4PGDA

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaf
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pgdA01
5JMRA 1N5YL 1JVKA 3P0GB 2YWYA 4RMUA 3HPLA 1CDYA 3L5IA 3PP4H 1AO7E 3SO3C 5FO9B 4KTYA 3EOAA 3SDDD 1QYGL 4R90L 4Y5YA 5EZLA 3KLHC 4XVSH 5EU5A 4S1RL 1S78D 3T65A 4QXGL 3ZE2F 2DQGH 2PR4L 3B9AA 4M03A 4P59L 3BP5B 5CZKA 4Y2DD 4GLRH 1DSFL 1FG9C 2NY5C 1P7HL 1FGVH 1N5AB 1DBKL 5FA4A 3S5LG 4G8GA 4KQ3H 4M7LH 1UXSB 2FZ3B 3JV4A 3MV11 3RWIB 3WIFB 5LWYH 1QPXA 4IJ3B 4WRLA 4FN0A 5DEZA 1MELA 1RUML 3QBTB 5JUEH 1FFPA 1L7TL 1WQVT 4R2GC 5BV7C 2BVOA 1IAOA 3MLRL 3BN9C 4GXUN 1NMCB 1G6RA 1TVDA 1D3CA 4NO5A 4Y4KB 2ZUQC 3K81A 4XBEL 1HYSD 3HHRB 1EFQA 1KN4L 4NN6B 2B20A 1KIQB 5E8DH 5EU7E 2BRRH 3PJSB 5D2NE 1H9VA 4HS8H 3WO4B 1JN6B 2YD8A 2ICES 2VLRE 5IVXE 4HIXL 3REWA 1ZT7A 4XP6L 1N8ZB 2EDHA 4X6DE 4YHOL 1G9NH 4BJLA 3R06A 2R0LH 3VH8A 1MREL 1NBVL 2PCPA 2R56H 4GXVH 4C54A 4OLXL 3VE0B 4HG4K 1D5XB 2EIBA 2CDGB 5AZ2L 3QDJD 5CSZA 3QZWA 4Y89A 3QEGH 4P2RD 4F57H 2B8OT 4PJDA 5IIEB 4HH9B 1SVZA 4ODSH 4ZFOB 2MQ0A 4YHKH 4CVWA 2WY3A 4KTDL 4OLYL 2PW1A 3KJ4B 3WLWD 1N4XH 4WO4A 1NC2D 3BFOA 2HFEB 1KSRA 1K4CB 1XCTA 4P3CL 4HZLA 3CDGA 1NLBL 4XC1L 5CP7A 5DJYB 3IDJA 4ZFOL 3PNWA 2EDNA 5F6IC 1R3LA 5I1DA 3UO1L 4TOYL 2YOCA 3WHXB 3EIFA 6FABL 4OCLC 5EU7C 4PJGB 4MX7A 1EEZB 1RIHH 4X5XA 1T66D 5BS0A 2OR9L 2UWEA 1B0WA 3THMH 1CXIA 3Q0HA 5BJTB 2GJ6E 1JRHL 1IKNC 2EDBA 2R0KL 2F53E 5C0IB 1PY9A 2X4SB 4NNYB 5GQBA 5F1NB 4Q9QH 1YY8B 4QRQA 3GBNH 3OXSB 1URLA 1Y18B 4IIQB 3O8XD 1FC1A 1T04A 4XP1H 3WV0A 1UACH 1JRHI 1BFVH 4NQDE 5LKNA 2A9NL 4I3RL 4MAUL 1FNGB 1LEKB 1U93A 4O51B 3QWQB 3IKCB 1F4AA 1YQVH 4PLKD 2C3VA 2A6DB 1LGVA 5LCVL 4IM8A 2D03L 1ADQH 5D5ME 5D7SL 4ONHB 3O3BA 4KGJA 1T3FB 1HQRA 3TA3B 3FZUC 2ZNWA 1RUPH 3M1BB 2HFTA 4OAWB 3DV6B 5E6ZA 4POZC 1VADB 5EBLB 3GSNH 1I7ZB 4OLVL 4EBQH 3VXUD 1YNTB 2I9TA 3C08L 3P4LA 1GZPB 4PRNB 4JGMA 1FH5L 4XHQA 4MQSB 1NLBH 2ZCLH 3IXAB 3VXRD 2HRPH 2LAAA 3T1WA 1P6FA 2AJ3B 3GRWH 3VXUE 2Z35A 4OCYH 4ZO6A 3HR5A 3L3GB 1QVOB 3RPIB 5LJYH 2XXMB 1AXTH 2HG5A 3R0NA 2BFVH 1FE8H 1HH6A 1SY6H 2PW2A 3EFDL 4CN1A 1CD8A 2OK0L 1MCWW 4E41A 2LE9A 3T0WA 4OF5A 3FMGL 3P4OB 5A40E 1S7WB 4LLYA 4PJ5D 1Q38A 5LQBH 1QNZH 2ORBL 1OM3L 3GJFH 3GMLA 1ZLSL 1A6TB 3MRJA 1FL3A 4NQDD 43C9B 4S0SD 1SYSA 3EJJX 1KT2A 3O4LD 4YXKL 1N2RA 1CG9A 8FABA 1KN2L 3GNML 1MEXL 3C5JA 2K9UA 1T1YB 4JO1L 5DJCA 3HLAA 2Q3AA 4UILL 5L2KA 3G5ZB 1BD2E 3T0ED 2F5AL 2MWCA 2VC2H 4DGIH 4X7EC 4U0QB 4XCYA 4WDIB 4HUVA 5IJKC 5LBSL 2EDTA 1JFQL 4U0RC 1N6UA 3AAZA 3CH1A 3VD9A 3T2QA 3RWHA 5C0GA 1L9MA 3FN9A 1K5NB 5GZOD 5E4IA 3IAPA 4O2FA 3QUZD 1UYWL 1KFAL 5CHNB 1F13A 4X7FC 5IOPA 2EEBA 1KPRA 5C07E 1Z9OA 3QUXC 1XH3A 2DTMH 1RAMA 3DX7A 4NNXB 4U33A 4NHUB 5CJ5A 4U1HB 4DGVH 3V6FA 3QFJD 1EGJH 2AJUL 4PJAA 4AENB 1Q94A 2YR3A 5KSBB 3KLHD 1IFHL 1CK0L 4U31A 1OLZA 5MEOA 4XC1H 1NC4B 4WUKL 1KCSH 2VLJB 1ZSDA 1BF8A 1S9KC 1S5IH 2NXYB 1E28B 2VR9A 3DUUA 5D7JC 2DQCH 4HIJB 4X6EB 3G5YA 2EKSB 1EHLL 1EBAA 2VXUH 1BEYL 1KULA 2DRUA 2KZ1B 1Z5LA 5JXED 3SDXE 3LB6C 1CDHA 3QJHB 3RVUC 4IHOA 1TZHB 4OM0L 5T3XL 4HUWA 2ATPA 5ID0A 1BREA 5HHPB 2BVUA 4RAVA 1B2WL 4JFFB 5D6CB 5E2VL 4PRID 3O41A 3TBSA 3U1SL 4QRPB 3B5GA 5BQ7B 5GGRB 3C2AL 1H3WM 2PYEB 35C8H 2DLHA 1ZV5A 4OZGF 3FAXA 4RISL 3T77B 3HZMB 1A4JB 1K85A 4X4YA 4HJGB 2FATH 3VW3H 4ONHA 2GFBB 3CK0H 3QEUB 4ZFOA 4NT6A 3BIBX 4DOHE 4LVHB 1R3JB 2O5YH 1CE6A 4LQFH 1INEH 1N64H 1EZVX 2EH7L 3LRHA 3GIZL 1V3KA 5SWZB 1YDPB 5BCAA 4WI8A 3IFPA 1MUJB 2VUOA 4EDWL 1RJCA 1J9CT 4MCZA 4DEPB 2QR0A 4NP4H 4NO3B 5KOMC 5HDQH 3V6OA 4XP4L 4PJDF 3QQ4A 4PY8J 4LSRL 1S9WB 4FQLL 1J1OH 1JPSH 4GMSL 4ZFGL 1MI5E 4HAFA 5I8CA 1EHLH 1A7PH 3O81A 4PJIE 1HH6B 1I8LA 3C8KB 4WEMB 5HVWA 1ZEAL 3GSRB 2OQJA 2FH8A 4PGDA 5DD1L 5IKCA 3FT3A 3LPWA 5KAQF 3PWJA 1JTPA 4P46B 1FVDA 4AIXA 1T7XA 3MGOB 1MH5B 4JRXE 5DRWB 1T1XA 3IXTB 4LAQH 3LSOA 4K3EH 2CRIA 2HH0L 4U2ZA 3SDAC 4BSJA 1UFUA 2X4RA 1KIUA 1OB1A 4X6CA 5BW7C 4H1LB 4ONGH 4P46C 3N85H 4GMTL 1T89C 2YK1L 3RY5A 2B0SH 2YD6A 3KXFA 2O26U 1N4XL 4G6FB 4LF3B 5C86A 1MCIA 1HYRC 2EDRA 4TNWK 4D0BA 2RB8A 1LP9B 4JDVA 1XR9A 3EDDA 4UTBH 3P11L 1KV3A 3VRJA 1T2XA 1LDPH 2XZCL 1U8JA 5HDBF 4O2CB 3ME0A 4OZFA 1I8LC 2AJVH 4NYLA 4GAGL 4PJ5A 1OD7A 3E6HA 4HX1A 5TF1H 3LKQB 3WSQL 3VXPA 3UAJC 4RFNB 2W9LA 1FNFA 3W9EB 4JO3H 5CSBA 4APQB 2FIKB 5DVMA 3HNSH 1JNHB 4RCAA 4M3JA 3BAEH 3O2VH 4Y19D 1DDHA 4DUXA 3PNWB 3O6FD 1EUUA 2Y07L 1D9KA 2BX5A 2P8LA 4WHYH 1NCDH 1IM9D 4WHYG 3RTQB 2AEQL 4U2YA 1NC4D 1NGZB 4H1LG 3MBXH 3PL6B 4KDTC 4I77L 2AKRB 1BFTA 3SGKC 4JKPH 4K2UL 5F7EH 3LRSA 5JW3H 3CFBB 1RD6A 2FYYB 1EFXA 3ZE0E 3LKSB 4OFKA 1I7TA 1YEEH 3HAEA 1NMBL 2APWA 2GY7B 3ZKQD 5I1KL 4EQ3A 4HFWB 2NY6D 4N8VG 3O9WB 4XCFH 2NW3B 2KZWA 2J8UB 2OSLB 4LFHD 1OHQA 1WVZA 3SGEI 4RNRA 3CXDH 4ZUVB 1HIML 5F9JB 4I0PA 4NQVA 1ZEAH 1BBJA 5IMMB 2J8UE 1L7IH 4ZS7L 2C3HA 3T0EA 4GRLC 4DQOH 3GUTA 2Z91A 3B2UC 4LRIC 4X6FB 2XWJA 4H25B 4KUZH 3WNPA 1RPQA 2YXMA 3E3QE 1LO5B 5KSAB 4NNYA 4M6OH 2R8SL 4FFZL 4DGYL 3VMNA 3PIQA 3BP5A 4FZ8H 4YWGL 1TFHA 2UZXB 3HS0A 3KXFE 5DT1L 2ADGB 3IJHA 5E2UL 4OM1H 4LCYA 3SGKA 4XNZC 1F02I 4FG6C 4IRSC 5GSVA 4NZRL 2O5XL 4GRWB 1AQDA 5DYOB 1UWXH 4JO4H 4Q9BA 4X6CB 1JGDB 5JORA 3JSSA 3VDBA 3K4DA 3CDGB 4TVPD 3WFHA 2AVGA 2R29L 3GI8L 2Y1VA 5IMKB 3MYJA 1YEFH 1RZGB 3KWWB 1P7KB 5I16B 1LE5B 4PV9A 4GLRI 1MLBB 1Q0XH 3FOLA 5AWNH 2X5PA 4MJ2A 2JJSC 1GGUA 5ELIA 4PJFE 5IHBA 1TJHH 2JK5B 4F9LC 4DW2L 3NABH 3EOAB 1FO0B 3C8DA 3VD4A 3RRQA 5C09D 4AEIL 4I5BB 2XN9B 1A6UL 3RI5K 5IB4B 4HMEA 4HJGA 1B4JL 3PP3K 1XAUA 1H3XA 3S97C 2XN9E 2YD7A 1EO5A 3SCMA 3SGDI 3MRRA 4L8DA 2FD6H 4BZ2L 3BJ91 4C58B 1T7VA 5JZ7C 4ERSL 3MOAH 5F7FA 4NQTA 1RJYB 4MJIE 3A67L 5C0BD 4Y16C 4LLDA 4XXCC 5DD5L 1N5YH 3F12B 3G5ZA 3H3BC 5SWSA 4HWBL 5FB8B 5K33A 5K59E 1T03L 1LD9A 4NNXA 4HKJA 5DVKA 3V2AR 4PJ9B 4JQIH 4ODBD 1N26A 3DMMA 4R4FH 5IF0A 1NGPH 5FFLA 2BNUB 3BXNA 5E5RB 4K55A 2J6EH 2PXYD 3SCMD 4J2XA 2JCCF 4K7FB 3S88L 5DJ6B 1XF1A 5DSCA 3DX9B 5D7LE 4K8RC 2ZUSA 4FQ1H 5CP3H 4MZ2A 5KS9F 1A3RH 5EO1A 4P2OD 5GGVH 5C3LD 1NKRA 2L7UA 5F3BA 5EBGA 2OL3A 1FQ9C 4R0LB 1UM4H 2H32H 5ISZE 2VDLH 4JR9H 1GJIA 5DHVB 4YHPB 1ZANH 2NY4D 3OV6A 4UDUA 2AQ3A 4P4KB 1DUZB 2JJSA 3LN4B 3MJ8A 1D5ZB 2YN5A 4WWKC 4GS7C 2YPKA 1IL1B 1NPUA 5ENWB 5AUMA 4D9LL 4TVPE 3S36L 3KDMB 3U2SB 3DSNA 1D5BA 3N1QC 1A1NB 1RUAH 5CIPH 3KYNA 4OAWA 5F88A 2EXWD 3FFCE 1MFNA 3QDJB 1S7SA 3HZVA 5J7CC 5IG7B 4ZUVA 1HDMA 5T1LD 5MENE 2DQEL 2HTKD 1A3LL 1IGTB 3OKOA 4HUNB 4BKLA 3ARED 5JPNB 1DSFH 1MCDA 4Y5YC 1J86A 1KXVC 1QLFA 3ULVC 4I1NB 3U79A 5DRNB 1U3JA 5DD1H 3GMQA 4M9PA 1KC5L 3O45A 4BH7B 4S2SB 3VI4F 3HMXH 5F3HA 4ZAKD 1L0YA 1AD9A 4PUBH 2FSEA 5F1NA 1FG2B 1G7HB 5I1JL 3NH7H 1KCSL 3DBXB 1ZKAA 4QOKB 4G6MH 4Y1AE 5LGJA 4FFVD 4G8GD 5JR1L 3MGTB 2GTWA 3VXRE 2BXZA 2VUYA 1X7QB 3ISWA 3MLRH 3S96A 4HKZA 2GJZB 4OFVA 2X4QB 1NMBH 1BBDL 3MA7A 4OT1H 4P4RA 2IAMD 4I0PD 1BVZA 5EO0A 3TA3A 1TNMA 2AJSH 3HI5L 1HQ4A 4MNHA 1R0AL 5B4MD 4F33A 3R1GH 5B8CA 4L4TB 4HWEH 5D7IE 5EU3A 1EBPA 4CMHB 1R5IB 3HC0A 1I8IB 5M7QA 1OAUH 1IGIH 4U1NB 5MHSD 2FRGP 1T7ZA 3QAZB 3FQTB 2I25N 5IR1A 4PJCB 3QXAA 2DMBA 1FAIL 4LU5L 3RGVD 3ULVE 5JNYA 2P48B 4LASL 4I3SH 1CQYA 3QCTH 4LEXL 4L1DA 1GAFH 4R2GB 3VRIB 5HHQA 2CO6B 3R8QA 3WSQH 3LQMA 4KKAC 5D2LB 3UP1A 1T5WA 3HFMH 2VN7A 4MWFA 1NFDB 2A6DA 3CSPA 2ZCHH 1CLYH 1EJ6A 1T1WB 4YHMH 5EDXA 1H3PH 3IVKB 3OBAA 1KB5A 3REVB 4LLVB 3W39A 4HQQH 3RGHA 4GRLD 2IG2H 2F54D 1HZHL 4P2QB 5B3JF 4MDIB 3U83A 3WN5C 3QIWC 5KS9E 2PYFA 4O2CA 3NIFF 4F80A 4YWGH 3QWOB 3W0WD 2I60H 2J5LB 2WSKA 1WC7B 4PJBA 5MEOB 3QWRD 5FK9A 1QLRA 3MUZ1 4DZ8B 3QDGE 4H20L 5BS0B 3JUZA 3IFPB 2P5ED 4WI6A 1S7QA 4KRPD 5AZ2H 1MJ8H 3V0AC 1OW0C 4PYGA 2YEZA 4GFTB 3OQ3B 1P4LB 4M5ZH 4L8BB 3PHOB 1WAAF 4G7YL 3ECBA 1WWWX 4HT1L 1J8HE 2XI9A 2A74A 2E7BA 5FO8B 2EIZB 3K4ZA 4BFBD 4LCUA 2P8LB 3MRLA 3RDTC 4S2SA 5FYJU 1MCPL 5E00A 4JR9L 3OZ9L 4XNUL 3FT3B 5E8NA 3RL1A 5JPMA 1P1ZB 3E8UH 1T2QL 3U9PL 1ERNA 1MRDH 5KTEL 2Z8WC 1NCDL 2IANA 1JCKA 1M05A 1HI6A 1DL7H 3Q3GB 4MNGB 3SDCD 3TN0D 4A6YA 4UV4H 2MMXA 2F5BL 3H7BA 4FQCH 4DUWA 5LGHL 1K4DA 4BFIA 3O2WH 1BJ1J 5B39A 1MIMH 1QA9A 4PJ9D 1XGYL 3SEPA 3LKNA 3RWIA 2N56A 1FL3B 2R2HB 4IBLT 2A6JA 1FRGL 3EUUA 1FJ1A 3QI9B 1AGFB 1QSFE 1MCKA 5C0BB 1KENH 1T1ZA 4BKLB 5JPNA 4HD9A 4WHTA 3V7MA 5K9KB 4NBZB 1AE6H 3CFKA 4NO0B 3CX5J 3WL9B 1CGVA 4I3SL 2JJTA 5JIHA 2WWKO 4XPFL 4XNXH 4M1GH 5EZLB 5HYJA 2NMSA 2NCMA 2FSEB 1S7UA 5SWQA 5DSCB 5DFVD 2F53D 4JQXA 5D2NC 3MOQA 1K8IB 3KPNA 4LVNC 3OXRB 2GJ6D 4WI2A 4PTUA 4ESKA 1AR2A 3CFCL 4JREC 4PV8B 1WWBX 3IDYC 2HRLA 3RVTD 4ZOEA 1U3HC 5GGTA 3LH2H 4PRIA 5EBWB 1Z9MA 1QR1B 2FH6A 3L5XH 4P2CG 4P2QE 2VIRA 3H3PH 4JZOA 2Z93A 4HUKB 2A1WL 4AG4H 2C3VB 1I1YA 5I1AB 1NGYA 2V6HA 4NPYB 4N90E 4OD3L 1RZ8B 2ZCKH 3CX5K 4NCC1 2XZQH 1G7PB 4ZPTB 1A7PL 3VXNB 3GIVB 4Z7UE 3P0YL 3UZVB 2EH8L 4DAGL 1MCNA 3TJHC 3V6FB 5D1QD 1CD9B 1DN2A 1RK0A 1G84A 4P23D 4X5XB 1UWGH 4XVUD 3SKMB 5IHUL 4FFWC 3S37L 1FO0A 1P5UA 4XTRC 3P9LB 4S11A 1OAQL 5IB2A 1LO5A 3ARFA 2FD6L 1MHEA 1HSBA 4GJTB 2W9DH 5IVXF 1PYWB 5GGTH 4Q2ZA 3DO3A 3RA7L 1JE6A 3T2OA 4YX2H 1AKJD 4PJXA 4EEEA 4JZNB 4UNTA 4DVRL 5HDQL 1AQDB 2NY6B 2HN7A 2AK4E 1M7XA 4EDXA 3QDHA 5DMIH 3VXQA 3QQNA 1H3VA 4OZ4A 1OT1A 3O4LE 2Q7NA 5DJAB 1EIBA 4HIJA 4JRXA 1MWAL 2Y6SD 4PV9B 1RU9L 1XGPB 1N8ZA 4OIBA 1NGQL 5BV7B 4JFXA 4CMMA 2AV7A 1I1RA 1PFCA 1PY4A 4LCWD 3HMXL 5TGBA 1IC7L 3LIZL 2DQCL 3PE9A 5F44A 4P2YA 5AZEH 2FHFA 3HI6H 3MRBA 3CMOH 1RIVH 3QEQD 4S0UC 2B5IB 9CGTA 1ITBB 4HUMB 1OAKL 3PP4L 1I8MA 1SMAA 2WMPA 2XTLA 2P45B 3QSKB 1MJ8L 1EO8L 1QEWA 4PRPB 1T89A 2RR3A 2EIDA 3LEXB 4ZXBC 1NCBH 1OGAA 2CO7B 5DA0B 2WBJC 1YPZE 4JKPL 4NWUL 2WLYA 4CL7A 3OJ2C 2HLFD 1ZHNA 5FGSA 1JZ7A 3S98A 1XF2B 5IVXB 4PP2B 1TQBC 1XMWA 3CSYB 1KFAH 4RMRA 2XACC 5I6XC 4QHLB 4LF3A 4QHUB 2NY7H 1ETZB 1QZ1A 2NY3D 3QWRA 2E9IA 2VDLL 4PTTA 1I3GL 1NAKL 5GS0L 3DI2B 4BH8A 1DBMH 3HNTL 2DWEB 5I8CB 1PAMA 1RUKL 5BRZB 5ADOH 4YDJB 4P2OC 2V7NA 3WDHA 4AK1A 1Q9OB 5HHNA 4HPOH 1IEAB 4QF1B 4RRPA 3S37H 1EXUA 4LLYB 4KUCF 4LSQH 4ZSOB 4KV5F 4P49A 2Z31D 3OHXA 1M7IB 3O11A 2V17L 2BY0A 4A6YB 2UWEB 2CKBB 4LSTL 5IIEA 1OWRM 4OZIA 3KAAA 4Q6IA 5KTEH 2EDJA 1JGLL 2JJTC 5JO5B 4U7KA 1YEHH 2X4NA 4GQ9L 3TPUB 4HK0A 1IAIL 3MLYL 3CMGA 3W9DA 5ACMA 4WFFE 4FQXD 5DJYA 4RZCA 1FAKT 3LN5A 3EBAA 1SBBA 5CEZD 2F58H 5GGRY 4MQXC 1ONQB 2DYPB 2V5RA 2QLVB 5F88B 4NWUH 4CNIB 5E0QA 3QEGL 3L95A 4NM4L 3ARBA 2XRAH 1WWCA 5EU6B 1ZLUK 5BVPH 4KKBD 4KHXH 4D94A 3FQTA 2ZZUT 4H5SA 3VWKB 2AXGA 2DWDA 1JNHA 4MCYB 5GJSL 5MP6L 3GBLA 1WICA 1MH5A 5DRWA 3IXTA 1Q8MA 1G6RB 3K80A 2XG5A 3MODH 3P4MA 1FNEB 4NJ9H 1VGKA 3STZB 1XT5A 2GCYB 3F58L 2OM5A 3I6GB 4HIEA 2X9YA 4P9ML 4PJBB 5EU5B 3SQOL 4HWZA 1MAMH 1XGTB 2VLRD 1O0VA 1UKQA 1HK6A 2VQUA 4OB5H 4OBRA 1G6RH 1JFMA 2AV7B 2ADFL 5JHLH 5J06A 4HHAA 4LBEA 2CPCA 1A7OH 4PJIF 2PTUA 2IMMA 3REVA 2JCCB 3VD3A 5C0CB 1NQBA 4K7PY 1NEZG 4M48H 3ROLB 2VDOL 3BZ4B 5T3XH 5JXAL 32C2B 3RUGB 3GSWA 5KVEL 1YECL 2COQA 3OR7A 4F9LA 4H26A 4X4ME 5HPMB 3QA3A 1LO2L 1S8DB 2Z4QA 4OF6A 4PLOB 4RMQA 2CR6A 5IB1B 1LK3H 3KYNB 1VCAA 4HBQA 4OGZA 5IEKB 5T3XD 4LSPL 4X80H 3IDIA 1HWGB 5IR1B 3O3DA 3QJFB 5E6IB 5EOCJ 5IG7A 3LZFL 4RISH 3DMMD 3L6FB 3CC5B 3VFPA 2VAJA 1O7SA 1KIRB 2JF1A 4JVWA 5FA3B 2AI0L 3C2AH 4GKOA 1XR8A 2PYEA 1MRDL 2VQ1B 2JELH 4GBXA 3L5WA 1A7NH 4XRCA 4O5LL 1LEIA 1LDSA 4NFDA 1UJ3C 2O5YL 2BMKA 2C9AA 3G6AA 3FAWA 2UWEE 1OP3K 2PXYA 5DJCB 3T3PF 4EZMA 3MLYH 2FECL 1K3IA 1D5IL 4P5KB 5M94B 4N0YH 5BO1H 1J12A 1BOGA 1TJIH 4GAJH 2F53A 5GGTL 4YR6B 4L8SB 3BWAA 4D2NA 1MLBA 2AAVA 4HKJB 2RCSL 4JJHA 1JNNH 1YJDL 4Z7VE 4UUJA 2JIXA 3VFGL 2R1YB 3DYPA 1MCFA 3O3AA 2YZ1A 5FDWA 3KPQB 1NLDL 4AMKL 5IF0B 4R2GD 2VO5A 1DCLA 3HPJA 5ID0B 2DQEH 5CMAA 3WXVH 5C0BA 3FN3A 5D5MA 1P69B 3BPNC 3B3IB 3PV7A 4HEME 5JHDA 3VJ6B 4NQDB 2YZ8A 3W11C 1NGQH 4LCUB 2RGSA 1SJXA 4FQCL 1CLZL 1AHWC 1JF6A 1YNLL 5KSBE 4NM8H 4MJID 4XWOD 5DEGA 1LP9E 4JFHE 5DLMH 5E9DE 3HA0A 1I1FB 2FBJH 2JJVA 4MXQC 1KBGL 3KHOA 5C0GB 1EEUA 1RHFA 1K5NA 4QLRA 3JXAA 4LIQH 5DK0A 1JPTL 2NR6C 4XCNB 4QXUH 5TDPB 4RQQA 4PRHE 4FQPA 3MLVH 2IJ0C 2D4FA 1LO0L 2VAAB 1KELL 3QEQE 1LE5A 3GSQA 2HTLD 3EJZC 1SY6A 4HWBA 3GGWB 1QOKA 2YPLD 3K4AA 4JHAH 3VXUB 3DO7B 1U58A 3ES6A 1WBYA 1N2RB 4S10A 4Q9RH 2EH8H 4Q9CA 3LRSB 1XF4B 2BHUA 3C9NA 5DYOA 2WBJB 5ERWB 4NZJA 2EEAA 2YA2A 3MRCB 3WS6A 2FB4H 4ZPVB 3WXVL 2OYPA 2ITCA 2EYRB 2QHLA 4XCYB 3VH8G 3S34H 3TNNB 3VFWA 1X5LA 2I27N 2E6QA 2C4XA 2W9EH 3BQUC 4UV7H 1NJ9B 3KPNB 1MF2L 3VGFA 1T04B 2F74A 5KSUB 3FQRA 5A16B 4YXLH 3C6LB 1D6VL 3W39B 5CBAB 3GMMB 5FUCC 3BZ4A 2W0FB 4NCDA 4QRSA 5C0JB 2QSVA 4HDIA 25C8L 3QG6A 1ZS8A 3DSFH 2IQAA 1NANH 4PB0H 2AABH 4WV1C 3JV6A 4EI5C 5A2IH 4I9WD 2YPVH 3DGCR 1Y0LA 1SM3L 5EUKA 3VG0H 1CVRA 1M6OA 1AKJA 1CTNA 3VGHA 5IHUH 1ZA3A 4TQEH 2KL6A 2Y72A 3BEVB 3VFPB 3IXAA 5HI5C 4JGJA 3KXFB 4LLQA 5EU3B 1KIPB 4JJ5A 3UC0H 2FJHA 4LLVA 4ENEC 1NSNH 1PLGL 2PW2B 1AGCA 3Q48A 2DQHL 1WITA 3RKDD 1JI1A 2MKLC 4F8QA 2LU7A 5E8NB 3RL1B 5I75B 2AGJH 4LSQL 1D5MB 4AT6A 1D5XA 4AIOA 1C7SA 1AD0A 3SDXA 2Q6WB 2WZPD 2IFFL 2WUBL 3ARSA 4X7TB 1LEKA 5HYFA 1FFRA 3QUKA 2D31B 2VE6B 4JKLA 1BGXL 1A7OL 2R0ZH 2BVPA 3ARFC 2FIKA 1XIWB 3OKNA 4MD4B 1J8HA 5IBUB 2HFEA 1S5HB 2CIKA 1K4CA 4OLUH 1JPSL 4GMSH 2UY7A 3KGRA 2YC1B 3I3EA 2VZUA 2YUXA 5E2WL 3RWCA 2GJJA 3GMOA 4YHIB 4F33B 2BSSB 4NYLB 1WC7A 5HI5D 4EN3C 1NGWB 3WIHA 4F57L 4KJPD 4LLWA 1CXEA 5SX4H 2XWBA 1EEZA 3B9KD 5EOQH 2A2QT 1PEWA 4J1UB 3RJDA 4M1GL 3DURA 3F7PC 4YDVB 1ADQA 3OKKB 2CSPA 4M7LL 1CFNA 3LKSA 2IBGA 4LCWE 1QHOA 5JW5B 2X4SA 1ZT4A 3BHBB 3ZDZE 3M07A 4KROD 1C12B 4ODXA 3C08H 3G6JA 3VFNA 4XT1C 5F9DC 2PUQT 4GOSA 3I75A 3V6OE 4QGTA 1T5WB 3QHTC 4O5LH 2W1NA 5E56A 1TMCB 2BZDA 3K2UL 4PREA 3QRGH 4GSDH 3PWUB 1XGYH 4YHYC 1JHTA 4XP4H 4OZIB 3GRWA 1W2KT 4PJHB 4CADA 4S1QH 3TCXA 4J6RH 5T1MA 1RZIB 2XFXB 3UYOD 3SDCB 3C2SA 5F1SA 5C0JA 1I9IH 4NQXA 2YPLB 3FHQA 3T3PE 4QNPE 5BXFB 2A38A 4Z8FL 1A4KB 1YY9D 4PJ9A 4YBHA 1DBKH 3GZKA 2R0KH 4XZUB 3U4BH 5HHXH 4YAQB 5CUSL 3L3HA 3QR2A 5JDSB 4P9HL 1IILE 3K46A 3MRDB 1ZWIB 3N1PC 2AERT 4M8VA 1PVHA 4HS3A 1FZKA 3RKPA 3MLXH 4UT6L 4XPTH 4ZFZA 2APBA 4KK9D 4F9PA 5F3BB 3R4DA 3ET9F 4KRPB 3B83A 5KAQG 2AW2A 2X44D 4P3CH 4K71C 2ARJA 3BI9X 4MAYA 2MPAH 5IQ7H 4L8SC 2DQDL 3OX8A 1BFSA 1E4KC 4UNUA 5E03A 5ICYA 2YPKB 1P2CA 3U4AA 3K8KA 1CU4L 4PJFB 3HMXA 4BQ6A 5C1MB 1DQTA 3ULVH 5ETUA 1J7VR 4Z7UA 4XCFL 3D3VA 2BCKB 4I18C 3QNXB 4LRIA 1NBYA 3OSKA 1A6ZB 2BNRD 5FYJH 4CU8A 3BEWA 4HUVB 4QOKE 5DO2C 1BM3L 5GGQL 4H1LH 5HI3C 4RX4A 1UWXK 5IMOB 4NC2B 5GISL 2ZUUA 4HIIA 4ZAKC 3QJHA 3OKMA 3W2DL 3VG9C 3KJ6H 5EBMB 1FJ1B 1XGPA 3QCUH 1UWGL 5FYJD 5FYLH 1IRAY 3L3OA 3E3QC 4UIMB 3NIDE 2BOCB 5HHXL 2W38A 3BN3B 3SDAA 3FO1B 1GPOL 5DMGC 1FNAA 4FTVA 4MJIB 2OL3B 4O4YH 2J8HA 5MHSE 1KYOK 5D7IB 3H7BB 4LP4A 3WKMH 5GHWH 3I50H 4OGYH 3FHAA 3ZYZA 2AK4A 4JFPB 1CICA 3AU1B 3QIBD 1LO3H 3V5HA 1HILB 2XZAH 1G7QB 2N7AA 5DR5L 5GRWA 2YPVL 4JFEE 3O4LA 3BKYH 1JZ4A 3NCJH 5E6ID 3VXSB 3GRWL 1DR9A 2ID5A 4N0CC 4XPHL 1B3JA 4P5KA 4M4RA 2VRAA 4Y88A 4XX1G 4G8GE 2Q86A 3AB0C 3QG7H 2WBWB 3HE7A 1ZLVH 3U4BL 1GIGL 3G9AB 1I7RA 1VADA 2BOBA 5JQHC 1Q9KB 1FFOB 4M43H 2EYTA 4F7CA 1QBML 3L3IA 5DXWA 3AREB 1F2QA 5TDNB 4WFHD 1S5IL 1EZVY 3MRDA 4J4PA 2OP4H 1WISA 1HE7A 4MJ5B 3G6JF 5MERB 3VGDA 5KN5B 3VMPA 5FAAA 3ALWA 3BWUC 3QUKB 5E8DL 3FQNB 2DQUL 4LIQE 3RZCA 1JYNA 7FABL 5FYKL 1QSVA 5C9KA 1PEZA 2XFXA 1HCVA 5ETUB 3ZE0F 5IFAL 3QIBC 4TUOA 1ZTXH 1WSST 2R9HC 1BX2A 3UZQA 2NY4B 5DRXB 5DZOA 5IVZB 4PJDE 1TTGA 4FNLL 1R3LB 2C4FT 3S4SG 4FZEL 2YEZB 4HZLB 4XNXL 1Q9LA 3DV6A 3BYYA 3FQUA 4WU5B 5D2LF 4JREB 3SN6N 1VFAA 4JM4H 4M3KB 4Y5VA 1DQDL 2DAVA 1QFUH 4ZFFB 1OP3H 5I76B 3VFUA 5HYSG 4CRPA 1HKLH 3T2NL 4I48A 4PBXA 2ADJB 5JO5A 2H26B 1JFQH 3MV9E 2H6PA 1FO0H 1UH4A 2XQBL 4ZTPL 2FX8L 2BNQB 3WFCH 2GJ6A 3EYFA 3LKOA 2F5BH 4IRJA 3D39E 4U4BA 4BUGA 1Q9OA 3BDYL 3DARA 1ZGLA 5GRUL 5CBAA 5KVMC 3U4EA 4JKMA 1D9KB 1GGIH 1IEBB 3SKJH 4Z77A 1YQVL 2PO6A 3O45B 4BH7A 1KPVB 5HDLA 2DMKA 3D0LA 4ZOBA 5HPMA 1XR9B 3I2CH 1MY7A 2Y7QA 1MSPA 12E8L 4J8RA 1RJZB 3ZKMD 3MRPB 2D9QB 2Z8SA 3UBXB 3SDDA 5ERWA 3NVQA 4NCC2 2ZKHH 5J6HB 5ISZB 1J88A 2X1WL 1HHHB 4RBPH 1A5FH 3TFKD 1YY9C 4ONFH 1JUFA 3P77B 3CFJB 4D9LH 5FGCE 3TN0A 1OT2A 4G5ZH 3WJJC 5E1AA 2NY6C 3ULSA 3AM8A 1N6QH 4MSWA 5T1KD 5C0AA 4G8IB 3PWPE 3LMJL 1RHHA 4S1RH 5EIIA 1W72H 5HGDB 4ZXBD 5FF6A 1YMMD 4PJ5B 3T4AA 2A0LD 2GHWB 4X9GA 3MOBH 4URTB 5F3HB 5TQ2H 5KJRL 3ARBB 3KLAA 5IFHH 4R7DB 3C6SB 2JKXA 2YA1A 4RFEB 3S5LB 3MLZH 4PGEA 4AIZB 1V3LA 1CVSC 3ARXA 4KU1A 4F8TA 4ODTH 1I8MB 3DUHA 2IWGA 4FQHA 4YHLH 1MCWM 3IFLL 1X5FA 2ZSWB 5MEQA 3B2VL 3VD7A 3CCHA 1DN0B 4L3EA 4OZFG 2E7LA 3V5DA 1BJMA 3HUJF 5ANMA 3GJFA 5E99H 5E8EB 3W2DH 3I84A 4MJ4A 4MJ5A 1I8IA 4ONOA 1JHLL 5DJDB 2YMXL 4U1NA 5I8OL 5D7IA 2HLAA 4M48L 5CGMA 4PJEF 2DM4A 1U0QA 1KJMB 4UQ2B 3D39A 3STLA 1QSFB 3MCLL 2HFFA 1CL7L 4NM4H 3P11H 4N0YL 5BO1L 4I3GA 1NCBL 4K2UH 3GFUA 1IZJA 4WUUE 4JFQB 2B5IC 3RWFA 4TUOB 1CGYA 2AJXL 5HGAB 3TV3H 2QV2A 5IJVB 1YMMB 3P4NB 4WI3A 5C0BE 4NZUH 3Q5TA 4HDIB 2WINA 2DM2A 5DMYA 4JM2F 3QG6B 4PJCE 4PPTA 3DHMA 4XVUC 4X6CF 1ORSB 4H88H 2A6JB 2BK8A 4IEFB 4JY5L 3QUZA 4Q7DA 4MA3A 1DFBH 2B1HH 3DUUB 5JHDB 5SWZA 2ZJSL 4QRRA 4Z7WE 5GISH 2UUDK 1FNHA 5E4EB 4RAVB 3IFLH 2VH5L 3OKOB 1QKZH 5DMKA 3I02B 2JB5L 4I8DA 1IAOB 1KJVA 2BRRL 1WEJH 2DKUA 1D5IH 3W5MA 2CK0L 4EI5A 1FL6B 1ZHLA 5IBTH 5GIRA 1MHPL 5LGHH 5KSVB 4OLEA 3C60C 3L3DA 4MD0A 2GW5A 2E5EA 2XYCA 4KZEH 4OD3H 3TNMB 4Z7OF 5EIVA 1W0YT 3LD8B 1H3GA 3LN4A 4GAYB 4BSWB 4TUJA 3MYZA 5HHVL 4PRDA 2AI0H 1D6EA 1FFNB 4PB9H 4OIAA 3VXQB 2ZOKA 4F37K 5IWLC 4N90D 1KJ2B 2F19L 2PF6A 2BCKA 3OB8A 4L3EE 2FDBP 3MROA 4KFZC 3MLUL 3KXFD 1A14H 1U8LA 3MRMA 4ETYA 4Z95L 1L0XA 5C0FA 3BMWA 1QSED 3BP7B 5IEHA 4YAQA 2EIEA 2KBGA 4AEIH 5BV7H 5L9DH 5J6HA 1CFQB 4N68A 1WK0A 2WWMD 3GK8H 3L95B 3OL2A 3WEXB 3QYCA 5CJQH 3UTQB 3ILPA 1EJOL 2APTA 1Z9SA 4X0KB 2D7TH 4KAQH 4YK4C 3TPKA 4OLWL 2O61B 1NFDA 3D9AL 5GRVK 1GGIL 3C87A 1NLDH 4AMKH 1DANU 4RWHA 3MNWA 5HHOA 2R29H 3CZJA 2VL5A 4XP1L 3GJEB 4UINH 2BXYA 3C6LD 5KSAA 3F7VA 1BF2A 4XC3L 2B1AL 1Z0MA 1IEBA 4Z77B 2EDFA 4UMGA 3DETC 1X5GA 1DQJB 3H9HA 4QCIA 3I6KA 1UVQA 3UTSA 3T4YA 1NGXA 4R96A 5C6WH 1J1PH 4KV5E 1T0MA 5DJ0B 5MP6H 2C5DC 4CDGC 3FJTA 3VFOB 4CVZA 1E6OL 3HE6B 2C26A 1YMMA 4F7TA 1OTUD 3KNBA 2AP2A 2WIMA 2A73A 3W0WE 2NW2A 4OZFB 1E27A 1VERA 3M17A 4P57B 5FUOL 3GB7B 3UC0L 3QUXD 3MR9A 1HHJA 3CVHL 3K7UA 1I7TB 3H9SD 3O6ML 1JMXA 5ICXA 2HT4D 5F89B 2F54B 3TFKA 3QI9C 3DX6A 3HAEH 4ZTOL 5EZOH 4OF3A 4E41E 4I18B 2W0KA 3JWOC 5GSRB 1TDQA 2OZ4A 4FA8A 4QHNA 3TF7C 1IC4H 2W07A 3MZTA 2OXGA 2P8PA 3J7HA 3OXSA 4KRPC 4WW2C 1Y18A 3TCLB 4NKQB 5GRZA 1D9KC 3KPRE 4MXWL 5D7KE 5DK2A 4S0TD 1JL8A 3QUZC 3D2UA 3IVKA 1QVOA 1JWMA 3LKRA 3RTQA 2I9LB 1QNZL 1U95B 2R0LL 4QTIL 2QTEA 4KY1L 4J6RL 4YUEH 3AY4C 4MAYC 1N3NB 4PD4J 1FE8L 3MBEB 4XCEB 3TO4B 2GK0B 1JGEB 3GKWH 2ICEB 3TIDA 5ACZA 2FR4A 1Y6MR 1MF2H 1QBLH 4KHTL 3FQWB 2VZSA 2GUOB 3L7EB 3NPSC 4MB5A 5A43C 5IP4A 2HJFB 3Q6FB 4D0CA 5C0DA 1KEML 4I0PB 3TJEH 1VEMA 4PRBA 3D25A 5DUPL 4JPWH 2HMIC 1HEZA 3JTCA 4JANB 3T0DA 1AD0B 2Q6WA 3FQRB 5FUZH 3OKDA 1X3DA 4NQEA 1GZQA 5DURD 3B9EA 5F9OH 3VFVA 2I5YL 3EGSA 4C57C 1ZA6B 4HC1A 4RMTA 1CDIA 4KQ4H 1YY8A 2IAMC 5IFAH 4C56D 2DIJA 4F3FA 3IKKA 2OJZH 2LU4A 3LS5L 1BVLA 3RGVB 1ZT4B 3BHBA 3MRGA 5J13B 1F11B 5I6XB 3AS3A 4G3YL 3IFNL 3O4OB 5FKAB 4V1DA 1UACL 1GC1C 1NCUA 5F8RC 3O4LB 1DANT 1SMOA 3VFSB 5LCVH 3MXWH 1KYOJ 4YUEL 5CEYA 2H3NB 4IMKA 1ZS8B 4DKEL 4HLJA 4ELMB 3TIEB 1H5BA 2FHCA 4NN7C 6FABH 4MXVE 3FCTB 4NNPL 1Z9LA 4MNQD 2OI9A 4Y4FA 3AREC 4NQCB 1EHXA 4M6AA 4BUHA 3H0TA 5CKAA 5H94A 2QADD 2W59A 5ESQB 1F4YH 3EO0B 4F7PA 1CDCA 1YEJH 5J57B 2OTWB 4PB9L 4O2EB 1JWMB 1SY6L 1A4JA 1A6AA 4BSWA 3G9VA 3SDYL 3BW9B 1G9MC 4KKCC 1W8NA 5F1KC 2NY1B 2NYYC 5HVGB 3HE6D 3F58H 5FGBA 1FSKC 3MRKB 5FYLE 4Z7OE 1HH9B 1HN1A 2CKBH 3BMVA 4NDMA 1CTOA 1ORQA 4LGPB 4HT1H 4UDTB 4WV1B 3MV01 3WJLA 1U91B 4M6MH 4CW1A 1PG7H 1UB6B 4FTVE 3GSNL 1JHKL 3PGCB 1X6LA 3QNZB 5DD5H 2VITB 4UV7L 1QRNA 3WL9A 1G7PA 3H9YA 2V17H 4H0GA 1Q0YH 4FQLH 5IW6A 3S34L 4JFXB 3GSNB 2R1YA 1KTLB 3NZHL 2ERJB 3WFBL 3O6LH 2QADC 3QO0B 5T5NF 4HS6B 4IS6B 1IVLA 2VZVA 4L9LC 1PSKL 2FJFB 4YZFE 4N5EC 3ZE1E 4WNQB 4U1JA 4PJGE 3CUPB 5DEFB 2IPUG 1VACB 3AMKA 5I30H 3MV7B 5FGRA 3IDUA 4KDTA 4WWKB 3CNKA 3QIUA 1CF8L 4LAJH 4OSUH 3IFNH 1BVKB 3MV7E 4DN4L 1MCOL 3QIBA 3HNVH 1U8OB 2EECA 2Q86B 4P59H 2VIRB 4JKWA 1AH1A 5F7UA 1MCSA 3L5WB 2K7PA 4ONGL 5EU6E 5HHME 1TMCA 5TDOA 2DOCA 4OZGB 3ZKSD 5IK3B 4L4VD 4NHUE 5LXGH 1LMKA 4GKZB 4LVNB 2VZOA 3IF1A 4L3AA 2ENSA 2GT9A 4TUKH 1JHLH 4LSUL 4E0RB 1E6OH 1S9XB 5FHBH 3G6AB 1WCQA 3V52H 2PO6C 5H37G 5HXMA 1K8DA 1OGTA 4PJAF 3EO1A 4OUUB 1DVFD 3S37X 2B4CH 3NOIA 4WW1B 4CKVX 1PX4A 4P2RA 3N85L 4GMTH 5IBTL 1EAPB 2ZWLT 3OG4B 3O2DH 4LMQE 5MENA 1DLFL 4JFFE 1CG9B 4YDLB 2NNAB 1GOGA 4WEBL 3CDCA 2P8MA 3WFBH 4HS3B 4GKSA 1NCCL 1J0ZA 4NRZA 1KB5L 1YEJL 1BQLH 1KNOB 3ZYIA 3BKMH 1WTGT 2A1WH 2FHBA 2HKFL 3BPNB 3L3DB 2DI8A 4LBEB 3GJFK 3GSUB 4MLSA 2BVPB 5ITFB 1NAMB 4XNQB 4BQ8A 1DJSA 4X80L 4EIGB 4EVNB 1RZJC 5DDHA 3BJLA 4FXKB 5D8JL 1BQHB 5CEXA 2PYEE 4LCWB 3AXLA 1SJVA 3GI9L 1RY7B 1OWWA 4WV1A 4LHQB 3H9SA 5E2UH 4XVTL 2XQYK 1ZHKB 1MRFH 3GM0A 4HFWA 4NQUA 1UM4L 3MV9A 1GZPA 4PRNA 2E7MA 4G59A 3L5JA 1U91A 3OKKA 4K3DL 4RBPK 4XXDA 5EZJB 3AM8C 3P9MA 4HKBA 3AAZB 3CC5A 1GGCH 3BN9D 1C12A 1R5VA 2WBJD 2ESVE 4F15C 1BPVA 2UVEA 1L7IL 2OS7A 4HIEB 1AKJB 4M1DH 3IS0X 3QUYA 3KVQA 4QY8A 4BK4A 1N6QL 2NTFA 2ATKB 2V2WB 5TE6H 2AEPH 2ADIB 4LOUD 2ED7A 3NCMA 4PRHD 2ZSVB 5I1LA 4KJQD 4K3JH 4ZUUA 4CVUA 3SO5A 4YHNB 4KK5D 1U36A 5EG6C 4WTWA 5DT1H 3GMRA 4RGNC 5D1XA 1U93B 4YE4L 1BAFH 1FLRH 3SOBH 4QXTA 3W82A 4JFHD 1IAKB 2NX5D 3Q6GL 1S78C 4OIIH 3H9HB 3V4PL 5EUOF 4RZCB 5A16A 5D1QB 1BIHA 2V5MA 3MTRA 1I85A 4QT5A 1BEYH 1M7DA 2VLRA 3WS3A 2X9XA 4G7VH 2VE6A 1IM9B 3RTQD 2CUIA 1IM3A 1XIWC 1VA9A 1YEHL 1A47A 3EFFB 5L2KD 3ARWA 3TNNA 1KJ2H 3PWNB 3N50A 4IDLA 4KI5F 4U1SA 2BHYA 3BKJL 4LDOB 1NUNB 4ALAH 1A21A 4CDHA 4QNPF 5T3ZE 4PDCE 5HD8D 4YDJA 3B43A 1FFQA 3IGAA 4PY7A 4K9EH 4P5TA 1XF4A 3DGGA 3MLVL 5I1KH 4FNLH 2E7LC 1DEEA 4GAGH 1X5IA 4YC2B 5IESH 2FZ3A 3JV4B 4H8WL 4XCEA 2UWEF 2Y4SA 3WUZA 5I0DA 4JY4B 5DQDH 3JTTA 4W6YB 1TZGH 4L5FL 1WZLA 4QHUA 1GC1L 5SV3A 4ODVH 1U8NA 3OPZL 2V2TA 3ESUF 3H9SE 4QWWC 3CH8A 4TTDD 5DD0L 4G6AC 5EFIB 5I1CH 4NUJA 2XG4A 4LRNL 1NDGB 1LO4H 3EDKA 2D7PA 3F62A 4FQIL 1XGUB 3FO9B 4CVZB 4L9DA 3OHXB 1UXWA 5A2KH 4WGVB 3UEZA 3QDMA 4XWGL 4ZO9A 5SWZD 1TQCB 1C1EH 4TNWF 3REWB 3S4SA 1AFVH 2Y36H 3TT1L 1RQ5A 4TVPL 3QI9D 1LQSR 1T7YA 3SE8H 3BQUA 5T3XE 2AJVL 1JF1A 1NDMA 2X1OA 1Q9KA 2G2RA 1MJUL 3OF6D 1U8QB 3U0PB 2QL1A 3QXDB 1DZBA 3A67H 3QDMD 3WS6C 1AO7D 1N5AA 1TENA 3RWEA 1R5VB 4QXGH 1TVBA 4QRPD 1IGJA 5DQJA 2EDXA 4WU7B 3D2UB 5F7NC 5LXGL 2DLIA 2JB6B 4H8WH 1SM3H 3VG0L 3VI3F 4MDJB 1OGAD 4DKFH 5E7BA 1F97A 3NGBC 1EEQA 2Y5EA 4OCMC 4QRUA 1IL1A 2A6IA 1NGPL 3HCVB 5CSZB 3UPAA 2L7JA 4NO2A 1A6UH 5I2IB 1IAMA 3OGCB 5DD3L 2XKNB 3RWFB 5L2KB 3E6FB 4X5WB 5DJ0A 4ISVA 1FPTH 2VLJD 3VFMA 4IIQC 2NW2B 3LMJH 3FO1A 3G5YB 1I7UB 3KYMB 3D39B 3QQ3B 1MHCB 5HYQB 5HJ3B 3UMTA 3KPLB 2BNUA 3BXNB 3TVMA 2P5EE 3DIFA 5CP3A 3MRIB 4TPRL 1E6JH 1AC6A 2DLFL 1EV2E 3ARQA 3UJIH 2P46B 1I9RH 4TTGA 1RURL 1MWAH 5IESL 4Y1AA 3SBWC 4JZJB 1RIUL 1GAFL 4ENED 1LK3L 4LQ1A 3O2VL 5C0AD 1FHGA 3TN0C 5BW7A 1CBVL 4OFYA 3RDTD 5H35B 1G9NC 3P0YH 1NAMA 4XNQA 3ZHKA 1MPAL 2E7HA 3MJ7B 5D1XD 3MLTB 2DQTH 1XCQB 2MCG1 3QULB 3A6BL 4FXLA 1U8MA 2IPKB 4WI7A 4EQ2A 1AGEA 2APVA 5IW6B 3U82B 1CIDA 1OSZA 4DKFL 1NDGA 4R4ND 5GS0D 2BJMH 2W0PA 3LEYH 3T0EB 3GUTB 5AG9A 2A0LC 3SQOH 1P7QB 5HGBB 4TNVF 2HWZH 1UB6A 5FV2A 5GGSB 5C0NC 2VZTA 4JFEB 3KG5A 2HT3C 4KZEL 3CFDA 2OL3L 5GZOC 2VSDA 3TH4T 4XNYL 5IWLA 4NQCA 3V5KA 3BYTA 3MLWL 2XKSA 3QFJE 1WV7T 2GY5A 2OMNA 4NJAH 4GAYA 1SYSB 3G08A 1AIFB 3MJGX 5FCUL 3LPGA 5BQ7A 3ULUF 4MD5B 5I73C 1CDBA 3T0BA 1TPXB 1RURH 3QUML 3LV3A 2W0LA 4AEHH 2ARWA 2R15A 3U7YL 5GIRB 4I3RH 4MAUH 5JW4N 1FGNL 4PJHF 1UC6A 4HJ0D 5IV2B 4DKAA 5E5UB 4F58L 3CPLB 1CGTA 3KS0J 5DC4B 3F7QA 4QRRB 4R26L 1SVCP 1PDKA 2RJMA 3GHEH 3PHSA 5L88L 5I19H 2XWTA 1KLGB 1JNLL 1R3IL 3SBWA 1N0XL 1ORQB 1ZLWH 3LY6A 5C3TA 4ZXBA 4PGEB 4LGSB 2PW1B 2IPTH 3K8LA 4XPBL 4M7KH 3UCRA 1ES0B 2GYSA 3OGCA 5EUOE 4XMPL 5MEND 3JWDH 1QRNB 4P9HC 4J1UA 3K74B 5FUZL 1A6ZA 1K6QH 1T21A 3IETB 1F3JA 5HHVH 4JFYB 2AK1L 1LDPL 4IDJL 4S1DC 1T4KA 3JWOL 4ELMF 1A3QA 4NOFA 1KB5H 4MMXC 3V7AE 4WU7A 2A9NH 3H0TB 4B5EA 5L2JB 4YHKL 4RGNB 2EIZA 4GQPH 4P4KD 4POZD 4G8FA 1WBZA 2VLLA 2PKDA 3UX9B 5ALBH 1KCUH 4FFVC 4HMDA 5IHLB 2EYSA 5IB5B 3VXRB 3STLB 3NH7L 2P8PB 5DI8A 4XP9H 1JNJA 5EFIA 3ZSSA 2NY1C 4HGKC 4L4JA 2FX7L 4YHZL 3TT1H 4K71B 1S7VA 4WEUD 2H32B 4MNGA 2Q8AL 4XCCL 1CI5A 4IOIB 5CWSB 3ROLA 2X7LB 1QFHA 3RWGB 1T66C 3FQNA 3G04B 3OKEA 4NBXB 3P0VL 3KHQA 1FVEB 4PGCB 3MBEA 5T3ZL 4UBDD 1U8JB 4XBEH 3HC3H 3U6RB 4XNYH 3F6LA 3WIHL 5HYIA 5ILTH 3T2PA 4MSWB 4RNRB 4CAGA 3RVWC 1K6QL 4FQXA 4FXGB 5HGDA 4QHKJ 4LEOA 2C3XA 1SEBA 5TFSL 1ZANL 2XRAL 2R4RH 5JOFA 3VFOA 3JV5A 1JWSA 2D03H 3X12A 2ENYA 4N5EA 4ZUWB 1ZLVK 5D7LB 3WFDL 4U1SB 4QRTA 1OF2A 3ULUD 5ABDE 4JY5H 4KI5C 1UZ8B 4E42B 1HZHH 1R0AH 5TDOB 1CFVL 2OZ4L 3P30L 5I1EL 3CPLA 4JG0H 1YECH 4AJ0A 5AG8A 3C8KA 2HKHL 1NGWA 1UG9A 4UOJA 3FT2A 5CINH 1U42A 2QJDA 1VKXA 4NGHL 1DBAH 2XTJC 1CS6A 2YN3A 4FP8H 3D0LB 3WXWH 4HKBB 1KCGC 4DAGH 3SE4C 4K3JL 5DD6A 3MOBL 3QIUD 1BM3H 5GGQH 1QFOA 4Y2DB 3WUWG 5DS8B 3H3PL 5CGTA 1CFQA 3AROA 2AQ1A 1WJ3A 5EC2B 1OCWH 3UPCA 2AK4D 4KKLD 2HA1A 3LDBC 4KRNA 1IGFH 1U3HB 4UTAL 4GKSB 4NRZB 1Q9WA 2YKLL 3VGGA 3G5XB 4XP5H 4OGAC 5I1LB 4EI6B 4H0HB 2C7UB 1WCBB 4KHXL 4PJXE 4Q2ZB 4WTXA 1P4BH 1RUQH 3IJYA 4KH2A 4Y4KD 2CJUH 4P99A 2EDDA 3SE9L 2EYSB 1GGYA 5TE7H 5JQ6H 4I4WA 3QPXL 5IMLA 3GK8L 1K3ZA 4N0FB 3L7FB 2VISA 4OCXH 3SE4A 5C0FB 1OSPH 1JGUH 2UZIH 4JFDE 4S1DD 3ROOB 3WUWB 5I71B 1X5KA 2VOTA 3GSQB 3EZ8A 3GMNA 1CICD 2XPGA 4AH2B 4PJ8A 4Q97A 1LQVA 3O9WD 1S7XB 2X40A 2DQGL 2EYTB 4LVEA 4MB3A 2DF3A 1KACB 2F15A 4O2EA 2C4FU 2FO1A 1G7MA 1HINH 2R69H 1EO7A 2WUCH 5DC0A 1E6JL 5GRUH 1F6FB 3O0RH 3WBDA 1P7QD 3WDJA 2NY2D 3VFGH 4FP8L 3OG6B 5EB9A 1KB9J 5C6PB 1RZFL 1TNNA 2ARJQ 1MFCH 4L3CB 1T0NA 5JHDE 3RU8L 3OAZK 5I1GL 5FCUH 5D93B 4R3SA 3OJDA 2BNQA 3DOSA 1XGRB 3TA3C 3BUTA 2Z8VC 1CYGA 2GEEA 1MCHA 1QBBA 2J8UF 2YBRB 1YPZA 3CFCH 3B2UD 4AZ8A 2MJWA 2FX9L 1RI8A 3WFHB 2UY6A 1CD1A 1WT5A 4XAWL 5TH2B 3MJ8B 3RDTB 3ARPA 4DGYH 1F6AB 2GFBA 2A6IB 3FO0H 4G6KL 5C0EB 3MRIA 2CJUL 4DN3L 3IDGA 1KCKA 3QUXB 3MNVB 2A83A 2RFXB 1JTTA 5C08D 1JPTH 4TUJB 3WEXA 4JVUA 4UDTA 2AABL 4NRYA 4KVNH 2YRLA 1U58B 3ES6B 1YN6B 4NKOB 3LS4L 4XPBH 1IQWH 3EDFA 5DJXA 4MA1B 1DBAL 3PGFL 4ODUB 4ZUSB 3GSXA 3O6FC 3PABA 5AYUL 2N4IA 4AEFA 4DN4H 4U0RB 2XN9A 3PHOA 3MRHA 3VGAB 2P1YA 4F9PC 4YDVA 2ZNXA 3PXJA 2MHAB 1J8KA 4R4NC 1MIEH 3KS0H 5SWSD 5IJKA 3TLRA 1S9VB 4L4TD 2E9WA 2ITDA 3HC4L 2R23A 4NC0B 3HNSL 3V9FA 1MFCL 3RWJB 1FIGL 3ARDD 2JB5H 2HLAB 1INDH 5SX4I 1LO4L 1HHGB 1XFPA 3MJ9L 4PLJD 4POUB 1MFEL 5C70A 2ZUVA 2OCFD 4LNVA 5TE7L 2BSTB 1H3UA 2ZJSH 5JQ6L 4QRQB 3T8XA 4P23A 1RUKH 5D1ZD 3BZFB 4GG6F 1LD9B 1K4DB 3IJYB 4BFIB 3DETD 4XMKL 1G7IB 2R2EA 1VKXB 2BOBB 2XPGB 1G9EA 1U8PA 5CEYB 3EFFA 2EE6A 1YEGL 2QHRL 4J23A 4RFNC 3N9GL 3V8CA 3C60A 1S9XA 4TQEL 4XC3H 5HJ3A 1AGCB 5ISZA 2IALB 2HYMA 5C92A 3NFNA 1AI1L 3ARGD 1YNKL 3QXUA 4KUCD 1SYVB 3WIHH 1B2WH 1Y6NR 4P23C 5FV1L 1FGVL 2BHZA 4Z7NE 1QLEH 5ECJE 5F9JA 4YDKL 3RX7A 4K94H 4JG0L 2IBZY 5H8DA 4QT5B 2F54E 1EAJA 1BZ7A 5F7MC 5J9PB 4GS7B 2Y5TB 5D7LD 1OSZB 1S7TA 5JOPD 1IJ9A 3H6JA 2DQIH 1WAAA 1PJ9A 1YN7A 5KOVC 5C0DB 4DK6A 4CN6A 2P43B 3WKNA 4UV4L 4ERSH 1FCGA 1RZIA 1UA6L 2APFA 3EYSH 3P73A 5EN2B 5IFHL 4HS8L 3CZFB 2AK1H 5DRNA 5TE6L 4LHUA 4C83A 3GMQB 2QKIA 3NCYP 2J6EA 5KVGH 3KPRB 2VLRB 5I76A 3LQAC 3OR6B 1XGQB 3BPLC 3IDYB 3U46B 3KPMA 2DLTA 4JO3L 1J18A 3AUVA 1TZGL 4D0CB 3W5NA 3VFRB 4BZYA 1G7LB 5IW3A 3SE9H 3KYOB 4V1DB 4HFUH 2G75A 3BPCA 3LVEA 5ADOL 2E9JA 2NX5B 5FYLL 1LNUB 2IAND 5EU6D 4OQTH 3DTXB 3EGSB 4OLZH 4Q6YA 3ZKXB 2BJML 3ZDYF 3SJVD 2W92A 1FIEA 4P46A 3DVFA 1VEPA 2IAMA 3U6RA 3LKPB 1G0DA 4NIKB 2ZOKB 1JHKH 4LHUD 4OM0H 2X70A 3H8NA 3TM6A 1W8OA 5MI0B 3EOBA 2OI9B 4N1HB 1X9QA 4P5TB 3TP4A 4NZUL 1FSKB 2P24A 2BSRB 3O9WC 4MVBA 3HN3A 4J3XA 4I18A 5GSRA 1I8KA 5AAWA 4OKVB 1RSFA 2Y23A 3DBXA 3O6LL 1X5ZA 4Y5XB 4JPKL 4W6XB 2G60L 4LPUA 1JN6A 5I17A 1HDMB 5CFHA 2BFVL 3D18B 1IFHH 2WUCL 3GB7A 5KZCD 1OLLA 4MGXA 2E6PA 1U92A 3HKFA 5EZIH 1JF1B 3NZ8B 2IPUK 1NMAH 1IGFL 4NO5B 4EN3A 4NT6B 3ULVF 4TUKL 2YBRA 5CEZH 3PDOA 1UH2A 2VXSH 5K59F 2R39A 4R4BA 3PQYB 1R3KA 5DRZA 5ISZD 4PJGF 4KKLC 2ESVB 4EDWH 3QPXH 4K9EL 1A6WL 3JWDL 1TZIB 2DJSA 4K3HA 2HRPL 1U8HB 1PKOA 4F7TB 4JHAL 1BLNA 3TFKC 5B3JE 1S7RA 3NA9H 3HRZB 3QIWD 3H7LA 3SE3A 3VDCA 3SO3B 4XP6H 1ZHBA 5D1ZA 4OI7A 5J11C 1ZMYA 3MRCA 3AC0A 4I0KA 4PBWD 1FG2A 1WFNA 4OV5B 3QCUL 2YXFA 3HZKB 4R97C 1FYTA 3TA3D 4JN2B 3QPQC 3QQ9D 3RY4A 5T5FH 1BWMA 5D6CA 3AU1A 3V5HB 2WIIA 5KZCB 3NACL 3U46A 1C1EL 1EK3A 4K3GA 3Q2CA 4U6XB 1FPTL 1BQHA 2JLLA 5CEXB 5KSAC 4TRPL 3IJSA 2C1OA 5CCKH 4P3DA 2VB5A 4X9HA 1EVUA 1GGBL 1T80A 5ITBH 4M6NL 4IRJD 4MA7L 3VGBA 3GGWA 4FQJL 3V4UH 3V0WH 1EHAA 1KB9K 3N1MC 5C09E 5HYJE 4YFEA 1UB5B 5L0QB 4XWOC 4X98A 4P5MA 5BZDA 1A6PA 3BH9B 3ETBF 3L3KA 1KGCE 4JDZB 1PW3A 4LCCA 4IOSD 5F7KC 3RL2A 3SJVE 3CFIC 1RK0B 1RULL 3FRUA 3S3PA 1XCQA 5CHNA 4N0CA 3TVMB 5IOPB 5KSVA 2Y07H 3WFEL 1P9MC 3MJ6A 1UCBH 5I9QB 3PV6A 1QA9B 4V3DB 4YPJA 1RUPL 1WFTA 5EZOL 3VWJD 3WD5L 1KTLA 5J8OA 5FYLD 3KJ6L 5A2FA 1CFSB 3JVGA 5D4QA 1UA6H 4EN3B 1U6AH 3IDIB 2MQCA 2DICA 3LV3B 5JW4R 1MHHA 3PQYE 5C2UB 2HG5B 2MTPA 3QNZA 4LSSH 2RCSH 2CRZA 5F6HI 2F8XC 1A9BA 4MQXD 5EN2A 1P6AB 4XPAL 2Z8RA 4L9LA 5EO9A 2O5ZL 4FQHB 2LTQB 2WP3T 4U6TA 3CFEA 5D1ZB 4NQCD 1MI5D 1TTFA 1BBJB 1UXWB 5L8LB 3QDMB 3L9RA 3BUYA 3E6FA 4G7YH 3ZHDA 4YFLF 3FMGH 2Q87A 2NYYD 3SDYH 4DW2H 2R8SH 1A7NL 5FKPB 3ARDB 3CXHJ 5I75C 1K2DA 3A6CL 1LK2B 4N8VA 2AEQH 5BJTA 3V6BR 2Z31A 3AS2A 4OJFL 3G6DL 5GS2H 4NO0D 5D2LA 4LKXB 1MFAH 1MCJA 3BZDA 4LLMA 1WIPA 4BSVB 1A64A 2FEDC 2ILLA 2NY3C 4ZS6D 1JGDA 3C5SA 4G8FB 4YEEA 1QYGH 3D1MC 3SE8L 3RP1A 1PKQB 1JZ2A 1W72A 4FS0A 3CFKB 4NO0A 1HQRB 2BSSA 1UJ3A 4CADB 1JPGA 4AG4L 3NPZB 4AEHL 1HHJB 4J3TA 4JFFD 4DVBB 2BNRB 5FYJL 4Q6IC 3CSGA 4KVCH 2DKMA 4M02A 1S9YB 4B41A 5EU6A 1I7UA 4AM0A 1T22B 1QP1A 5DD6B 3FB8B 1EFXD 3ELAT 5DMGD 1H0DA 3VFNB 1RV6X 3U36A 2X4UA 4X6BA 1MCBA 5IROA 1P84K 3BESR 4KDVA 4U3HA 4QGYA 4TN9A 4OZHA 5FUOH 1CLCA 3GI9H 4DWHA 2E27L 4YGAB 4Y4HD 3LKRB 3FQXA 4OQTL 1XGTA 1JPFA 4G6JH 4J7RA 3PDDA 2P5EB 2X10A 4NKIH 1G0YR 1XF2A 5E2VH 1XCTB 2A6KB 2D4DA 1SJEA 4O51A 1A9EB 4QOKA 1F5WA 2V9TA 4MS8A 2BRQA 1F58L 1GCFA 5CD5D 2EO1A 3X12B 4NUGL 1DLFH 2KPNA 1A1MA 4XGZB 4BH8B 1B6DA 3C09C 1A3LH 2ZUYA 3SKMA 3H9SB 1AXSA 1YPZF 4UAOC 4JFOA 5BZWB 4QRPE 1U3HA 1OAYH 3BD5A 3IDXL 5B21A 5ID1A 3INUH 4PP2A 1REIA 4PGDB 5F71A 5C2BH 3MBEC 2H2PC 1BD2D 3UTQA 3T0XA 4LRNH 1MUJA 4TSAL 1B88A 5DZLA 1INEL 4FTVD 2VLKE 3MRNB 2QSQA 4WO4D 2Q8BH 3BRGC 1OTTC 2WBKA 4AL8L 2Z92B 4WY7H 2X7LA 4XMLL 4Y0GA 3ZHLA 3DV4B 1HOCA 4PS4L 4F2MA 4XPGH 5FXCH 1JK8B 3V6ZB 2H2SC 4MNHB 4J3UA 1IGML 1SBSL 4PJAB 4XPAH 3TV3L 1NBYB 5C0ND 4CU7A 3KPSA 3IU3A 3QDJA 4M7ZC 1UCTA 5DI8B 5EBWA 1CT8A 4U3XA 2IH3B 2NXZC 1CL7H 2FJHB 1RZJL 3HNVL 1G7JB 1Z3GH 4RMVA 4ODWA 4YGVA 3SGJA 4PJCA 3S96B 2EKJA 3O3EA 2O93L 1G0XA 4JHZA 2VLMD 5EZJA 3VW3L 1CXKA 5I1JH 4QRRE 4D3CL 4N1CA 3AS1A 4OZHE 1U3HD 3H9ZA 2W60B 5I18H 5F9WC 1FFOA 5IGXH 1KN2H 1ND0B 5HHPA 1CLYL 4NZDA 4OZHB 1F4XL 3ULUL 1L6ZA 5DJ6A 3UPRB 1RZKC 4X6BB 5DEGB 3QIUB 5CZXC 2VDOH 2H1PH 3MNZB 5GRYA 1TCMA 3C5JB 4ZG1A 4R7NB 1ZGLP 3B8SA 5L8JB 4GRWE 1PGRB 5HYSB 3UTZB 3BRFA 1JV5A 4G9FB 3RWEB 5ENWA 4S1SL 5AUMB 1PX3A 5C6TH 4G9FE 5JORB 3PGFH 3SPVB 5L6YL 1LO0H 2VITA 4NN6C 3VXMA 4X8JB 3EOTH 2MHAA 4O2FB 3QP3A 5CZXD 4R3SB 3EDJA 2EE2A 3ALPA 2IALA 4GG6A 2GAZA 4HS6A 1HH9A 4Z9KB 3INUL 3NACH 3SDCC 2GSGB 5L2JA 4NM8L 2VABB 4XAKE 5I15L 4OCNC 5F6IB 4O02H 3CJJA 4HIHB 5E8OA 4IRZL 2E7CA 4R0LA 4YPGB 2YSSB 1G7QA 1XEDA 3GM8A 5F7HA 1QO3B 3BZFA 4M6ML 4YK4B 3ZYJA 1MFAL 2P5WE 1QFUL 5HYEA 1QLRB 2J88L 3B9KA 3ROOA 3WUWA 2ICWB 1T5XA 4CGTA 1E28A 3KPQA 3VXOB 3D9AH 2WK2A 4HKXB 5I1AA 1EEYA 3FN0L 1Q0YL 1QSFD 4WUUD 1JZ6A 2VDML 5KJRH 4KUZL 1J8HB 1OP9A 4PJAE 1A1OB 4DTGH 3VI4E 2XV6B 4Z0XB 1MWAB 2XQBH 4ZTPH 3WFCL 4ZS7H 4NN5B 4NQXB 3IU3B 2RHEA 1QR1A 3DPBA 2RAMA 5FB8A 1QFWM 4H26B 3SDXF 4E41D 1KEGL 3QG7L 4MXQA 3LN5B 3RQ3A 2D0HA 4Y1AB 3FT2B 4LPXA 3VRLE 1WIOA 2VXQH 3FFDB 5AAMA 5FDWB 1F4WH 1HSAB 5DHYA 1MFBL 3ARGC 4GRLA 3OXRA 1TETL 3LEYL 2GT9B 1HNGA 1X5XA 3QHFL 4I77H 3PWPA 3FT4B 3S8WA 2CLRA 4HGWA 1WZ1L 12E8H 1IGJB 1HHKB 1I9JH 4G8IA 4ZUWA 15C8L 4HLZG 5C0EA 3MUJA 2BY3A 1CLZH 1EGJA 4MAYB 3UPRA 4Z78B 4QO1A 25C8H 4LSVH 2VWEC 3O2DL 1S7UB 5SWQB 1DDHB 1FRGH 4NUJB 4OGXL 4G9FA 3P30H 1WCBA 1LP9F 3U0WL 3LKPA 2GTZA 2Q76B 3KLDA 3ORJA 1PSKH 3FFCB 2OJEB 5FECA 5K9KA 1AGDB 3D25B 3QDGD 1Z6JT 3P2TA 4GW5B 5CEZE 5GRXG 3SDDB 2VYRE 2EXYD 4X4ZA 3WLBB 2HJFA 3L1OH 3KPOA 4Y4KC 5EU4B 1LEGA 1TCRA 3FONB 4FQIH 5GS0H 2DJUA 1EGJL 2AJUH 2NY0C 3PJSA 4L8BA 4Y7MA 1UKTA 2WANA 3JWDC 1U8QA 4PD4K 1YEDB 1IKNA 1SEBB 3DVGB 3CCHB 5DA4A 1KTKE 1NUFA 4X99A 4LHUB 3A6BH 1H5BC 3CD4A 2H8PA 2FL5A 1HXMB 2WNGA 2QQNH 1YMHA 1QFWL 2HVKB 3UJTL 4YHML 2JIXD 1XGQA 3OR6A 5DWUL 2DI7A 4ZPVA 4K8RL 1YC7A 1YYMH 2YRZA 3LKQA 3WHE0 1R3IH 4MHHG 2XKUA 4MDIA 4PB0L 1JWUB 5D7JB 3P73B 4JFED 3TC9A 2I5YH 1B6UA 1F11A 1Q0XL 3DXAD 2DIAA 5FHAL 3NIFE 3KPSB 2KKQA 4D0DA 1G9NL 2IBBA 4Y5VC 5DTFA 5ILTL 4JDVB 1WF5A 5JIKA 3CSYA 4Y16A 4I0CC 4N9GA 4E5XB 1IM3B 1PKQA 3RWDA 1DFBL 3UTTD 1T21B 4JFYA 1W0WB 3KPRD 5D7KD 5ADPH 2NQCA 3DJ9A 4OI9A 1U9KA 3B4NA 2FBOJ 1WIUA 5B22A 2GKIA 5MERA 1BFOB 2CQVA 3WLWC 3KYOA 3M8OL 1BIIA 4D9QD 2ZCHL 2Q8AH 2H1PL 5DJXB 4RAUB 2PXYC 2DQIL 4HG4J 1WZMA 5FHBL 3L3IB 1MFDL 1MHEB 3CSBA 4UNVA 2NZIA 2X6MA 3HUJB 1U2CA 2EDWA 3CIQA 3MACL 3ZDXF 1M4KA 5DFWH 1C5DB 3MLPA 3VD5A 1CD1B 5HSFA 3ZKNC 4R8WH 1OP5H 1UKSA 3DHJA 3SKUD 5EA0H 1D5MA 4Y5VB 3TYFA 4IOFD 4LP5A 3CX2A 4AIZA 4Z0BL 1GGCL 5L7XL 4BZ1L 1OVZA 1HNFA 4JN1L 3C9NB 2PO6D 4L8DB 4Y8AA 2OTPA 5IB5A 1AD9B 5DJAA 4XI5C 5DR5H 3U1SH 3VFTA 3Q5OA 1FYTE 5DGQA 4Y16D 4JRYB 5DRXA 4ZD3L 2XY2A 1QQDA 4JY6A 2JELL 1NGYB 2Q1EA 1VESA 4LAQL 2E6JA 4R4FL 4PJXB 2E9BA 4JZNA 5DVOA 4LCCB 5EC1A 1A6VH 1F3JB 1WTLA 3E8UL 4MNGE 4U1GB 5B39G 3OAYH 2AEWA 2FGWH 3U9UA 3FT4A 3G08B 2WBJA 3SDAB 2SEBA 1FVEA 4PGCA 1R3KB 4IOFC 5HHOE 2RQ8A 3UJJL 3NFNB 4JCLA 1QSEB 4YIQA 5GGUA 3RNKB 3AMLA 4WCYL 2VH5H 1DBBL 5I66A 1JGUL 2UZIL 3P9LA 4KK8C 1MFDH 4OKDA 5C09A 3O2WL 4NHCH 4YGVB 4XBPB 4LKXA 5C0RL 4OFYD 3RDTA 3MJ7A 1ZGLM 3MRQB 5IW1A 1MJJB 1I3VA 1TJIL 3E3QA 2Z9TA 4UDUB 3WN5B 4F7MB 2JJWA 3QA3B 2VL5B 1KG0B 2IGFH 2NY3B 1RUAL 4Z7UB 1JK8A 4KMLB 3C5SB 3S3JA 3V6ZA 4EVNA 5IB3A 3K2UH 2PO6B 5HVFB 2H45A 4PIRF 3BDXA 1KIPA 4K8RD 2BVQA 2QSTA 2XNAB 1QUNA 5EIQA 4LPYA 3QQ3A 3WYRA 5E5MB 5GGSA 4F37F 4L5FH 1OCWL 3QQ9C 3QPQD 4L4VA 1YEKH 1AI1H 5GGVY 4XHJD 1F90L 5BXFA 3MNZA 4OLVH 3PWVB 3QUXA 3KYAA 4KWUA 1JYVA 5E6IC 3P9WB 5IVOA 1MQKH 4BQCA 1C5BL 3TPUE 1DEDA 1I1FA 5JR1H 4RWYH 1ZWIA 3I50L 4OGYL 3D3VE 3S35L 4ZUSA 4PTUB 1KCVH 4HBCH 3UJJH 1JZ8A 1V3JA 2QQKL 2VDQH 1NCAH 1IZKA 4ZNEA 3MGAA 4I4WB 2J4WH 3IU4L 3MREA 1LHZA 1AQKL 4LSSL 4LMQI 43C9A 3I75B 5I0ZA 5KSUA 1TJHL 2E3VA 4NUGH 4Q58C 5DJZA 1RZKL 4DFIA 4CMHC 3QDAA 3IDGB 2HJLA 3ZDXE 4J3WA 4HWEL 1RZFH 3CAFA 5IMOA 1C16B 4KPHL 1UH3A 3HPJB 1AY1L 1AXTL 2IGFL 5H35A 3HFML 3IT8D 2R69L 3QI9A 3GBMH 2AXFB 4YHZH 5LAXB 5H37H 3B6SA 3WFEH 5C71A 2BVEA 3QUMB 3F12A 3VCLB 5K9OB 4NQEE 1NSNL 1PLGH 3N0PB 1IMHC 1YUHB 4AYFA 4NC1C 2YUWA 4Z95H 3V5KB 4U1IA 1KJ3L 1A14L 5HTSA 1OTUC 3IDNB 3Q6FA 1N0XH 5FEBA 2JIXB 5GS1A 5A1AA 4PGZA 3IS1X 1KJ2L 3V4UL 5INDA 4Y19A 2DTSA 1JF5A 1J05A 2DWEA 3DRQA 4HHAB 1T6WA 2ZSVA 3CDFA 5DQ9B 1CL7I 1FZOA 4YHPA 1I9EA 1AP2B 4PY8I 1E4WH 4WHCA 4IRSB 2DQJL 4G6KH 3G5XA 4XXCA 3P4MB 4QTHA 3VXTB 32C2A 1VGKB 1W72B 4KRMB 4N0RA 4JY4A 4TSCL 1BQHG 1QFPA 3OKLB 2CGRL 4F3FB 3F5WA 4ODHH 4NJAL 5DMIL 3VFTB 3KPPB 5D72L 3FFCD 3CU1A 4NRYB 5IEKA 5DRZB 4X6DB 3SKJL 2C1OB 4FFWD 4Z76A 1W72L 4KROB 5EULV 4OI8A 3D69A 4L4VE 4Z8FH 3DVIA 3RBGA 1KC5H 4XBGB 3MLUH 4GW4B 3VDAA 4D3CH 4MAYD 2Y7QB 2HKFH 4KRLB 4B7LA 4L4TA 3BP4A 4HC1H 1TQBB 5B38A 1U6AL 3V5DB 2BC4B 1DBML 3HNTH 5F7DB 2F8VA 1S8DA 2ICWJ 1NFDF 4RIRA 4HLZH 3FQXB 5KN5A 4KC3B 5C08E 1BHGA 5DUML 4FQQB 1V3MA 2NX5A 3FCTA 3LH2L 3GHBL 2IG2L 5KANG 3IGAB 4PY7B 3L3OB 1SJHB 4UIMA 2NLJA 3CVIH 2Y9RT 4K8RH 4L3CA 4NOBA 4HBCL 2W0FA 2Q20A 2GJ6B 4PGJA 3EYFB 3CVHB 4Z7VB 1QSZA 3ULSB 4D9QE 3THML 4E41B 3JTTB 2R4SL 2EZ0C 5EO0B 2HVJA 4IMLB 5EIIB 5F1IB 3QZWB 4XRCB 1I1CA 2V2TB 1MVUA 1KPVA 5EWIH 1UZ8A 4OV6F 1TIUA 2BP3A 4U1LA 1AY1H 3WNOA 5JXEA 1HKFA 4V1DD 4UIKH 5I1IH 3S88H 3D48R 4LPVA 1NFKA 1ZHNB 4RSVA 4LLQB 5BRZE 2BNQD 1CGSH 1F8TL 1HSBB 1YNTA 5J12C 4TTDC 5CJQL 1QBLL 4KHTH 2DBJA 3QXDA 4GXUM 5E9DB 3B2VH 1CDJA 3F7YA 4NQEB 4O02L 3ARFD 1GPOH 1NUDA 3PDGA 4NP4L 3IFOA 3LCYA 1O7VA 2DQDH 4NQSA 2WW8A 2EDQA 2YRPA 4X99B 4OKVA 4TNVK 5DUMH 3MV7A 3MMEB 1E4WL 3TBYA 3QRGL 1IT9L 1J05B 1CLOH 3KNBB 1RVFH 2CKBA 4JQXC 4RRPG 3T2NH 4I48B 5FF6B 1NBZA 1VFMA 1QEWB 3GI8H 4YLQT 3SKOB 3BOVA 3HMWL 3SDCA 3ZE1F 3WFZA 1KCRL 4Y4KA 1WUNT 1PQZB 2Q76A 1Y0LB 2RIKA 3ARDC 1DLHA 2VZ1A 2D2OA 3RX8A 2ED9A 3WDIA 2ZKHL 1IKFL 4PJBE 3L3JA 4MXVF 4X6DA 1KF9B 3EO1B 4DKEH 4OUUA 3RVXD 2DL9A 5EU4A 3GMPA 3OWEA 4WFGD 1KLFA 1G7LA 4LLAA 3TBTB 5FYKD 4ELKB 3MV8A 3W0WB 2GAZB 5HYQA 2M2DA 1NCWH 5HGHB 4PJEA 1RIVL 3HZYB 5DJ8B 5I1EH 1G6RL 5F89A 4JG1H 4M7JH 1HXMA 4U7MA 4ACPA 1X44A 4GRLB 3TO4C 5FKPA 4O58H 4PJXF 3RUGE 3MLWH 1IAIM 5CKGA 5E8OB 5FO9A 1UEMA 1B4RA 1CU4H 3EYVB 4WO4C 5JLZB 4TVPH 3QHZH 5DURB 2G60H 5DJZB 1YPZB 4YXHH 3IAGC 3HR6A 4AEEA 4ODTL 4OCWH 2E7LE 1DQJA 2R2HA 3MUGB 4QCIB 3BWAB 4GKZA 1E4XH 5BRZA 5BZDB 3M8OH 3KPTA 2H9GB 3EOTL 1A1OA 5C8JB 1ZSDB 5E8PB 2M8XA 4NKDB 3MYJB 3RPKA 4ZYKB 4XP5L 5SWSB 1F8TH 5GZNC 2KQMA 4X9FA 3VFUB 5CEZL 2FGZA 4X7DC 3RL2B 4JZOB 1BFVL 4KTDH 1RJYA 1JTOA 3FOMB 4FABH 3ZYOA 2JK5A 1FZJB 2CLZB 4HIHA 4KTEL 4FFYH 4FTVB 4B0MM 4Z7NF 2ZSWA 5FKAA 5F93C 4OT1L 4ZPTA 4JGUA 2LTQC 1J87A 1BD2B 1C5BH 1P9MA 2XOTA 3TBSB 3GKZA 1ZHBB 5HI4C 4N1EA 1NCTA 2YUVA 1RIHL 2PNDA 4RFEA 3V4VL 4QOKD 1QTYT 1QSEA 1K8IA 3X3GL 4JHWL 4QTHB 3VXTA 3DURB 2IH3A 1U8KA 1G7MB 4JKKA 1DVFC 3NABL 3S9DB 2LVEA 5C0AB 1FGNH 4EOWH 4YDKH 3B5TA 4PRDB 3T8XB 2GCYA 4Q9QL 3RWCB 4Y4HC 1ES0A 1I1AB 4GKNA 5EOCH 4F7EA 3TESA 4Y4FD 4HIIB 1JV5B 1MVFA 3MUY1 4YFDB 3T3MF 4PLKC 1T2QH 3U9PH 5CZVL 4GH7B 3VXNA 1IKFH 1S3KL 3U48A 1CCZA 2AGJL 4MA8L 3AGVA 1M1SA 4F7CB 4JO4L 3GIZH 2V7HA 3TIEA 1PZ5B 5D5MB 4YXKH 4ZFZB 4OM1L 1BLNB 5I17B 5JW4M 3RUGA 2WV3A 3CMOL 4JFDD 4HIXH 2FL5B 3EHBD 4G42B 5DMKB 3O8XA 1KPRB 4PREB 2VNCA 4GG8B 4I9WE 4N5ED 3T0EC 3L3HB 1GGBH 5ITBL 2EC9T 5E7FA 2AJSL 3HI5H 4KI5E 3RGVA 1I9IL 3PDOB 3OTTA 1SJEB 4GW5A 4YBLC 1H15A 5FGBC 1VPOH 1TVHA 2CRMA 1WWAX 2CRYA 3BW9A 1AJ7L 2P7TB 4NQED 1J11A 2X1PA 4O9HL 5J4MA 5E8PA 2FCBA 1J1XL 5BV7L 3PWUA 3RWDB 3SCMC 3RNQB 2A73B 3O3BB 5I74B 4U1JB 2EKSA 3CFBA 5CJBA 5E5MA 4ODVL 2VDNL 3MJ9H 3RVWD 5J89A 1N7ML 3LN9A 4J8RB 1CLOL 1FIGH 1DEEB 1H3TA 1CFNB 5DJ2A 2B2XL 3TYGL 1V8HA 1YYLH 1U92B 3RBSA 1KIQA 4OB5L 1ZA6A 3MMEA 1HSAA 5DHYB 3LOWA 4FQXB 3SQBA 4U3CA 1QHPA 3HRPA 4KK8D 1FORL 4APQA 3DSFL 3BIAX 3S6CA 4IMKC 2MOVA 1FVDB 1PKQE 1INQB 1RZ7H 4GO6B 4H8WC 1ED3A 2O5ZH 2ZUXA 1CDUA 2HH0H 2BNRE 2X4RB 5T5NG 3RU8H 3LIZH 3OB0H 4HV8B 5H2BB 4QRTB 4XPFH 4M62H 4UINL 3C5ZD 3O8XC 3ZDZF 3ESVF 4LVOC 4UIKL 1MAKA 5JHDD 2X4OB 1BQUA 1T5XB 5B8CC 1EH9A 1CFBA 1YZZA 5GS1C 3BRDA 1P4IL 1GHFL 1YMHB 1KEMH 3TJEL 4ZFFA 5FK9B 4OFIA 3KPRA 3VWJB 3DXAE 2PTTB 4PBVC 2EE3A 5JDSA 5D9SB 2CLRB 4FFEX 1FVCA 3MCKA 5HPOA 1JGLH 4A6YL 1A1MB 1TCRB 3WXWL 3DGGB 4A2LA 3SDDC 2V2XB 1I4FB 3TVMD 2CGRH 4PJCF 4BYHA 1KIRA 3FRPG 3MFGB 1EA9C 4FQXC 5I8KL 3MA9L 3I6KB 2R1WA 4IRSD 3C6LA 4JFOB 4NHCL 5KSAD 1EPFA 4ZDHB 3BSZH 1FL5A 2HJKA 4APQC 1FL6A 3QCTL 4LEXH 4JN1H 1K2DB 4GG8A 4X7TA 3MCG1 3QEQB 3HUJA 4EUPG 1P1ZA 2VLME 2VN4A 2X4PB 5ITFA 4FG6D 4FQ2L 2ZG3A 3VFWB 1L8JA 4G43A 2V9RA 4FMFA 1MRCH 2CDFA 1F2XK 4OSUL 5DWUH 4IRJB 5J0BA 4TSAH 2OTUA 4O4YL 3KYMA 2KDGA 4AM0B 1L7TH 5I73B 5CJOL 5E08H 5JW3L 3ZTNH 1ACYL 4OCSH 1LE9B 1OOAA 3MROB 4ALAL 4WW1A 5IFJB 4XPTL 3OF6A 1JPGB 1WZ1H 1J5OH 1QRND 3VH8B 2J88H 2BVOB 2HT3D 4PRBB 5MENB 1I3RA 7FABH 4JO2L 3FQUB 3DI3B 2YPLE 2JTDA 3X11B 1JGEA 4K07A 2ZCLL 1GC1H 5FA4B 5GS0C 5ICYB 4JVPA 1XZ0B 4MD0B 4WW2F 2DBLL 3CLEH 1NCCH 5JA8B 5DMJB 4EUPB 1JI2A 2IF7A 1OAZH 4K94C 2Y6SC 3GDBA 5IB1A 1RUMH 3F7VB 4LLUB 1J0HA 3RZCB 4P23B 5JHLL 5FYKU 4X98B 3PQYD 5EOCL 1GH7A 2VKWA 5T3ZD 5C7XH 3IDMA 3I02A 3V6OC 3I85A 3DO7A 4BA8A 5EBMA 5J13C 2FX9H 4ZXBB 2DD8L 2B0SL 3BPOB 2D9CA 5J1AA 4U6YB 5HY9B 4RAHA 2H6PB 1FYHB 4NZTL 2ITDB 5FM5M 1JNLH 5T1KB <