E 2I9TA 4HGWA 3NZ8A 2DF3A 2FLBT 4WUUA 3MTRA 5FYJL 4PP8C 4IRJB 3IDJA 3GSVB 3MMEA 4POUB 1I1YA 4M3KB 1G6RA 5ERWB 1YEHH 5J7CC 1F4XL 3LIZH 3ZE1F 4DKAA 4LBEB 3U7YL 3S9DB 4ZD3H 1H5BC 1HZHL 3V4PH 1UT9A 4KK8C 1MAML 1QYGL 2HH0L 4Y5YB 1BVKB 3L5WA 1S8DA 3GK8L 3NA9L 3GMNA 1MCWM 1SJEA 1KJ2H 3G6JF 4Y7MA 1MCKA 2F5BL 1RV6X 3DVGB 4M7ZC 3E6FB 4CN1A 1WVZA 4R0LC 3FB8B 1ZGLB 1G9ML 4HIJA 1FZJB 2G9HB 8FABA 1F5WA 4MAYB 5F9OH 4OBSA 4NO0A 3MRJA 1OGAD 4PJEA 1XZ0B 1CL7L 4UDUB 2CRYA 2O5XH 3UTSE 5GISL 1DN0B 2WLZA 2P4AB 1ZT1A 4ZDHA 1LGVA 1J7VR 1S7WA 4CVXA 1W8OA 3QFJB 3D85B 4K94C 3VFRB 3Q1SH 5FGSA 1Q9KA 2BNQE 3IFPB 4JY5L 4PJDE 1YUHA 1J1PL 4X7SL 5IVXF 4PV9A 3U46B 5IP4A 4PGBA 3MZGB 2WBWB 2R69L 4H0HB 4KV5E 4DW2L 3VGDA 5T1LD 1AD9A 2W59A 2VITA 4ZO6A 4HJGA 4IIQC 2QQLL 3QIBA 3OXRB 3S96B 3MCKA 5F7UA 2RGSA 2VN4A 3ZE2F 5KSBB 3VGHA 1EK3A 3KDMA 5M95B 4NFDA 3F12A 4NN7C 1EVTC 2CH8A 2X4QB 3E3QE 2UWEE 15C8L 3NBNA 4WI5A 4PJIE 4W4OA 3ZKNC 3CK0L 4P2YA 1DN2A 2AJXL 3FQUA 4HJJL 3O2VH 3EJZC 4R26H 4KTEH 1XCTA 5IMKB 1R24B 2DM7A 3U36A 3QFDB 4HC1A 4IRJD 2YD6A 5SV4A 4K71C 4NNYA 1T5WB 2HTKD 4ZUTA 4YBHA 3V2AR 3BVNA 4XVJL 4OB5L 1MJ7L 2FJGB 5D7LE 2VDLL 3P4OB 4Y4HC 2W0PA 4WCYL 2CMRH 4L1DA 1SBSH 1JPGB 3CU1A 4LU5L 5KG9B 2FLRT 3V7AE 2X4TA 1BZ9A 3UBXI 1ZLWK 2H2SC 1O7SA 4X5XB 1NFIA 4AEHL 5GGTL 3QCVL 1TQCB 2QR0B 4G5ZH 5I15H 4ODWB 4URTB 1LHZA 3S3SA 3ALWA 4Z6AT 3WHE1 5D6CB 4MAYD 4P5TC 5C0NC 1TNMA 3HZYA 4ZXBB 2CIKB 5HHXL 4AENA 4OIIH 4P23B 1S7XA 4OFIA 3IDYC 3TJEL 2P5EB 4LLYB 3RL1A 2EDBA 3EYQC 3OSKA 5CGYD 4K7PH 1RULL 3D85D 3QFJD 2FO4A 4K3DL 5GGQH 3V9FA 4AEEA 1L7TL 2AEPH 1P5UA 4X7DC 5D2NE 3X14B 5DK3A 2R2CA 3VRJA 4ZSOE 3MUZ1 5HHOB 5KVEH 4L3EA 1QO3A 1EV2E 5DHXB 1C08A 2HFFA 2P46B 1HHKB 3CFKA 3L7EB 3DWTA 4AEIL 4U6XA 4WO4C 5ESVA 1RJLB 1UYWH 1PAMA 3PF2A 3CLFH 1RY7B 2WLYA 1QLRB 3EHBC 3O2DA 4P49A 4ZYKA 4J3SA 4RGMC 2DQUH 1MQKL 5C07A 4PB9L 1BPVA 5D9SB 4P2OA 1DDHA 3B5TA 2X4NA 1CFNB 2A38A 4QWWC 1I9JH 4RRPA 3FMGL 1T4KA 4Y16D 3MOBH 1SEQL 4R7NA 4DZBA 2NY4C 5IK3B 4QOKB 2QV2A 1CLZH 3LPFA 4DZ8A 3SGEH 2FH6A 3L1OL 4TVPH 5HYJA 3NFNB 3VXSA 4KY1H 4JN2B 4KMLB 1PZUB 2XA8H 2G75B 2YD5A 4GW4A 4H8WL 4F7EA 5L2KB 1SMOA 2AJSH 2FATH 4MJ5B 1PY9A 2NY6C 3PP3K 5I6XB 5DQ9A 1JTTA 4HJ0D 1P9MA 3SE8H 5HGDB 1PYWA 4NWUL 4L3CA 4O5LL 4BZYA 5I18L 4FQQB 2GTWA 1NGXA 2JK5A 2VDQL 4ZXBD 5I73C 4QRSB 3T0XA 2DWEB 2R1WA 1CDUA 5C09E 4HWEH 4PRAB 4I13B 1E4JA 2P5ED 1IKNC 3LN4A 3OAUL 2AW2A 5E5MB 3R06B 2Q8BH 4QY8A 2XPGB 5E8NB 4JRYA 5HYFA 1FRGL 2D31B 1DANT 4N8VA 4Y1AA 1QKZL 4DWHA 3L3JB 3ES6A 3O9WA 5IFJB 1AY1H 5C0EB 3MRKB 1NJ9B 1OP5H 1VB9A 5ACZB 5IQ7L 4WI9A 4R2GB 5HHOD 5ISZE 3BT2L 4P59H 5C0RH 5KSVA 1HI6B 2CUMA 1CGTA 1CYGA 2DQDH 3LRGA 1JFQL 5MEQB 3OGCB 4Y2DC 2WBJC 4KQ3L 4OKVB 3ZT6A 3QYCA 1FZOA 4OD1L 3Q5YA 5BV7L 1U93A 3FAXA 4PJ5B 4GFTB 4EDXB 1IAMA 5J0BA 3MA7A 3ARGC 1AGBA 1J1OL 3RIAK 3SE4A 4TUJB 1U8OB 3ULUD 3I75A 4G7YH 1I7RB 4K8RH 4XBPB 3CVHA 3VRIA 4P2RB 1M6OB 2APBA 3LMJL 4UV7L 3V0WL 3A67L 1AHWC 1G9NC 3H2WA 2BNUB 1A0QL 1INQB 5MEOA 1A6WL 3QZWG 5DR5L 1Q0YH 3DX8A 2VH5H 3U0TB 5T3XE 2ERJB 2DM4A 2RCSH 5DD6B 5HI4C 3VWKC 3OKDB 4YHKL 3UTTA 1JPFA 1IILE 4HZLB 4KU1A 1OP3K 1QQDB 4HH8A 4TUOB 2NY3B 3MRHB 2OTWB 4JDVB 1CN4A 2YD7A 5L2KD 3GSNH 1SY6L 3MXWL 1CQKA 1IGTB 3PL6D 2R0KH 4P57A 3BKMH 1OGAA 2DQGL 1W0VA 4CVZB 5KJRH 5E8DL 3W9EB 4XCEB 1FGVL 2CDFA 2VABA 4X80H 1IC1A 4RFEB 3MUJA 4XNMB 1SJVA 1YMHB 4Z0BH 3GFUA 3WBDA 3KPMA 4GKSB 1MJ8L 1KTDA 4DUWA 5KVMC 2AXGA 3MCG1 4J3TA 5DUMH 2ORBH 1ITCA 4JFZL 1ZLSH 5KTEL 5GS1A 1IGJB 3VXTA 3BZ4A 3TBVB 5GPRA 5I76B 1F2QA 2P24B 4LLDB 4L8SC 5KW9L 5T1LA 2E8YA 4LRNL 1KPUB 4OQTA 1FNEA 3QI9B 1FDLH 4ZPTA 4R2GD 2R0ZL 2Z8SA 3IU4H 5ESAA 5E6IB 2FSEA 1DBBH 1OLZA 1HSAA 2AVGA 1PKOA 4HIXH 3BGAA 3CSYB 3D0LB 4HPOH 1F2XK 4K7FA 5E03A 5I74B 3KR3H 4TNVF 4PDCE 1HHIB 1L7IL 4OCSL 3TT1L 1EHLH 4PJ5D 1I9EA 1JK8A 1MELA 4FNLL 3CMGA 2DQFB 4RDQG 1NUDA 4BQ8A 2FX7L 5FCSH 4IRJA 3GSVA 3SCMA 2QSTA 2ICWI 4P2RD 1EDQA 5ERWA 4NC1E 1I3GH 4JQIL 3SE9L 5EC1A 1L9MA 3S36L 3O45B 2Z91B 4C56B 2MJWA 3BEWB 4XVSL 1A1OB 1A7OL 4AMKH 1BVKA 2HMID 3IDUA 2YPVH 1DTUA 3MLRL 4HXAH 4OAWB 5LJYH 3MCLH 5AWNH 3DVGA 3E6FA 3S88H 4PRHE 1AIFA 5FHBH 2NY3D 2K7PA 1FZJA 4P4KC 1BD2E 2J8OA 2VDKH 4MAYA 3NIDE 3U9PL 4PGDB 4LCYB 4UDUA 3FJTA 3P2TA 4HH9B 1QSEE 2J7LA 4WU7B 1DN0A 2MPAH 4MB3A 4ELME 2ZPKL 1U36A 2HJLB 3QFJA 5BQ7B 1FVDB 2VL5A 5JHDA 2NXZB 2UZXB 3U0PB 3IFPA 3DYOA 3UBXB 3BHBB 3UTSB 4ZNCD 4NFBA 1IKFH 3F65A 4H88L 5GGVY 2CJUH 5KSAB 4N5ED 3MA9L 3UTZB 2E7LA 1TMCB 2DMBA 5F21B 3C60B 2BNQB 5DS8B 3ARQA 1N5YL 1X5FA 4MWFB 3NH7L 2ZG3A 2IBZY 4WU5A 1CG9A 1Y18B 5LGHH 2BY3A 3CX5K 1AR1C 4KAQH 1D5IL 4YQXH 2X4QA 1JNLL 1JGLL 1QVOB 4ODSH 1LO4L 5ITBL 1ZANH 3C5ZD 4Y0GA 3V4UL 3BPOC 3WEXA 3T3PE 3I3DA 12E8L 4WEUD 1N6UA 3BQUB 4Y16A 4YE4L 5F6HI 1ZT4B 3LN9A 1YJDC 5IMKA 2DQCL 1R24A 5C9KA 4GMTL 2W9DL 4LVOB 3MACH 3QFDA 4OV6F 3LRSB 1EEYB 1T5WA 5J6HB 5IB1A 1SJXA 3GZKA 4LSPL 4PYGA 1F90L 2CK0H 3P4OA 5IHBA 3DGCR 4RIRA 1JPGA 3ECBA 3K3QA 4UV4H 5H2BB 4X5XA 5GSRB 5D7LB 1PEWA 1JI1A 5C2BL 3C09B 5EIQA 3SOBH 5BOZG 3RX7A 1C5CH 1MCOL 3BYYA 4R4BB 5MP6L 5DHVB 3DETC 4IOIB 5CZXD 5DO2D 1EJOL 5EO9A 4JRXE 4JGMA 5EZIL 4ZXBA 4QHLB 3TCLB 2CIKA 2AK4E 1RZ7H 2P5EA 4LLYA 2IPKB 3P0YL 2PXYC 2RJMA 4CN4A 1AC0A 5JORB 1EGJL 1B0WA 1N26A 4YH6A 4HIEA 5GQBA 1NUFA 3RWEB 1P6FA 2NXZD 4OZFH 3KPPB 4XNQB 4I3SH 1JNNH 1E4XL 3UTSD 4I4WB 3ARBB 2QTEA 4OLUL 4U05A 5KSAD 2CLZB 3X14A 4JM2C 5J1SC 5I1GL 2HTLC 5HHOA 1KCRL 4X5WB 5GJSH 1GH7A 2ITCB 3C60D 2BNQD 3OKEB 3LB6C 4K9EC 1KXVC 3QUMH 1HHKA 1YECL 4XC1L 2EZ0C 4NC2B 4L8BB 1NANI 1NGQH 4ZSOB 4OV5B 1RJLA 4OFYA 4S1DD 2ZUSA 3RKPA 4JGUA 4LARL 4WENB 3QWQB 3UPRB 2ZG1A 2Q7NA 3X12B 3QXAB 4XI5D 1B90A 1NCWH 4J3XA 3NOIA 3T3ME 1CFNA 2IANE 3QSKB 4TVSa 3BQUD 4DKDC 5IK3A 5HYSB 2HT2D 2BOBB 5TQ0L 3FT4B 4YHLL 5DJZB 2FX8L 2OZ4H 4NPYA 3BN9C 4WTZA 5DZOA 3EZJB 5LG1A 4ZQKA 1NDMB 3P11H 4PTUB 3EZ8A 5D1QC 3RJDA 2G75A 5I17B 2Q76B 1BEYL 3UJJH 1GIGL 2FEDD 5L2KA 3G6DL 3T2PA 5D7LD 5GRUL 4WW2B 1JRHI 3PL6A 5GHWL 5HGDA 5F7LB 4G6KL 1ERNA 4UOW0 1NCAL 4HUNB 2I60L 3U82B 4I3RH 1BAFH 4GG6E 4NN6C 3U30B 1G84A 5SWSA 4FQQA 4LCIL 4QRSA 4XBEH 5A3IC 3MZTA 3TLRA 1MCQA 3MXVL 1ULVA 3WFEL 1LP9E 3ZL4L 3RUGF 5E5MA 1JJUA 2XPGA 5TF1L 2D31A 3U7WL 3NFPB 1CDIA 2VXTL 2EDYA 3QCTH 5C09B 4NM8H 1QFUL 2BNRE 3ARBD 3L3JA 1RZGB 1L6XA 1EAPB 3OJMB 5IFJA 5FM8A 3MRKA 5C0EA 1MPAH 1OAZL 2XY2A 1FGNH 1I8MA 2D7MA 5HYEA 5IB5B 3KLAA 1T0MB 3DECA 1VFUA 3PV6B 1TZIB 3OGCA 2ADJA 4OKVA 5C7XL 3HE7B 5ISZB 4MJ6B 5HD8D 5FGBC 3ZTJG 5DD1H 4NOBA 2Z8VC 5I1EH 3BKYH 4DEPC 3I50H 2FIKA 4PJ5A 4UNUA 4WFHD 4OLXL 1ED3B 1RUPL 3MFFB 3VH8B 4FQHB 4OGAD 1QLEH 5IEKB 3RVTD 3GBMH 2ED8A 4DCQB 1OL0A 2NY7H 1U8OA 1OOAA 1I7RA 4TQEH 1SYSB 1WICA 3EYUL 4P2RA 1NFDB 2R29L 1M6OA 5GGUB 5HJ3B 4Y4KB 1RUKH 2K9UA 3LKQB 4HS6B 2CLRB 2HP4A 2J6EH 1INQA 1M4KA 4JDZB 2FGWH 1LO2L 5L2JB 1HHHB 5EBWB 3TZVC 1U6AH 4HKXB 2DTSA 2YUWA 1RZJL 4BM7A 5DD6A 4U0QB 1FORL 1FSKB 4YHPB 2YSSA 3ELAT 4M6OH 3QQ4B 5ESQB 2UVFA 4XRCB 4W6WB 1LEGB 2DM2A 5CCKL 1QQDA 4LHUG 1A6VH 4X4YB 4TUOA 4OT1L 2OTWA 4JDVA 2I24N 4ZUUA 3TBWB 3QT2A 2BZDA 2NYYC 2X1OA 1IGMH 3KHQA 1ZTXH 2ICWB 2PO6C 3W9EA 5DJ0B 4XCEA 5GGVH 3MODL 4OTXL 4X6BB 4RFEA 2NY1C 2ESVD 1YMHA 2PYEA 1IGFL 3B43A 3IKKA 3ZE1E 1WLHA 5IW6B 5TDPB 3H7LA 3H0TA 2QKIA 5T1DH 1G6RH 4AQOA 1IGJA 1YNTB 3TBVA 4N5EA 4K2UL 3D69B 5I76A 2P24A 3UJTL 3G6JE 4LLDA 1JVKA 4KROB 4X4ME 4XBGB 4MXVF 1MOEA 1KPUA 5J13C 1AE6H 3REVB 1VACB 4MD0B 3WS3B 4LOUC 5FB8B 1UWGH 1MRCL 3CSYA 3D0LA 4NUJA 3FO0L 2QQNL 2I5YL 1XFPA 3K80A 3C5ZA 3HE7D 5F1NB 5ISZD 2OI9B 5B22A 4GXVH 1MF2H 3GBNL 3DVNA 5FFLA 5F8QC 5CEZH 1HNFA 2DQFA 3I9GH 4JO4L 3RWJB 4XCCH 3ESVF 2GEEA 2WWMD 4G6MH 2DLHA 5IVXE 3QUXA 2ATKB 4Y4KD 1AGDB 4G9FD 1J1XL 4J4PD 5IW1B 4N8PA 2YPLD 3T4AB 3O45A 2Z91A 5DLMH 3BEWA 2D9QB 1A1OA 1X6LA 5F88B 2C4XA 3TNNB 1MWAL 3N9GH 3SDCB 3NABL 3SGKC 3WFBL 4OAWA 3ZE2E 3BP4B 3JTCA 1NAKL 3D6GA 1U2CA 4M9PA 5JHLH 4NZTL 1F58L 1Q9LB 4Q58C 4W6YB 3PHOA 5JW3L 1JPTH 1NAML 5T3XD 4OI7A 4GAYB 2NR6C 5A2JH 2EEBA 4L9DA 3NFSH 5DMYA 3EOTH 1G7QA 3SGDI 5FDWB 2EEDA 2DQHH 1N0LA 3QNYB 1DQDL 4HH9A 1OAXH 3MV8E 1I7TB 2ZUQC 4JFEE 5I71B 1V7ML 1W72L 2VE6B 2UZIL 4OCMC 4YEFA 1FVDA 5CEYB 1AQDB 2R0WL 4HC1H 1AQKL 5E2VL 1F4HA 3UTSA 1QSEB 1K2DB 1OAKL 3BHBA 5KSAA 1GGYA 4ELMB 3I3BA 4ZFZB 2FEEI 3O9WC 4KROD 3UAJD 1CZ8H 5IHUH 3C60A 4MDJB 5D6DA 5DS8A 1BREA 3MRGB 4PS4H 3QPQC 4MWFA 1OSPL 2CRZA 4DKEL 5SX4H 1T7VA 1Y18A 1YYMH 1T1ZB 5JZ7C 5CMAB 3KLHD 4X7TB 5FYKH 2NZ9C 1R3JA 1KEMH 3I85A 3ULSA 5CP7A 3WXVH 1MCFA 1Q9OB 1QFOA 3C87A 1YEJH 3X3FL 2ZNXA 4PBWD 3ULVL 4P2QE 3CLEL 1S5IL 1G7LB 3AB0B 3J8F7 5DA0B 4ZFFB 3VD3A 3E3QA 1CXLA 1IM3B 4MHHG 3CCHB 5C0JA 3TCXA 3M8OH 3LRSA 3PP4H 4HKZA 1J18A 3MJ9A 5EBLB 4HK3J 5J6HA 1CD8A 4R96B 4M7KH 4YDVB 3BP6A 1A4JB 2YUVA 4HF5H 5ETUB 1S9WB 3THML 1IFHH 5DQDH 1WWBX 1OAUL 5C0BE 4G8GE 1CU4H 1NGPH 1MHPL 2JIXB 4UILH 2BVUA 3SDCD 1SHMA 4XXDB 5H2BA 1E4WH 3DUUA 5LBSH 2C9AA 4OIAA 5GSRA 2RR3A 5D7LA 3BDYL 3HE6C 3QG6B 1MFAL 4D0DB 1T7ZA 2DJSA 4LP5A 3E8UL 2I25N 4YLQT 3S3PA 1KCVH 1P2CB 4R4BA 4MQ7B 5DHVA 2XKUA 3O2DH 3RY4A 1T2QL 4ELKA 5DJ2B 5C0GB 1YA5A 2BSTA 5F6IB 2IPKA 4A2LA 1K3ZA 3RDTB 5JORA 1RZIB 4MX7B 4XNXH 1JL8A 2H9GB 4KK6C 4HK3N 4JRXB 3KPPA 4XNQA 5HVHC 4KMQA 1DBML 2AK4B 2R1YB 1QSED 4JFQB 4I4WA 3ARBA 5D5MA 2CLZA 4QXGH 4HX1B 1S7UB 1BJ1J 5E94B 3VRLF 4X5WA 3GRWL 2JB5H 2ITCA 1QA9B 4M8QB 3HRPA 1C16A 3QRGH 5K33A 1TQBC 2HT4C 4NZJA 4JFPB 2ITDB 5D1XC 4HUXA 5GGRB 4ZSOA 4BH7A 4OV5A 2EYTB 5EUKB 4L4JA 4MCZB 1PLGL 1RZ8B 4RMRA 4BFGA 4PRNB 4JJHA 1RJYA 3ZTNL 4AIZA 3QZWB 1JYVA 2PR4L 4OLWL 3UPRA 3X12A 3QXAA 5I0ZA 5TH2B 3BGFB 1KACB 1WBXA 4L8DB 4Z8FH 3FQXB 5HYSA 3SCMC 3GMRB 4NZUH 2BOBA 1NMCC 3FT4A 2B2XL 4QNPF 3GSUB 3WLBA 2IADA 1A6PA 1CK0H 4OQ1A 2IANB 3IKCB 3UPAA 3T0AA 4HMCA 2NMSA 2YA2A 1NDMA 1CLOH 2LU4A 2IQ9H 3EYVB 4O2FA 4HUMB 4RNRA 2XKNB 5I17A 2Q76A 1LO3L 4N1CA 3O6KH 2X40A 3OR6B 3LEYL 3MNVA 3AXLB 5GRJH 3MLYL 4P2CG 4NQXB 1TENA 4H26B 4Z77B 2YRLA 2VWEE 3WUWG 5E08H 3TT3L 5ALBL 3CX5J 2ESVA 1MFDL 3U1SH 1N6QH 1FFNB 3TEUA 2R15A 1J10A 2Z8RA 3HNTH 1NCBH 1NCDH 5TDOB 1TFHA 1FVCA 3CVHH 5HHVH 3OHXA 4GG6B 1WBYB 2AEWA 1GC1H 5HSFA 1MHHB 4JRXD 1OQXA 2LVEA 3S6CA 1QFWI 1YEGH 3NFPA 5AEAA 1KPVB 3ARZA 4IBLT 5IROC 2AK4D 2E7LC 4EVNA 1DL7H 1RZGA 5KAQF 1EAPA 5JXED 1LP9B 2BFVL 5EFIB 4KDVA 1B4JH 2Z35B 5IB5A 3A6CH 1MHCA 1PD6A 4H1LG 4IOFD 3VG0H 3WDHA 2VZSA 4XHJC 2DQEH 2BNRB 1FYTD 3QEGL 3PV6A 4MAUL 2ZSWB 3HE7A 3GBLA 5ISZA 3UYRL 1LDPL 3HZKB 4MJ6A 2VDOL 1FNHA 3MLVL 3VH8A 5IEKA 1ED3A 4FQHA 4Z95L 4R97B 1RMFH 2MHAB 4YHOH 5GSVB 4DCQA 1GGUA 1SYSA 4AH2A 1NFDA 5GGUA 5HJ3A 4Y4KA 4WFFE 4G9FA 4J4PA 4X6CF 2MMXA 2YPLA 5HI5D 2X4PB 4KJYB 2PCPB 4GSDL 4L9LB 1TLKA 2IAND 4S1SL 1HHHA 2CD0A 2A6JA 2R2EB 2VXQH 1WC7A 5DZNA 4Q0XL 1MNUL 5HGAB 1N8ZB 4OQTH 3PP3H 4TSCH 5F7FA 4YHPA 3TFKD 3QQ4A 4XRCA 1H3GA 1LEGA 1U8QB 2W0FA 1HINL 4Q7DA 4HWNA 3TBWA 1Z3GL 5DJAA 4YFDB 4LMQE 4W68A 4QHUA 2FR4B 5MI0C 1G9EA 4X6BA 4NDMA 3C6LB 2V2TB 1KFAL 5JXAH 5IW6A 5TDPA 4XPTH 3KNBB 4MYWB 4Z7VF 4I8DA 4U6VH 1YNTA 1BFVL 1ZGLP 3BUYA 5DMGC 1BX2A 5FUCE 4PJAF 5T33L 4FMFA 4KHTL 1H15B 2E6PA 2GQHA 1VACA 3O6MH 4MD0A 3STZB 4Z78A 1JWMB 3WS3A 3ZT5A 1FO0B 1FBIL 3G6JB 4JM2F 2UUDK 35C8L 2Y07H 3JWOC 1NLBL 2XXCB 4M7LL 5FM5M 2HG5B 2ADGA 2PNDA 3Q3GB 5F1NA 4KRPC 4F7TB 2OI9A 4D3CL 2B1AL 1H3VA 3RKDD 3PNWA 4R4FH 2BOCA 3GKZA 2VTFA 2XOTA 1UKSA 4KJPD 3RHWF 3QXTA 3MLXH 1WISA 2Z31A 5B4MD 1A3RL 3RWFB 3TYFB 3GSWB 1D9KC 2ATKA 4K3EL 4OCWH 1MFBL 4XPAL 5LCVL 4ZS7H 5IW1A 3T4AA 5LXGH 1K85A 2X09A 1FYHB 4JKWA 2OP4L 1WFNA 5F88A 3EUUA 4XT1C 3TNNA 4XPGL 3SDCA 1OP3H 3GUTB 4LMQI 5IVXB 4R9HA 2HJKA 4ZUSB 3HNSL 1KG0A 5C6WH 3BP4A 3TIDB 4Z18A 1R3IH 4PLKC 4XVTL 1Q9LA 3DSFH 1RFDL 5DZLA 4W6XB 3UO1L 3LZFL 4GAYA 1AD0B 1VGEL 5FDWA 1MREH 3U4EB 3QNYA 2X4RB 5FYKU 1KNOB 1JV5A 5CD5C 5EU6E 3C6LD 2ZOKB 1CFBA 1HIMH 2VDPL 2VE6A 4S0SD 3HFML 5EDXA 4Y5XB 4XP6L 4MJ2A 4HEME 1QSEA 3MV8B 4J3VA 4PJ9C 2Q3ZA 1QHPA 1FFQA 4LHJB 5I9QC 1J5OL 1WITA 4ZFZA 2V2WB 4KVNH 4JLRA 5ADPL 3CFDB 3V79C 2YN3A 4MDJA 3TC9A 3MRGA 1RUAH 3TV3L 4ZTPH 5EU5A 2AQ2A 1I8KB 3IFLL 1J8HE 1T1ZA 5B8CC 5CMAA 5FCUH 3AREC 2DLTA 5LAXB 3FO9B 3EYFB 1MIEL 1Q9OA 4HQQH 3OX8B 1RVFL 1I85A 4PLJD 4RWYL 1BJ1H 3IB4A 1I3VA 1FLRH 3M07A 1UWEH 4ZFFA 3CSPA 1TZGH 1K5NA 4M43H 3GI9H 1TVBA 2LTQC 5EBLA 4XNUL 4P2QB 4UBDC 3TO4B 3ZKMD 4R96A 1A4JA 1S9WA 1NBVH 2RAMA 4LSVH 3JV4A 3MRIB 4OCXL 1S7RB 3FFCD 1CDBA 2Z92B 4POZD 1JWUA 2F8OA 2XN9B 1NH6A 1BQLL 3TN0C 2AJZB 5B3JF 1BP3B 2IBBA 4YHZL 1DBAL 2XZQL 3QG6A 5C0BB 4APQB 4U7MA 3CX2A 3LKRB 1HXMB 5ID1A 1P2CA 4MQ7A 3TPUA 3NCFB 4G6FB 1JYXA 5DJ2A 1HCVA 5C0GA 3EJYC 1HKLL 2BX5A 3T2NL 1Y0LB 3ULUH 4Z7UA 2H6PB 1VDGA 4MX7A 4EOWL 3BWAB 2H9GA 4YJZL 2PTTA 4L5FH 5I1HL 1GGCH 5T1KA 3BPCB 3MV8D 1R3KA 3OAYK 4JFQA 1YEDB 5JXEA 2E5EA 1RUML 1KGCD 1S7UA 5FYLE 3PQYE 4KZEL 3QUYC 4MNQB 1QA9A 4M8QA 1Q94A 2R0LL 4XPFL 3VWJB 1FYTA 3JWDL 3QXDA 1MLCB 4JFPA 2ITDA 5DQJB 1MI5D 3C2AH 3KJ4B 5GGRA 5TF0A 1AO7A 5D7SH 5EUKA 3RVWC 4MCZA 1RZ8A 4G6JH 5DJ8B 1T66C 4OGYH 2E9IA 4K7PX 3QZWA 1BVLA 2DICA 3N85L 4LAQH 3QB7C 3WN5A 4XXCA 3X11B 4O4YH 1K4DB 3LY6A 3OKNA 3RUGE 3FQXA 3WIIL 5L9DH 1JYNA 3W9DA 1MJUL 2XFXB 5L8LB 4YIQB 2M2DA 3ARFB 4LHUB 1FG2B 3QUXC 5DC0A 3ZYJA 4BK5A 2EH7L 3PWVB 2XZZA 1KIQB 4YDKH 3QUKA 2EDLA 3NTCH 4P2QD 1OTTC 2IANA 3IKCA 3ARTA 3KPSE 25C8L 2KUTA 3RGHA 4FFYH 3DMMC 4YO0B 3T4YB 3TFKA 3EYVA 4TVPE 2W1NA 4GS7B 5AD0B 3EYSL 2CRIA 4JFFE 4JG0H 4FRWA 3GHEH 2XN9D 1JCKA 3S37L 3OR6A 2ZG2A 1I9IH 1C7TA 4XH2B 3K2UL 5C0BD 4M5YH 3AXLA 1JHLL 4QGYA 3X3GH 4APQD 1P5VA 2P49B 4OJFL 3IDXL 4IDLA 4CMHC 2DJ4A 4WY7H 2PKDA 2AS5M 4H26A 5EU3B 2AJYH 4Z77A 3PWUB 5HPMB 5IB3A 4N0YL 2ADIB 3D1MC 2QHLA 5DMIL 1GGIH 2F74B 4ISVB 2VLRB 1FFNA 5HHMD 1BF2A 3RTQC 3MUY1 3EGSA 5TDOA 3FB6B 1U92B 5DK2B 3D3VA 3SO3B 4S2SB 1WBYA 3B2VL 1JBJA 3L95A 1T80A 1T89A 1MHHA 4MA8L 5FOBA 4FXKB 4ERSH 2VYRE 3KYAA 3BX7C 4R90L 1LP9A 4JQXC 4MS8C 5EFIA 1CD1B 4BSJA 2HKFL 1I1AD 3AS1A 2Y6SD 4MNQD 2CR6A 3WHXB 1UA6L 1PSKL 3F7VB 3VWJD 3ZHKA 4G59A 2V9QA 4KUZH 3P3YA 1QPPA 1F8TL 5JA9A 2ZSWA 1FFRA 3U0WH 4H0GA 4OCYH 5GRVL 3T1FB 5SV3A 4OD2A 3MLUL 5D93C 4FFVC 2APWA 5MEPB 4FABL 5CILH 4WHYH 4OZFG 1S9VB 3O4LA 1XGQB 3S34H 4MXQC 3FONB 3PDDA 3PWPA 1GRWA 1R3LB 2CGRL 1RK1B 3ARFD 2DBLH 2CR3A 4LSTL 4TTDD 4LHUD 4JO1L 2X4PA 4OKDA 4MZ2A 2VXVL 1A4KA 1BQHG 4KJYA 4MXVE 4Y5VA 1VFBA 4L4VD 1H9VA 4NBYB 1QFWM 1Y6NR 1N8ZA 3VCLB 3EKCA 4U6HB 4DVBB 1A7PL 1CGUA 1ZLUK 2YD3A 4MA1B 3TBYB 4RFOH 1QRNE 4U1SB 2DB8A 4OZIA 4EN3C 1KENL 2E6QA 4RA0C 2FR4A 3Q5TA 5CWSB 1GYAA 3C6LA 5ILTL 5KAQG 2V2TA 2BRRH 2VLRD 1C5BH 4OCNC 1TJGL 4GKNB 1N0XL 5AZEL 2FBJL 3BISA 3RWIB 3TGXA 3QWOA 1RZFH 3BIKA 4FZ8L 1EVUA 1YNKH 2MQCA 4NHUA 4WEBL 2OBGA 2XQBH 2RFXB 1E28B 2JTDA 2GYSA 1KYOK 4XB7A 4YXHL 1PQZB 1VADB 5ID0B 1CLCA 3EDKA 3U6RB 3MJ7B 3STZA 4LSSH 4LCUA 3G6JA 3MV11 3RWDB 3DXAE 4K23L 3I84A 3MLPA 1EGJA 1I1FA 1YQVH 1NEUA 3RGVA 2B4CL 2BVOA 1WT5A 4KKCC 2WZPD 4G42B 1UGNA 4UT6L 4F7CB 1FN4B 4BQ9A 2R56H 1IAIH 2ICES 4JB9H 4F7TA 5FUOL 1EFXA 1UM4L 3G08B 4I0CC 1ODAA 4RISH 2V7NB 5FHAH 1T83C 3B2UC 4EDWL 3JV6B 5C86A 1RIVH 4RX4D 5DRNA 2Q6WA 3RWFA 4PB0L 2QJDA 3GSWA 4C4KT 1HSBB 5GJTL 3FO2B 3FFCA 2E7CA 4ALAH 1MRFL 2VJXA 1FAIH 3GUTA 5DVKA 5IVXA 3SE3A 4PP1D 4ZUSA 1TTUA 4WFFD 2YK1H 4ODVL 4RFNB 1DBJH 3TIDA 3H8NA 3TA3B 1EFQA 4L29B 2H2PD 4KKBC 5CJ5A 4KK9C 2ZOLB 1P4LB 3DGGB 4JHAH 1AD0A 4OCRL 3FT2B 5C0DA 4JJ5B 4XP5H 7CGTA 1JGUH 3U4EA 4YDLC 3LQZA 4IS6B 2X4RA 4LCWE 3V0AC 1T0NA 1JZ7A 1FNSL 1HXYB 5I19L 3RIAF 3B9KC 1CDHA 4MA7H 5JTWA 1R6VA 4F7PA 2APXA 5GS0D 4Z7OF 5DTFB 5J1TC 3QA3A 4FQLL 5DJXB 4XAKE 3MJ9H 1FL3B 1G9MC 3MV8A 3CU7A 5EU6B 3O4OB 2BY1A 2FEEL 2V2WA 4NN5B 1JGEB 4YWGL 4FZEL 3C9NB 3Q6FB 3H3BC 3QR2A 1DQQB 4LCCC 3TWCL 4AYFA 5IG7B 3WIFB 4YDIH 1I8KA 4X7EC 4JGJA 3IAGC 3LSOB 1MI5A 3QEUB 2WAHA 3D39E 2H1PL 1ONQB 2ICEB 5IFAH 1R5VA 3Q48A 4XWOD 5DHVH 1JTPA 1J8HB 1BFOB 3NGBB 1HYSC 2ZKHH 3S8WA 1B6UA 1F3RB 3REWB 3DYMA 2IFFL 1JF5A 3FO1B 1MFCL 4RZCB 3BD3A 2AJUL 3E0GA 1MVUA 4P2QA 1FCGA 3T09A 3U48A 1PX3A 3VRLE 5C0IB 4KGLA 1AJ7H 1HOCA 4JKKA 3MRIA 5EOTA 4E5XB 1S7RA 5LQBL 5JUEL 1IZJA 2XG5A 5EZJA 2XN9A 4BJLA 2AJZA 4LRIA 1FAKT 4WV1B 3MRLA 2BVQB 2YN5A 1F4YH 1YQ2A 4PIRF 5C0BA 1DBKL 4EBQL 4APQA 1T7XA 3TA3D 3W2DL 1U3YA 3LKRA 5I75C 5F1KC 1HXMA 2EC9U 2JJUA 5D7IF 1KCKA 1N59B 2DQIH 5LGJB 3O6FC 1INEH 3DJ9A 3KYOB 1K8DB 5HHMA 1GSMA 1UWXK 4EI6A 5J3HC 4N8CL 3MLWL 4GJTB 4PTTA 4QNPE 5KVGL 4H1LB 3S7GA 3B6SB 3BWAA 2XKSA 3L6FB 5B21A 3CSBA 1OW0C 3PDGA 3QIWB 1F3DH 1R0AL 1PBYA 3HC4L 1YEDA 1K6QL 1QUNA 2CXGA 5EU6D 1MCHA 1HHJB 2IG2L 1I1AA 1FQ9C 1N64H 3TIEB 5FK9B 4MNQA 3ET9F 3CD4A 2YA1A 1KPRB 3ZT7A 1FIGL 3EOBB 3OG6B 3VWJA 1GGBL 1L6ZA 4JO3L 5E8PA 3RX5A 2VC2L 3QNXB 4MD4A 1H5BB 1TJIL 3PHQB 3CVIL 5DJ8A 3VE0A 3A0OA 2C3GA 1ZT7B 4LGRB 3U7YH 3VFSA 4P9HL 4ZOAA 2C1OB 2J88H 1RIHL 3G04B 5F3HA 3V6ZB 1J8HD 1NC2B 3AU1B 2ZSVB 3PJSA 1UFUA 4M7ZB 3X11A 1K4DA 4JE4B 1KB5L 1KN4H 4R0LB 1WTGT 2XFXA 3GSOB 4YIQA 3WD5H 2OMBA 5I1DA 4OFPA 3ARFA 3DO3A 1CI5A 4LHUA 1FG2A 3AUVA 3KPOB 4DAGH 1CTNA 1KIQA 2XZAH 5D8JL 1X4YA 4L4VA 1DVFD 3F62A 3GM8A 3P77B 4F8QA 3TH4T 3ARSA 2YR3A 4QLRA 4A2MA 1WZKA 3WFDL 5DHYA 3AGVA 4KQ4L 3BJ91 4EEEA 1YEEH 4A6YL 1WFTA 4LVNC 1IQDB 3HTLX 2J8HA 3BPNB 3O2WH 4GRWF 1B6DA 3SBWC 2D03H 4PG2A 4L3AA 1A21A 4XH2A 1HH6B 1VFAB 3S5LG 1D6VH 3RWCB 5EU3A 4JFFB 5HPMA 2E27H 2DL9A 2ADIA 4NM4H 1MWAA 4LQ1A 4IIQB 3HR5A 2F74A 2X44D 2VLRA 3QO0B 4DW2H 3G5ZA 4NQUA 1TETL 4I0KA 3QH3B 4X6CE 4H8WC 5GGRY 3FB6A 4NJ9H 5TGBB 3OL2A 4NN7B 4S2SA 1LK3L 4KJQD 1A7NL 1CVRA 2VXUL 3ISWA 3L7FA 1QFWL 2IGFL 4KKLD 5F9JB 1R3HB 3BE1H 3QIWD 3T0DA 4P9ML 3INUH 4KI1A 3W11D 4O02L 5JA8B 5T1MA 1CD1A 5TJWK 4ONOA 5ANMA 2QADC 1YPZF 2VMFA 3WHXA 4K71B 3HZVB 3F7VA 3VXOB 4P3DB 1PG7X 5CZVH 5E8EB 5T3XH 5FYLD 4LIQE 2JELL 4Y4HB 4KK8D 1AH1A 5HHPB 1I85C 1WEJL 3U2SB 3T8XB 4UT9H 1KC5H 3T2OA 1CFTB 1RZKL 1B2WL 1OCWH 4WCYH 1IT9L 4LF3B 5MEPA 1N6VA 2H26B 1NC2D 5TE7H 2O5ZH 4RMUA 1XGQA 4Z7VE 3B5GA 5JPNB 4POYA 2Y06L 3ABZA 4PJHA 1R3LA 4CGTA 1RK1A 4QRUB 3WUZA 3L5XL 4PJAE 4P5TB 5J57B 1L0QA 5BV7C 3IDYB 4F2MB 1DLHB 4V3EB 4UTBH 1CT8B 2XIDA 1AKJB 4Q9BA 3I2CL 4KWUA 1HKFA 4U6HA 4DVBA 2W92A 3STLB 2NW3B 2EDOA 4H20L 5DD0H 3FKUS 4XP1L 4HXBL 4U1SA 1AP2B 1GZPB 4KRLB 4TSAH 3SPVB 4JFXB 4XZUA 1QR4A 3VJ6A 3P4NB 4JFFD 3WJJA 1DZBA 5CWSA 4F7MB 1U95A 2DLGA 1QRNB 1A5FL 1U3HC 3GI8H 4WO4B 5E24E 4GKNA 1OF2B 4FQXC 4N8VG 4WUUE 5C08D 4WI6A 3VXRE 2DQJH 3WSQH 4WHTA 4RGMB 1EZVY 2DTMH 1E28A 5D1ZC 3ZKND 5E2WL 4KJWD 1W2KT 1JHKH 1PQZA 2X89D 1VADA 1CFQB 1MQKH 3EJZD 4QT5A 3ZO0A 2FB4H 3U6RA 1A6ZB 3MJ7A 1UM6L 1DLFL 2CUHA 5F3BA 4ZO7A 1KXTB 4G42A 4F7CA 5IFHH 3VFGL 4Y4HD 4XP4H 5EORL 4YAQA 2IBZX 2L0DA 1PVHA 3RNKA 3WNLA 3DXAB 5DEFB 5GS3A 2V7NA 4XXCC 3OKMB 2H2SD 5F1OB 3JV6A 2D7TH 5J6GB 2NY6B 5LWYH 2D0GA 1LO0H 1AXTL 1Q38A 3CGTA 1KBGH 4NBZB 1TPXC 4QXUH 1C12B 3SQOL 1HSBA 4P5TD 5C0ND 1HQ4A 3FO2A 4FQPA 1IQWL 5IVOA 5I18H 3UYPA 5C6TL 4HFWB 5DEGB 4NRZB 1AKJD 2YXMA 3EYQD 4MA3B 1QBLH 4QTIH 2Y5TB 2IBGA 2NTFA 2BVPB 3TA3A 3HS0B 1WBZA 2ICCA 2V5TA 2ZOLA 1P4LA 1D7FA 4HUWB 2R2HB 2F8VA 2J4WL 3RVVC 3HRZB 4WW1B 4PPTA 1AGCB 4F57H 3EFDH 3QG7H 4OSUH 4YBQC 4IS6A 4QRPD 4WTWA 5T5FH 4IJ3C 4NZRL 1HXYA 5CJQH 1C1EL 1QRND 1XH3B 3BT2H 4JHWL 3AC0A 1KTRL 2G60L 4WO4D 4Y2DB 2Q86B 1M7XA 2WBJB 3H9SD 5DTFA 2APFA 1Z5LA 2GY7B 4X9IA 5DJXA 4LCWB 5SWZE 1FL3A 3MBXH 3EHBD 1VENA 1P4IH 4DN4L 3LKSA 4XP9H 4KQ3H 2YXFA 3PWNB 2Y36L 3ARGB 1DUZB 1KXQE 1XGTA 1JGEA 2HYMA 3UEZA 1JGVL 2UUDH 5B3JE 1DQQA 4GW5B 3B9VA 5IG7A 2XWTB 3WIFA 2NY0C 2NY4D 3QEUA 1N4XL 1AHWB 3V5HB 5I66B 4B50A 2ICEA 5IB4A 3DROB 4JFHD 3L5JA 3LIZL 3N1GC 1UJTA 5FA4B 1J8HA 3TBTA 3VWKB 1BFOA 4ZD3L 3CC5B 3NCBB 3D39B 3V4PL 3VD9A 1IAOB 3TH3T 1PX4A 1BQSA 2A9NH 5E7FA 3CUPB 5EN2B 1KJ2L 1S3KH 2G2RA 2NY6D 1F6LL 4HUUB 4RZCA 4OM1H 3OAZK 3TO2B 4XCNA 1DVFA 1TDQA 4ZMAT 3R8QA 3FZUC 4UDTB 3EBAA 3OPZH 2W38A 2AQ3A 2DQGH 4RGOH 4KKAC 5EIIB 1JRHH 2W91A 5F9OL 3VFWB 5F9DC 1FGVH 2LU3A 2O5XL 3V6OC 1XCQB 2BVQA 1U2HA 1WF5A 2Z9TA 3QQ3B 1I8IA 3TJHC 4YZFF 1KYOJ 1GOFA 1X44A 3H3PH 4JFZH 4L8SB 1DP0A 3ZSTA 2EKSB 2VR4A 3NCYS 5KTEH 5DC4B 3VFNB 3Q1SL 1V7NH 1PDKA 2MQ0A 3UTQB 2ENYA 4LASH 1JNHB 2I07B 1K8DA 4X0KB 6CGTA 1BQUA 5C07E 4FMKA 2IAMB 4QF1B 3DVIA 3B6SA 5EUOA 3DLQR 3KYNB 4Y2DD 4OM0H 4NSKB 4CVUA 1PZ5A 2WBJD 3VDCA 5DK0B 2C3WA 3QIWA 3QHZH 4LCWD 5E0QA 1RJCA 4CADB 3VFOB 3LRHA 5IT2H 3MRMB 4NO3B 3LKOA 3ARGD 3LS5H 4U6YB 5BO1H 3TIEA 1XGUB 5FK9A 5HYJE 1KPRA 1AGEA 4IRSB 5TPWH 4ZFGH 4FNLH 4OZFB 5D5MF 3EOBA 3RJQB 3O2VL 4R26L 4KTEL 1H5BA 1K4CB 1P53A 5DFWH 3PHQA 1A22B 1B0GB 1ZT7A 3PDOB 2AK1H 1J8KA 3RA7H 4P5MB 4PV8A 3G04A 3V6ZA 4LLUA 5HI4D 3VWKD 1J0HA 1NC2A 3AU1A 3ARWA 5L6YH 2Z4QA 3D39D 2UY7A 5D70H 3V8CA 2CMRL 3I6LE 1T1WB 1KLFA 4R0LA 3GSOA 4U1NB 2GAZB 4J3OC 4P4KB 3KHOA 3KPOA 3MQIA 4HLJA 1HILB 1UXSB 4G5ZL 1ZWIB 3K81A 5IBLC 5I15L 3P77A 5EOCL 1A14H 1GHFH 1AGFB 4DFIA 4J6RH 4F9LC 3RNQB 4PJ8C 3MYJB 3SE3C 4S1RH 2FJHB 4M4PA 5CSZB 5HPOA 2NY5H 5DVOA 1UM5H 2O5YL 4OIIL 4LDEB 1OY3B 1P4BH 2QBWA 4BQCA 5IQ9B 3S4SA 1VFAA 3K1DA 5C3TA 3Q2CA 4P23C 4K7PL 3RWCA 3LEXB 4FQCH 4JFFA 5GGQL 4ZAKC 2MCPH 3TM6A 2AEPL 3HKFA 1V3MA 4XCYA 4IIQA 4QXTA 3QO0A 4EUPB 1V5JA 4JM4L 3HMWH 1REIA 4Y8DC 3BPLC 4GLRI 2XWBB 3QH3A 4BZ1H 2A73A 3OAYH 1HWHB 6FABH 2X4SB 5TGBA 3TPKA 5C08A 2AV1B 4HKJB 4YX2L 1VFOA 3N1QC 1HDMB 2OXHA 3LDBB 5EC2B 1TVDA 5F9JA 1R3HA 4X6CB 1UYWL 2FYYA 3D5OF 2X89A 1VPOH 5ITBH 3CLFL 1X5YA 4D9QD 3KXFE 1KTLB 2DQUL 5I1CL 2P8LB 3HZVA 4IRSD 5DVNA 2GSIB 3VXOA 4O2CB 4P3DA 1I9JL 5EO0A 3V8OA 4D9RE 2ZCLL 5CS7A 3MOBL 3UTTE 4JZJB 5HGGS 3CAFA 1S9KC 4Y4HA 1UKQA 2VB5A 2BDNL 3X17A 5DD3H 3T8XA 1LMKA 2P43B 4OF8A 1H8SA 1CLZL 1R5WA 2DYPA 2XQYK 3ARRA 1WUNT 1BLNB 2H26A 4TVPL 5CHNB 5I30H 4PY8J 4G7VH 2Y9RT 3FOLB 4WTZG 2XA8L 4P4KD 3LH2H 5GRZA 4P5TA 4RWHA 2AJSL 2ZUTA 2FATL 1MCOH 5GRWA 1DQJB 1MJJB 2H41A 4PP2B 5C0FA 1N7MH 1NFDF 3SE8L 5I1KH 1S78C 3J7HA 4F2MA 1DLHA 4NWTH 3G9AB 4YR6B 1AKJA 2PXYB 1TCMA 4PJAB 1BBDH 5FA3B 3ZYIA 4UNVA 3HPJB 4F80A 1FO0H 2NW3A 1M7IB 2D3VA 1EBAA 1ZEAH 3CH8A 1B88A 4HWEL 3PWJA 1AP2A 2JJTC 4JM2B 4U1LB 3SPVA 1TJHH 1WIOA 3SKJH 3BDXA 1DR9A 4QRPA 3P4NA 1SJHA 3G6AB 1NMAL 1RZJC 4E42B 1QRNA 4M1DH 1AY1L 4WO4A 1OF2A 3H9SA 1OTSC 1AR1D 4P59L 5HGBB 1G0DA 3GIZL 3T0WA 2DQDL 4XWGH 3BD5A 3PGFH 4N1HB 1JTOA 2YD9A 3CPLA 4HSQA 1HEZA 3QXVA 1CFQA 5DD5H 2FGZA 3VXRB 1A6ZA 3NVQA 3LKPB 1YY8B 1I1YB 3DV4A 3L3IB 2OXGA 2VAJA 3ARYA 5DWUH 4G7YL 2VLKE 4K8RL 1CXEA 2FX8H 3SN6N 3ILQC 4XMPH 2BY0A 4B53A 1JP5A 2P48B 4Z7OE 1KLGB 1Q0YL 3OKMA 4Q74A 2VH5L 3PUCA 2NW2A 2RCSL 4HIJB 4IOSD 2GJJA 2GKIA 3MRJB 4CNIA 5JHDE 3W0WE 1C12A 4NN6B 3DETD 4HLZH 3GSNL 4DQOH 1ZLUH 1ZT1B 2R0KL 3BKML 4Q9RL 2E7LE 5KJRL 3FN9A 1IKNA 2PXYD 4MA3A 4E41D 1Q9KB 4O58H 4X80L 2BVPA 4B7LA 3HS0A 4LDLB 1D5BB 1YUHB 2W65B 4Z0BL 2IJ0C 5DI8B 5ECJE 4LL9A 3M17B 4PV9B 4PGBB 4HUWA 1NCUA 1P7KB 3HRZA 4WW1A 1CGYA 2VSDA 5DUML 2ORBL 4JM2D 3VU2A 4RMQA 2HTLD 5EZOH 2DL2A 3DX9A 4WHYG 3MRDB 5JIIA 5ICXB 4HJGB 3BESR 3QIBB 3MCKB 1M71B 4YNYB 2EZ0D 2V5MA 4Y2DA 4KTDH 2Q86A 1FNFA 2WBJA 1LILA 1FDLL 4LSUH 4B7IA 4F3FB 4LCWA 4DUXA 3IU4L 1DBBL 3QI9C 4LFHD 4M48H 4LNVA 3RWHB 2ED9A 4DEPB 1ACYH 3PWNA 1HK6A 5JDSA 5MHSE 4HIXL 3ARGA 4HPOL 4X4XA 5E6IC 1XCTB 2L7UA 4GUPA 3KR3L 3B3IB 5SWZB 2XWTA 3C6SB 3VXRD 1WSST 2HJFA 1OARH 4NNYB 4ZUTB 1AHWA 4HBCH 5D7IE 3V5HA 2DDQH 1G7PA 3OZ9H 3BGMB 3FTGA 4WI4A 3DROA 3BN9D 1JYWA 1FZKB 2XY1A 3TZVB 4M8VA 2E7BA 1MHEB 5FA4A 3VWKA 5IIEB 3RQ3A 1IAOA 1NFIB 4AMKL 5CGMA 2VR9A 4LDOB 4FP8H 3DO7B 2JB6B 3CUPA 3I02A 5EN2A 4JQVC 1RIUH 2YPVL 4HXAL 4HUUA 2AABH 5CJ8A 3TO2A 3MCLL 5AWNL 2QQQA 2LE9A 3S88L 2PO6B 2P44B 3CZFB 3S5LB 4UDTA 5FHBL 4AENB 2K3TA 5EIIA 5TE6H 1XMWA 4G43B 2VDKL 3ULVC 3RL1B 5A3ID 3VD4A 2YMXH 2FO4B 1XCQA 2MPAL 3WNNA 3VW3H 2X9XA 3DV6B 2Y1VA 4L8SA 2EKSA 3B8YA 3VFNA 5J13B 1BGXL 3UTQA 1IKFL 1JNHA 2I07A 2HFFB 2CJUL 4X0KA 3CFKB 3QIBD 2RIKA 3IDIA 4QF1A 5HTSA 3G5XA 2JJVA 3JBG7 4YXKH 4P4RA 3KYNA 4NSKA 4KGJA 1U91B 4ZYKB 5E4EC 5LGHL 3TF7C 3MLSH 5C07B 3HI6H 4JR9H 3MUGB 3VFOA 4Z7UF 4KAQL 3MRMA 1MCLA 4P2OB 4XTRC 3F7PC 2H3NB 5KSUA 3RVXC 4YQXL 3VMPA 4U6YA 1WZMA 4GRWE 4HS8H 4ODSL 1ZANL 1JI2A 3HCVA 5SWZD 3NCCB 4XGZB 1SYVA 4NOFA 1K4CA 4TYUA 1U8MB 1NLDH 4FTVD 3MACL 3TZVD 4P5MA 4LVOC 5DUPH 3C08H 3GO1H 2CK0L 5SWSE 3IXAA 3OR7A 3HPLB 1T1WA 2GITA 4P5KA 4U1NA 4IDJH 1OSZA 2MNUA 3IFOB 4UV4L 4P4KA 3UPCA 1PYWB 4L3CB 3BSZH 1LE5A 1BM3L 5HDLA 1UXSA 3IETB 1ZWIA 2GTWB 2PO6D 5T3ZE 3OG4B 4OFVA 4MNGB 1U58B 3SOBL 2ZUQB 1C5CL 3RHWK 2R1WB 1YPZE 2NY1D 4J23A 4XMLL 3RNQA 4JFOA 3GHBH 4MXWH 3FN0H 4HS3B 2FJHA 5CSZA 5HYIA 3GMLA 2FL5B 3FQRB 1X5ZA 3KS0J 4R7DB 4N0UE 3VGFA 1CLYH 1RZ7L 4PY7B 4N8VB 3OV6A 4NQEE 5IQ9A 4ZUVA 4HIHB 1UWXH 3ES6B 3O9WB 2NCMA 4QKXB 3LEXA 2HFGH 4MMXC 3HAEB 4UOW1 2R23B 1UKTA 4LSRH 4I3SL 1JNNL 4N1EA 4JCMA 4K07A 1KIPB 3T2QA 4EUPA 4PJ5E 1E4KC 2ZWLT 4LOUD 3LQAC 4OLEA 4HMEA 5GJSL 1OSPH 2AV1A 4HKJA 4OFDA 2JJSC 1FZOB 3QUML 4P2RE 2NPLX 5EC2A 1CS6A 4OZHB 1U93B 1JIBA 5B39B 1NGQL 3MA7B 4I77H 2Q20A 5D2NC 2CO7B 3I75B 1WFUA 1KTLA 2N7BA 2P8LA 1NCWL 1UCBH 5AUMB 2GSIA 1RK0B 1YEFH 4O9HH 2Z93B 4O2CA 5EBGA 3TYGH 3H7BB 3DX8B 2VLJA 5DUBA 4JPKH 5KOMC 1J86A 3KXFB 5JLZA 5JW4M 5HVFB 3E2HC 2OJZL 2AI0H 2OL3L 2OZ4L 1GOGA 2F5AH 2VO5A 3UTTB 5HYSG 1BLNA 1KB9K 3JZ7A 5CHNA 4F15C 3P11L 3HE6B 5GS0H 3W5MA 1OAQH 5EZLB 2PYEE 3FOLA 4Y4FC 4GAGH 4P57B 2N1KA 2NR6D 3SDXA 3UJJL 3D18A 5JW5B 2CDFB 3RZWA 1DQJA 1MJJA 4PP2A 4EIZC 3I6LD 3Q5OA 3BEVB 3WIHA 3RI5K 2Y72A 4Y89A 4YR6A 4I3RL 2PXYA 1BAFL 5JR1L 2APVA 4E41A 4WW2C 4PJAA 3DUSA 5FA3A 3HPJA 3VXTB 1M7IA 3BZ4B 4PD4K 4XBEL 1EXUA 4FFWC 3PIQB 3NCMA 2XRAH 4I9WE 4U1LA 5T1LB 3O9WD 4NHCH 2J8UA 1KJ3H 2W0KA 4ZPTB 4WHDA 3G6AA 3QCTL 5F97E 1WWWX 4NM8L 1TQBB 4QRTA 4E42A 3QPQD 4OZIF 1SVCP 3ZDXF 1MPAL 5D1XB 3S98A 5JZ7D 3CFBB 1AXSB 1BBJB 4ONGH 3QJHA 1FGNL 3OKYA 5AG8A 4U7SA 5HGBA 1DE4A 2NZ9D 2GFBB 4M00A 4XPHH 4LLVA 4TUKH 1T6VN 2NZIA 5DRXB 4XC3H 1G7MA 4QRQA 1CBVH 1VA9A 1JK8B 3MLZL 3UC0H 4TN9A 4PJFB 4WWKA 4BZ2H 1WAAA 2VKXA 1T7YA 4OLYH 5DD1L 4JVUA 3VXRA 1NGZA 4RAHA 3BKYL 3SCMB 5I1EL 1NFKA 3I50L 3LKPA 1YY8A 1NMCB 3L3IA 4O2EB 1QLEL 3BZEA 4NIKB 3C5JB 5EC1B 3GBML 2NY7L 4OFKA 4TQEL 5LVEA 1NL0H 5C2UB 3VH8G 2WY3A 5EOQH 1RUKL 5K9KA 3KXFD 3UTPD 5D1QA 2WWMC 1QBAA 4U1KB 3FRPG 2J6EL 4G8IB 4B41A 3QIUC 1H3UA 1KLGA 2FGWL 5DJ6B 4D9RD 2BHZA 2VLKB 3PGCA 3UTTD 1AIFB 1S7QB 1U6AL 3HE6D 3AY4C 4M6OL 2CQVA 1NBZB 4XPBH 3F8UB 1A6VL 1WWCA 1DFBH 3GSXA 4RMTA 4Q6YA 3MR9B 5DVMA 4D0BB 1IGML 1BVZA 1ZTXL 1IC7H 1IBGH 1F13A 2VL5B 5GGVL 5JHDB 3LD8C 3W0WB 2A9MH 1IARB 3P30H 3P40A 2FD6H 4K3JH 5IKCB 4KK6D 1D5BA 2W65A 5DI8A 1T1XB 3M17A 4Z76B 1J05B 3H42H 5GXBB 1P7KA 5T1DL 3VXNB 1G6RL 3MRDA 2X4OB 2X9WA 5ICXA 1OQOA 4CW1A 2C4FT 4WU5B 1CG9B 2HRLA 1PKQE 5B3NA 1M71A 4YNYA 2HT4D 3HN3A 3PHSA 3V6FB 3ZHDA 4FXGB 3K4ZA 1AE6L 5D1XD 3P9LB 4CMMB 5I1JH 4F3FA 1EERB 2VLLA 1YN6A 5FGBA 4DOHE 3RWHA 3WEXB 2QHRH 3QCUH 1UWGL 3VFMB 5I1AB 1FVEB 3B4NA 3OB0K 4Y16B 3MBEC 2HWZH 3B3IA 1IAII 4GXVL 5SWZA 1IL1A 3C6SA 4M7JH 5SWQA 4YZFE 3SCMD 5DA4A 2NXYC 5IB1B 5CEZL 1KIRB 3S35L 3BGMA 4FTVA 4XCCL 1JZ2A 1E6OH 3SDDA 3LHPH 2AEQH 3DTXA 1FZKA 4G6ML 4RIRB 1BOYA 4ENEC 1ZHKB 3TZVA 1A3LH 3ECBB 1QSFA 3QEHB 1MHEA 5D7IB 5IIEA 3OF6D 5DLML 2A77H 3SKNA 3EO9H 3N9GL 3DO7A 2JB6A 2VLKD 3O8XC 3LEVH 3BXNA 4H1LH 3BAEH 1II4E 2Z0BA 4XX1E 1F4AA 5H8DA 4KVCH 2PO6A 2VZOA 5EO9B 3CZFA 5HDQH 4GRLC 4K55A 3S5LA 5MI0B 2B39A 1JPTL 4RA3A 3GKWH 4G43A 3Q6GH 5D5ME 3NFSL 3UZEA 4LSQH 3EOTL 1ZGLM 2MKWA 4HWZA 2DQHL 4HIEB 2JCCF 3F5WB 5JHDD 3W0WD 4CU8A 1OAXL 3QPXH 1SM3H 4M6NH 5FV1L 3BWUC 5FYLH 2MWCA 4JDTH 3DV6A 5F7KC 4G3YH 1VGKB 4AG4H 4HC1L 4DK6A 2VLME 2EDEA 4LEXH 1GAFH 5T33H 5DEZA 4WFHE 3WCYA 1Y6KR 4QXWA 1BECA 4XHJD 5IHUL 3JVGC 3KS0H 3GMMB 3WFCH 4LPYA 4LNRA 4PS4L 1U91A 3V95A 3T0EC 4KRPB 4JPVH 1YYML 1NLBH 5K9QG 4C83A 5LKNA 3MUGA 2CO6B 3BKJH 3CFIC 5FYKL 2H3NA 1KEML 5IJKC 4YGAB 3WXVL 3FHQA 1EA9C 3IDGB 1YEJL 3ROOA 5KANG 4K94H 1D9KB 4XGZA 4NO2A 4GMSH 4ZNEE 5MHSD 2OR7A 4NPYB 5BVPH 1IEAB 5FYJE 1U8MA 4GRWB 3B83A 2WWKT 2V9RA 2VXSL 4ZQKB 3M8OL 3CH1B 3PP4L 4EJ1C 3SGKA 2HKHH 5FM4A 4D8PA 4M7KL 1EHXA 4HF5L 4PJCA 4XPGH 3OAZH 1XGYL 1IFHL 5DQDL 1TCRA 3G5YA 2IMNA 5I8OH 2ZUXA 3HPLA 1CU4L 1NGPL 2EKJA 2ESVE 5I16B 4UILL 4CJ1A 3MRBB 3RVUC 3RAJH 3PL6B 3JWDC 3IFOA 5E00A 4CJ0A 4XVTH 1WQVT 4X9BA 5LBSL 5HBBA 5FECB 4U1JA 3IETA 5SWSB 4EI5C 5JOEA 4PREB 4MNGA 1U58A 3VI3F 1KCVL 3RL2A 4HS3A 2OSLB 3O2DL 3K1KC 2FL5A 1B4RA 3FQRA 1VKXA 4R7DA 4PJ9B 4BA8A 5E9DA 5I9QB 4PY7A 5M7QA 1YPZB 4LP4A 4XCFH 4HIHA 4XNXL 3I6KB 4FN0A 4O51A 5DMGD 3ZDZF 1BHGA 3HAEA 1I8MB 2R23A 3RDTC 5J89A 5FIEA 4N0UB 2AKRB 4FFZH 3KLAB 4YGVB 4NQEB 1KIPA 2FECI 4QXGL 5B8CB 4U7KA 3AREB 2ADJB 2F15A 2JB5L 3EDEA 4KRMB 3V7MA 3QRGL 4OFYD 1MCSA 1ROWA 1I9RH 1NFDE 4KRPD 1P6AB 4OZHA 2FIKB 2B1HL 4G9FE 5B39A 1MIEH 3MRRB 2YPLE 4F8TA 3BD4A 4E9LA 3WNKA 4YXLH 5KVDL 4NCC2 5AUMA 4NGHH 4M1GH 1OPGH 1RK0A 4Z8FL 2Z93A 1D9KD 2CK2A 2PW2B 1MCDA 4XNZC 3H7BA 4U4BA 1KCLA 2PYFB 1KSRA 1J0JA 4UINH 4NZUL 4YK4C 4FS0A 3KXFA 2X70B 4NKOB 4PBVC 3AVEA 1FLTX 2YSSB 4GXUM 1CK0L 1Q9WA 3BRFA 3TN0B 5ADOH 4PJBF 5JOFA 1CLOL 3HE6A 2IQ9L 2LABA 4PLKD 4ZUUB 5EZLA 1CFSA 1CL7I 2NLJB 1MCEA 3SJVA 3O6KL 3ROLA 5JW5A 1P1ZB 5SWSD 1UH2A 1L0XA 5GRJL 1T2XA 3OKLA 3BEVA 4PJHF 2PYEB 3IS0X 3LV3B 5CD5D 3EO0B 5D71H 2G5BB 5E08L 1ADQA 2WANA 4HD9A 3T04D 3H0TB 2QKIB 3U1SL 5FEBA 3VD5A 1DQLH 3CMOH 3F7RA 5T3ZD 5JQ6H 1N6QL 1K8IA 4DGYH 1NCBL 4PJ9D 3ULVF 1NCDL 5BZDB 3PIQA 3CVHL 5HHVL 1A9BB 3EYOB 1GC1L 3MRPB 5E1HB 2IC2A 1ZKAA 2CKNA 3QUYB 4ETQA 1YY9C 2PUQT 1YEGL 4JY6B 1DL7L 3MOAH 4NQED 2YWYA 2VDMH 5D1XA 2CKBL 3CFBA 1AXSA 1WFOA 1BBJA 2LAGB 1D5ZB 2F9BT 2IWGA 3PABB 4NUJB 3ARED 4ORZC 4NKMA 1B4JL 2GFBA 5JIHA 1ZHBA 3MV01 3C5ZB 3K0WA 3A6CL 3VG0L 4M6AA 2DQEL 2PN5A 5DRXA 3DVNB 4LPVA 1KJVB 2P1YA 3V4VH 1S7TA 3QJFB 5IESH 4ZS6C 4PJFA 1J0YA 5B38A 4WI3A 9CGTA 1FE8H 3QUXB 4O2EA 3R4DA 2H8PB 4KRNA 4OGZA 2VSCA 3C5JA 1RMFL 4Z5RB 2HRPH 4YHOL 5EA0H 4MMZC 2WP3O 3KPLB 3VGBA 2W9LA 1S7VA 3DMMB 2GK2A 43CAB 4FOMA 4U1KA 3OF6A 4HK0A 4G8IA 2GK0B 2D7QA 4W4NA 5DJ6A 2VLKA 3TN0D 1T0PB 1MUJB 2VXQL 5D7KE 1S7QA 3KVQA 3PHOB 4JPWH 1H0DA 5FGRA 1LEIA 4OQTL 2Q8AH 4TSCL 5CSGA 3QWRA 7FABH 2B4CC 4F58H 1G7QB 1NBZA 2CLVB 2AXFB 3MR9A 2VZTA 3ALPA 3EJYD 1I1RA 3RTQB 4YBLC 4D0BA 2PYED 1JWSB 4NQDE 3ZKXB 3AS0A 3W0WA 4X6DA 4BSWB 4LHQB 5IKCA 3CDYA 1G9NH 1ZA3B 5JXAL 1T1XA 5IROA 4Z76A 1J05A 2O26U 1SBBA 5TQ2H 3HI1B 4CU7A 5HY9B 4XPTL 4DGIH 3VXNA 1F6AB 4U6VL 2X4OA 1QACA 5F70A 3QUYD 2V6HA 2IMMA 1KTKE 3LAFA 3BKCH 3V6FA 4M5ZH 4FXGA 4I9WD 1R3JB 1BFSA 2P7TB 3P9LA 4CMMA 3C8HA 3ULSB 3O6ML 5CP7B 3RVWD 4KXZI 1T66D 5K93A 2V7HB 1PKQB 5I1AA 3VFMA 1KB9J 3O11B 2ENSA 3MV9D 3ARUA 1FVEA 3FRUA 2A0LC 5D93B 2EXWC 4XVUC 5C0JB 2DS4A 1ZMYA 4DOHB 4HKZB 2OCFD 4R4FL 1KIRA 3QUXD 3BP6B 1IGIH 3MLXL 1OTTD 4NKDB 1B3JA 3VXME 1ZHKA 4OCWL 4LLQB 2DJUA 2KZ1B 3QEHA 4I18C 4KDTC 3DMMD 4ZS7L 5D7IA 5LXGL 1JMZA 3TPUE 3DUUB 4LVEA 4PD4J 1CE1H 2M1KA 2C3XA 4K3GA 5K9QI 4Z7UE 3P0VH 4OLZH 4EN3B 1R3IL 2ZJSH 1TVHA 4ELKB 1NKRA 3O3DB 3DSFL 2ZUVA 2BSTB 1QP1A 5C3LD 2WUCH 5GZNC 4P46C 4ODHH 1FNGA 3RTQD 1MREL 1S7SB 2B0SH 3F5WA 4OBRA 1IAIM 2X9YA 2FBJH 4QHKJ 3TVMC 4X9HA 3OJVC 4Z7QF 1FYTE 5D5MB 4R3SB 2HFEB 2YKLH 4U49A 5T5NF 1UACH 1VGKA 1B0RA 1AO7E 1IGYB 3GNMH 4EQ2A 4MS8D 4DVRH 4ZFOA 5E70A 1C16B 3W81A 4YXHH 5E2TH 4KVNL 3CFEB 2A74A 4HUXB 1T22A 4BH7B 3GMMA 4HLZG 1RUAL 2WQ8A 3A6BH 1K3IA 3JUZA 1RJYB 2D0FA 4ZTPL 4AIZB 5C9JB 3NCYP 2CRMA 3N06B 1L9NA 4M1CC 2YBRB 5FCUL 4D2NA 1JUFB 2BY2A 4MCYB 5EUOF 2CDEA 5IMOB 1WBXB 5BMFH 4QRRE 1MFEH 4FFVD 4WWKC 4NFCA 4HQQL 3IDGA 2FHCA 3IJSA 1I3RA 1OLLA 1FL5A 4GOSA 4MXQD 1D9KA 3QXUA 3WLBB 2IADB 1UWEL 3UP1A 1XF2A 4U0RC 5IV2B 5IWLA 1IEAA 1IC5H 1TZGL 4M43L 2F54E 3GI9L 2B8OT 2HLAA 4FQ2H 3CH1A 5IVNA 3RU8L 4DTGH 3B9DA 4O2FB 1J0KA 2VOTA 4RNRB 1CGSH 1NBVL 1PFCA 4LSVL 2DAVA 3TO4C 4EUPH 4N0CA 2CUIA 4MGXA 5I16A 3MNVB 3MRBA 1YEIL 4LPUA 5JDJA 1INDH 2DIBA 3GIVB 3D3VE 3S97C 4L4TE 5FECA 4EN3D 4YDLB 3BI9X 2ESVB 2M8XA 4P9HC 4PREA 1JGDB 1PG7H 1F11A 3UZVB 1DEEA 1YJDH 5D2LF 4ZUWB 2OSLA 3S36X 2NTSP 1FVCB 3DIFB 3OHXB 4G8EA 2A2QT 4ONFH 1JZ5A 3SKOB 3NPSC 4NKIH 4PJ9A 2DOCA 4D9LH 3ULUL 1YPZA 3G5VB 1OM3H 3SDYH 1MFNA 4EVNB 4AL8H 3HHRB 1OAYH 3I6KA 4QO1A 4N5UA 2ZUWA 3MJGX 4GBXA 5CUSH 3KLSA 3NIGF 4L5FL 5CINH 2ZNWA 3O3UN 5TE4H 5E95B 1P84K 4N0UA 2AKRA 3IS1X 4WFED 5CJBA 1MHCB 4YWGH 4YGVA 4NQEA 4OF0A 5BS0B 4LIQH 5B8CA 5I1IH 3AREA 2KBGA 3GSRB 3EO1B 2VLMD 3O4LE 4KKCD 2MTPA 4JZNA 3PWPE 1AFVH 2GI7A 1OB1B 3C2AL 2UY6A 3MRRA 5D7SL 4HUKB 2A83B 1O5DT 4G6JL 3GDBA 4OGYL 1I8LC 3FT3A 3WIHH 1NCNA 3B2UD 1P7QA 2EIZB 4AH2B 1C5DA 1EZVX 4LAQL 1UCTA 2WBKA 4G9FB 3QNZA 3D9AL 2YPLB 4O4YL 2VQ1B 4NUGH 2PW2A 5L9DL 1FJ1B 1N2RA 3V6OE 4QGTA 1T1YB 3SDDC 2PYFA 4HULB 1PGRB 3WNPA 2A6JB 1WC7B 1UQSB 2X70A 2YC1B 4NKOA 2BSED 4TSBH 4UUJB 4YDKL 4OZIE 3NTCL 3ZDXE 3O81A 4UB0L 1H3XA 3TN0A 4E0RB 2IEPA 4K9EH 3AMLA 3EDDA 4KKNA 2W0FB 5FYJD 2XA3A 4FFYL 2BJMH 1C8PA 2ZP0T 4NCDA 5I75B 4KKBD 5AYUH 4YC2C 1OTUC 3B8SA 5DJAB 2DI7A 4KK9D 1A2YA 2W60B 2OR8A 4JG0L 5CSBA 5FO9A 1JZ8A 2NLJA 3C8DA 2APTA 3GHEL 4ZODA 4JO2H 3UJIH 1MY7A 4QHUB 4HCRA 4X4ZA 1I9IL 1P1ZA 3MGTB 4NDMB 4NHUE 4M5YL 3X3GL 2EDFA 5FO8B 1RZKC 3LV3A 5BVJA 4WY7L 1M05A 1G0YR 3EO0A 2AJYL 3B9KD 2C7UA 4ODXB 2G5BA 2VDRH 2ZCKH 1GGIL 2LQRA 1RSFA 2R4RH 3FQTB 4YDJB 5TFSH 1DEDA 3QDHA 3BUYB 1BX2B 5BZDA 5DFVC 3RWGA 1A9BA 3EYOA 3MRPA 2EO9A 4AT6B 3QUYA 1NQBA 4Z78B 4JY6A 4P99A 4ERSL 2SEBA 3KWWB 4M4RA 4N90E 1WK0A 5L7XL 1MCJA 2DLEA 5BS0D 2EECA 1CF8H 2K1MA 3FQNB 3PABA 1D5ZA 3HMXA 1ZVSB 5CJOH 2ADGB 1AI1H 1KELH 3QUZC 3MV9A 5INDB 4KZDH 4KUZL 3PNWB 4S0UC 1KJVA 2BOCB 3GM0A 5A2LH 1QR1B 1HYSD 3QJFA 2YD4A 3U0WL 5H35A 5KS9F 3BRDA 3FFCE 3AM8C 4OCYL 2Z31B 3ZLQC 1J88A 1PY4A 2H8PA 3BH8A 4Z5RA 5CILL 4HWBA 3S34L 3KPLA 4LSDA 4S0TD 1YC8A 4HKBA 2DIAA 2DBLL 1CICA 1S5HB 3DMMA 43CAA 2HJKB 1L8JA 1KG0B 4XHQA 2GK0A 4LVNB 4BKLA 3WFDH 1MUJA 2A1WH 2V2XA 5DURB 3ORJA 3ZE0F 3ZZ1A 4GG8A 5ALCH 3FB7B 4U1IB 4ZTOH 1BOGB 1XR9A 4Z7WA 4DGVH 2CLVA 4RFOL 2B20A 2AXFA 3O6FD 3VDAA 5BCAA 1JV5B 2X1QA 4MA1C 1KGCE 3RTQA 3JV5A 5J3HD 4W81A 5IEHB 3HC3H 1JWSA 1RUQH 1E4XI 5IGXH 4BSWA 1KN2H 2BRRL 4L1HA 1ZA3A 4KK5C 1C5BL 1DQMH 1QEWA 1LK3H 1MI5E 3P4MB 4PJXA 1RZFL 4JLRB 4NQDB 2FZ3B 5HY9A 1YNKL 3HI1A 1NEZA 2GT9B 4JQXA 3RBSA 5GS0C 4MS8A 4Q9QH 3GGWA 1F6AA 3BOVA 4P9MH 3UDWC 2AV7B 2XQBL 4LLAA 1IEBA 5FUZH 5EU5B 3O0RH 2QADB 4BELD 4PLOB 2Z8WC 4U1HB 2YA0A 4S1QH 2I9LB 3HB3C 2P7TA 4X99B 2VDNH 1FFOB 1WZ1H 2V7HA 1PKQA 2JELH 2Q7YA 1YQVL 3O11A 3UMTA 5I8KH 2AGJH 3DVFA 5L0QC 4UU9B 2V9TA 5EOCJ 2DQTH 4X98B 2JCCE 2R56L 1IAIL 3D2UB 4JB9L 5K59F 1K5NB 5ENWB 4MXQA 1TVBB 4UTAH 1FH5L 2Z31D 1WV7T 1AXIB 1V3KA 3O3BA 5FHAL 4KUCD 2XN9E 1RIVL 2PETA 4MNHB 5KN5B 1WCQA 1WIPA 4NKDA 4LVHC 4N0RA 2P8MB 5BV7B 3JV4B 4NO5A 1JF1B 4LLQA 1JWUB 2WW8A 1CTOA 1DQTA 3BW9A 4JG1H 1G7JB 2X41A 4ALAL 1P7HL 3VXUE 5HHME 1FAIL 3WKMH 4KMTH 3VXMB 1A7QH 5DURD 1CR9H 5ID1B 2E6JA 2YK1L 4H20H 2D0HA 3TPUB 1DBJL 2YHGA 4EN3A 4MJIE 3WDJA 1Q0XH 5HI3C 4CUCA 1A7RH 1X6NA 3O3DA 4OGXH 5D7KD 4JHAL 1U3HB 1VEOA 4PG9B 5BRZE 4XP5L 2OL3A 1EEZB 1KCSH 3EFFB 4Z7UB 5E2JA 4FQXB 2OZ4A 5F89B 1JGUL 1S7SA 2PTTB 4MNQE 5T1KB 1R3KB 4MA7L 1XIWC 4R3SA 2F19H 2HFEA 3U4BH 4GLRH 1RQ5A 2BVTA 4MQXC 3CDCA