4PGDA

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaf
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pgdA01
4YR6B 5C0DB 3T2NH 4O2EA 4X99B 3GJFA 1T5WB 2YHGA 3HUJE 1NGXB 1T1XA 1VENA 1MCEA 4P2QE 4GG6E 2PXYD 1GGTA 3KR3L 4NKIH 1DQTA 2UZYB 4OAWA 2DIJA 1UB5A 1ONQA 1A14L 1I1RA 5LGHL 4XCYB 5I1HH 1NBVH 3P9LA 3C08L 1VGEL 4PBWD 1DR9A 3FFDB 2E7CA 1AP2A 3L3OB 2AXHA 1OAKH 3TJHD 1YPZA 3VWJD 3CGTA 2VDLH 3KYOA 2Y7QB 3QDGB 2AW2A 4JFXB 2VC2H 1KIQA 2B2XL 4JFPB 3TZVA 2FHBA 4HZLA 1X5KA 1CLOL 1HH9A 1S7WA 4F7TB 3FOLB 2QSCH 1UXWA 1NGWA 1MRFH 4OGXL 5JUEH 4J3UA 3ZE2F 3ZTJG 3R4DA 3VRIA 2A6JB 1A7PL 1G7QA 2Q8BH 4ZAKD 3MPCA 5JXEC 2D9CA 5F97E 3HS0A 1MSPA 3O2VL 3O0RH 1U3YA 3GI9H 2CJUL 3FAWA 5JIKA 3SDDC 5F1NB 2M26A 5FGSA 4XNUH 2BC4A 3TNNB 2I9TA 4U1LB 3BEVB 1DE4A 2NW3B 1A9EB 4NQDD 3K2MC 2R0WL 5I6XC 3S4SB 2I25N 2V7NA 4PYGA 2ILLA 2L4OA 3DXAD 5F70A 2YRPA 4HK3J 1Y18A 2CO6B 1REIA 1FCCA 3CPLA 4HXAH 3MV9D 1CL7H 1WEJL 4AENA 1MCPL 1JGUL 4KJPD 2VDPH 2R2EB 3O81A 3VMNA 3RWIA 3VGAB 2C3WA 5D7IF 4MXWH 5BVPH 2JB6A 5FYKL 3GKZA 4OKDA 5F9OH 3HRZB 3DVGB 5F89A 3QCVL 4K3GA 5C8JA 1Q9LB 3D85D 2PTUA 4MNGE 5T5NG 4MNHA 4JREB 3ALPA 2R29H 1FGNH 4Y4HD 3VFGH 5GGTH 5F9WC 2D0GA 5I2IA 3CZFA 3I6KA 4LCIL 3TA3D 3U0WH 5FUOH 2AV1A 2F53A 5AYQA 4JM4L 3TJEH 4MDIA 1P4IH 4K94H 3NN8A 2P24B 2X4TB 3FFCA 4M9PA 2ZZUT 1VGKA 5FYLH 2NY3B 1H3PH 1DTUA 1L0QA 4NSKB 5DZLA 2CXGA 4MJIE 4JFZH 1JPFA 1MNUL 4G8FA 4QGYA 2DIBA 4Z78A 5JORA 3QJFA 4JKPH 3KPRB 3LKOA 4YBQC 1EEUA 4I9WD 3T77B 4MJ2A 4QXTB 3QI9A 1F4WL 1KCVH 4J4PC 3GJEA 4X7EC 3LEXA 2HKFH 2ZSVA 1XF2B 5IEKA 1JGVH 5C0AA 4NOBA 2ATKA 3HE7B 5TDPA 3S35L 4JDVA 4JFQB 3NFSH 3RNQB 1YEKL 5I17B 3OKDA 5GRWA 5L6YH 1J7VR 5LWYL 3VG9B 3FRUA 3ARGC 4RWHA 2FX7H 5HYSA 2ZUUA 4QRRB 4P23D 1BFSA 1X44A 1TVBB 3HLAA 2ZOKB 4FOMA 4U1HB 1A0QL 3IETB 1DQJA 1I8KB 2FO4A 3QO0A 5E00B 5J3HD 2AEPH 3MRQB 3VXNA 5ACZB 2BSSB 3PJSA 3X11B 5D7JB 5DUBB 1JMXA 1AC0A 2PYEA 1QBLL 3V4UH 5C0IB 4E5XA 5JHLL 1D9KD 3OGCA 1YJDL 2Z92A 1RMFH 4P2RA 3X3FL 4PJBA 4BH8B 3SDAC 1KIRB 4FXKB 5DJDA 4RZCA 4M02A 3UAJD 1QRNA 1W72H 3F8UB 2GAZB 4KI5C 4HKXA 5EU6D 2IBGA 4L29B 3WFCL 5EO1A 3FRPG 3P11L 4OM0H 4RMRA 5ITBL 4HEPG 3MUGB 3P3YA 4HXBH 4HQQL 4MB4A 1TVHB 4NKOA 2CKNA 3RVUC 1AE6L 4Y4FD 1IAIH 4P4KB 1O0VA 4L8DA 5D1XC 1FFOB 2A83A 4OB5H 3MREA 3X14A 4NQEB 4N8CL 1KLUA 2LU4A 2K7PA 2YKLL 4Y0GA 4L8SC 2OCFD 2MTPA 4QRRE 2LVEA 3VFNB 2K9UA 1MLBA 2P43B 5C0NC 1MAML 1QQDA 5D71H 3JWOH 4D3CH 5IR1A 4QCIB 3PUCA 5KOMC 3ARWA 4PDCE 5D7SH 4GSDL 4YIQB 3I02B 2F54A 2GJZB 5I1JL 3NFNA 2GCYA 5HI3C 1BD2D 1HWHB 3MBEB 4JVPA 5FYLD 3S36X 5HPMA 3JTTB 3EFDH 1QFWL 4M48H 1PZ5A 3HB3C 2VL5A 1FIGL 1U8QB 1FNFA 2Y06L 3LKSB 1JF6A 2DTSA 3RGHA 1LEKB 4GG8A 4Y7MA 1LNUB 2NY5C 2EO9A 4YDLB 3WIFA 4PRHA 5KSBE 5C0GB 4I18A 3GO1L 2J1KA 4DGIL 5IMKB 1JNHA 3QEUA 4QY8A 5DJ6B 2H2SC 3JZ7A 3QQ9C 3CCHA 3L3DA 4PREB 1XIWA 4OCWH 5KSAA 4LEOB 3UBXI 4LCCA 1DQML 3BKCH 2A73A 4X6DB 4UAOB 5EOQL 5B4MD 5D2NA 3PP3H 3E6FA 3L3JA 3V6ZA 1MI5B 2RHEA 4LSVL 3A67H 5AD0A 2AK4B 1N2RA 2DQEH 5C0FB 1YNLH 2Z8VC 3V52L 1U95A 1X5XA 4OM1L 1DQLH 4EN3B 3VGBA 5I1AB 4MCYA 2I9LA 1X5JA 4PTTA 5F9AC 4NO2B 1HOCB 4AL8L 1GAFL 1YEDB 3Q2CA 2DDQL 1JNJA 3ECBA 3IDJA 4J12A 4PJBF 4PP1D 1UACL 1KC5L 1TETH 3NGBB 1WWAX 4HWBA 5DMIH 3LH2L 5HPOA 4AG4L 2ARJA 4LLYA 5GSRA 3OR6A 5IB2B 4N1EA 1MFBH 1JZ3A 1P1ZA 3KJ6L 3STLA 4PJXF 1S8DB 1AGEA 4MNQA 4FQLH 1DCLA 3JTSA 4RA3A 4F7CB 4WWKA 4ZUSA 2GUOA 4XXCA 4I3GA 1MCIA 5MERA 1OGAD 2R1WB 3QH3A 5DQDL 2Y6SD 5D2LF 1TJGL 3H3KA 1J0YA 4QHMA 5I73B 3O2DA 3ZE0F 3S8WA 1BZQK 4PJ5D 5FCSH 4P46A 2ZCLL 2C3VA 2XFXB 4OGZA 4CN6A 3A6CH 1D5MB 3BP7B 4K7FB 2OK0H 3BDBA 3NVQA 2XZCH 2NR6C 3RA7H 4JFDB 1LHZA 3MOAH 4GBXD 1CVSC 2P5EB 3ILQD 4PRNA 1UJ3B 4JRYD 3VI3E 5FA3A 4JDTH 4QNPE 5DD0H 3BW9A 4PJ9B 4U1IB 4XC3L 3DO7B 1QNZH 1AY1L 1NCWH 3K8KA 4UB0H 2ADGA 4PGCA 3MNWA 4GKSA 1UC6A 5ALCH 5TH2A 3ZT7A 3BQUD 2VRAA 4K07A 4ETQB 1FL6B 5C07D 4TNWF 4YUEH 1L7TH 5C3TA 1X5YA 3Q3GB 3W82A 1DUYB 2DWEA 4KZDL 3VMPA 2H26B 5BRZB 3GMPA 5I1GH 1GZPA 4Q9RH 1BBJA 2OTUB 2COQA 1KPUB 4O9HH 1D6VL 2AQ3A 2BVPB 4I3RH 2AEWA 2GTWA 3K8MA 5JXED 3U7YL 5GGRB 1QA9A 3Q0HA 3VXMA 4HIJB 1MCSA 1UB6A 1UFUA 2NNAA 4XCFL 5TDOB 4QRQB 4HS6A 2Y5TA 1LEIA 3MCKB 2DI8A 1EMTH 4D0BA 3I9GL 4XAKE 1A7OH 2J6EL 5CIPH 1PQZA 2Z8WC 3W81A 4UNVA 2NY6D 3T0ED 1QR1A 4ZOCA 4UIKL 3VFSA 4YGAB 4TQEH 1GOHA 4BJLA 1F8TL 3FQWA 3F7VA 2GT9B 4OLYH 4Y16D 1L0YA 2E6PA 3FCTA 3LMJH 1HYRC 3MRKA 4FQXB 4TVSa 5I8CB 1I8MA 5DJXA 5E6IC 3B8YA 2P5WB 4OBRA 4XVSH 3UTSE 4HIHA 4KZEH 3P4MB 5DD1L 1H3GA 2R8SL 1S7SB 4Z0XA 1NKOA 1T7WA 1T20A 4FQ2L 4JFFD 1LDPH 4LIQE 5K9QG 2ZPKH 2J8OA 3ESVF 4PR5A 2W60B 1T2QH 3HPJB 1FRGH 1AJ7H 2GQHA 2IC2A 3G6JE 4M1CC 2NZIA 4CUCA 3BXNA 1MHCB 2NY2D 1EPFA 3U6RA 5DRWB 3ARRA 3QR2A 5IFAL 2CDGA 2HVJB 2EC9U 1QBAA 5HYJD 5MEPA 3L3KA 3RWGB 1HHKA 3NACL 5DJAB 4UNTA 5JXAH 2H1PH 4U7SA 1VDGA 1OARH 4JFHE 5IBTH 1F13A 4JN2A 3MGOA 1FC2D 1MJUH 2F19H 5CSZB 3O4LB 3HNVH 5IUSA 3CMOL 5F1OB 4LLQA 5MI0B 3RGVB 4DN4H 3WKML 2CLRB 4YX2H 5DFWH 4AT6B 5CEXB 3IDUA 4DZBB 4WO4A 3IU3A 4JO4H 3HZVB 4OZ4A 1FNHA 4MAUH 5ID0A 5EOCH 2VITA 3GB7A 3HAEA 2QL1A 2RFXB 2QQNL 1SJXA 3IXAA 3WFDL 3QDMB 4LMQE 1IKFL 1U58B 3MLVL 1U93A 1BFOA 1BBDL 1MHPH 2ESVE 1MCWM 1KTDA 2ADFL 3O6FB 3AROA 4E0RA 1OAYL 2XWTA 5KSVB 1NC2B 4LVNB 1XIWC 5KSAC 4TNVK 4PB0H 5GGVY 4WI6A 1AQKL 4JY6B 5T1KD 3FL7A 1ZWIB 3S34L 1NLDH 3LB6D 2R4SL 3FB6B 1A3RH 4TN9A 2J3SA 3W11C 3W0WA 2D31A 3RVXC 5DI8A 2O5YH 5FO8A 3F58L 4GRLC 5DTFA 3VFTB 1P5VA 3GKWH 3SY0B 1AHWA 4H1LG 5TDNB 3FO2A 3MR9A 1IRAY 1BQHG 1X5AA 4EDWH 4KQ4L 1R3IH 5CEYB 4MDJA 4JPWH 2EDRA 5C0BE 1CGWA 2ZUXA 2CPCA 3ZE1E 5K59E 4XXDB 1YEHH 2QLVB 2V2WB 5DRXB 3U30C 4NKIL 3AMKA 3MV7B 5IHBA 3EZJB 4KAQH 5D1XD 2VAJA 5EC1B 4NCDA 2Z4QA 4TSBL 3CDGB 4HK3N 1SEBB 4QOKA 2X7LA 1JPSH 2JB5H 2IAND 4PIRF 4DQOH 1P6AB 4L3EA 5J6GB 1AR2A 2HFEA 5ICZB 5FB8B 2IAMB 3MRLB 1YEEL 4LSTH 2VC2L 3MZGB 4KRPB 1I3VA 1AH1A 1BVKB 4PJEA 4YHIA 4NP4H 3ES6A 5IFHH 2B4CH 4XXCC 3QWRA 4WTZA 5C2BH 4P5TC 5BV7H 4RGNB 3UPCA 2J7LA 3GHBH 2ZG2A 5HI3D 5BO1H 4G8GE 4OCRH 4KDWA 5EIIA 3C9NB 5FM4A 5CWSB 3AY4C 1T5XB 3D2UB 4LOUC 2Z35A 3LQAH 1O7SA 3OBAA 3HB3D 3O0RL 5JQHC 5E2VH 3GI9L 5E08H 2H8PA 3T1FA 3BZFA 2UV3A 4DUWA 3M8OH 5BVJA 4KGJA 3ZDZE 4P5KA 1AO7A 3GBNH 3U9UA 4CN4A 1KXVC 2FRGP 3UYRL 1LO5B 5K9OB 2ARJQ 1FPTL 3PP4L 1J1PL 1PKOA 3SGJC 4NZUH 1BF2A 4UIMB 4YHKH 3R8BB 3RKPA 2BNUA 2HRPL 1A7QL 2W91A 4J8RB 3LHPH 3B3IA 5IHUL 3VXSD 3M1BB 4MB5A 5IVXA 4YGVA 3SCMB 3TZVD 4ZMAT 4XPBH 4KDVA 3GMRB 3KYMB 3QA3B 5C9KA 3FT4B 5GZNC 5F9OL 1FAIH 2IADA 5IHZA 5GRJH 4G9FE 8CGTA 5DD5L 5EA0H 4WI8A 2R29L 4QRSA 5GGTL 5LBSL 2CGRH 3X13B 1OP5H 1WIUA 3QQ3A 1IM3A 4PJCF 2VISB 5GSVA 3U0WL 1DQDH 5FUOL 1GGBL 1OSPH 3GZKA 3BH8B 1CVRA 3D3VE 5B39A 3OHXB 4D9QE 4FHBD 1EFXA 4HFUH 1T22B 3QUXB 2GSIA 1QFOA 3WL9A 1CFVL 4KPHH 4WHYG 4PRDB 3QUZB 2EEDA 3JV5A 4KJQC 5JPNA 1IT9H 4GAYB 1IAKB 2XTJD 1OW0A 4NT6A 3BX7C 2C1PB 4NQDB 3VXTB 3BAEL 1XGQB 1MJ7H 1CG9A 4LLVA 1LD9A 3K4AA 4LGSB 1SYSB 4S0TD 5FM8A 5HHNA 2BNQE 4PP8C 2HWZL 1JGVL 2CUMA 3FO1B 5IKCA 1L7IL 1BPVA 4JO1L 5T1MA 3VJ6B 1RHHA 3PGDA 4JZOB 4U3XA 3U36A 5CZVH 4HT1L 4NDMB 1OSZB 1TMCA 4I0CC 3DX9B 4KV5E 3IJYB 1I1YB 1WZKA 4JQXC 2NR6D 2VLKD 4PJEF 1II4E 3SE8H 5HHME 1XF3B 2F53D 5IB3B 2Z91B 3BJLA 3UZQA 2ED9A 4GFTB 4I0PA 4NCC2 2CK0H 3D6GA 4ZFGL 3D39E 2MHAB 3FFCD 1JZ7A 2MOVA 3ARQA 3SDCC 4PRIB 5JW4Q 1VADA 3V5HA 5E0QA 3LRGA 4XP9H 1FFPA 1PSKH 4JRXE 3VRLE 1BZ7B 1UM5H 4IRZH 1KNOB 3VXUA 5IJVB 2XKNA 5DRZA 5JOEA 1Q72L 2FD6H 1UEMA 4P99A 4QT5A 3WXVL 3ZYZA 3QI9D 4U3CA 3ZKXC 5EH1A 5I76B 4ODVL 3FONB 1F4AA 2YPLA 3RU8L 2ZCKH 3MX0A 3MO1A 3MMEA 3C8DA 4HXBL 4JJ5A 2ORBL 1WAAE 5FGRA 5JHDA 1PY4A 5DT1H 4ONHB 5SWSE 3EW3B 3DOSA 4UDTA 1A6AB 2P4AB 3OAUL 1PZUB 3UBXG 3PHOA 4UQ3A 4JQIH 5IVXF 3GRWH 4UTAH 4PD4K 1EO5A 5E5MB 4WV1B 5INCB 3S96B 1V3KA 1G7LB 5F96L 1I3GL 3A6BL 3M17B 1NUFA 3RWDA 3S3JA 4Q9CA 3QUMA 3SKNA 3DMMB 3DX7A 1I1FB 4YC2B 2OJZH 2PYED 2EH7L 3VXQA 1I7ZB 4QHKI 4HV8A 5FCUH 1MFEH 1N64L 4K71B 4EI6B 2KL6A 4P2RD 4OZFA 2D7TL 1QRND 3JUYA 1PG7H 4I8DA 2DQCL 1MJ8H 5T3XL 5BW7A 4M48L 1SBSH 3GMMA 2BDNL 4F9LA 5D93B 5F21B 4HWBH 2M2DA 4BK5A 1D9KB 1NGQH 2X9WA 4PJ7A 3VXOB 3QIUB 3RWFB 4AM0A 3FAXA 3HN3A 3DI3B 5I15H 1JCKA 2AS5M 1ZVSB 2X4RB 2DLHA 3G5VA 1MCOL 1HHGA 4ZQKA 5ISZB 5F8RC 4OCWL 3MUJA 5C08E 1PAMA 4HHAB 3BD3A 1IEAA 2OR8A 3O2DH 3K74B 1OTSD 3HNSH 3A67L 1ACZA 1S7RA 3AU1B 1JGEB 4LCWB 2HJFB 3SKMA 3E2HA 3CK0H 4PBVC 1WITA 1NKRA 3DIFB 2OI9C 4P9HH 1QLRB 3QXAB 4G42B 2F54D 4HSQA 4BSVA 1G0DA 4NWTH 5J1AA 1FFNB 2IWGA 4BFBD 2YC1B 4CDGC 1X5IA 1DQLL 1O7VA 4X6CE 5J6HB 1BLNA 1EIBA 3O41B 5C0CB 4GW4B 35C8H 4ZPTA 5E4EB 1WTGT 4MVBA 5A43C 3KYNA 5IQ7L 5IF0A 3RBSA 3VXPB 5HSFA 1R3JA 5T3ZE 3IDGA 4PRHD 5DGRA 1TETL 1HYSC 3HG1E 5KVDL 4XMPH 3AS1A 4WW2C 3PE9A 4QEGA 4X98B 2BJML 4D9RE 1JHKH 4U31A 1XIWD 5KSAD 5FDWA 1MFBL 4NKDB 2EDKA 1U92A 1AGFB 1R24B 5DD3L 5IM7A 4XNZB 1NCBL 2ICWB 5CILL 5JMRA 4C57C 2OSLB 4KH2A 4WENB 5LAXB 3I6GB 3LS5H 4YZFF 4B0MM 2E9JA 3BUTA 2FDBP 5CP7A 4YE4L 2X10A 4AEEA 5IGXH 4HBCH 4ESKA 3LS4L 1GGCH 1S78C 1FYTA 1HZHH 4MCZB 2BHYA 3EYUH 4P9MH 5E56A 1GOFA 3U0PA 2V2TB 4AEIH 4XP6L 1LO0H 2JCCA 1IC4H 3MV8B 4V1DE 5FKAB 2OK0L 3VGEA 3HNTH 4M43L 3VFMB 3G6DH 5L2KB 1QPPA 4X6EA 3B2VL 4PRAA 3EYFA 1HILA 3GBML 4JO2H 3ARTA 3FN0H 3GFUA 4NQUA 2VMFA 3VDBA 5JZ7C 1PVHA 3PXJA 3ARZA 4NN7B 1KULA 4OGYH 3RIAK 3EYVB 4TOYL 5ETUB 1QHOA 4XNYL 3HI5L 4BZYA 4WUUE 5DJZB 1ZHNA 1OW0C 5IMMA 4PJ7F 4R97B 4NJ9L 3VH8A 2W0FB 5J89A 2A74B 2YD8A 2D7NA 4JFOB 3CU7A 5I1GL 4MNQD 5TGBA 4WWKD 3CFEA 5A2JH 5D96C 1A2YB 5K33A 3SBWC 3BMVA 3QHTC 1BOGA 4PJDE 4YBLB 3UTTB 1FLRH 2FATH 2K3TA 2R0LL 2XA3A 3RNKA 1CFSB 2APBA 2OL3A 4P46D 5KVGL 2Q87A 4KMQA 2OTPA 3O4OC 2ZUQB 4PP2A 3O45A 4R8WL 3OJMB 1A7OL 5GS2D 1UM4H 5B8CB 4UINH 3RX5A 1QR4A 3DO3A 5F3HA 4OLEA 4PJ5B 5L2KE 4LKXA 4I4WA 5CFHA 4LVHC 1BQSA 2D03H 3PWVA 5C0JB 5CUSH 3TBSA 2BOCB 2CSPA 4ODSH 2O5XH 3HA0A 1RIVH 4MD4A 3DV4B 3P2TA 5I75B 1TJHH 4GBXB 2RCSH 4L1HA 3ROOA 4Z7OE 4Z8FL 2YD7A 2OJEB 4ZFFB 4YPGB 1B6DA 5EU5B 1NBQA 3KNBB 1VFAA 2CH8A 1QLFA 3HAEH 2OXHA 2KKQA 4I2XB 2BVQA 4XVSL 3WUWG 2NPLX 5BQ7A 3U1SH 1IAOA 2HTKC 4IRSB 2AJZB 3RDTA 1LDPL 3QEGL 2EDLA 2FL5B 4GXVL 1B9ZA 1T2QL 1FRGL 3VXMD 3TLRA 3BPOB 4RQQA 5E8NA 4YHZL 3WO4B 3RKDD 5HY9B 2ADIB 3IFLH 4X7TB 4CN1A 3C5ZA 3TBWA 5J57B 3N50A 3QDHA 5I1IL 4Z77A 3IFNH 1QHPA 4ZFZA 3K1DA 1C1EH 3QQNA 4KJQD 1PBYA 3K2UL 4WI9A 3DV6A 3UYOD 3D9AH 1T4KA 4Y5YB 3O6MH 2P1YA 4JR9H 5IMLB 5FGCE 5DHYB 5IBTL 4L4VE 2DL2A 1CDBA 3QNYB 4H88H 3SDXE 4UQ2B 5HYQA 5IV2B 3JV4B 2FJGB 2PO6C 2PTVA 4Y16B 1FL3A 1X6NA 2W65B 1R5IA 4KJWC 4XC1H 5C09E 1I85C 4R9HA 3ROLA 2B0SH 1FFRA 3WHE1 4JO4L 4MAUL 4DOHB 1PX3A 3KJ4B 2WQ8A 3QFJB 4ODTH 2V2XB 5TQ0H 3ARSA 2UWEA 2GTZB 2BCKA 4ELMB 2X4OA 1AGBB 3KPSA 4Y19B 5C0EB 3N1QC 1PKQE 3WSQH 3AGVA 4AK1A 4Z7VE 2IPKA 1DBKH 3I85A 1RK0B 5LG1A 1U9KA 3PWLA 4MA3B 4YO0B 1X7QA 3FTGA 1XGPB 2ZG1A 4TULL 1Q9WA 5DA4A 4X9GA 4HC1A 4EKXA 2DTMH 2EIEA 4PS4H 2O5YL 5FF6B 4RNRA 3LDBB 4LFHD 3E2HC 4X9FA 4ODUA 1NGZA 4N1CA 1EEYA 4YHPB 4QXGL 5GIRB 4C4KO 4YQXL 2BHUA 5JW5A 4JEGB 4DGVL 4TTDD 2WLYA 1YEHL 1QSZA 3CH8A 1PW3A 4MVBC 5DZOA 1UZ8B 4WO4D 1OF2B 2WBJA 2GJJA 4WHTA 3OG6B 1S3KL 5GS1A 2UY6A 1QBML 1WISA 4LSRH 1S7UB 1YNTB 4GH7B 4OT1L 3NCFB 5T1LB 1E4XH 2JJTC 3OPZH 1AIFB 3BD4A 4DQOL 5HDQL 2YEZA 1KTRL 2VDOH 2EYTA 4HF5L 1K5NA 2YUWA 4F7EB 3TF7C 1WLHA 1F45A 2R69H 1NMAL 2GITA 5HGDB 1UVQA 3MLRL 1U91B 4Z76A 2X1QA 1A6TA 5F7HA 2V7HA 4NP4L 5IFHL 3MFFA 2IH3B 2OZ4A 3W0WD 4LNRA 5I1LB 1JNNL 3GHBL 1I3RB 2CUHA 1OAZL 3QDAA 3V6OE 3OR7A 1OLLA 1JL8A 3EYOB 2CRMA 4RCAA 1ODAA 4U6HA 2XI9A 1UWEH 3LQAL 1HH6B 5CIPB 5I19L 5E08L 5E2VL 2LTQC 2X44D 4DKEL 3V5KA 1JHTA 1CFNA 3TBYB 3RI5K 1LQSR 3MNZA 3ALXA 4JVWA 3GBNL 1KJ3H 4RBPH 1XR9B 1KN4H 4XPTH 3JVGC 3EDFA 4GRMA 3UTPD 1KV3A 2YS4A 5EO9A 3IKCB 2FYYB 3BUYB 2ITCA 4PRBA 1NCDL 3ZKNC 1I1AC 3KXFA 4YHKL 4QOKD 3FQNA 5F6IB 4WDIA 4L3ED 4YHYC 4N0UE 3H9SA 1N5AA 3E6HA 5DK0A 2YPKA 3LN9A 2UWEF 4PBXA 4DKFH 4IIQC 1NFKA 3AREB 3IJHA 1ZHKA 3PNWA 3QWRD 4JFEB 4PUBH 4QWWC 5KAQF 1HEZB 4NGHH 1MOEA 3CH1B 4OCYH 3W39A 5CCKH 3VI4F 4HJGB 3C8KA 2B39A 1WCBB 2XKUA 3C5SA 3DHJA 2A9MH 1CFBA 4EZMA 3S37X 1NDMB 3MJ9A 4JO3L 3CSYB 4ODHH 3REWB 4ZXBC 1TZIA 1P9MA 1MHHA 4P49A 5EUOF 4HFUL 1JP5A 2Y4SA 4FQIL 4M93C 3P4OA 1AO7D 4HGMA 1QVOA 1RV6X 4KPHL 1IAII 1RIUH 5CSGA 4KFZC 3V0WH 1IT9L 4HAGA 5JLZB 4YDKH 4OAWB 4ZTOH 4EI5C 2X9YA 4NUJB 1QSEB 3IVKB 4D0CB 3MRGB 2ZUTA 4RGOL 4ZS6C 1MJ7L 5IK3B 5FUZH 1MFAH 3P9LB 1OP3K 3L3HB 1MPAH 3MC0A 3MRFA 4WU5B 3BFOA 3P0VH 3F7YB 1ZSDA 1NEZG 3O2WL 1YPZB 4A6YA 32C2A 4BZ1H 5D7LA 1WUNT 3B9EA 5DQJA 2NXYC 5CZVL 3RDTC 4HZLB 1T89A 3NA9H 4P59H 2HG5A 1GPOH 4JY4A 3O8XB 1NGWB 2Q86B 1UA6L 3LKNA 5F93C 4MD5A 3EJZC 1A9BA 3QUMH 4GAFB 4U3HA 5D7KE 5CKAA 3S5LA 1JE6A 1EJOH 5B38A 1NCAH 1EFXD 4FP8H 3GIZH 5CJOL 4ZUVB 2ICWJ 5JZ7D 5KTEH 2NXZC 3HS0B 2C26A 5DEGB 3UTZA 2FR4A 4K3EH 4OZFH 1T7XA 4D9LL 3D0VA 1XZ0B 1CICA 1N59A 4XP9L 2WP3T 1U8MB 2P8MA 4N8VG 5DR5H 4RAUB 2BRRH 5EBMA 2EH8H 4XNQA 4JQVA 3DVNB 1F11A 4JZJB 4X6FB 2VABA 1CGXA 1ZHBB 4O00A 5KS9B 4IMLA 1DUZA 2B1AH 4S1SL 1CD0A 1BIIB 5MENA 4Z7WF 3MA9H 4L4TE 1FO0L 5HDBF 4XZUA 5E9DE 1UG9A 3GRWL 2JB6B 4P4RB 1DDHA 4UT6H 4UT9L 1UKQA 3WE6A 1P4BL 1ITBB 1MRDH 2EDXA 2YXMA 1MH5B 5D1QA 3NCYP 4MNHB 1QSFE 2KDGA 3MRCB 2RAMA 1T1ZB 1TCRA 4G59A 5CBEA 4GW5A 1LP9B 3GMNB 4K9EL 4NC0B 3I6KB 2H3NB 3INUL 3EDDA 3FMGL 5GRVL 2YOCA 4LAJH 2CR3A 4H20H 3CU1A 5EBWB 1EAPB 5ILTL 2J5LC 5FGBC 3VXUD 1KBGL 3NN8B 2EDWA 3FFCB 5FYJE 5TPWH 3GMQB 4XPAH 1VGKB 2DWDB 3NFPA 1PG7L 4M4PA 4PJAE 1MJ8L 1A3LH 1T2XA 5H2BA 2EYSA 4HWBL 2YPLD 4G8FB 4QRPA 2HLAB 3Q6FA 5E2WH 2WM0A 2DQFA 3RIFK 3UZEA 1H8OA 5JHDD 5EN2B 1TCMA 3HC3H 5HI4D 5ANMB 3QI9B 4GG6A 1IGIH 3BI9X 4YWGH 4MXQC 5IEKB 4YFLI 3MLWH 4GOSA 5C0AB 3V6BR 4JDVB 4NQXA 5GGUA 3V0VA 5L7XH 3H9HA 2MQCA 2NQCA 2EE6A 3HZKA 1KEGL 4JAMA 1D5BA 1TQBC 3NCJH 3OKDB 3HMWL 4OCMC 5HD8C 5C9JB 1T0MB 1RJZA 3V7AG 4ZFOA 4JVUA 4NQCA 3CK0L 2F74B 2NY1B 5CEZH 1KB5A 2FO4B 3QO0B 1WK0A 1YNKL 4Q6IA 1FVEA 4NWTL 4M7KL 3PJSB 1JK8A 1XR8A 4K3DH 2PO6D 3C6LA 1XF5B 1HI6A 2PTTA 4XB7A 2GFBB 35C8L 3CVHA 2WINB 1A1OB 3R06A 3EJJX 1INDL 5DEZA 2NW2A 4PJBB 5D8JH 4RZCB 3ZT6A 5JPMA 2AKRA 4F7PA 4HLZG 4GXUN 1FZMB 1ND0A 4G6AC 3GSRB 4YR6A 5C0DA 4X99A 2IF7A 4PJIE 3BRGC 1NGXA 5DK2A 1GGUA 1E6JL 1OL0A 4NKOB 3VG0H 3NIDE 1DEDA 1T7VA 1VEPA 3TO4B 2V5YA 2QJDA 1LO2H 5GJSH 4TVPH 5DRNA 4XCYA 3DTXB 1EERB 3FFDA 4LAQL 1HHIB 3HKFA 4Z7NF 5HHPA 2OL3H 1VSCA 3L3OA 1XGTA 1MLBB 2VXSH 3B2UC 2QQKL 3QDGA 2CK2A 4JDZA 4JFPA 4MA8H 3UXFA 4FTVB 4G3YH 3EYUL 2E5EA 5IR1B 2BSTA 4AEIL 4F7TA 3FOLA 1LO0L 3PL6B 1BZ9B 2YK1H 5I8OH 2YUZA 3HNTL 4GO6B 5IB4B 3G6DL 4MVBD 5SWZE 3DX8B 1JV5B 1TQCC 1UGNA 2A6JA 4FXGB 4K3JL 1N6QL 1M4KA 5HPMB 3FN0L 2B7DT 4V2BA 5C6TH 3MLSL 1IILE 5HI5C 4W81A 3C09B 1ZMYA 4OZGB 3TNNA 2C9AA 3RFZC 1CZ8H 3BEVA 3WIFB 2NW3A 1A9EA 3W5MA 4I18B 3S4SA 4LPUA 2UYLB 3JV0A 4A2LA 2R56L 1MVUA 4GG6F 3QEUB 4QY8B 3ZSSA 4BH7A 4NO0B 3SE9L 3CCHB 1U8NA 3KS0J 2MKLC 1FO0B 4K23L 5HGHB 3FZUD 1VPOH 2FATL 5D2NB 1OCWH 3L3JB 1KFAL 2R2EA 5A16B 3V6ZB 1FYTD 3OKLB 4GQPH 5GGQL 3LEYL 4RAVA 5AD0B 5DJ0B 5CEZD 3HRZA 5ICYA 3DVGA 1NSNH 1TVDA 4OZIF 1Q9LA 5J06A 4UINL 2I26N 1KF9B 3SO5A 3NIGF 1CDUA 4EBQH 1NMBL 2I9LB 2O5XL 5JQ6H 2E7LE 3DX6B 2BMKB 1RZIA 5JW4R 1BF8A 2P24A 2X4TA 4MA1C 3QO1B 3SJVE 1RULH 4ZO7A 4FS0A 1H0DB 4NSKA 4F7MB 5GGRY 2A6IB 3U1SL 3KPRA 2WIMA 4PJHB 1YEJH 3QG6B 4HMDA 4TVPD 3T77A 4I5BA 4QXTA 1KEMH 2A0LD 5DJCB 1G9NC 1FE8L 1F4HA 2GUOB 2YD4A 3DRTB 4HS8L 1B0GA 1QSVA 1XF2A 3QH3B 3VGHA 3HE7A 4JFQA 1CGSL 3IFLL 4KWUA 2CQVA 3V2AR 2J88H 5I17A 2I07A 4O5LH 4P46B 5GISH 2HAZA 2Q6WB 5C92A 4QRRA 1TLKA 3AM8A 1NANH 3BT2L 3JWDC 4MLSA 2ZOKA 3IKKA 4XP4L 1V3LA 4YDJA 4U1HA 4Z95L 3O6ML 1I8KA 5E00A 4ELKA 4ZS6D 4PFEA 4RGMC 1OQOA 3BW9B 3X11A 3RY6A 4ODWB 4EEEA 4OD2B 1FG2B 5KW9H 2ADGB 3DUHA 4PGCB 5TH2B 3OAZK 4XC1L 4GJTB 2YD1A 2J2ZA 2GAZA 4ODTL 3RDTD 2DWEB 5D9SB 4L29A 2DLTA 5TQ0L 1P84J 3GMPB 2N1KA 3IDYC 3QPXL 5FM5O 5TE6L 1GH7A 3VXRB 2FH6A 4F9PA 3MUGA 4RSVA 5IWLC 5I16B 1TVHA 3ALWA 4OCLC 2GTWB 1NL0L 1C7TA 3C5ZD 2NXZD 4P4KA 2CIKA 3AB0C 1Y0LA 1FFOA 2BNRE 2VLRB 1NMCB 3ULVC 3E3QE 4NQEA 4DN3L 4NZTH 4HS6B 5EOCJ 1W2KT 3BJ91 5ALBL 3EGSB 3NZHH 4PS4L 4QHLB 1PQZB 2AJ3B 1Y6NR 3VFNA 5CBAB 4CW1B 3BKJL 4LASL 1TXKA 5IVOA 3RHWK 4OFDA 3LVEA 3IXTA 4QCIA 2CRYA 3FQWB 4H8WL 5FOBB 3VD4A 1RUAL 3F7VB 2GW5A 1A64A 3BP6B 3FQTB 2CRZA 4YIQA 3I02A 2Z0BA 2GJZA 3MRKB 1I8MB 1YC7A 3OXRB 1X5FA 3MBEA 5HHOE 4DUXA 1F42A 1OT2A 2DQJL 3KYAA 1IC5L 4HIHB 5IW1B 1U8QA 3KPSD 3LKSA 3OX8B 3F12B 1HCVA 1RUPH 1T20B 4U05A 1LEKA 5BS0B 2VZ3A 3REVB 2FB4H 4PR5B 3BWUC 3QDJB 2HH0H 3QZWB 1MF2H 3TN0C 3QWQB 3CDCA 2DD8L 4KY1H 3MJ9H 2F8OA 2BK8A 1KIUA 4X6DA 4ZPVB 1G7MB 1I8LA 2ED8A 4WI2A 3ISWA 2XZQH 1MI5A 4NUGL 1HHKB 1UWEL 3TV3H 2XN9E 4HIIB 2AK4A 2R1XB 1J1OL 3ULUE 3B9KC 5HBBA 4Q9BA 1TIUA 1JHLH 1MCNA 1KJ3L 2WBJD 4LL9A 1K9TA 4ETYA 1EZVX 4EN3A 4WNQA 5I1AA 3P4NA 4KHXH 4HFWB 4APQA 3V7AE 2FEEI 1DBMH 3I3EA 3S9DB 4NO2A 1M6OA 1HOCA 2AGJH 4JG0L 1AI1L 5CHNB 1KACB 3KLHD 1YEDA 1D5ZA 5KZCD 3IU3B 1S7TB 2WY3A 3OZ9H 4W4OC 5EO0B 2FGWL 5ID0B 1XGYH 4XCNA 2DOCA 5L8LB 3G5YB 4PJGE 3UJJH 1I9JL 3MRPA 5GRUH 1U93B 4PLKC 3OG4B 5AUMB 1I7UA 2DKMA 2CLZB 1HDMB 1UH4A 4P2OB 5IB2A 3OTTA 2HFTA 4NGHL 4QRTA 3O11B 4WFFD 4UV7L 3SPVB 4F7CA 2A9ML 5HGGS 4G5ZH 3X3GL 2R1WA 4KMTH 2D31B 3L3IB 1WWCA 5I8KL 3T0BA 1AHWB 4I77L 4IRJA 4M9OA 3P0YH 4JG1L 4KUZL 4OSUH 2XFXA 2WW8A 3G5XA 4JREC 5IG7B 1D5MA 3BP7A 4K7FA 2NCMA 3V0WL 4JFDA 1RIHH 5C1MB 2JKXA 4YDKL 1H15A 2P5EA 4ZTOL 2VQTA 1UJ3A 3AS2A 4KROD 2X70B 2C1OA 5FUZL 3EO0A 4PJ9A 3H9SD 3CX2A 3QWOB 2GSGB 2K7QA 3DXAE 3G9AB 4XMKH 1G9MH 1U8LA 1YDPA 2NY3C 3UJIL 1FL6A 3PGCB 4L1DA 3MV9E 4R4FH 2DQUH 1I9IH 5KVMC 3Q3GA 5C7XH 2ZUYA 1DUYA 3KPNB 4KGLA 2N4IA 4X7CC 2H26A 5BRZA 4KJYB 5DD6B 3NA9L 4YHIB 4OZHB 2OTUA 3QUML 4M6OL 1KPUA 2B20A 2BVPA 2FH8A 4J6RL 4WGWB 4X6DF 4FP8L 4HIJA 5IBUG 5TDOA 2VZVA 3QCUL 5HI5D 1E4WH 4RMTA 3VG9C 5E8DH 3MCKA 1AFVH 5ERWB 1F90H 2DI7A 2WWMD 1BFTA 5DR5L 4F3FB 2KZWA 4QTIL 3BVNB 4X80L 1AO7B 1QO3B 3N9GL 1BGXH 1CLZH 4RISH 3VCLA 4V3DB 1TZGH 2H32H 1WWBX 3HI6H 3SKJL 4LQFH 4KK6C 3SE3A 4AEFA 1OB1B 3J7HA 1K8IB 2GT9A 2B1AL 5D7JC 3BYTA 3UDWC 1UKTA 5I8CA 4I9WE 8FABB 4NN6B 2VLMD 4JB9H 3RX7A 5D7LD 1YY9C 5M7QA 2NX5B 3MA9L 2P5WA 2GJ6B 3MLXH 3P4MA 4OCSH 2YMXL 4UT6L 2VDML 1ZLWH 1H3TA 2VL4A 5IHZB 1SQ2N 2OP4H 2ESVA 4K8RC 3MTRA 1KB5H 4YAQA 4S10A 4QRSB 4P4KC 3HPJA 5J11B 1QFPA 4MHHI 2Q20A 4J23A 1MHCA 1IM3B 2O26U 2I5YL 1CICD 5DRWA 4H20L 1P53A 1FJ1B 2XWJA 4RMVA 3CVHH 1A5FL 1GCFA 1IM9B 1WIOA 5IROC 5TPWL 3BGMB 4HPYH 1ETZB 1CR9L 2W9EH 4K7PX 4XTRD 1AD9A 5DJAA 1HQ4B 3DUUB 1EX0A 4L9LA 2E8ZA 6CGTA 4G9DB 1CXKA 5CD3B 3GJFK 5MEND 5C0BA 3P30H 5EU6E 4ERSH 3C5JA 5TFSL 2VDQH 3RZWA 3FOMB 3O4LA 1IGIL 3PWUB 3RGVA 2CLRA 3PXHA 5CEXA 4DZBA 5IKCB 1JNLH 2UVEA 5L7XL 2BVUA 5T1MB 1RZ7L 1RHHB 2RFXA 1TMCB 3QDMA 4HJJL 5AZEH 1LVEA 1U58A 4YDLC 5F7MC 3O6FA 4HKJA 4LLDA 5KSVA 5AWNH 1NC2A 2DQDL 1UCBH 1KTLA 4R4BB 4I0PB 4JY6A 3BO8B 4Z7QE 1ZWIA 4K3DL 5FK9B 1KIPB 3FB6A 3SGDH 4YHML 1I75A 3MJ8B 3S97C 1ZT4B 3VFTA 3SY0A 2KQNA 2XKNB 4QRPD 1YEFL 5TDNA 1BD2E 4HX1B 5AZ2H 2B8OT 3VRJA 1IGJB 4QT5B 2YSSB 1D5IL 5D70L 1VEMA 3U7WL 2AJVL 2DLGA 4EN3C 1YMMD 3WFBH 2YPLB 3OKEB 1P6FA 1QPXA 4KK9C 4O2CA 2HT4C 5DRXA 4JJ5B 3JUZA 1NAKH 3MV7A 5E95B 1CI5A 1T83A 5HJ3A 3B5GA 5EBLA 3LRSA 2R9HC 5EC1A 1J9CT 3DYPA 1UQSA 5EORL 3PHOB 5H37H 4N68A 3CDGA 3HHRB 3SOBL 4FABH 1CBVL 4Y2DA 5J6GA 4NQCD 4JCMA 5I74B 4GRWB 5FV1L 1FSKB 2IAMA 3MRLA 1UZ6E 3N1GC 3QUMB 1B90A 3C6LD 2XKSA 1CLCA 4N9GB 2QADB 5I8OL 2C4XA 5LVEA 3PDDA 5HYEA 2IFFH 1WT5C 3D87B 4DAGL 5A3ID 3GNMH 5F44A 2UUDH 1R3KA 4NWUH 2V9RA 5CWSA 1FNSL 4HWEH 1T5XA 3D2UA 1YECH 2J6EA 5ID1B 3X12B 3JWNC 4ZNCD 4I3SL 5CP3A 4LSPH 4G6KH 3EJYC 5GGSB 3WKNA 1VKXB 4KKBC 1CZ8L 1RZ8A 1LO5A 1UJ3C 2R1YB 1EA9C 4PJ9C 1E4KA 3T0WA 1YJDC 2DJUA 4KQ3H 5D1ZC 2WUBL 4MJ5B 5J13C 1JPST 4PPTA 2FBJL 3SGEI 1LDSA 3O3BB 4DEPC 3BP4B 1DBBL 4BK4A 2EKJA 3M1BA 4YXHL 3SQBA 5EZOH 4LLUA 3QDGD 5L88L 1ZT1B 3SGKA 3VFWB 3SCMA 1OGAE 1LK3H 2E7BA 3KYMA 4ZUUA 5F72S 3FT4A 2DQHL 1L4IA 4MS8A 4R2GC 5GHWH 1UWXH 3SDDB 3QULA 5ESAB 3NBNA 1BLNB 4NRYB 1DZBA 4EBQL 5HHMA 3X13A 2DMBA 5JQ6L 4M6AA 4ALAH 2BY0A 2VISA 5ESQB 3QNZB 5DURB 5I6XB 1J87A 3BH8A 1DEEB 3OHXA 3D39A 4FFWD 4FZEH 2NY5L 4EUPH 1T22A 4JRYE 3QUXA 1MCHA 1E6OL 4JRXA 1RULL 4PRDA 1WBYB 1ZGLP 3QUZA 3ZDZF 2E7LC 1ZGLM 1IAKA 3KR3H 4U6VH 5C07E 3SE3C 4HIEB 4NHCL 1CLYL 2PR4L 2P7TB 2C1PA 1YEJL 4PGJA 3VXTA 1XGQA 4FQXC 5LGHH 2IFGA 3I6LD 1VGEH 1SYSA 2ZOLA 3OXSB 1VACA 1WGOA 5SWSA 1U8OA 3AFLA 2X4QB 5CP7B 2XZAL 3FO1A 5F9WB 4NC1C 1H8NA 1HSBB 5DO2C 4D94A 2B2XH 2G2RA 3C6SB 4NDMA 4H25B 1CLOH 3DX9A 3IJYA 1KXQE 1U6AH 1I1YA 2JCCB 3EDKA 1A7RL 1HXYB 2VXUL 2D2OA 1KCRL 4HMCA 3OB8A 4PRAB 2G60H 3EYFB 2EDDA 5IB3A 2Y36H 1A7PH 2Z91A 1BAFH 3T0EE 1E4XI 1MQKL 4XB8A 4M5YL 1KXTB 3WN5C 1KT2A 2YPVH 1CDYA 2CJUH 4C4KT 4PRIA 3VFPB 3HR5A 5KW9L 3WFEL 2F5AL 4QLRA 3R1GL 2QTEA 1BZ7A 1UWGL 1BJMA 5HYSG 4TUOB 5D5ME 2EE2A 3E8UL 1KNOA 5IJVA 1ZHNB 3KPRD 4Y1AB 4YBHA 2R0WH 1TPXB 2VH5L 5DK3A 3MRHB 3WIHL 4NN5B 4C58B 4EDXB 3CFEB 4XHQA 1NFIB 3HE7D 3RGVC 5MI0C 4LGRB 4JFFE 1WEJH 4R26H 1MCPH 1JGUH 1A6AA 3RNKB 2PKDA 2OL3B 2A2QT 4PLJC 2H41A 4NZTL 2QV2A 4PP2B 1UH2A 3O45B 2WIIB 4QRRD 4XBEH 3NZHL 5E5MA 3QCVH 4WV1A 3S96A 1G7LA 3O6FC 2A1WL 3M17A 5EPMB 5HYJE 2Y72A 3ZSTA 1X4ZA 2DM7A 4I4WB 4LKXB 5IIEB 4KK6D 1AC6A 5I30H 4LCIH 2AABL 5D7JD 3MXVL 1I1FA 1FNGA 3ROOB 3MJ7B 1CF8H 1S9KC 4EI6A 2ENYA 5DJYB 2IALA 1CT8B 1H5BA 3AS3A 3VRLF 5F9JB 4JN1L 4M1GL 4U1NB 3ZTJH 2JJSC 2R4RL 3QEQB 3FHQA 5BQ7B 1IAOB 3QIUA 3SQOH 3QXUA 3RWFA 3HC0A 3NIFF 4L8SB 2FB4L 1F4WH 1UJTA 3EYQC 4P4KD 2VB5A 5EFIB 1N6VA 1J8HB 4H1LA 4C83B 3QRFM 4NQED 1ZVSA 4RQQB 2X4RA 5E8NB 5SX4I 1MF2L 2RBLA 2GK0B 3ZE2E 5ISZA 1ZANH 1ZAGA 3C5ZB 2GYSA 1NFDB 5TJWK 3TT1H 4CVZB 3PDOA 2R15A 3L6FB 3HRPA 3TV3L 3AU1A 3F7QA 4KRPC 1CD9B 1JGEA 5DF0A 4LCWA 2HJFA 4ZOEA 4WY7H 5I1KL 2VN7A 1T4KB 3DIFA 1X5HA 2EDEA 1F58L 1QLRA 5GGTA 4OI9A 4G42A 4WEUD 3GK8L 3KVQA 1FFNA 4MA7H 4V1DA 2YC1A 3ARBC 3MBED 5J6HA 4XPFL 5TQ2H 5ADPL 2R2BB 1ZVYA 4GW4A 1FL3B 5DVNA 2CDFB 5F6HI 1A7NH 5JHLH 1KYOJ 5F7YC 3OZ9L 3ULUC 3TP4A 5F7FA 4ENEC 3H7LA 1K85A 5FYKU 3WFCH 5GRUL 5D7IE 2BCKB 2X4OB 4HGWB 2VWEC 3P11H 2C3HA 4X98A 5ITBH 5LKNA 4P48A 2H9GB 1FLTX 2IANE 2PXYC 1E4KC 1AE6H 3N1PC 2IPKB 1PX4A 4LIQH 2YD2A 1AGFA 2E27L 5E5RB 2ICWA 1IGFL 4N8CH 1MI5D 2YKLH 1Q9WB 4XI5C 1G0XA 1ZT7B 5FYKD 2OSLA 3AS0A 5LAXA 4G5ZL 3I6GA 4XBPB 1EEZA 1WZMA 2AK4D 2HJKA 3LPFA 2XTLA 3IGAB 4O58H 3TJHC 3TBVA 4Z9KB 2X09A 4Y88A 4JHWL 1IKNC 3HC4H 1MAMH 4OSUL 1EEYB 4MCZA 4EN3D 2V2TA 2G75B 2LE9A 1F97A 3ARDB 1UXSB 4KK9D 5FKAA 1RAMA 5L2KA 4GSDH 2MKWA 3E1F1 4F15B 1RIHL 5I1JH 2WBJB 5GS1B 3G6AB 5J1SC 3QUXC 4IOSD 3UPAA 1FIGH 2R23A 2Y06H 2E3VA 2ZWLT 4K7PL 4QHUB 1G84A 3EYVA 5ETUA 4X5XB 2VLJB 1P7KA 5JA8B 2P45B 3L9RB 4HS3A 3BMWA 5DJZA 3QIWB 4OLUH 5EU7C 3VXSE 2EO1A 4U2YA 3GO1H 2AI0L 2W0FA 3RX8A 4DGIH 3F5WB 1UVQB 4JFOA 2DM4A 1R3HA 1KSRA 2QSVA 2V7HB 1A2YA 1KENL 3NTCH 3KHQA 4QXWA 2EZ0C 2QKIB 4MHHG 4ZO6A 3BYYA 1JZ4A 1K3IA 5EOQH 3UTTA 2XYCA 3OR7B 4RWYH 1CFSA 3VFOB 1IAMA 4DGYL 4KJPC 4LSVH 4BELD 1U8IA 4WTXA 3C8HA 4XVUC 5E8DL 5IB1B 2EKSB 2F9BT 3EJYD 3V52H 4JM2B 4JFDD 1N0LA 2P5ED 4OM1H 2VXTH 1CLZL 4RISL 4GRMB 3L5IA 2BOCA 5EO9B 2P47B 2ITCB 3HI6L 1GOGA 4PJ9D 4LQFL 1BX2B 4X4MA 3QXWA 2ZSWB 3CX5K 3KXFB 1JWSB 1GAFH 2XTJE 3TA3C 1WBZA 5DJ8B 3FB8A 3LZFL 3SDXA 5JDJA 2OJEA 3QPQD 4ZFFA 4KROB 2BRQA 2P44B 1I7RA 1UACH 2BVEA 3H9SB 3KNBA 4FZ8L 5F1IB 4EXPX 3NCBB 3LH2H 1EHLH 4AG4H 5BRZD 2NY0D 3DURB 2DLFH 3MLXL 4X6BB 3DWTA 1IE5A 3GSQB 3IJHB 1ZHKB 4RFNB 2OR9L 1UENA 1JGDA 4IRSA 2OP4L 3KJ6H 3U79A 4HWUA 1PKQA 3GDBA 4LHUB 1F6FB 1VB9A 3ZHLA 3FT2B 3GI8H 4Z18A 2VLKE 4Z7VA 4NQSB 2ADIA 3B5TA 2F53E 4V2CB 4X7TA 2VXQL 3IRPX 3DI2B 2ZCLH 3QHFL 3ZYJA 1QVOB 1RJYB 2APFA 1QFUL 4HPYL 4DW2L 5E6IB 4MMZC 5AYUH 2CO7B 4P23C 3DMMC 4Y5YA 4YC2C 4HG4K 5DHYA 5J3HC 2XXMB 1NLBL 1OAXH 2JTDA 4K71C 4XC3H 3D25B 4UQ2A 1AY1H 2P5WD 3JV4A 2FJGA 3MRFB 4S2SB 2W65A 4YH6A 2FZ3B 2QHRH 3IDMB 1F2XK 1JNLL 2X4UB 32C2B 1F6AB 3CSPA 1D9KC 4LFHG 4PRPB 5D7LB 4TRPH 3LKQB 3QFJA 5IFJB 5DQJB 2ESVD 5AZEL 2GTZA 2HG5B 4JY4B 5FOJA 4C56E 4V3EB 4BM7A 3ETBF 4Y19A 1JN6A 2B1HL 4GLRH 4OV5B 5L8KB 4YEEA 3DROB 5AWNL 2JE8A 1UCBL 3U7YH 3CUPA 4Y4FC 2IPUG 1IMHC 5D6DA 1RK0A 2CRIA 2OLDA 3UTZB 3HAEG 4XCFH 1XGPA 3TIEB 1CICB 2PYEE 2P8MB 3WHXA 2J6EH 3V6OA 5FF6A 4E41B 4PJFE 5CP3H 4ZSOB 1Z2KA 4P2RE 1MLCB 5EBMB 1QZ1A 1VFOA 1UCTA 4OCNC 1IZJA 3IB4A 5IW6B 1QRNE 5C0BD 4M8VA 4WFGD 5GIRA 2VR9A 1F8TH 3TCLB 3VFUB 3O4LD 3RUGB 1DJSA 1DUZB 3BP5B 3WFBL 3RGVD 3D69B 1T80A 3TVMB 5E4EC 3CAFA 1YQVL 1NAKL 4K94C 3CJJA 3LCYA 4PJXE 4UUJB 4HKZB 2EDOA 4PLJD 5JW4N 2HT3C 3AC0A 3PQYB 3RTQB 3QDMD 5T1LA 5DD1H 5D2LE 1GC1H 1HINL 3MNVB 1J0IA 5EIVA 4FABL 3O6FD 4UOW1 4JKWA 4P3CL 4FQ2H 1B6UA 4JGUA 5D1QB 3ZE0E 4XVJL 1KG0A 1FNLA 1NC2D 4YK4C 4F7EA 3NCCB 1TCRB 4GRLB 5HGDA 5CBEB 4GW5B 4MQSB 4XNZC 2IH3A 3UTOA 1RUML 5IFAH 5LGKA 3O6KL 1I3RA 2F54E 1JZ8A 3TIDB 4RMUA 3EYOA 2P46B 4NWUL 4PG2A 3NACH 1JFQL 3BZDA 3TPUB 1HH6A 4Q2ZB 5FHBH 1T1YB 4Z7UB 1CQKA 1G7PB 3MJ6A 5E7FA 3TBYA 3ARFB 4G6KL 5DHXB 3MLZL 3QFDB 4WTZG 2DQTL 3MV7D 5DWUH 2A6DB 4AJ0A 2H32B 3HUJB 4PRHE 4HBQA 4P2QB 1B0WA 1KB9K 4DZ8B 3CMOH 3IKCA 2FYYA 3BUYA 2KZ1B 4XBGB 1GSMA 1QFHA 1I4FA 1SEQL 5HYFA 3FQRB 4PGDA 1L9NA 3HZKB 1BWWA 4JAMB 1NANI 2E7MA 4PLNC 3H0TB 3WFDH 2IAMD 4N0CA 1VFUA 2ZNWA 3MLVH 1BBDH 4KRPD 4TSAH 4UBDC 2I27N 4ELMF 1OAYH 2AJYL 4U6YA 3AREA 4JFEA 3G5ZB 4RGND 3CH1A 3RWEB 3GM0A 4D0DB 1AQKH 5FA4B 4HJGA 4P5MB 4LPCA 5D4QA 1JK8B 2R0ZH 1XR8B 3S34H 3D2UD 3EHBD 2PTTB 2R4SH 1MCLA 3CSYA 2Y5EA 3REWA 4ALAL 3F58H 2Y6SC 2ZUQC 3GSXB 3R06B 4FZEL 3OAYK 2E9BA 3WJLA 5C70A 1MCJA 4ENED 5B8CC 1LE9A 5K9KA 3JWOC 4KQ4H 4JHAH 1AR1C 3G04B 4NNXB 2XXCB 1HHHB 5DC0A 1KPVB 4X7SL 1S5IL 1I7TB 4F33B 5DK2B 2WV3A 2QSQA 4U6VL 5I75C 5JLZA 1MIML 2SEBB 4GBXC 3BN9C 2W38A 3IVKA 4NUJA 5B39G 1QSEA 3ILQC 3MRGA 4D0CA 4GS7B 3UYPA 4TSBH 4OTXL 5DRNB 5IK3A 5HTSA 1AXIB 4MQ7A 4XI5D 2C3GA 4MNQE 1WZLA 3L3HA 7FABL 5DMYA 2AEIT 3HFMH 3SCMD 4WU5A 5HHPB 4X0KB 3F7YA 1QYGL 1XGTB 2GHWB 3BQUC 5HYIA 1OD9A 4XHJC 4MS8D 5BZWA 3VD5A 4JDZB 1YEEH 4IRSC 4U6TA 2XY1A 2XPGA 4HLJA 3DVIA 4U1JB 1Y6MR 2BSTB 3WJJA 1U6AL 3O8XA 4MNGB 2Q86A 1F5WA 3LPGA 3TYGL 3QYCA 4ZD3L 3WO4C 2G60L 2BOBB 2Y36L 4R4ND 1BAFL 1S9WB 4ZUVA 4OD3L 3QUXD 3T3ME 5DEGA 2X1WL 4JRXD 2YPVL 1XZ0A 2N7AA 3QUZD 4GQ9L 4BQ8A 1U8MA 1FP5A 2FGZA 2BHZA 5EZJB 2HVKA 3HMXL 3L95B 4RAUA 4BFEA 1IFHL 1RI8A 3UYRH 3DVNA 3F62A 2NY6C 4JZJA 3T0EC 2XQYK 4X6FA 4MJIB 4C59B 1FPTH 3PP4H 1J1PH 1ZHBA 1MVUB 2WUCH 4Q74A 5KS9A 4BH7B 2HRPH 1A7QH 5I66B 2EZ0D 4H1LH 1BIIA 4Y16C 5SWSD 4KC3B 4LLWB 5MEQB 1U8NB 2BX5A 3BSZL 5IHUH 1EO8H 4R26L 4R6UA 3UX9B 3MRDA 3VXME 3KJ4C 1NBZA 4XVUD 2AJUH 4RAVB 1A4JB 4WWID 4KDTA 3MV01 1MCKA 4P4RA 4XBEL 1J8KA 3RAJL 5ICYB 2Z8SA 1MH5A 4LCUB 5DD5H 3MRCA 1T1ZA 2WMPA 2DIAA 5LBSH 4HWZB 1LP9A 3GMNA 2EE3A 2ICEB 2H3NA 3OB0K 5I30L 4PRID 2ZCHL 4RRPA 5ENWB 3U4BL 4UT7L 1GGBH 2NY2C 3ZKXB 5EBWA 1RZIB 1T3FB 1EAPA 1J5OH 2NY7H 2X89A 1CF8L 3LDBC 5T5FL 1ZA3B 1JRHL 3GMQA 1CFVH 2D7QA 3RL1B 2DWDA 4FQQB 4KUCD 1FNAA 2VZUA 1G1CA 5DLML 2HLAA 4BFGA 1ZA6B 4U1MB 3FQUA 3PGFH 5EN2A 5F7EL 3SQOL 1R0AH 3BAEH 1JI1A 5ANMA 2P49B 4I5BB 1T03L 4LU5L 4OLZL 3S36H 5SX5K 2V5SA 1B0GB 2HWZH 2ITDA 3TO2A 2W0LA 3BPLB 3O3EB 1ZANL 1MHEA 1L7IH 2XQYG 4D2NA 4JO1H 1YPZF 4LLMB 3TT1L 3BZ4B 2I07B 4HT1H 4IHOA 3OQ3B 4OIIL 5C9JA 1T0MA 3DMMD 2H45A 2V17L 1RK1B 4YDJB 2F74A 4WY7L 3VDAA 4ELKB 1RZKH 4YXLL 4N1HB 4ZFGH 3M45A 4MA7L 1RJLB 4UI2A 5F7LB 4U6XB 5TQ2L 1XF5A 1KCUL 1DL7H 5F7DB 4Y8AA 2DF3A 3LB6C 2GFBA 2WINA 4EUPB 1A1OA 3MA7B 1A7NL 3ME0A 5DSCB 2DYPB 1Q72H 4MZ2A 3QIUD 4HUXB 2A77L 3KG5A 3WXVH 2WQRA 1FZMA 3GSRA 4ODVH 1DN2A 4RFOL 3VDCA 4D9RD 3MLUL 3RU8H 5KS9F 1F3DH 3B9DA 1MCRA 5KSBB 5DYOB 2ORBH 5I18L 5ISZD 2IEPA 4LIQL 3TO4A 4WHYH 5F6IC 2AJXL 2CIKB 3OAUH 1Y0LB 3LY6A 4BQ9A 2OI9B 5E2JA 3DTXA 1A6UL 3CVIH 1NUGA 4PJCE 1HHIA 3SDYH 5EUKA 1Z9MA 3W0WE 4LCWD 4XVTH 5F96H 4O58L 1I3GH 3A6BH 5FHAH 3HC4L 2IQ9H 4FTVA 3IXTB 1LP9F 3ARVA 3RBGA 5C0CD 3PL6A 1BZ9A 2WP3O 2J12B 2EH7H 5IB4A 3DX8A 4CVXB 1JV5A 4WW2B 3SN6N 3BKMH 1N64H 4FXGA 2D7TH 4YDVA 3C60A 4HDIB 3UTPE 2HT3D 4JLRB 4NZJA 2EDJA 2DQCH 1DBJH 1R5VB 3EUUA 5T3XH 3JBG7 4AIZB 1CDJA 2BDNH 3VGFA 3M07A 4NBYB 4OZGA 4QOKE 4R7DB 1U3ZA 5TF1H 4H0HB 4L3EE 3D0LB 2X9XA 1ORQA 4OLUL 2ZUSA 1MREH 4CADB 3QAZB 4OLWL 5D72H 2UYLA 4OFIA 4YFEA 3RJQB 1GGIL 2AXFB 4PJEE 1MCOH 4NO0A 1YN6B 3NTCL 1RZGB 5ADOL 1FO0A 5HGHA 3DARA 3ABZA 3GRWA 5FAAA 1JPTL 1M7IB 1SY6A 4RWYL 5A16A 3EDJA 1T6WA 3OKLA 4G6ML 3VH8G 4NHUE 1U8JB 3TZVC 5DJ0A 3MV8D 5FECB 3O8XC 1KJMB 5L2KD 2H6PB 2R0KH 5GS0H 2VXTL 1LK2B 3MXWH 4WNQB 3P4NB 1FBIL 4APQB 4G43B 4ONFH 3MLTA 3ZT5A 1M6OB 3T2OA 1AGCB 3DX6A 4Y5XA 1Q94B 2NYYD 2AP2A 2XRAL 4LPYA 5IQ7H 1D5ZB 2BMKA 2YA1A 2X2YA 3IJSB 3ZKMD 4O4YL 5CJ5A 4XCNB 3QO1A 1ES0B 4HD9A 4U4BA 4UBDD 5IVXE 3MRPB 1IEBA 5KVDH 1EHLL 5BMFL 1H0DA 1I7UB 4F7MA 2BJMH 2DLFL 1WQVT 2A6IA 4OUUB 1OAQL 2XTJC 4WW1B 1UT9A 4PJHA 2LU3A 3QG6A 4QRTB 1HSAB 3MZTA 5DD3H 5DJCA 1A8JH 3UTTD 1NCBH 5CILH 4WGVB 2APWA 3DRTA 4ZNEA 1HKLL 3GI8L 5SV3A 4RDQF 4EXKA 3KPLA 4W6WB 5GJTH 4YE4H 3E3QA 4IRJB 3CXDH 3LS4H 3GGWB 4KRNA 3RP1A 3H3BC 4RMQA 4LKCB 4OCXL 4RA0C 3W2DL 1AR1D 5CZXD 5JDSB 3G5XB 3OL2A 4XP6H 1QFWM 4N5EA 2Q6WA 3E0GA 1XGUB 2B4CC 4M43H 5AYUL 5BV7C 3B2VH 3TEUA 1PFCA 2YRZA 3BN9D 3GBMH 3CIQA 1H15B 1OAXL 5T3XD 2C1OB 3LQAC 4FXLA 2X4PA 3EO0B 3KS0H 4ODWA 4OD2A 1FG2A 3KLAB 1U8LB 4IBLT 4KRMB 1YDPB 4TOYH 4XNYH 2RGSA 4OZGF 3HI5H 1FN4B 2QHRL 1SMAA 4XHJD 4KXZI 2DJ4A 3BH9B 4IRSD 3LEVL 4NJ9H 3UTSB 4TRPL 3QEHB 3WFHB 3VD7A 1TTUA 1Z9SA 1KPRB 5D9SA 2NY0B 3QI9C 4JPIB 2Q1EA 3VXRA 2X4NA 1MJJB 1D5XB 1AKJB 5I16A 4QGTA 2DI9A 4POYA 2GEEA 2MQ0A 1N5YL 2BY3A 3G6JB 2IG2L 1I8IB 1YYML 2R0LH 2VLRA 2DLIA 5KVGH 1BOYA 4EQ2A 4M8QA 2D4FA 1FZJA 3EGSA 4R8WH 4QHLA 3L1OL 2AJ3A 1ROWA 3VXUE 4ZOAA 5KAQG 2VZTA 5CBAA 2KH2B 2HFFB 3VCLB 4CW1A 3MBXH 5LGJA 1X4XA 4BQ6A 1MCBA 4KTDH 5FOBA 4BYHA 3BP6A 3FQTA 1DN0A 4Z8FH 5JHDE 1YYLL 3OXRA 4L3CB 3QFJD 4WI4A 1WC7A 1NBYA 1JGLL 4YZFE 1CN4A 3MRNA 5IW1A 1GC1L 3OX8A 5EU3B 4OQTH 4Y19D 3F12A 2WWKO 4RX4A 3WLBB 1PLGH 5BS0A 4Z5RB 3QEGH 4GXUM 2ESVB 3O9WB 4PJHF 3REVA 1BREA 3QDJA 4YAQB 3VA6A 4GXVH 3TO4C 4QTHB 4Y89A 5CLTA 3HCVB 3VWJA 1YA5A 4XMLL 3QZWA 4G7VL 4YHZH 4U7MA 3U82B 2XWJB 1K6QL 3S7GA 1F00I 4ZPVA 1F2QA 1G7MA 5I1IH 4HIXL 1SYVB 3U48A 4BFIB 3TH4T 4HH9B 3K2UH 1AD9B 1OTSC 4U0RB 1MFDH 4HIIA 5E03A 2R1XA 5FHBL 3QUKB 4L9LB 3PL6C 1P4LB 4ORGB 5FKPB 1S7QB 3GBLA 4PJ7E 5C0BB 5DWUL 2FNBA 5DJ2B 5KG9A 4WI3A 1O5DT 3C5JB 3IT8D 1RUKH 4HFWA 2OMBA 2VXVL 3BWAA 3T3PF 5T1LD 5CHNA 3RVVD 4MQXC 1RZJH 1J10A 1S7TA 3C09C 5EO0A 2O61B 4RMWA 5DUPH 3TFKA 3PWPE 5CD5C 3G5YA 3LN5B 5GPRA 5I8EA 4I18C 4TSAL 2YA2A 5AUMA 2CLZA 4LVOC 1HDMA 4HKJB 2IBZX 4MB3A 4LLDB 4P2OA 4TSCH 1KTLB 43C9A 3TNMB 3O11A 4LCCC 3SPVA 1N26A 2B5IB 1BJ8A 4FRWA 2OR7A 3AUVA 2R0ZL 4TULH 5D2NC 5I1EL 4G8GB 3L3IA 3BHBA 4M61B 1V7ML 1JZ2A 2R2CA 3S98A 3PV7A 1I1AB 1A6VL 3VRJB 3WIIL 4QXGH 4K9EC 3K4DA 5C0RL 4YQXH 4JHAL 5IG7A 4DGVH 2C4FU 4EIZC 4H26B 4O2CB 2NZ9D 3IDNB 4G8EA 2VQ1A 5HJ3B 1INEL 5HHVL 1M1SA 1S3KH 4FQCH 5EBLB 3LRSB 1C5CL 2X1PA 4X5WB 1U36A 4IIQB 3ZKSD 4DTGH 1QBMH 1UQSB 5L0QC 2X70A 1BHGA 4OT1H 3PF2A 3QWOA 2GSGA 1U42A 4KHTH 2PCPA 3HFML 2APVA 1OOAA 3BKYL 4Y2DB 5HDQH 3PGCA 1NUNB 3ARED 4JFED 4HF5H 2HTLD 2VJXA 1B0RB 1FVDB 4ZXBB 1NMAH 3KPNA 1FYTE 2XG4A 4KJYA 3MLRH 5DD6A 4HULB 4UZGA 5D7KD 3CFJB 4OZHA 4UDUB 5CEZE 3GHEH 4Y2OA 4WWKC 3L5XL 1KUMA 4G9FB 1G7IA 1JNNH 2DMKA 1XF4B 1OAZH 1R3KB 4EQ3A 3OKOB 5EZLB 3IAGC 3D3VB 4EI5B 5I19H 4P46C 4NKMA 3TC9A 3T2QA 4DKEH 1E0OB 4N5EC 5ERWA 4LRIA 4F3FA 4P9HC 3BVNA 4M3KB 1EXUA 2APXA 5M94B 3S5LG 4GUPB 1QO3A 2WSKA 1RZ8B 2XQBH 2KQMA 3BOVA 5T3ZL 1QSED 1V5JA 5B38G 4YPJA 4GAJL 2X41A 2V5RA 1NCDH 1MEXL 2WUCL 1OB1A 5E2TH 1K8IA 2Q8AL 2NXYB 2LAAA 1GRWA 1JTPA 4K2UL 1S7XB 1IGCL 4TVPE 8FABA 1EO8L 2BNQB 2DKUA 1WF5A 1FNEA 2NX5A 4LLUB 5B3NA 4S0SD 2GJ6A 4PGEB 4R0LA 1EEQA 2AJUL 3GSNH 4ZUUB 2D7OA 3O8XD 4O51A 4YJZL 1Q1JL 1ZEAL 1QOKA 5B3JE 1TTGA 3QULB 1Y6KR 4FQJH 1Z0MA 4R96B 4ONGH 5HHMB 3RWCB 4JO3H 1NMCC 1W8OA 1QRKA 3VE0B 2YUVA 3RVWD 1IGTB 4M7ZC 3D39B 1FJ1A 4G6JH 3RKDC 1BQLL 2VIRB 1J5OL 1NAML 2NY7L 3N06B 4FQIH 1IM9A 4JPKL 4JRXB 3BGMA 1ETZA 2J8HA 1XH3B 1AXTL 5IMOB 1G7JA 5EBGA 1HQ4A 1WBXB 3DUUA 3T0VA 2P8LB 4WHCA 3RPIB 2AXJA 2BVOB 2Z31B 4G9DA 5CD3A 1KJ2H 3ET9F 3PGFL 5EC2B 4UNUA 4RGOH 1R0AL 5LQBL 1HE7A 3V4PH 3FOMA 1CGTA 3KGRA 3S36L 3EDEA 2ZOLB 2EC8A 5FO7A 3PWUA 1VACB 4PJ8B 4S1QL 2D4DA 2VDKL 5SWSB 4FNLH 3ULSA 1U8OB 1I3UA 3L5HA 3O2WH 1MWAH 4HUNB 5KANI 1EFQA 3LQMA 4GW1A 2J8UB 5DDHB 5DA0B 1C16A 2G2RB 1JWUB 1BWMA 3MLPA 2FHFA 3CZJA 1UA6H 4X4YB 5FXCH 4OZHF 1QFWI 4ZTPL 3TM6A 4YXKH 1W0WB 3L7FB 1VCAA 4PV9A 5CJOH 1RZKL 2X89D 4Y4KB 4R4BA 5DQ9B 3SHSA 3TBTA 4CNIB 3BO8A 1PD6A 1KT2B 4CL7A 3EOBB 1DVFB 4D9LH 5FK9A 1KIPA 3HR5B 1DL7L 4IJ3C 5I9QB 3MJ8A 2O93L 1N4XH 2NLJB 4F58L 2W92A 3C2AL 1ZT4A 5GRYA 4AQOA 1X3DA 4R7NB 3FO9B 1A1MA 3OJVC 4HX1A 5ECJE 3S35X 1IGJA 4S1DD 2YSSA 5DHVH 4DVRL 2UWEE 3UROR 1FVCB 1B4JH 2LV4A 3KPSE 3QCTH 4S1SH 3OKEA 5DC4B 4TTDC 1X5ZA 5C0AD 2BVYA 3RZCA 1T66D 5T1DL 4WO4C 3VI4E 1FO0H 4W6XB 4Q58C 2J8UE 3IU4L 3CVIL 3T09A 1SY6H 5C08B 1JBJA 3SDYL 4UT9H 3W9DB 3U83A 1P4BH 4XVTL 1SM3L 5EUOE 5I0ZA 1K8DB 2NY1D 4Q9QL 4X4XB 5FHAL 4P2OC 4CAGA 2HFGL 2IQ9L 3CFDB 4K9EH 4L8BB 3INUH 1ZTXH 3FMGH 3T4AA 4B53A 3NPSB 4CDHA 1R6VA 1FNGB 4N9GA 3ZDXF 1EUTA 5CJBA 2OTWB 4X6CB 3G08A 1DSFL 5ILTH 4QF1B 1KBGH 2PETA 3BKML 2IALB 1AHWC 4EVNB 1I9RL 1H5BB 4R90L 4J2XA 1FGVL 5ID1A 3X12A 1DBJL 1B2WH 3HPLB 3BZEB 5GQBA 1YN7A 4MWFA 1EJ6A 5TF1L 5GGSA 3K3QA 1VKXA 3FO0L 3HG1B 3ULVL 3ZHDA 3HC0B 4AYFA 3TO4D 1CD1B 1MREL 5D72L 5C07A 4H1LB 2R1YA 5KOVC 4KK8D 1BQHB 3OMZA 1BMGA 5KN5B 1CDHA 2YWZA 2BSED 3I84A 3WNLA 1KEGH 3LSOA 4MJ5A 2WANA 4N9OB 1C12A 3O3BA 4WFFE 3HMWH 3PDOB 3BP4A 4LPVA 1ZT1A 3VFWA 3B5HA 3B4NA 1L8JA 2FLBT 4FTVD 3S4SG 5JXEA 1QEWB 1T21B 3PL6D 4I48A 1YNKH 3MQIA 2R0KL 3SDDA 3OKYA 1YEGH 4M7KH 4V1DB 5GS0L 3MXWL 5ESAA 4NRYA 3C60D 4JZNB 2UZIH 4ONFL 1QBBA 5ESQA 3QNZA 4MQXD 4NFDA 2YD3A 3TYFA 1DEEA 1INDH 1OP3H 1LE5B 2F8XC 4N8PA 2V9TA 4Z7WE 5CD5D 1IBGL 1IAIM 4NRZB 3VWKB 4KTEL 4WJ5B 4GLRI 5HDBE 1WBYA 3CLFL 4WUUB 4NZRH 3QUYB 3H3PL 5HHXL 1E6JH 4NO0D 4HIEA 5GZOD 4AH2B 1FV1B 2P7TA 3AXLB 4JJHA 2CMRH 1YY8B 4NN6C 3H42H 3OXSA 4LAQH 4R3SB 4ZS7L 4JFFA 1XT5A 2L7UA 4PJDB 1EEZB 2HJKB 2X4QA 5GJTL 5L8JB 2IGFH 3TBVB 2IPTL 3DSNA 3CXDL 2QQKH 2D3VA 4U33A 1HSBA 4GRWF 1P5UA 4ISVA 3C6SA 2ZKHL 4H25A 3QXVA 3GSUB 4WEBL 2BERA 4OIBA 4MA1B 3RHWF 1HXYA 1ZLSH 3RL2B 5H35B 1A4KA 2CDEB 3Q5YA 4TTGA 5MP6H 1U0QA 4K3JH 1N6QH 2VQUA 3I2CL 3Q1SH 3MLSH 4DFIA 3VFPA 3OSKA 3T65B 2IH1B 2R23B 5CINL 1RUQL 4TUOA 4J4PA 4HCRH 1P7KB 1Z9OA 5DS8B 4HS3B 1J0HA 4HKBB 2VLME 4Y1AA 5FUCE 3BDYH 3BESR 1J1XH 2YXFA 2QEJA 2R56H 3MRHA 4KKLC 3WCYA 4EDXA 1R3HB 3SE9H 1OTUD 4P57A 1NFIA 3ARGA 1CXFA 4OV6F 1F02I 1G6RL 4HLZH 4K23H 4WI5A 2OS7A 2MFNA 5BOPA 1KFAH 4JCLA 3L5WB 3ARXA 1INQB 5GGQH 3LEYH 1U8IB 4Q7DA 3W9EB 4N5ED 1EHNA 2WIIA 4ORZC 2Q76B 5T1KA 4E42A 4H5SB 5EPMA 3O3UN 1A6WL 2HJLB 1A6PA 1NMBH 3MBXL 5E2UH 1J12A 5IIEA 4I0PC 3SO3B 3SDAA 2M8XA 2PN5A 4CMMA 2E8YA 1EHXA 4KTDL 5FGCB 1WBZB 4KVNL 4L4VB 3FB8B 3SDXB 3MJ7A 3QT2A 5MENE 3VFRA 5E8OA 5H94A 4NNPL 5DJYA 4OFPA 1I7RB 1ZKAA 4PB9L 1CT8A 5C09B 4XNMB 5F9JA 4U1GB 4FN0A 4U1NA 1J88A 3JV6B 4Z7NE 3QEQA 1E4JA 5D1XA 2P8PA 3VXRD 4OQTL 1P7QB 5IVNA 1JGDB 4UILL 1PLGL 1Z0NA 5D7IA 3WDJA 4FG6D 4L8SA 5HI4C 5EFIA 1PKQB 2VLRD 1FE8H 1J8HA 1OWWA 4HS8H 4C83A 5DMKB 4Z7VB 1JF5A 1X9QA 3KPMB 2GK0A 1CGSH 2P48B 2FX8L 2OMNA 5JO5B 4G6FB 1NFDA 3UTQB 4CVZA 2YBRB 3QIBB 2AEQL 2KBGA 1FSKC 3L6FA 4ZO8A 2CLVB 4RIRA 4YFLF 3BT2H 1MFDL 3UBXB 2JCCF 4XP4H 4Z95H 4QRPE 3DGGB 2QADC 1BIHA 3UJTL 3U46B 5FO9B 4KI1A 5K9JH 4M7JH 1A22B 3QHZL 4IOIB 1RUKL 1YMME 3CFCH 2R2BA 1U41A 3O3DB 2CDFA 4N90E 5BW7C 2VSCA 4W6YB 4F9LC 4M6NL 1RZJL 4K8RL 4MX7A 3CFKA 5KVEH 4RX4D 3TN0B 3ULVE 1OTTD 5DUPL 3QQ4A 5BS0D 3Q6GL 5BZDB 1QP1A 1EBPA 3QDJD 3QPXH 2NMSA 3MV11 5TE6H 43CAA 4HGWA 4PYHA 1JN6B 3VXSA 2H9GA 3B9VA 4NQCE 4OZIE 1FYHB 5DEFA 4WHDA 1NL0H 2W07A 4TSCL 3CUPB 3NIGE 5J1TC 3B9KB 3PDGA 4ZUTB 5ESVB 4DN3H 3P9MA 4IOFD 4RAHA 1QG3A 1ZT7A 5TE7L 5ALBH 4XBPA 4DKAA 3WHXB 4HJ0C 1Z3GH 3IGAA 1AD0B 1IQWL 5IBLD 5FYJL 3V4VL 5ICXB 3MUHL 4XNXH 1PYWA 3BKJH 4LASH 3PIQB 4UV4L 1S9XA 2G75A 4XGZA 5T33L 3OWEA 3ARDA 1UXSA 1CL7I 4H8WH 4EOWH 3S37H 1RUAH 4LPTA 1ZLVK 4KI5F 3S3PA 1IZKA 3U4EA 5KJRH 4FQCL 1ADQL 4DTGL 2DQJH 3EBAA 3DUSA 3TFKD 3G6AA 1IC5H 4MZ3A 1VHPA 2NY4B 4M5ZH 2PF6A 4KHTL 4AMKL 4QHUA 5JOFA 1RFDL 4N0UB 4X5XA 2VLJA 4ZDHB 3FN9A 3L9RA 3QIWA 1KG0B 1BVZA 4P2OD 3WIHA 5JIIA 3QDGE 2Q7YA 3F5WA 3BD5A 1SVZA 5JOPD 1G6RB 4X83A 4JHZA 3GHEL 2DD8H 3EZ8A 4MD0B 2YD5A 2QKIA 4OF6A 5KSUB 2NTFB 4LCYB 3AMLA 2XIDA 2DM2A 4CU8A 1G6VK 1NFDF 3FZUC 2VLKA 4CU6A 2LAGB 3VFOA 2VUOA 2KUTA 4NUGH 2AJSL 2FWOB 3WDHA 1B88A 3PWNB 4JGJA 4L5FL 1GIGL 1MFCH 3TCXA 1J1OH 1RURH 5IB1A 4PLOB 2EKSA 3NH7H 4JM2A 1JUFB 3G9VA 3DBXB 2EIDA 3LKPB 3HI1A 1XGRA 2ICWI 2XQBL 4WFED 1ZE3C 2Q3AA 5HGAB 1NGYB 2ERJB 2OM5A 1M71B 3AAZB 4JG0H 1AI1H 1BX2A 1I4FB 2ZSWA 1JWSA 5E2TL 5DJ8A 2FSEB 4PGDB 2FGWH 1OM3L 5DVLA 3NAAL 5A40E 3I6LE 1LMKA 5KANG 5F1IA 1I9JH 1TPXC 5EWIL 3GSNL 3DURA 3T04D 4X6BA 1KOAA 3MJGX 3GSQA 4NN5C 4U6YB 4NM8L 1TNMA 2XOTA 3IFPB 4UV7H 3STZB 4DVBB 3GM8A 15C8L 4C56A 4BUHA 2BSRA 4FQJL 4LHUA 4J1UA 2A0LC 4ONGL 3FT2A 5E8PB 1EGJL 3F7RA 3ILPB 3OKNB 3X3GH 3BIKB 1DLHA 4PG9B 4X9HA 5I8KH 4MXVF 4NQSA 4I77H 4G6JL 4JG1H 3ZYOA 4KUZH 4XP5L 1LE9B 1S7VB 5K9KB 1NC4B 3OAZH 1RJYA 2DMCA 4XP1L 5E6IA 2ENSA 2Y9RT 2ATPB 2XA8H 4PJFA 1RU9L 5E8EB 2H2PC 2I24N 2PW1B 4M7LH 5DVKA 3KPRE 1KJ2L 3OKMA 3V4PL 2NX5D 3D25A 4MQ7B 1KLGB 3UMTA 3ZDYE 2GJ6D 2X42A 4S2SA 3UJIH 12E8L 1D3CA 2FZ3A 4FNLL 4PJXA 1LQVA 1EBAA 1WV7T 1MWAL 2X4UA 3IDMA 4L4TB 4NM4L 1F6AA 4LBEB 3VA2C 5IESL 1OAUL 4PRPA 5E9DB 5BZWB 3LKQA 1FORH 4HUUA 6FABL 5IFJA 5D2LA 3P0GB 3IAPA 4GRWH 5E1AB 3WXWL 4L8CB 1DQQB 2XPGB 2IBZY 1C7SA 4POZD 1U2HA 1U8HB 3L3GB 2QQLL 2DQGH 4M6OH 1QSFB 1SBBA 4OV5A 1YEIL 4QRUB 2CKBL 4YXKL 3DROA 4J6RH 2CUIA 3WUWB 4XCEB 4BQBA 1BVLB 1IM9D 3C5ZC 3KPOB 3U0TB 4C54A 5K93A 4YLQT 1K3ZA 3QCUH 1OGTA 5JR1L 3TIEA 1ZS8B 3D18B 1WFNA 2VDNL 1N4XL 3PHSA 5J12B 2E9WA 2HVKB 3PWJB 4OFKA 4PTUB 4QTIH 4BZ2L 4E41A 5ACLA 1WZ1L 4X80H 4ZSOA 3STBA 3N9GH 1MLCA 4JM2F 4PJAB 4MJ6B 2FX9L 5IW6A 4KKLD 3SKJH 2FIKA 3TCLA 3VFUA 3RUGA 3BP5A 1B4JL 4DFHA 3QCTL 3MLYL 3MFGB 3D69A 1XFPA 4MAYB 3TVMA 4OQ1A 4KU1A 3OF6A 4XH2B 4UUJA 4HKZA 1GHFH 1AGDB 3MRDB 1Q9OB 5IVZB 1NBZB 3PQYA 4NQEE 3RTQA 4FFVD 1SY6L 3J8F7 4XPHH 2YMXH 3MNVA 2VDMH 3I50L 1AQDA 4NO3B 1UH3A 2P42B 3BRFA 3U2SA 1CYGA 1F3DJ 4GRLA 1BFVL 4I0PD 4YDIL 3V8CA 3NMEA 3ELAT 4GT7A 4D8PB 1ZTXL 2I5YH 1T7YA 4X5LA 1A5FH 4FQ1H 2IMMA 3TIDA 2EXWC 1CR9H 4KVCL 4NJAL 3TPUA 4Q2ZA 3CLEL 1T1YA 1ZXQA 4Z7UA 1B2WL 1G7PA 4K3HA 4PJFF 3ARDC 3ARFA 4WFHD 3FQUB 2W9LA 4HK0B 3QFDA 2ICCA 3HE6B 2A6DA 4F15C 1HHJB 3RZCD 2H32A 4PJIB 3HUJA 2WBJC 5TFSH 5CGYD 1S5HB 4P2QA 4CJ0A 5GS1C 4DZ8A 4XBGA 4CGTA 2ITDB 3BISA 4UTBH 3TO2B 3EO9L 3FT3B 3FQRA 4UMGA 3KLHC 1MHEB 1V7NL 1RZ7H 4X6DE 1EVTC 4P5TA 1EUUA 1N7ML 2YUXA 3GSNB 4F57L 3H0TA 3QIWC 4HJJH 4OF3A 4IHOB 4S1RL 1LEGA 1MI5E 5FYKE 3BE1L 4S0UC 4J3TA 3AY4A 2AK4E 2JIXB 4QHNB 4JPVH 4DWHA 2QADD 2V5MA 3G5ZA 3IDIB 5I71C 2DQDH 4XPGH 2W9DH 1BJ1H 1H3VA 5F7KC 1L9MA 3RWEA 4D0DA 1IGML 2C3XA 1YEGL 5FA4A 4P5MA 1IC1A 1ED3B 1ZLUK 5SWZB 1K2DA 3H7BB 2UZIL 2BXZA 4YHMH 5AAMA 1F4XL 3K8LA 3GSXA 1NCTA 3SGJA 1YEFH 4HWNA 4M62L 1NDGA 2F5BL 4JM2C 4JRWA 1D5IH 2OQJB 3AVEA 5D1ZB 5D70H 4NNXA 3G04A 5J13B 3U7WH 2AJVH 1HHHA 4Y5VB 3MRJB 3MRRB 4DEPB 1KPVA 4HUVA 1I7TA 4F33A 3RUGF 2L7JA 1KJ2B 4NZRL 4GAGL 4JFYA 2SEBA 5JW3H 5EORH 3T1WA 2CMRL 4KROC 1JZ5A 3P77A 4OF8A 4R2GB 2DL9A 3H42L 1MWAB 3SOBH 1CBVH 1U8KB 4HJ0D 4X0KA 3O6LL 5EUKB 5DZNA 1ZHLB 2IGFL 4RFNC 1SHMA 3LKRA 1T1WB 4PGBB 3SDDD 1OPGL 4U1JA 3FB7B 3V6FB 3WMSA 1K4DB 3WLWC 2CKBB 4MNGA 2R2HB 1H9VA 1ZLSL 1F4YL 3ULUL 1CE1H 4RFEB 5DURD 4OI8A 4JFDE 3ZO0A 5IJKA 4DAGH 2BOBA 2P5EE 5MP6L 1J0KA 1OLZA 1P9MC 1S9WA 4YDVB 3C60B 1FNSH 4YEFA 1RJCA 3Q1SL 5A2FA 3WUZA 4I3SH 1KGCE 4Z7UF 5EZJA 4Z0BL 2JELH 2WWMC 3L95A 4HCRL 3SJVB 3BPNC 5DHVB 1ORQB 2VLLB 1KN2L 1CGUA 3BDYL 3MODL 4LLAA 3K4ZA 1ZVHA 3UC0L 4MJIA 1J1XL 1Q8MA 3HUJF 3GUTB 2QQQA 5E1HB 5BRZE 3S3SA 3MGAA 3V9FA 5I66A 1N0XL 2WUBH 1R5WB 2WWKT 3IF1B 4LLWA 3JXAA 3KPTA 5LJYH 2FBJH 3VMOA 5MEQA 4JQXA 5INDB 3S88H 1DBBH 4YXHH 5FUCC 5L88H