4PGGA

Caffeic acid o-methyltransferase from sorghum bicolor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
360
structure length
360
Chain Sequence
ATAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKALAAEEVVARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFDESVSTLVDVGGGIGATLHAITSHHSHIRGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVTTDAVPKAQGVFHVDMIMLAHNPGGRERYEREFRDLAKAAGFSGFKATYIYANAWAIEFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the Structure and Catalytic Mechanism of Sorghum bicolor Caffeic Acid O-Methyltransferase and the Structural Impact of Three brown midrib12 Mutations.
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 116
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.1.1.68: Caffeate O-methyltransferase.
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pggA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pggA02
1BC7C 4HA8A 2E7XA 4M36A 4FS8A 3FXQA 2Z33A 1J59A 3FF5A 3WU1B 1BKYA 4CO8A 2H94A 1FSEA 3RKYA 3V7SA 3V4GA 2VZ9A 1J2XA 1DP7P 5EEHA 4IRHA 4MEYF 3ZMSA 3CKKA 3I59B 4QQNA 5K0JA 5IT9Z 1R5GA 2E1NA 2K4JA 3M33A 4WXCA 4G8XA 1SD5A 5LEKA 4PYLA 4FT2A 3BPVA 2OY0A 3CUOA 2PLWA 1UFMA 5E1DA 5D5VB 3PX2A 4IKPA 5FQOA 5EQJB 2OQRA 2YXLA 2ZMEA 3WTTC 3P97A 2VDVE 1XDZA 2O8XA 5GWXA 2XV4S 3SSNA 2H00A 3UWPA 3HOSA 4E32A 5DX1A 3B7PA 2NAZA 4FSDA 2OA4A 3PLAE 1D2CA 2HS5A 4LB5A 1XGNA 2DAOA 3P9NA 3ECHA 2WA2A 5KQSA 5EZSA 1AWCA 3UJ9A 4HBLA 3HA5A 3QV2A 4A5MA 2LSOA 2HNKA 4QTTB 1SMYF 1RUOA 1HKSA 3LSTA 1W7PB 4I98B 1JQDA 3N4MA 2JHAA 3HTSB 2RGVA 2ZBKA 2JH9A 1P4WA 1K78A 1YW7A 1T38A 3B3JA 3R24A 4IRIA 2IVMA 5J6XA 5CVRA 3WG9A 3GJYA 5EKXA 4UV8A 4GXOA 1VIDA 4P58A 5CCXA 3SFZA 2AN3A 4P9FA 3K1PA 5FFZA 4E33A 3LQRA 5LSAA 4WXHA 4GC5A 2ZXJA 4EV0A 2A3SA 2ZIEA 1Q1HA 3LPMA 2XAJA 5KK1A 2M1BA 2XHKA 5D6FA 1OMIA 3FZGA 3MCTA 1LDJA 4L7VA 5LQUA 4GQBA 1H0MA 3GRVA 2NRAC 2BEOA 3F8CA 2QRVA 2VODA 3KPJA 2FBIA 2P8JA 3CBGA 3SQNA 1ZRFA 2PXCA 5CVIA 3FM5A 3PS9A 2XKPA 3S2WA 3HCBA 1HSTA 5K09A 1WXXA 3BROA 4RTSA 5E1BA 2IH5A 3L7WA 1PJZA 4E2YA 2L02A 1R6AA 3L8DA 1XMKA 3ELKA 5LHIA 5D4RA 5LLQA 5TRDA 1YIOA 2H6BA 2EFWA 1EG2A 1LB2A 3IHTA 2V1UA 1HKQA 2G7HA 5IH3A 4M71A 3LFKA 1ZLKA 4XLPF 2CKDA 5KVAA 3CO7C 4PYOA 2RKHA 1G55A 1FT9A 4L0ZB 4RAZA 3UA3A 1WSUA 3IWFA 1IY9A 4CKBA 2CO5A 1HW1A 5GIPE 2E7WA 1R8YA 2MC3A 4BY9E 1O3RA 4KA4A 3FRHA 3FTCA 4HTFA 2O0YA 4M9XA 5F2OA 2VBZA 2QBYA 4XLNF 3KP6A 1RIOH 5ICFA 2H27A 1WI9A 1TW2A 2B0LA 3EDPA 1KIAA 3BJ6A 5HIKA 3GLXA 1QNTA 4OIQF 4N0BA 5L3EA 3LDFA 1KU7A 1AQIA 4HGZA 5CVEA 2YSRA 1MKMA 2HGCA 4NECA 4KIBA 1R1UA 4RWZA 3FXRA 2ZO4A 3WTSC 1JTFA 3P9CA 3ELUA 4HF0A 3FPHA 3TKYA 3C7JA 1X1BA 2AOTB 3HRTA 3VYWA 4GUAA 4RTPA 2H6CA 3T5XA 2ADUA 3ME5A 2E5WA 3B89A 2AN5A 3TPZA 1ZN2A 1G3TA 2BGCA 3V8JA 5LGTA 5DT2A 3GZ6A 3SVZA 5H6QA 1L1EA 1KQ0A 3BDDA 4RVHA 1G60A 3NWEA 2EA4A 3Q9SA 4WK8F 4LLNA 4O6JA 3P8ZA 3FMRA 3ZMVA 1IXSB 2YQZA 2OU2A 5CIYA 2H09A 4KDRA 1FYKA 5FUBA 2CW0F 4HG2A 3S68A 2UWMA 2HYFA 3O3KA 5DM1A 2G1PA 1VE3A 5T67A 2PV0A 4JXJA 5DSXA 1C0WA 4AUKA 1RUNA 5K0LA 1KU3A 4DZRA 2IA2A 2XIGA 5K0EA 2FHPA 4E31A 3FTDA 4RTQA 1MGTA 2HTJA 5FLXZ 3D0SA 4AZVA 1BI3A 1G4DA 4WX9A 5CUQA 3QPTA 1HKTA 1HW5A 1S8NA 2FRHA 2PJDA 2W57A 5ICEA 3I64A 4PDKA 3TOBA 1J0RA 5GM1A 2Z3YA 3PQKA 1W4MA 1QZYA 3I53A 1PUEE 1ZARA 3HM2A 1G8AA 1P4XA 1NT2A 4X63A 5LGNA 3MQ2A 2AVDA 1R58A 4S04A 3GYHX 3AXTA 4WWCA 4EJOA 4EM1A 5D1HA 4PINA 5AIPA 5DTRA 1Z6RA 2EJRA 1S29A 2IH2A 3JWJA 2AOVA 3GFJA 2OD5A 2VOPA 3R3HA 4IVNA 4MTLA 5BS6A 1YZ3A 2QLZA 2IFTA 1J7KA 5BPIA 2R3SA 5HOQA 2XROA 2KIMA 2M30A 5EKUA 1IUYA 1G3WA 4U7PB 1O9GA 3G8BA 2MLGA 1XSVA 2ZULA 2JPBA 3NWBA 2MH2A 2NNWB 3ER8A 2F2EA 5K0BA 4M72A 3EMDA 4RGUA 3BWYA 2Z6UA 2ORED 2BR4A 4KRGA 1R5HA 2IA1A 1GXPA 1MHTA 4GBED 4V0QA 3IKTA 1P92A 2FBHA 5DWQA 2YXDA 4AWXB 3T7TA 1MJBA 4U0YA 4QTUB 2AOTA 5F2NA 2FQ3A 1P2FA 2X4HA 3DXZA 3BOQA 3ZN0A 3KKZA 1AQJA 3DTNA 4IJAA 4P55A 1NBIA 4CTKA 1G6NA 3K0BA 3RDIA 3RKXA 1ZQ9A 4G6QA 3V8VA 2XYQA 3KP7A 1M0EA 4IHSA 3CLOA 5D6EA 5HLGA 4YFNF 4XBFA 3FHZA 3EGIA 4R8HA 3G2MA 2WA1A 2M87A 1SD7A 3GO5A 3ULQB 3OFKA 1FP1D 2DI3A 2JTVA 3WGIA 3V7CA 3FUTA 1QO0D 1ORHA 3ELYA 3A4TA 3SGLA 1Z3CA 4AX8A 1FZPB 2CG4A 3PTAA 5ICGA 4FZVA 2PX2A 3R0QA 4U0WA 4RTJA 4EJTA 4HRAA 1G3YA 1DUXC 5JR3A 5BXYA 2EV5A 2XVCA 3I54A 3HA7A 2Q2EA 4PCAA 3KPYA 5IT9K 1YB2A 1I27A 5FULA 3BKWA 3DEUA 2P35A 2F5EA 1R23A 4IHTA 3OZTA 3E23A 2PJPA 5ED4A 3NVKI 1Z7UA 1EAMA 5K5QA 2GQQA 3HCCA 2UYOA 2OKCA 1JE8A 2ZZMA 3C6MA 2JH8A 4QDKA 4P7JA 1F9NA 4M9SA 1BI2A 4I0BA 3H2BA 4KDCA 3PX3A 4CKEA 3E6DA 3FMQA 1NBHA 2IIPA 2A07F 3EVGA 3LHDA 5KS2A 3K69A 3SZTA 2W25A 5L3DA 4BQAA 4A5NA 3WTZA 4HF2A 3K9TA 3I59A 1TPYA 3JAMK 4QQKA 3E6MA 3OZSA 4O29A 3GO4A 1IZ1A 1VPTA 3HVHA 5HVQC 4LECA 2Y48A 3DKWA 3DULA 1DPRA 1I9GA 3HVKA 2EFQA 1S6LA 2IBSA 4XSZF 2Q41A 1JG3A 2ELHA 2VT3A 3FZVA 1KHHA 4YFXF 1FJXA 1WQ2A 4MWZA 4ER5A 5ILVA 1N7JA 1SD6A 5E1WA 5K01A 1ZG1A 3D2LA 2HQRA 4BLWA 5E8GA 4GO1A 3KPWA 3LBYA 1IW7F 7MHTA 5D1NA 5H6RA 2LF7A 1L0OC 4E2XA 4DA4A 2IPQX 3M70A 3T7RA 2CMGA 3FUVA 3WODF 1IXCA 1QQIA 2NNYA 5FTWA 1PP7U 2Y75A 2EX4A 2BZGA 4BLUA 1FSHA 4A0YA 1ZHFA 3G88A 4U7TB 3W6KB 2FNAA 1XGMA 3GGDA 3FRIA 2ZBRA 2G9WA 5DPMA 4M37A 4M6XA 3BPXA 4P5OA 1XMAA 2K4MA 1SMTA 5E8JA 3GX4X 3BWGA 1O7LA 1B6AA 1MJ9A 3REOA 5FLXK 2OZ6A 4RVFA 2DO7A 3NJRA 3V8LA 1T0FA 3IC7A 3IHUA 2PLYA 3ML6A 2A68F 3GRRA 4IWNA 4EJUA 1F38A 5LRRA 3WE3A 4A12A 4RTNA 3CUQA 1QAOA 2WC2A 1I1NA 3EVBA 1B4AA 4HW0A 2Z9OA 3P2IA 4NQWA 1O7FA 3IEIA 1Y8CA 1RI5A 3PB3A 4DCGA 5DRTA 4UOEA 3F72A 2N47A 4MHGA 1OYYA 3EVFA 4KYWA 3SX0A 4YFKF 4E2ZA 2IT0A 2PY6A 2RDPA 1VLMA 3ISPA 1NW5A 5DRYA 5E2AA 3K2ZA 1BIAA 5EC8A 2P5KA 1EH8A 3RKWA 1CF7A 2DPUA 2ESNA 3E8SA 2JSCA 2AOWA 2ZTHA 1HXDA 3JWGA 4QDJA 4YMGA 2CL5A 1WG8A 3M8FA 1JQEA 3I9FA 5K8VA 2HTSA 2WWYA 1INLA 4PNEA 3DP7A 2R6ZA 4X61A 2GAFA 3CCFA 5EGSA 1ON1A 3C1DA 4H0EA 5BPDA 3LKZA 4I7HA 3TLJA 3TMAA 3Q87B 1XDUA 3HVIA 1X1DA 1XSDA 3KQSA 3WE2A 1G38A 5FWAA 2P6SA 2K4BA 1B9NA 5L3FA 4RAYA 4ZYEA 1IRFA 4KIGA 3A25A 5HDGA 2FBKA 4UHTA 2GXGA 2ZNZA 2UYHA 4HYEA 4RS8A 3HSFA 1XGSA 3DFGA 5CM2Z 4LLLA 3LBFA 4OIOF 2VC1A 4DF3A 4FP9A 2UXXA 5P8WA 3SSOA 3KR1A 4PYKA 1YYVA 5FA8A 4Q48A 4IRGA 2ZSUA 4HX8A 2O61A 3B3GA 3UJAA 2WTEA 1ZG5A 3VB2A 3F4KA 4AIKA 4XUEA 2GAUA 5E9WA 1QAMA 2D45A 3O7WA 1G3SA 4GYGA 2IDJA 1QAQA 1TLHB 4YV2A 3GRUA 1XJ5A 2F5FA 4EGZA 3LCCA 2XKOA 4BHPA 3E97A 3HRUA 3LECA 2JT1A 5JVTA 3RI4A 1RJFA 3T0YA 4EJWA 1WKMA 2O05A 4GOLD 2EV6A 1QYRA 3TQNA 3KQMA 5CVUA 3H3ZA 2NXNA 1UCRA 1S7OA 4R8SA 2GB4A 2ACJA 2B78A 3Q9VA 4U88A 2KKOA 4OMZA 2EV0A 3WTYC 4RB2C 1ZRDA 3MTEA 2G7UA 1YTYA 1KXZA 4PYJA 4YMHA 1QZZA 2CQKA 1SG9A 3GZ5A 4FSXA 2PMHA 3RPQA 3HTXA 4GOND 3JTHA 4LG0B 5E2BA 3DMGA 3CJQA 5HS7A 3R6TA 1V3FA 2QYOA 2Z5UA 2XAQA 1XB4A 2Q0OA 2X0LA 4JK1X 4UNOA 4CTJA 2V1DA 2GWRA 3KQPA 4GOOD 4ENJA 1NKVA 1SUSA 3J7AO 2EFNA 3CUQB 2DU9A 2ZNYA 4AVPA 1O3TA 2MLKA 3ERCA 2EK5A 4X60A 2EFJA 5T64A 3P71T 5DM0A 4B8XA 2G72A 1R22A 3HEMA 2AN4A 2CFXA 2V6CA 3GFMA 2FPOA 3KLNA 4CGZA 2GPYA 5E20A 4RB3C 2FEZA 3UFBA 2HOEA 1LNWA 4YUWA 1FNNA 1UHMA 4YUVA 3DQVC 4C07A 3WU0A 4FX0A 4U7DA 1FPQA 2J5OA 4ENKA 2PX8A 2ESHA 3L2CA 4N9IA 1P1BA 2XBMA 3RPUA 3CC8A 5FHRA 2K27A 3TO9A 1YG2A 3KPVA 2NXCA 5DTMA 2K02A 2STTA 2Y1XA 5LEJA 4EQZA 3O2PE 3GFIA 2LD4A 3ER9A 4EM0B 1USSA 2EFPA 3MZYA 3R0AA 5LQKA 5CCBA 2CYYA 2P7IA 1UWVA 4BP3A 5L3GA 3KHKA 4HLYA 4HOBA 2JZYA 1RJGA 1R7JA 4F85A 3R9XB 3IL2A 4A6EA 2BYVE 2IBTA 2ZWVA 1T43A 3FPFA 1BOAA 4RTMA 2KRFA 3UJDA 3HUGA 5HFJA 1M6EX 3E3VA 4RGXA 3TOAA 2I62A 1XD7A 1K6OA 3FYDA 4G56A 3ID6C 4CYDA 5GOZA 1B9MA 2ZFWA 1U78A 1Y0UA 4OA8A 5EEGA 1QBJA 2JHPA 3NDIA 4ATNA 3BT7A 1LJ9A 2VXZA 2CMHA 2HV9A 2ZCWA 2ZMEB 4ZYGA 2A69F 3L9FA 1EIZA 2OBFA 5E1OA 4CXMA 3KP4A 1HBXG 1NV8A 4MQ4A 1IXRC 1IXKA 2ZJ2A 5ILSA 3BZBA 4M38A 1AV6A 2UZKA 3U1DA 1VBFA 1KU2A 1YFJA 4WCGA 3QU3A 4XCXA 4RV9A 3BWCA 1JG4A 2CWEA 1R00A 3B3FA 1KYZA 1V4RA 2OAZA 2XRNA 1ZAOA 5LQNA 2FOKA 3RJPA 3P2EA 2K86A 5KQRA 1K78B 3EVAA 3KU1A 1RJEA 1Z91A 1LEBA 1D5VA 3KEQA 1A04A 4HAMA 1REPC 1SVUA 4GEKA 3E7PA 2A5YB 4YG2F 5LR6A 1RJDA 1FC3A 2FF4A 5LBQA 4GC9A 3CUQC 1SFXA 3OE5A 1ORIA 2VS1A 1SAXA 1S7AA 5L3BA 3RYRA 1YF3A 2ONYA 2HKOA 5FADA 1I6XA 5HLIA 1RI7A 2EA2A 3O31A 3NTVA 1FBUA 1O3QA 2CWWA 2EJUA 4MHTA 1ZRCA 1R74A 3LA3A 3HP7A 5E8RA 2NP7A 2AS5F 1X3UA 4L5JA 4U7BA 3WSTA 4KVZA 2PI0A 2VE9A 2OPBA 4OQDA 2OB2A 2DPMA 2LDUA 3E5UA 4YIIA 3NRVA 4OMYA 2G70A 2NXEA 3FM3A 3BZ6A 1IN5A 1SFUA 2G71A 3JWHA 3UA4A 4M6YA 2FCAA 2VBXA 3PFHA 2ZBPA 4MNUA 4HH4A 3X0DA 3LAPA 5K1YA 2JPCA 3F8BA 3JTGA 2ADMA 3E6BA 2FMYA 5E17F 3LAJA 3TGNA 3Q7EA 4AZWA 2GXBA 2C7RA 4A2UA 3PQJA 1KP9A 3UJ7A 1SUIA 2H1RA 5MHTA 3AWIA 1FBSA 3M6UA 2OXTA 2STWA 2MA3A 3NEUA 4FT4A 5K5OA 2P5LC 2M45A 2PT9A 1E2XA 5EMMA 2FSWA 2PX4A 2FNPA 3DPTA 1W5SA 5B1SA 4QVKA 3T7SA 1JQ3A 1W7PD 3C6KA 1FWZA 3O6BB 1BBYA 4M74A 5E9QA 2A6HF 3CDHA 2P41A 1BJAA 3CJRA 3IRQA 3ANXA 2ERCA 1P6RA 3WTWC 3LKDA 2YX7A 1L3BA 2P1DA 1STZA 2YX4A 5HIMA 4FT8A 1JHHA 1SKMA 4LFUA 5FD6A 1EV7A 4N9HA 4EGYA 4P7FA 3TQSA 3IKVA 4P9UA 3GDHA 3MWMA 1HMYA 3UJ6A 3NW9A 1IRGA 4MTEA 3BJOA 4Y17A 3G2PA 1NW7A 4BYYA 2FRXA 3HHGA 5FB2A 2QQ9A 1OYWA 5DTQA 3DF8A 1MDMB 2QY6A 4PZJA 1J5YA 3NQOA 1KYWA 3MB5A 2UZ4A 4CDGA 3KQVA 4Q47A 1WXWA 3WGHA 3KR0A 2IDKA 3BY6A 2P3QA 3VC2A 3SMQA 5EPEA 3OU2A 1U6GA 4CWAA 2HMYB 1WRJA 3G3ZA 5BW4A 3KP2A 4BXUA 5K0GA 1IF1A 3HSEA 1P4AA 3TO7A 2F8LA 1OKRA 3U2RA 1DCTA 3G2OA 2VBYA 5DUIA 2OYRA 2D1VA 4M73A 4ER3A 3SZPA 4XUDA 5LHHA 2LKPA 1LEAA 3KLOA 4OOIA 3LCUA 3TR6A 4RB1A 4OIPF 1D8JA 2PKWA 5D4SA 2V1XA 2VDUE 3FXUA 1BOOA 4ESJA 1NHAA 2JJQA 3IWZA 1IN4A 5AIQA 1D8KA 1EH7A 3KZZA 2RC4A 1VQ1A 4R8RA 1XCVA 5EG5A 4LGWA 2ZVJA 2V74B 3E6CC 3GEZA 2OZVA 3O4FA 1WZNA 1T2KA 3SXYA 3KQWA 3F21A 3HYIA 1LVAA 5U4XA 2GA2A 4RB0A 1YQAA 4F86A 5FD5A 3A26A 3KR2A 1LQ1A 5BP7A 3D5LA 3L09A 2IP2A 3BGDA 1IAWA 3N97A 3MTIA 4K2EA 4G94A 5H02A 4UVCA 3DUWA 2BR5A 1Z1DA 2GA1A 4E2WA 5DCFA 5GM2A 3U81A 5DD8A 3GUDA 1N2XA 5LQCA 3A7EA 2KJCA 5A2QK 1XCLA 3SM3A 4C08A 2ZIGA 5E1XA 2HR3A 4ZH4F 5K0FA 3PT9A 1JGSA 1L3LA 1FOKA 2ONZA 4EKGA 3ZMTA 3VC1A 4RTRA 1JHFA 1Z05A 2AZTA 3NVMB 1MDMA 3TDZC 4BAYA 4PYNA 5FHQA 3I5UA 4UV9A 5C1IA 5EZQA 1ZG3A 4KT5C 5C0OE 4IXAA 5K0CA 2P7VB 2FE3A 5E8IA 2IGTA 4C04A 5HZMA 1TW3A 4X1OA 4DCMA 4PCQA 3GNLA 4DMGA 2L3DA 4HX7A 5CLSA 3QOXA 2UYQA 5DSTA 3TRKA 3QOWA 4P96A 2IA0A 5L3CA 3L00A 1D2HA 4OIRF 3DLIA 1MZBA 1X1CA 2O06A 4V0RA 1J9IA 4GOMD 5HIIA 3EYYA 2FK8A 1HQCA 3J80K 3KQOA 3R61A 5EIFA 3V7RA 1P1CA 4EMSA 3MQ0A 2ESRA 4K6MA 1YW9A 2QE6A 4ENNA 2P8TA 5T6BA 1JSZA 2ZW9A 5LQRA 3EPPA 3LQQA 2HWVA 1EH6A 1U5TA 2D1HA 3KPUA 4HF1A 2YVLA 4O5VA 4EJVA 4R05A 3KP5A 2RQPA 3JSOA 3M9AA 3LCVB 3MERA 4HQEA 5BMZA 4HV5A 4HGYA 3SXJA 1HW2A 1R8XA 2NS0A 3HCFA 1H1DA 3F6OA 2PQ8A 1V39A 5DM2A 2WK1A 2DBBA 3M8EA 2PMUA 1NE2A 4YV1A 5F2KA 3IYLW 4LWPA 1PDNC 3F8FA 3ZMUA 5HEKA 1XCBA 5HILA 4P7GA 5JHUA 2HDCA 3KCCA 4XSXF 2B2CA 1B42A 4Y30A 1TBXA 2IRFG 5FFXA 3QAHA 4QVGA 4UVBA 1UIRA 1XXLA 1OPCA 3HA3A 3KEOA 3OOPA 4KN4X 1Z9CA 4MEXF 4C4AA 3UJ8A 3FWEA 4L9VA 3GU3A 2P7CB 3UJCA 3CJNA 4EM2A 1FX7A 2VONA 1EJ6A 1YUBA 9MHTA 1NW8A 2PN6A 4MGRA 1JR4A 4DQ2A 3VSEA 4GGGA 2GZWA 3J80Z 3M6XA 2PT6A 3VEPA 4HDVA 4EKIA 1XDSA 3OU6A 1NW3A 1BM9A 4LK0F 2QBYB 5EHIA 4CXFA 3ABTA 4OU0A 3JAMZ 2V79A 4LG1A 2VC0A 1J75A 2HEOA 5FO5A 3GWZA 4ON0A 3BKXA 2R7DA 4ASNA 3UZUA 5BQTA 2F5CA 4CHUA 4KDPA 3WTXC 2XUBA 4QPNA 1XCJA 3ECOA 2PWPA 3ZQ7A 4Q4ZF 3B73A 3OZRA 3FUWA 1JG2A 2KJBA 2PFBA 4JQFA 5HLHA 3THRA 4E70A 2BV6A 1I5ZA 4C05A 1FBQA 2XYRA 4OBXA 3LX6A 3ERED 5EMKA 1FLIA 4PWYA 4PGHA 2O57A 3FTFA 2XAHA 3MFKA 1O57A 3AAFA 4I09A 5DXJA 4BHCA 2I7CA 2GA9A 5CD1A 2HQNA 4MTDA 5CYVA 5DUKA 3CO6C 4Q5SF 2EB7A 2B3TA 4GCVA 5FWDA 2TDXA 3QOPA 3LA2A 4YIFA 5GIOE 2KIUA 4ER6A 2IH4A 2Z6AA 1VP3A 2HZTA 5FCDA 2RNJA 4ZYHA 3TKAA 2ZWAA 3JWIA 4YUYA 5DX0A 2M5WA 4R1HA 2L54A 4PYMA 2PG4A 5LHGA 2AXLA 2W84A 4ZYDA 1BC8C 1TTYA 2QZ8A 4RTKA 4BHBA 1MJAA 3RYPA 5ERGB 4AIJA 1JTEA 1U2ZA 2JG3A 5BOXA 5F1RA 2AR0A 1K7AA 2ISYA 1XGOA 4LLGF 3R4KA 4HC4A 4ESBA 1KA8A 2XAGA 2GIVA 2FK7A 3G2QA 4PGGA 2ZIFA 3TOSA 2XVMA 3CGGA 4A0XA 4AD9A 5J8FA 3GW2A 2O07A 5FGMA 3ELDA 2DK8A 2LNBA 3PVCA 4R6XA 1YFHA 2EJTA 3EEOA 1M6YA 3HIFA 5HDKA 1CGPA 1TNSA 2P40A 4UVAA 3LA7A 1N7IA 1SQFA 3C0KA 1VL5A 4QLCU 3RIEA 4FHTA 1T6SA 1GHCA 4A6DA 5HOOA 4NHJA 1F4KA 5JI6A 4NB5A 3ELWA 4TV7A 3GRYA 2QM3A 3FUUA 5KVRA 2FXAA 2QVOA 3EEYA 4LK1F 1ODDA 1KU9A 5D5WB 3MZHA 3A27A 4BNCA 4ZZDA 2YR0A 2BM9A 2JRTA 3LGAA 3G8AA 2YUIA 3EETA 4C03A 2YTZA 3TM5A 3T8TA 4IPAA 3ORHA 1CF7B 1USTA 1YLFA 4HV6A 1KPIA 4RSRA 3M4XA 5FA5A 4L18B 2XYVA 1F3LA 4BP1A 5DD4A 3M6WA 5ERIA 3GIWA 4WXDA 2VP3A 4RTOA 3F8MA 1HNNA 2NYXA 4Y2HA 1EJ0A 1FP2A 2KIFA 4KUMA 1TQMA 2EFOA 5TJJA 2DPDA 1XTPA 1T98A 5JUWA 1ZREA 3DR5A 1H9GA 5LQAA 2C7PA 3F3XA 3HHHA 5M5BA 2ISZA 1B1BA 4OA5A 1G8SA 2A14A 1JXSA 4RVGA 4LMYA 1YW8A 3BWBA 1TQPA 1HSJA 2ZKZA 4S05A 3LDUA 3TFWA 3V8KA 3B5IA 1YS7A 2C6YA 1SQGA 2PX5A 3GFLA 1F5TA 1L9KA 5C9ZA 1ZGAA 3HCAA 2PXXA 2BE5F 3GCZA 3FMSA 2COMA 1ON2A 1SD4A 4G7HF 1RNLA 3KETA 3MEXA 2PGXA 2QQAA 3M6VA 1ONVA 2AOUA 5DDGA 4AZTA 4FR0A 1D2GA 3EVEA 2YR2A 3KFWX 2ZFUA 3J81Z 4PYQA 3PFIA 4MIKA 2WV0A 4PIMA 5D5XB 2GLUA 4EQQA 3QPHA 4LJZF 1I4WA 1IN7A 3BP8A 3FTEA 2NP6A 4MQ9F 2A61A 4KFCA 2L01A 2UYCA 4IF4A 4GYIA 4YUZA 2JHCA 3THSA 4KNYA 1MJFA 5DEQA 2P3LA 2YXEA 5K0NA 3G5TA 6PAXA 4FGZA 1U8RA 5KYGA 4L9NA 1DPUA 1L3IA 3ZP5A 3RTRA 3HRSA 5J8CA 1BHJA 4RGSA 3DXXA 1DUSA 3P2KA 3SSMA 4I01A 1P39A 5HS8A 2DT5A 4FX4A 2C7OA 4PIPA 2ETHA 2PSSA 3HCDA 2B9EA 4DM3A 5EHGA 1KQ8A 1VP9A 2LF8A 3GXOA 2QRVB 3DV8A 4PCLA 2OO3A 2QWWA 5EOVA 3COAC 1FBNA 4R6WA 5CVDA 1WY7A 1TQIA 2GH1A 3CJTA 1Z6TA 3IRRA 1WS6A 5F6FA 3FYCA 1OYIA 2HWKA 4EVIA 3KR9A 5E1ZB 1W7PA 2FMLA 4QWQA 4H0NA 3H3UA 3JW4A 4KMFA 3H92A 4M9ZA 1R1TA 3AJDA 2O6GE 3UBTA 2KW5A 2AVNA 4ZTBA 3KQQA 2I9KA 1XVAA 8MHTA 1PRYA 3AY0A 4P7KA 1BIBA 4ER0A 3P7NA 3R6SA 2FYTA 1O54A 3BWMA 4KWCA 3KE2A 1YO5C 3Q5FA 2YPRA 1SFEA 1OR8A 1ZLJA 1KPGA 2YX1A 2G8NA 3OPNA 5DM4A 4CZZA 3OE4A 3BUSA 4M7RA 4AZSA 3QP6A 3T0IA 4ISCA 1JSXA 4JBAA 1KPHA 5CVJA 4D0PA 3C3PA 1XSXA 4DKJA 3TM4A 3WTVC 1KGSA 5D8KB 3HRMA 3EVCA 4BH9A 2K7LA 3EVDA 2EWNA 3I71A 2RN7A 2B25A 3DLCA 2V9VA 2NYUA 2ZBQA 3CVOA 5H20A 3DMHA 5DYMA 3F8NA 4DNCA 3M7GA 2P7HA 3P9IA 2CGPA 4ER7A 1K79A 4O3MA 5CJ9A 2RVCA 3FPEA 1R1VA 4OBWA 3SHFA 4HSGA 2P4WA 5D8LB 1UHWA 1KQ9A 1IN8A 2PBIA 4UUVA 1ZH5A 1P91A 1LDDA 4EK9A 3K1MA 3QU6A 3E05A 3OV8A 1UB9A 10MHA 1BC5A 2H11A 2VDWA 2P5VA 4HDUA 1TNTA 2P3OA 2DTRA 1NV9A 2P6TA 2DQRA 2PEXA 3RIRA 2PVCA 2DQLA 3KQTA 3LDGA 4KMUX 3PFGA 3K6RA 3HNRA 1E17A 4YUXA 4LB6B 5HIJA 4BLVA 1B59A 3DOUA 1RI4A 3BJAA 2BH2A 2PWYA 2DW4A 5A2QZ 1KR5A 4HZFA 4YV0A 4C06A 2OBPA 2EG5A 3VFZA 1XN7A 5IKMA 3ZN1A 4G9YA 4AIHA 2BM8A 1ULYA 5HS9A 4PONA 5LGUA 1YS6A 2R7FA 3WTUC 2W85A 4CKCA 3EUHA 1RZ4A 1EQAA 4L5IA 2HTEA 5D5UB 2VE8A 4L0YB 3R0JA 1U5TB 2IPXA 4LD5A 3BXOA 1X1AA 3RODA 2OZUA 2XGXA 4F84A 3DXYA 1BN5A 3A7DA 1QPMA 1W5TA 3EQLF 3HVJA 1X19A 1IN6A 5HDNA 3GF2A 4GF5A 3VODA 3G7UA 4PYIA 3HTUA 3FUXA 1FYLA 4ETSA 4B17A 2M8EA 1AF7A 1H9TA 3G73A 2O03A 4KICA 5DLYA 5K5RA 3T8RA 1NW6A 3VOEA 3CTAA 5GINE 3MHTA 3E5XA 4WVLA 1GVJA 3RW9A 3E5QA 2VBWA 1Q0TA 4I2OA 4KIFA 3V97A 2AOXA 3BGIA 1YFLA 3NDJA 2HR1A 3MGGA 3GRZA 1Q0SA 2AS0A 3M1EA 5DCMA 4IV8A 2RV8A 2MH9A 1RI2A 4POOA 3R60A 3J81K 2ZLBA 3LL7A 4I02A 3G5LA 1AOYA 3IV6A 1ZYRF 4Z2YA 3TDUC 4RGRA 4G7OF 2L4AA 2QQBA 4ENMA 1RI1A 4L9TA 5CVVA 1QANA 3MAJA 3W6JB 3I58A 1LDKB 3ROUA 1GXQA 3FX3A 1JG1A 3ABUA 2Z6QA 5LQJA 1L3CA 2O3FA 4A0ZA 2IW5A 1U5TC 1ZGJA 1BI0A 2HKXA 1MD0A 2L4MA 3P9KA 4HLXA 2ZCJA 3ZMZA 2FA5A 3EYIA 1WWXA 2PBFA 1FYMA 2XAFA 5DV5A 1O9HA 1DDNA 5DXAA 3G89A 2Y1WA 5G02A 3AXSA 3DH0A 3F6VA 2XVAA 3MCZA 3HCEA 3B02A 4CICA 3C3WA 5LRSA 4XRFA 1R18A 1I1GA 2GS9A 2PXAA 2DULA 2DLLA 3OCJA 3BGVA 2Q8KA 5DX8A 4HTFB 3DXJF 4HX4A 3K0LA 4Y15A 1U2WA 4I0AA 2AOUB 2VOOA 3KP3A 3OU7A 5GP1A 3HSRA 5IT3A 5E9JA 4F7ZA 4R79A 5AONA 4ZZLA 2DFIA 3ZMDA 3QP5A 3DPLC 2DK5A 2XASA 1O3SA 1IM8A 1YZHA 2ZZNA 1DL5A 3K1NA 4LG0A 2NXJA 3MAGA 3I4PA 3KQYA 2J5PA 3FPGA 4RVDA 4RTLA 3SR4A 3T1BA 4OINF 4XUCA 3DMFA 2YU3A 1BI1A 1S3JA 4HQMA 3NMUF 4U0VA 2BBYA 3I0TA 3KZYA 4QPPA 5K03A 2O0LA 1OR7A 4RYLA 4OX9Y 4WF2A 3FPJA 4UXNA 2Y0MA 2BR3A 5F64A 3F22A 3QRFF 2CSOA 1R36A 1G6Q1 1VTNC 1T39A 1UFKA 4L9JA 5K05A 4KW7A 1U3EM 4MQVA 4G7ZF 2E1CA 5BW5A 1ZKDA 3EMBA 2NNNA 3HOTA 3ZPLA 5JFRA 3U9GA 2QUFA 4E30A 2MD5A 5FQNA 4LWOA 1PP8F 1RI3A 3F23A 3EVZA 5ILUA 3TO6A 1FY7A 3LWFA 3C18A 3GVAA 2C7QA 4X41A 4B09A 5EVJA 3UJBA 2UXNA 4G6DA 5DCMB 2D2WA 5EMJA 2OQGA 2VN2A 5E1MA 2HFHA 1D3YA 4KN7X 5ICCA 5EIWA 3JSPA 3WGGA 1QGPA 2QENA 1I1SA 3C3YA 4ESFA 2ZZKA 4Y13A 5E18F 2HYGD 4IV0A 2A6EF 2F5DA 2MBFA 2VT2A 3EGEA 1F1ZA 2FU4A 4OQEA 2V7EA 3EGVA 3OFJA 2OB1A 2Z99A 5EMLA 4RX1A 4DQ0A 2W24A 2I6GA 2IJLA
chains in the Genus database with same CATH superfamily
2P9TA 4HA8A 1QYVA 1B0AA 2H1SA 3PKZA 1P7VA 3FGOA 3K4MA 4M36A 4MWDA 4FS8A 2LIVA 4B3AA 3TCKA 5CEJA 3FXQA 2Q4DA 3WQQA 1B8OA 3NBUA 3PDCA 3Q8WA 3ZNNA 2ZSEA 4MWEA 2D8AA 4ZHQA 3FF5A 3WU1B 5MN5A 1A9ZA 1PVVA 1ZP6A 2XDWA 3BBLA 2H94A 4GXTA 3IESA 3KKEA 4UEKA 5IWAB 3WGUA 4CL8A 4DRXB 1YT5A 3H4IA 4IW3B 1EWYA 1J2XA 5GVSA 2XMCA 5CFOA 3L7LA 5EEHA 4MEYF 3ZMSA 1K68A 1CJSA 1W52X 1OBHA 3R5JA 3H9CA 2K4JA 2WC1A 4I9HA 4PX5A 3HDDA 3M33A 3INYA 4S1PA 2ASEA 4NE7A 4F8YA 4QULA 1NQTA 1S8FA 4D46A 6YASA 1SD5A 1SIUA 5LEKA 3PI7A 3HUTA 4PYLA 1WCIA 3BPVA 3LZDA 1NXWA 1AK9A 1L4HA 3NALA 1QHGA 2PLWA 2VTVA 3KAPA 3PU6A 1NY6A 4YPFA 4LHWA 4YLEA 3ZJVA 4WKBA 1R6UA 1HLVA 1JI8A 1O0SA 5FQOA 2OQRA 3JQ6A 2QL5A 1NQOA 4F3YA 2XT6A 3A1YA 2Z2IA 2O8VA 3P97A 4AVYA 3GTLJ 1VHDA 5EZYA 1I3LA 4V1CI 4XDGA 3OMYA 3TQCA 3PGMA 3UN1A 4IBOA 2XV4S 1JIJA 3BMCB 3F7OA 3UB3A 5JMWA 2OSBA 5FKMA 3HYSA 3B7PA 2CQNA 4FSDA 4WOJA 5FJ8J 1F0YA 3IDFA 1PLLA 4YP7A 3PLAE 3IQWA 2VWQA 3G7NA 1PJLA 4K9RA 1XGNA 3IMGA 3Q7QA 4KUEA 3CA8A 2KB0A 3F6YA 3P9NA 4JUAA 3CZ9A 2WA2A 3KV3O 4NP6A 1EK1A 1H2YA 1VTKA 4LXGA 1AWCA 2J5BA 1VSVA 4HBLA 1VSBA 2JZCA 3B1JA 3H2GA 3UJ9A 2XTZA 2HNKA 4G1MB 4QTTB 4CMEC 2FN8A 2WT8A 4TQAA 1PW7A 3RYIA 4EENA 5JYEA 4E5DA 3Q3SA 1QHHD 4RELA 4EHNA 4ZWNA 4MGEA 3ZI0A 3GPBA 1JQDA 4PCVA 3ESQA 2RGVA 1ADCA 4R1SA 4JYPA 2JH9A 2R5FA 1VIVA 4KLZA 1OPXA 4AJKA 4OFXA 1YW7A 2HF2A 1E9DA 3DE4X 4ZOAA 1HG0A 1T38A 4E4YA 4W1QA 4B31A 2ZMEC 1DELA 4MDYA 1FFXA 1P5FA 2V6JA 3C7CB 3GFGA 2OLEA 3L1VA 4EDFA 3ZKWB 4RD0A 1D5WA 3CMYA 1R4MA 4KFUA 4UV8A 1G0NA 5K45A 1FXSA 1HDZA 1C9DB 4WERA 5CCXA 2X4LA 1U2DA 1OIVA 2AN3A 2B9VA 2XGJA 2E5ZA 1WI3A 1NM5A 2DX7A 2PV7A 3DBIA 1KS2A 3MS7A 2Z09A 4J1NA 4QEZA 4TKMA 3S2FA 5J43A 2EOAA 3BX1A 5LSAA 2LR8A 3Q3EA 3KT8A 4QZVA 3MILA 2YZKA 1A4IA 3C5VA 3H1TA 1C7JA 3TPCA 2P9FA 3FSGD 5IANA 1YDMA 1NLZA 4K8RB 3V8RA 3LUGA 4GR4A 5D6FA 2EBFX 5FA6A 1CIPA 2G6TA 2Q1SA 5TQ2A 3RRNA 1EM8A 1K92A 4JA2A 1H0MA 1HDOA 2Y67A 5LYYA 4TVOA 2H1OA 5HTOA 4JV5B 2QRVA 3KYIB 3A3OA 1RAIA 2PLFA 4Y6LA 1IM2A 1QTRA 1T56A 3CLVA 3ZD8A 4YMVA 3S32A 1RLUA 3L6OO 3SQNA 4XCVA 2VN8A 1H6AA 3FM5A 1PUIA 5A5FA 5KPDA 3DHNA 2AW3A 5A3RA 4XKJA 4WADA 5F35A 3JQAD 5HBGA 3QYBA 1OCZH 5JAUA 5KNDD 1LBEA 2NZXA 4XD7A 5CXQA 3BROA 1VECA 2C4NA 2EL9A 3MIZA 2BKUA 2ZI7A 4K0RA 5KAMA 2VEOA 1CETA 2PWZA 4EHLA 2E55A 5IASA 2BFCB 4CIXA 2WYVA 1PJZA 4TYQA 1T95A 5LUAA 4B4OA 2MD0A 1IUOA 2X0IA 1R6AA 1ZR4A 4CCJA 4OEHA 3I6ZA 3NTUA 1HCRA 1S2LA 2QRJA 1XMKA 1V8PA 1B8IB 2W2QA 3AR9A 1DWUA 3FWPA 5TRDA 2I91A 2J6CA 1YIOA 3OEWA 2O7OA 2VZLA 5EKDA 3TL3A 4DMCA 1KMMA 3F6RA 3PDWA 4CMCA 2BZ1A 2B5OA 2BMEA 1JFRA 3MEQA 5CPFA 3WP0A 4DGSA 1YDHA 5ALIA 4X66B 3HBNA 2YMQA 3O84A 1HKQA 2G7HA 2HYJA 3LOUA 1YJ8A 5FLYA 5LBIA 3TRHA 4A2WA 4YRZA 2NSHA 4M1YA 2IF2A 4XLPF 1ISMA 2CKDA 1PJBA 2WM8A 4PYOA 1EB8A 1X77A 2F1HA 2GARA 3E81A 3FJYA 3M3YJ 2M6SA 1S3IA 3MS4A 5DIZA 4GS5A 3L1PA 3TVDA 1E8MA 1DBSA 1X13A 5CR9A 1RHUA 4AB1A 2AJ8A 4CKBA 4J2HA 1X80A 2CO5A 1KJJA 1ZX1A 2HJHA 3LGXA 1ZW6A 4Z1MA 2PLAA 4BEVA 3IP4B 4ERNA 2X5NA 1RXUA 1K06A 4H3KB 4RSGA 1Z4MA 4CEIB 2MC3A 1E79D 1TZKA 4KA4A 1PDVA 1U6JA 1PWEA 3ZGLA 5B5EC 3PFYA 5DNVA 5F1KA 3CKLA 4WOCA 1T36A 2QAGB 4RPLA 1KEPA 1KZYC 1RIOH 5ICFA 2YQ5A 3EIWA 4NE9A 2FEPA 4PR0A 2H27A 1SR8A 1WI9A 1M6NA 1QCDA 1YS9A 2IOHA 3BJ6A 1U3UA 1R5ID 3GLXA 1QNTA 3LDFA 3ET5A 4MRRA 2ABWA 4HGZA 1AQIA 1QYIA 1ZN8A 4JNKA 1I6HJ 3F9IA 5T4BA 2H4WA 1CUVA 3T1VA 1XVLA 3D6UA 4CH7A 1WJ5A 2JB9A 3CY6A 3HACA 5AVVA 1GTSA 1ZRSA 1R1UA 1FP7A 2D7CA 3U1KA 4XOUA 2C7BA 4ZK2A 5KHOC 1G21A 2FZVA 4FONA 3IMFA 5K7SA 3P9CA 3WNDA 1PV4A 3MW8A 4A92A 5EXSA 3O91A 1G42A 2GX6A 2IK8A 3TKYA 3ELUA 1U0FA 1UIMA 3ITKA 4JT8A 2JFVA 5JNLA 1WB9A 1JR3D 1UKCA 1YBHA 5B57C 4XN3A 1COWA 3DVAB 1AKQA 3RZOJ 1O5OA 1OQAA 4XLEA 3BERA 4JLUA 1RCFA 4BMOB 2P5SA 1Z8FA 2E1PA 5DWDA 1CJKC 2E5WA 2QZ9A 4K03A 3KZXA 1NN1A 2AN5A 3W7VA 4AY3A 1ZN2A 3V8JA 2BGCA 5LGTA 1ZFNA 3EB9A 1KH3A 4Z3DA 4HWSA 1L1EA 1GQOA 3E7XA 3T4EA 1KQ0A 3KWFA 3K35A 1YQWA 4DF3A 1G60A 1UPFA 4EF6A 1E2BA 4KR2A 3HKBA 3NWEA 1E5QA 2BOVA 5K0SA 1XEXA 2Q21A 2Y69H 3L0IB 2VHXA 5KAIC 4TL8A 2O8DA 2DWCA 4LLNA 2G88A 3LXMA 4TMVA 3G8YA 5LDGA 4BV8A 2Q0XA 1HBJA 2FR0A 2H5EA 3K7EA 2WD7B 2BVMA 5EZGA 3ZMVA 2ZRLA 3DQQA 2WVGA 3P8ZA 3PD7A 4DZPA 3C98A 5HJ5A 1X9HA 4RY2A 1IVSA 3LP5A 2G9UA 4F4DA 2H09A 3OECA 5JCJA 1XMJA 4NZMA 4D8XA 5FUBA 5CFNA 3THWA 1GSIA 2BGJA 4OP2A 4RJ2A 1BQEA 4YJFA 2UWMA 2HYFA 2D06A 1H1TA 2C2BA 4KSBA 4Y52J 2JAXA 5DM1A 3R5XA 4AIIA 1NAIA 3LKBA 5F1PA 1VE3A 2GTHA 5CLIA 5KOHB 2IYRA 2RGGA 1RR8C 5A7GA 1VE5A 4QM6A 4AUKA 4NV3A 2C9YA 4CNQA 3V4ZA 4RA9B 1DTEA 1VG1A 1RUNA 4G0YA 1JFLA 2C3YA 2PZEA 2VUIB 4UAVA 4LXTA 2EHJA 3DAPA 3NHRA 5F76A 2E18A 2DKFA 1C1DA 3RVRA 3SS8A 2C5AA 3J7AY 2X6YA 2FF5A 4I4CA 3IAAA 1MGTA 5H3CA 2HTJA 3F8SA 3MSCA 3VR3D 2OILA 3D0SA 1HE8B 2QV7A 5CUQA 4BGEA 4EHAA 4BVAA 3NJ4A 1AOXA 3CNBA 3IEVA 2CMPA 1Z28A 2FFJA 3I37X 1FB5A 1UZNA 2ID9A 1E7YA 4Y2TA 3ILYA 1KRWA 1T9AA 3I64A 3NRBA 4ADSG 4XWGA 3H5TA 5CDSA 2GJKA 1TO6A 5EXPA 3TOBA 2B21A 2J30A 3AQ4A 3DAOA 1WQ1R 1Z2NX 2VKVA 1Z39A 2RHHA 3VZCA 3IC5A 4I0WB 2O3UA 4PRZA 4EX7A 1J97A 1JEEA 2B2XA 3X43A 5A2QA 4B83A 1ITZA 2DPHA 2JW5A 3F9KA 3VPDA 5A4MS 2AZ4A 2CK3D 4XM2A 1ZARA 2WZQA 3FXOA 1K8RA 1II9A 4X63A 1E9AA 4J0GA 4NBSA 3GWGA 3RC2A 4LIVA 1Z7GA 2BBSA 2HLDD 4URYR 3EDYA 1R58A 4S04A 2IXEA 2UYYA 3AXTA 4CM4A 3ETNA 4AF6A 5ALPA 3ZRGA 2DBRA 5D1HA 1ZJYA 1BEUB 3E82A 4KXUA 1SXJE 4Q5IA 3WLAA 5AIPA 1CZRA 2FSGA 2H7YA 3UOWA 4C6TB 4WBNF 1UJ2A 1ZI6A 3TH5A 1EM6A 5EN4A 3OEYA 4LVNA 4EFLA 3GFJA 1WP4A 2GK3A 2HJ9A 2VOPA 3UHPA 1WSAA 2PX3A 2E37A 3BXEA 3R3HA 5ELMA 3HZZA 5HKOA 2VJNA 1FUIA 4MR8A 1GA4A 5BS6A 5FKJA 2K7ZA 1UPXA 1RLMA 3Q8LA 4NU5A 2E4VA 1GCAA 2R3SA 3CJRB 3GRPA 2MWMA 1DEHA 2ZJ6A 3NORA 4RC9A 4JYCA 3L05A 4IJ5A 4CMIA 1T1RA 2I76A 4NQZA 2JLUA 4UUSB 3WIOA 4QXPA 1DWOA 1RYEA 1OX6A 2J6IA 1O9GA 4EA6A 1SHTX 4ETIA 2PKYX 2V4JC 2JGIA 2GHTA 1QJCA 1VJRA 4RA6A 1P0PA 3H0KA 4CF3A 2O8FA 4D41A 4NFHA 2XCIA 2GOXB 1S8AA 2OENG 3OZXA 2Z6UA 2WJHA 4F3RA 4R1PA 1LQTA 4DABA 2AQKA 4O1MA 1IMOA 1H6BA 1N6NA 2WSSA 3K2QA 3C1AA 1RPJA 5JSFA 1Y4AE 2P4HX 3IKTA 1VQ7I 1O58A 3EBPA 3GDGA 4Y3OA 2C83A 4NNOA 4AWXB 1RYBA 1KY2A 2GCNA 1WDWB 4GLFA 1RWMA 4DT1A 1UM8A 2AOTA 1NOIA 3VX3A 1SKQA 2VDWB 1J00A 3PYLA 4KN6A 2AFIE 2FQ3A 1OX5A 2JL1A 2IV7A 1K6EA 3HZHA 4MW9A 3DXZA 3BOQA 1GA1A 2HFKA 4Q3NA 3ZN0A 4CFYA 1AQJA 4EUFA 2XW6A 1PSDA 1C7QA 4CIBA 4NYIQ 3WDLA 4CTKA 5IVHA 2AMJA 5GONA 3WIDA 4G8BA 1WJBA 4FQ5A 5JBQA 4DUZB 2HVRA 3P9YA 1DAKA 2EAUA 5C32A 1MO3A 3PXEA 3KJQA 3RKXA 1G2OA 3PZBA 5LUBA 2J46A 2UZ0A 1M0EA 1VE1A 3CLOA 2XDYA 1MORA 4NJOA 1K88A 3WKBA 2QA5A 5ESRA 5B4TA 3W8NA 1QHNA 2R85A 5HQ3B 2IPMA 1XAGA 2ECOA 1PGOA 2XSJC 3BGWA 2WE8A 1UJCA 2QMEA 3NXKA 4RK1A 1OR7C 2R6R1 1ZHOA 4F92B 3G2MA 2ZE5A 5FO0A 3SJZA 1RQLA 4MUHA 1OLUA 1ETKA 2W0SA 1G2PA 2V26A 3D0OA 3DKPA 3I9MA 4LHSA 4EJMA 2ZBVA 2HDDA 1Y6RA 4D9NA 1OJLA 1A5JA 3WGIA 4OFWA 3V7CA 4CV3A 4YHHB 2BFOA 1QO0D 1C3OB 1BO6A 2WU0A 3NGLA 4IMIB 5A06A 5B2FA 2R8EA 3ZK8A 3I6YA 5K3EA 4UCXA 4ALKA 2OO7A 2DFNA 5J9FA 2IHVA 3AT1A 4NG4A 1IJKA 3RBAA 1MCZA 4G24A 2JRCA 2CG4A 3V8BA 2UUAB 2VT7A 2DFTA 1E4YA 3NYRA 2NUPB 5F9MA 3TLGA 2VUUA 3LTEA 3NWSA 1W85A 2PX2A 4I99A 4BMNA 4N9QA 1Y5NA 3FGPA 1XALA 4EJTA 2BJWA 1G8KA 3IXLA 4RZQA 1ZXBA 4A27A 2O54A 1BS1A 3WAKA 2WHRA 5KDOA 2EV5A 1C4XA 1Z73A 1N78A 4MDEA 3WLRA 2HQOA 2VQ6A 4IUYA 4MWTA 2XLBA 3AWDA 2LRDA 2VQEB 4PCAA 2R7LA 3KPYA 5DOZA 4LOHA 1YB2A 5FULA 3H11B 3DEUA 1BWSA 2NZVG 2P35A 3NKFA 3RWOA 3U7QB 4ZVNA 3OZTA 3Q98A 4ZT3A 2OXIA 3PV0A 5ED4A 1PR9A 4C0BA 3UB2A 3RS7A 1XUOA 5K5QA 2GQQA 4D5FA 1AM4D 1ZU5A 3P27A 4DHEA 1M5RA 3NQ41 2WUEA 3C6MA 1ETYA 2VHQA 3O2QB 1DX6A 3FYTA 5F33A 4MUYA 4O2LA 1VZ3A 4AWBA 3NFRA 4TPKA 5IAAA 4JB3A 2ANCA 3E5HA 3OO1A 4L22A 4Y2RA 3DTVD 4MQ6A 5HRUA 2YV2A 3W5UA 1KR2A 3E6DA 1CDZA 1J06A 5BW6B 1YJ5A 1QS0B 2QGZA 2PYDA 4YMTA 2A07F 4TT3D 3LHDA 3KXPA 4LHXA 1U0HC 1HFKA 4XOIA 3EK2A 3ZV4A 1T9KA 1WZCA 3FYSA 1VPEA 4FBGA 2W25A 3DR3A 4GMFA 5EESA 4JL6A 3AGPA 4N3CA 2F48A 1B6SA 3K9TA 3A6DA 3I59A 4MKHA 4C87A 4O4IF 1WXIA 3VOBA 2LK2A 1V45E 4WXYB 4ARUA 5JEDA 4DG9A 1YU6A 1TVKB 1NN0A 1IG3A 1LK0A 3C2BA 3TLZA 2IWHA 5IJWA 3VJRA 2VL7A 3ND9A 2OKGA 3QEAZ 5KKCA 3GO4A 3V8QA 1X7XA 3BVPA 4H3HB 1TF7A 1GZ3A 1PG5A 1VPTA 1X80B 5EYPB 1NR5A 3JY6A 5EGOB 3G17A 5I7RA 2JA1A 3QVOA 2EFYA 3PP8A 2IUYA 1R4NB 5EE5B 5KTPA 4E0BA 5IBPA 3DAYA 4WNIA 1RPNA 2R8OA 1UQTA 4EY8A 4AKGA 1CY8A 4AROA 5BRJA 2XMGA 4B7AA 4P83A 4IS2A 4DNFA 5L7TA 3HZRA 2IBSA 3RYCA 5AKYA 3J7TA 2O8DB 5E3MA 3EJ6A 4B40A 1TPZA 1QMGA 2AYZA 3ZHRA 4YO7A 1FJXA 3EA0A 2R96A 5GY7A 1N2HA 5M5YJ 2C1ZA 3SVLA 1DJLA 3QX3A 2OCXA 3OM9A 5DI9A 2O9JA 4ER5A 2GFQA 1OH8A 3HP1A 4R9UC 3GGSA 5E1WA 1RLIA 3D2LA 4ND4A 3DM5A 2XECA 3GZNB 4HXFB 4PLTA 2H3EA 1O4VA 2X6QA 1SOMA 3WKAA 3WZ2A 2ZDQA 3X1DA 2AD1A 2Y0PA 3FIUA 4BO7A 2FEXA 2ES4A 2HLNA 2I0FA 2ENUA 4XLAA 1EU1A 4X92A 1WVGA 4D9CA 5FOXA 3UXEA 1W4CA 2A9OA 1MX1A 2ASVA 2ET6A 4ZVUA 4L1KA 1LNZA 2EPFA 4M1SA 2O2ZA 1XBTA 1IXCA 2NNYA 2W9XA 3ZDFA 4Q7QA 3U5ZB 2Y75A 1PHRA 5BSTA 3ZWCA 4CMGA 1F4LA 5JQGF 4IICA 2EZ4A 4C76A 3KZ1E 4N7RA 2EZHA 4NS4A 4TT8A 2V3CC 3K0KA 5JDCC 2FNAA 2VDMB 2W2TA 1J0XO 2ZAMA 4BU2A 3H2IA 4C7VA 3RTEA 5F51A 1L5VA 4ZIRB 3GGDA 3FRIA 1PV2A 2ZBRA 3CRQA 5IHXA 2G9WA 1Z4NA 2CUTA 3I5MA 2R5ZA 3K9CA 4IYRA 3B5EA 4DR5B 4C0AC 4Y7NJ 1D2EA 4HEJA 2G4CA 1SUDA 3Q11A 4CYCB 2R7ZJ 1OA0A 2PS0A 2BRUA 3BLYA 3CMAI 4C4ZA 3C3AA 4WZAB 5KJEA 4JGIA 3L7CA 2PYIA 2KS6A 4HWGA 4CKBB 3ZDDA 5K8UA 2ZR8A 2W5UA 4F7DA 1O7LA 4R8MA 3CIFA 4DB2A 2DY0A 5FPQA 3X1MA 3R7FA 1RBYA 1MQAA 3NJRA 2B82A 3V8LA 3W2AA 3WB2A 1N5DA 2H59A 4C5BA 2P69A 3IHUA 2PLYA 5KTTA 1GV0A 1HE3A 2RK4A 3VKGA 4IWNA 3AEUB 1VJ0A 4B79A 2FI1A 5LRRA 2KQUA 4RTNA 2VYFA 2FJUA 3EQZA 3PQ3A 1GRVA 2DBYA 4ZOQI 1QAOA 1Z47A 1KQGA 4UBMA 3ORYA 3TB6A 3WWEA 3GYBA 1YZQA 2XRZA 4PRYA 3S0JA 4MS3A 4A2QA 5I4BA 5IKPA 2XXAB 1B4AA 1LPBB 2FPMA 3TSCA 4HW0A 4C6SA 4F60A 1AKYA 3RSHA 1ENOA 2FZWA 1NBMD 1PCXA 4L4SA 1QP0A 2ISQA 1U2QA 3OZFA 1W5FA 4FEAA 3VOSA 2NU6B 2FQXA 4JQYA 1RI5A 3OJEA 2CXOA 2PZJA 3MRTA 3PB3A 5KUTA 2GEKA 1MNEA 3MM4A 2VQFB 5KTOA 1E4OA 1R9GA 1Z7BA 3S1MJ 4PG5A 2DR2A 3BMOA 3F72A 1RC1A 2F1OA 4U3JA 3LQFA 3K70B 1I2AA 2OCEA 5B7NA 4KYWA 2OD9A 1NDQA 2IYPA 2UXCB 4YFKF 2IEGA 4LQLA 3BG5A 3SYMA 3G68A 2SCUB 4BS9A 1CS4C 1G18A 3B6MA 3OHMA 1DCFA 4OLFA 4CE6A 2ZBEA 1JEQA 3HPRA 1VLMA 5J2TF 1K83J 2AEEA 1T0FC 1BIAA 2C9MA 2P5KA 1EH8A 3GMIA 3D59A 1KC1A 4FYMA 4LMRA 2ZUFA 3E4CA 1XPJA 4N12A 2JSCA 1A9SA 2AOWA 3IEXA 3MMSA 4WRRA 1QFXA 4CI9A 3OT5A 5AD1A 1XTTA 1P4RA 3IHWA 4QDJA 4YMGA 1BXRB 1B8VA 2CL5A 3GRAA 2VKTA 3ILHA 5TPWB 3WL4A 3FNRA 1IN1A 3FFAA 1WWKA 4FXOA 3I9FA 2AMYA 3TZQA 3CNEA 1ZM3A 2HTSA 4A3CJ 1ZD2P 2GDZA 5JT1A 3HR4A 3NGMA 1EBUA 3ZCPA 4AXBA 1SB9A 4OK6A 3CCFA 4X61A 3LSKA 3LY5A 3VNQA 4HQKA 4RKQA 4TSFA 3GTKJ 1KSJA 2RCYA 3E2PA 1BX1A 3Q2KA 2O50A 4I1RA 3WWDA 1CR1A 3AEKB 1ZMOA 4HDRB 3L8EA 2B7CA 3F90A 5CDFE 1Y80A 3C3XA 3OX3A 4FW9A 4RKWA 3SF8B 3TMAA 3HJNA 2HIGA 1QHFA 4URHA 1XDUA 4CL2A 2PUCA 3KQSA 5JS1A 2E5FA 1KQNA 1WDKA 1EFCA 4MLZA 1LB1B 1CF2O 1PW5A 4A82A 1U63A 4RL4A 3OTOB 1XJQA 1HZJA 2JIQA 3L0DA 5HCUA 1X39A 3NBMA 1MGOA 2VJCA 4O2BA 4X8LA 5AKKA 1G8XA 2JVHA 1D9ZA 1NPTO 4C6HA 5BWOA 2W82A 5B64A 4XR4A 2JEOA 3RS5A 1V9CA 2MYTA 4LV6A 2GXGA 1OFVA 4BBPA 5SZKB 5G4KA 3LS2A 4YCLA 3DFGA 4HI0E 6NULA 4BPBA 3S2IA 4LLLA 1ACIA 1E9BA 2VBCA 3BF8A 3HN6A 1ZUNB 3LBFA 1HPLA 2VC1A 3HFRA 1T8WA 3LX4A 5D5QA 3ZQQA 2JA5J 4UVIA 3C5EA 1G3UA 1G5FA 1GRQA 3I9V1 4JQZA 2E6KA 2GZDA 3IBFA 4Z9XA 4NR0A 2FH5B 2O2EA 2QTAA 4PYKA 5FBWB 5ICSA 5JFTA 1FLDA 3ZLJA 2MSCB 2QF7A 4IRGA 3MN1A 3P45A 1X3WB 4IH9A 2O61A 3H17A 5AHOA 5C5DA 1GDDA 1GRCA 4DSNA 5HP4A 4ZV4A 3OLXA 3LT4A 1QG2A 3C4JA 4JC5A 2WTEA 2B8EA 4LYHA 5F3DA 4IRMA 2IW3A 3S3MA 2VXDA 4AIKA 1FDUA 1QZTA 4FNOA 5H8WA 4PLFA 1LKXA 1J2JA 3L4EA 1U94A 1CNEA 5E9WA 2V0GA 2D45A 1AKVA 1D1PA 1Y5IA 1OAKA 3O7WA 4GYGA 1QYDA 1KZ4A 2IDJA 2QM8A 3F2IA 3K5HA 3NASA 3CSSA 4FCWA 3GRUA 4JQCA 3GFBA 5D3KA 3RS3A 5CFMA 5DNWA 3ZJTA 1T8PA 3ZCTA 4ND1A 4IJKA 4E5MA 3HRUA 2MTBA 5IJ0A 2FXVA 2OK7A 4KXWA 1RJFA 3K31A 1R3DA 3C5CA 3FLMA 1UDAA 3T5CA 3H05A 3T0YA 4IIDA 3VU9B 4BNDB 3ZD7A 4ZRMA 2QUAA 3PGLA 4N8DA 3T9AA 5AVWA 4KISA 1OB5A 3E70C 1TAQA 2C9BA 5BSWA 2NXNA 1UCRA 1GT0C 1O6ZA 3W5CA 2EWVA 3ACDA 3WADA 3DWFA 2J0UA 5AW7A 1B74A 3IIKA 2X5XA 5HUJA 4U7HA 4O4HA 2MSDB 3Q9VA 1JW9B 2BFFB 4U88A 1XZEA 2EV0A 3BSWA 2C29D 2DHDA 2G7UA 1YTYA 2R7SA 1KXZA 2Q1WA 3GLHB 3SYLA 3LY7A 4JP2A 3K1TA 1UC9A 3N6VA 3GZ5A 4PPQA 5JAHA 1EDDA 2PMHA 2LP4Y 2WAQA 2JKYA 1WUJS 2OORA 3JYPA 4FSXA 3QFTA 4GOND 4J07A 4DL9A 1RYMA 5EIEA 3CJQA 5GZ1A 4TT3A 3NBXX 4Z0NA 3RU7A 3W04A 4BFYA 5CA1A 3O8QA 5ALLA 2C2OA 1WJEA 2QYOA 2XAQA 2Z5UA 2ZRPA 4E6EA 1PQWA 2REBA 2X0LA 4UNOA 2ODAA 3OYFA 3CBQA 3F98A 3QXCA 5F52A 1T8SA 1YZGA 3RC3A 5J1RA 1I6MA 2PKXA 1G8YA 2WJIA 2X9LA 4GOOD 5FUWA 1OV6A 1TUEA 2WSIA 3IAHA 3PYXA 1NW9B 3LPAA 3A4YA 4Q9KA 3TEJA 5JZ9A 3H36A 2P0EA 2ZNYA 5FBKA 3F0CA 2EFDB 4J16A 3WRYA 2P2ZA 1KJWA 3FM9A 3MCVA 2Z1MA 4CCNA 1T1EA 2EFJA 3HGTA 1RR7A 1IHDA 2FN3A 3PXCX 5DM0A 4FISA 4BEHA 1PD1A 5B53A 1B93A 2XNDA 2Q3HA 4WLOA 3W6OA 5AVXA 3RS8A 1DBWA 1P7JA 3O3MB 2B94A 4RM3A 2C9DA 3AM5A 3L82B 3PRKE 2XTJA 1OMOA 4FFBB 3ZDXB 3GFMA 1JKXA 4O4JA 3KLNA 1PFWA 2VF5X 2Z83A 3CX4A 1XJWA 3G13A 4H7JA 3UY4A 4AS3A 1NJ6A 3OOSA 4XQ9A 2GEJA 2H29A 1HM5A 4PBSA 1D4AA 5TGZA 5AVZA 2G1UA 2WD8A 4EL5A 4G8CA 4YUWA 1YZUA 3X2FA 1WEHA 3U3MA 1GV2A 2II6A 3OOEA 4HEA6 1TTTA 4B9EA 1UHMA 3W79A 2XZLA 3U4DA 3RVBA 5JTUA 3CCJI 4EYKA 4BASA 4YJDA 1YIDA 3WBKA 2ECBA 2Q4BA 4TOIA 4UFPA 1WJCA 3TG2A 1XC5A 1HZZA 3GFTA 5HRCA 1ZH6A 2LUOA 1L4FA 2H1LA 4LSWA 3BIWA 2QJRA 5GPAA 1JRLA 1KF0A 1R88A 3LUBA 4LITA 4QWWA 1P1BA 1QOZA 2WVJA 3K6KA 1IIBA 3CLUD 1FDRA 1OZFA 2I4MA 3CC8A 3OCVA 1W88A 4GWGA 4RKYA 1ZONA 3O9VA 5HTKA 5FHRA 4JP1A 3RSFA 3SKVA 2OTCA 3TSAA 1D6MA 2NVOA 1ZRHA 4H9GA 4PC2A 5K3FB 2BDEA 3O74A 2HX1A 2RHDA 4HVLA 1SG6A 3G8DA 1IY1A 3L5KA 3O2PE 4KR9A 5K8LA 5BNFA 5E79C 1RJWA 4DVJA 5IYDJ 3V7NA 4EM0B 2O6HA 5AW5A 3MZYA 3AKYA 3U4AA 3W2VA 4AC9A 5LQKA 4U7FA 4R2JA 1KMNA 3MTQA 3E3LA 4OYYA 4M3FA 1P1JA 2XWPA 1U5BA 5ALFA 2CMDA 5SZJA 2WSSD 3JD4A 3KHKA 3SJBA 3TCXB 3UPTA 4FQGA 4WINA 4HLYA 2B35A 2L0XA 2JZYA 3HWWA 1KO8A 2ODQA 3KJEA 4W8HA 3TI9A 3D64A 4AP5A 1P1IA 2N8GA 3QFFA 1F3OA 1Z15A 2WG0A 4U00A 5I4CA 3H4VA 4Q1VA 2ZITA 2ZJBA 2FOXA 3I9V6 4F85A 1ZYUA 1BE0A 4A6EA 2JFOA 3FPFA 4F4FA 4LF8B 4L4YA 4RTMA 2CXXA 3H5LA 3UJDA 1QU3A 1FTTA 3HUGA 2I2CA 4CJXA 3E3VA 4ZQEA 4C7OB 1L4MA 3MJFA 3FYDA 5A62A 2QJTA 2WKPA 4BMZA 2FUNB 3G1OA 3K4PA 4JKIA 3DEJA 3NOXA 2QRPA 1LBQA 2VSYA 2X0KA 1U78A 1Q0LA 3BH7A 1M2FA 4OA8A 5EEGA 1QBJA 4G5RA 4RAQA 4O6VA 3WNBA 4JBGA 1WDMA 3OJXA 3IA2A 4ATNA 2Y1EA 3H75A 2CMHA 2D2XA 3O1JC 3UOGA 4DB4A 3WYDA 4BBAA 2HV9A 1CZNA 3MVPA 5HG0A 3WFJA 1YI1A 3WKDA 2OBFA 3WYEA 5JAIA 4S1TA 2P0WA 2ZS9A 3LA8A 1O3YA 5TMEA 4MQ4A 2VDRB 4KQXA 2YJNA 3KQKA 5C31A 4JR0A 2WG1A 5HSGA 3SJCA 1IXKA 1G20A 4HTAA 4Q3OA 5FUMA 5IMBA 4M38A 4UC0A 4XPZA 4MPDA 2UZKA 3U1DA 3UCEA 1VBFA 4AMVA 2C2WA 5KSOA 1UCFA 4JYAB 2C3MA 5JDIC 4MKRA 1WHUA 4WCGA 4BC1A 2VJMA 4I46A 4JJEA 3QU3A 4BKRA 4L27A 4AIRA 1GPKA 3FSRA 4XCXA 3EQ7A 2QPAA 1D09A 5FEUA 1B41A 3NIGB 2OR3A 4G89A 4LJLA 4G12A 4JUFA 4BIMA 4UPEA 4RPCA 2BRUC 3DPIA 1BXKA 2XMPA 1IYZA 1V4RA 2OV3A 3NHUA 3Q5EA 1C80A 2XRNA 1DTWA 1UDCA 2VVTA 2ZT7A 3PXXA 3HLKA 3R2JA 3PNLA 4MYSA 4RK5A 3UAVA 2FP4A 5DLDA 2JA7J 4EGSA 4OUDB 2Y1DA 3QPBA 4HVTA 2BM1A 2J07A 421PA 1DIBA 1TT5A 3P4XA 3ZV6A 4ZDJA 1SXGA 3KEQA 2W2LA 3LK6A 1U1CA 4MVYA 1SVUA 5EAIA 1VJDA 5ADHA 4NQRA 5KBYA 4MUAA 4E3ZA 3C3EA 2A5YB 3K0SA 3DFMA 5JLWA 1IG0A 1Z08A 1PIWA 2HNAA 1E6LA 3Q7IA 4QX6A 2HCFA 4YG2F 3H16A 3H13A 3M5PA 1TMOA 3QHPA 2G0TA 5ADUS 3EXIA 3OS2A 4IFTA 1FC3A 1ZAKA 3SE0A 4HEA1 3IV7A 1S96A 3TVYA 1E77A 1X8LA 2I78A 1VF9A 3SMVA 3UFXB 4RETA 4OQQA 1BR1A 3EXFA 5ARCA 3W3AA 4HYYA 1D5YA 2ZXFA 4NK4A 4XVRA 1JA9A 5LIPA 4C7OA 2VQGA 4P98A 2EFHB 4ARVA 2KLHA 4R7GA 5EXXA 5HK8A 2G04A 3WGJA 4CQMA 3RYRA 3UENA 1YF3A 4IJ6A 4EX6A 1F6BA 4CU2A 5C1DA 2G67A 3LT1A 4H7IA 3D2CA 4JZKA 2VP6A 1RXVA 1N1GA 1I6XA 2BGTA 2PMWB 2VJDA 5HLIA 4COKA 3T7KA 3OCXA 3MTBA 1RI7A 1ZUWA 2C2XA 4W5RA 1YQQA 1N1EA 3BXGA 4X64B 1V4NA 2V7WA 4OAQA 4XZ3A 2AG5A 1M2NA 3M9LA 3FMIA 3OD5A 1RQ2A 2C58A 1S2DA 1JSRA 1ULZA 3IQXA 1P75A 2JAQA 4MHTA 1GPBA 4XDHA 4LGMA 1BH6A 5DHAA 1OH6A 4ZZ3A 4GT1A 3NHLA 5KREA 4DYDA 1J23A 3L0YA 5F3RA 5ES4B 3CUSA 3ENNA 4NEGA 3CP2A 2VE9A 2PI0A 1DXYA 4OQDA 1MVNA 4AUEA 1OTYA 1J22A 1JWBB 3AUSA 1NLMA 4R0MA 5JI2E 2BMVA 5H5JA 5E6SB 3T4PA 3WJ2A 3K8QA 1F06A 4A8JB 3T94A 3MWEA 4NYJQ 4QHYA 1XZBA 3VI4B 1QZXA 4Y2SA 3G6WA 4TLEA 2G70A 1G7CA 2WUDA 3EGXB 5CK4A 4IO1A 1KO4A 3FM3A 1WJAA 4DBQA 3D7RA 4LCJA 1JJ6C 3FCUB 3NHBA 3NIDB 3WYNA 3G6EI 3L2OB 4Q24A 3N5KA 2CL7X 3ASNH 1TJ3A 1GZ6A 1NQUA 3H2ZA 4DIKA 2JKVA 3OTGA 3JWHA 2IU3A 3QIVA 4NUBA 1WD5A 2VBXA 3BMQB 3COWA 3PFHA 1WHSB 2ZBPA 3OQ6A 4I4TF 4OFZA 3T12A 4E03A 3W2EA 4X93A 1A6IA 1OCPA 1J9ZA 2Z8YA 4XICA 4P6VF 2HMSA 1T91A 3HI4A 3E6AA 5BYKA 3D0KA 5IRCD 2DLDA 2N1MA 4ZEXA 2ZJ3A 1E3SA 3NARA 3TGNA 2GN8A 4YT4A 3AILA 4AZWA 4UM9B 1UBOS 2HWWA 3T61A 3M1CA 4AY6A 3LSMA 4KQMA 1E9SA 4A2UA 2EBUA 1YZFA 3RANA 3V8MA 2JFZA 1M2EA 4Q1BA 4RJKA 4YJ3F 2ADFA 4DXDA 1REQA 4UB6C 5K0FA 3JAMA 1K7YA 3COYA 4CMBA 2BVLA 5FD8A 3S2DJ 3U4GA 3U7RA 5HNKA 1JA0A 2F6CA 3ZGYA 1NNI1 2WWHA 3JRNA 3QIAA 3KFLA 3ZQKA 4WE3A 1X7YA 5MHTA 4AL4A 3QPAA 3FTQA 2STWA 2K9SA 3BS4A 2MA3A 3NEUA 4FT4A 3EUFA 1DX4A 3TCNA 4FPXA 1S02A 1GG5A 2GBFA 1LI4A 2M45A 1Z0SA 1A9OA 2D0IA 4ND7A 2FSWA 1U0TA 1FRZA 2PX4A 2ZIWB 3DPTA 4LS3A 2AXTC 4XNFA 2PLRA 3FZEA 1AB5A 3Q8KA 2OORC 3G5MA 1ZJZA 3D1NI 1M2VB 3MN2A 1N0WA 1JQ3A 1W7PD 2AEMA 1YTLA 3GRKA 4PLYA 3ZWYA 2X2FA 1FS6A 2A1TR 2GN1A 2H9AA 2HEIA 2O1EA 3O6BB 4E7ZA 2E4ZA 4M0MA 4M74A 3GFVA 4RBNA 5CX1A 5E9QA 4DREA 1QRAA 3KHTA 4BDZA 2E1RA 4BNVA 2Z2KA 2BSQA 3LVBA 1NJ5A 3E03A 4D43A 2K9NA 1TKRA 3KQUA 1FSFA 3ZQIA 1E94E 1JAXA 5J5CA 2PSEA 5DGDA 1DC4A 3C4QA 2P1DA 4JFRA 2YX4A 4FETA 2MSLA 2Y4OA 3LLMA 1EESA 4NTZA 2XDQB 2NTEA 3AHDA 3HYNA 1JHHA 3PRJA 3PUFA 4JLPA 4LFUA 5FD6A 4GI3A 4REQA 1QC5A 5DU2A 1D0IA 4EA8A 3RCBA 4EGYA 2OUIA 1ISSA 3V1MA 3ZBQA 3TL2A 2VJAA 1NJ8A 4P9UA 4F38A 3ADDA 1I0IA 1XAJA 2ECCA 1ZL0A 3AGQA 1HMYA 1XZNA 1ZCZA 3P0JA 4TWRA 4XARA 4Q82A 5HMLA 1F9AA 3UJ6A 3HEBA 3NAQA 1VQ5I 1SANA 4MTEA 3OKCA 2ZSHA 1YZTA 2UKDA 1SHKA 3BJOA 4KBFA 1R6DA 5TJHA 4DLUA 1MMGA 3HXTA 4JU8A 3RE1A 1EXMA 2HSEA 2HU8A 3G2PA 3HB7A 3NC0C 3QVWA 3U7QA 1N2CB 2I54A 4LRQA 3RPUD 5D5HA 3ZLVA 3F8TA 5FB2A 2PU5A 4EF4A 4E08A 4G5XA 4FQ8A 2YQ4A 5EWLB 2QJWA 5FP0A 4HN9A 4ZCPA 1MJ5A 2BFAA 2X4DA 3UMVA 4PZJA 2EKZA 4RCYA 2EH3A 1ZK8A 3NQOA 3C85A 3PWTA 4FDTA 1KYWA 4H1UA 3MB5A 4OMDA 5L6LB 4PFOA 2EQ5A 4HZUA 4Q47A 4FCTA 1RMTA 4S24A 4BPRA 4BVLA 2ZVQX 3DOIA 5YASA 1K97A 3GBSA 3BY6A 3KQNA 4DNQA 4JX4A 5KCMA 3QX7A 2DMTA 2A57A 4N5HX 4XB2A 4AD8A 2B4QA 4JLVA 5TQJA 4J00A 2VG8A 3LSRA 1XSEA 1FP6A 1GFZA 2V6FA 1OZAA 1XN4A 3GVCA 2AI1A 4HH3C 5K4HA 2HMYB 4PLGA 4HPWA 5L7WA 4DR4B 5BW4A 3OL3A 4BB6A 3T1YB 3L8FA 1A76A 1E1MA 1VMAA 2QXTA 1XNGA 3N5CA 4HDAA 3CUVA 1U2GA 1YQUA 1GNRA 4KE7A 5BUSA 5KSWB 3THXA 5E0OA 1C3OA 1KI3A 1A3CA 1UZLA 2DYKA 2IP4A 1QVAA 1Z33A 1J2TA 4W99A 1MABA 3LPNA 2ROQA 1PD0A 3U2RA 4EYGA 4GP7A 1TF5A 5DNCA 1PTJA 1V95A 5DN6A 4I5FA 2X1CA 2JJYA 3QNWA 4IEIA 4XD7D 3T95A 2D1VA 2QS9A 3P94A 4ZCLA 4OI1A 1BSVA 4YRJA 2QTBA 4QPDA 1DTSA 1YE3A 4US0R 4ER3A 5I48A 1LEAA 4PANA 2H1KA 4XCQA 1LPAB 3KLOA 1H4VB 2CNWA 4FFVA 5BV8A 5D2CA 4OIPF 1G16A 3U21A 4G9GA 5A3VA 4F21A 2V1XA 1QG6A 2RHRA 3AQIA 3NETA 2Q3FA 2VDUE 3FXUA 1BOOA 2CZQA 2QSJA 4HWKA 4C4OA 3ZGXA 4W8OA 3N2GA 2WAYA 1VI6A 1O97D 1AA7A 2VQHA 1DC5A 2E85A 1LPOA 3DT9A 3IAS1 4WV3A 4B6EA 3KZZA 1JQJC 2JGFA 4YXWA 1VQ1A 1S1CA 2R1ZA 3GGPA 1K27A 4IS3A 4BLTA 4IINA 4R8RA 2GSDA 4F96A 5GAHJ 4B3FX 4LGWA 1LTQA 4I4NA 2ZJ4A 1AK1A 1T6NA 2YL2A 1W49A 2OZVA 4TKVA 5JE8A 3KQWA 3KL2A 1YQDA 4M7PA 1FVOA 2I87A 2WIDA 1UFQA 4AZ0A 1LVAA 2GA2A 2PAFA 1Y48E 2JVIA 4MV0A 3L02A 3CWCA 4BRUA 4EG4A 4B1FA 1VQOI 3DCFA 2JCGA 4XIDA 3F7NA 1XX6A 3KR2A 4O02B 3WLPA 1IEWA 1H05A 1N92A 2ZRDA 3L09A 2VBIA 3K4QA 4BMDA 2W6PA 3E9DA 3N97A 3FJ1A 3G6KA 4JELA 3VWBA 1IY0A 1Z5PA 3QF7A 1IG7A 4NHEA 1EX1A 4BDTA 4G94A 5DGHA 3L93A 4UVCA 5H02A 4YQEA 2W6ID 1IC8A 3EZNA 4IX7A 1KU6A 1GPDG 1T5BA 2A88A 2BR5A 2W4QA 1Z1DA 3JQBA 1NU6A 3Q3GE 4I81A 4GICA 3BIFA 2ZRGA 1L7NA 3M83A 1EWQA 2NU9A 4GDFA 1DBRA 4AKSA 5LQCA 2QV0A 1AVTA 1XCLA 5LP6B 2NTJA 4IQ8A 1SWWA 1E0SA 3QH4A 4L3OA 2J09A 3WQRA 4RU1A 4LDZA 3C15C 4Y1GA 3IP3A 5E1XA 2VHEA 3QWFA 1QVWA 4M0FA 3ZHUA 2HR3A 4WN9B 2B98A 3QU7A 3SI7A 4HRXA 4ZJYA 1BKDR 2O0JA 1T9ZA 3COZA 1ZXLA 1I2CA 3FR8A 3ES9A 3H6KA 4IEEA 4PBRA 2W6JD 1QCYA 3GAFA 4MAAA 5LZ5A 3ZHCA 1L8OA 1LSSA 2R6AA 5DCLA 3KPHA 3G9UA 4W8GA 3I5UA 4UV9A 2HXOA 1KEZA 2CHEA 4ZMBA 3PDUA 2DMQA 4UEJA 1GFSA 4RD4A 5K0CA 3GLFB 3HVRA 3ZIAA 2Y77A 5LC1A 4BVHA 1Z21A 5E8IA 2GVZC 3V3KA 3RKQA 1TW3A 1BW9B 1AT1A 3RAJA 1U0JA 2L3DA 2H1HA 4HX7A 2Q8QA 2YWJA 2Y0SN 5CLSA 4H6PA 4MXDA 5IYZF 2UYQA 3KYJB 4KPUB 3SK0A 3T34A 4A3MJ 4DKXA 5JDCA 4A3LJ 1F51E 4ODIA 3NPAA 4AJEA 3L00A 1D2HA 4OIRF 4K6KA 2PZAA 3CD6I 3UC9A 5KNCD 3HM5A 1JFFB 2XMBA 3AOGA 4Z51A 2W42A 2BMJA 4GVXA 1X1CA 1DG9A 1P9OA 1YACA 1VDZA 1OWOA 1T9BA 4IHJF 1G21B 1UWLA 1VSTA 1CZKA 3EYYA 4QE3A 1HQCA 3J80K 3K70C 3R61A 5CK5A 4PBTA 3F1LA 1XRRA 1P1CA 1P73A 1T4CB 4FFSA 2J0QA 2WF5A 3H9UA 1JHYA 4QTXA 3N53A 3K4CA 3PQ6A 2RGDA 5IDYA 5A6SB 5T6BA 5HVNA 2ZW9A 1AXGA 2DP4E 4DA9A 4ZYLA 1M2OA 4M1OA 5LQRA 1PR5A 4ZQCB 1BR4A 1U5TA 2X0DA 2D1HA 1Z83A 3CCUI 2I66A 2IE0A 1X15A 2PKRA 4LJ6A 3ZU4A 1IQPA 4CG2A 3KEGA 4TN1A 1XMOB 4JJZA 4OXYA 3DFFA 1TYBE 2O2YA 4E6PA 4QWMA 5KVSA 1DFIA 5LJIA 1PJ2A 4QUDA 4TXNA 3RVQA 1QE0A 5B55A 5BSVA 4WZBE 3DE2X 4QPCA 1E1QD 4YH1A 2B7EA 1KJIA 1YQEA 1KFBB 3GJ4A 4YJKA 5I01A 3LCVB 4CIAA 1HC7A 1K3TA 5I7AA 2I5UA 1KEWA 2BW3B 1NRJB 1Y98A 2C4HA 1E1YA 1T13A 2VDOB 3E1GA 2RBEA 2A0UA 4MVXA 4YDRA 4BBRJ 1R8JA 3SXJA 2GD2A 5IZCC 3OEHD 5JSZB 3FCSB 1QVVA 1COWD 3IH5A 1MO6A 4W5HA 3TNDA 5JJKA 4YDQA 1PO7A 1N7GA 3P0FA 4MS1B 4LEIA 3R5FA 3ANSA 2ZAIA 2CDCA 4ZQFA 5ITWA 1NE2A 1NP7A 4I55F 2R6DA 4ME6A 1GGJA 1TYZA 4QT0A 4S0XA 1SWVA 3IYLW 1JEYB 5I6DA 4LWPA 2AN9A 5KAPA 3UXMA 3QKRA 2JIOA 5HEKA 5A1TA 4PTZA 4CM5A 1GKIA 1PNOA 1MHPA 2O2JA 1CUYA 2B2CA 4B84A 1A7UA 1E6EA 2RKWA 1D1QA 1KRHA 3SICE 4A26A 4JBWA 5AKZA 4ZYZA 1NU8A 2XQFA 4UVBA 3FDZA 4CKWA 4JQSA 1F8GA 1KVUA 4X20B 2DC1A 1OPCA 2Q5LA 4RO0A 1YOBA 1W4AA 1QWOA 2V7GA 2NPFA 3SZRA 3COVA 1CVLA 1UQRA 3DZJA 1OXBB 3EXHC 1H8HD 3K1AB 1CZLA 5L3ZA 1JPVA 3B2NA 5LP6C 3JQCA 1LD3A 1Z9CA 3CEAA 2XA9A 4FFOA 4LAFA 4MV9A 2FZEA 2Z8XA 3MUFA 3GU3A 1OT3A 2ORYA 4V1CA 3GK3A 1S7EA 6REQB 3CJNA 4Q4JA 3FHNA 3QEMB 2EERA 3VVLA 5IM4F 1DFHA 1EJ6A 3WG7H 5K3SA 3HRIA 1EINA 4D4GA 4A1OA 4JI7B 3TRFA 3O2SB 3K9WA 4FUTA 3M1AA 3L7IA 3AX6A 4UBIA 4WZZA 4XTRA 1YRWA 5K99A 9MHTA 4CEIA 3JQ7A 3GGJA 4EVSA 1XRLA 3P2OA 4LZLA 2IYAA 3MD0A 2EW1A 4D82A 3KTAB 2F5VA 4ZOEA 3ANMA 2VNSA 4KXXA 4DUYB 4MGRA 2GRJA 4GGGA 3JARB 4DCOA 2PT6A 3N6XA 2FPXA 1XKTA 4LVOA 1R0RE 3K0AA 1Z6YA 2VAWA 5M5WJ 2UVPA 1NVXQ 2YVAA 2F1RA 3VC7A 3HB5X 1ECFA 1HQYE 3FGNA 3BR6A 3PQ5A 2VOJA 4G36A 3HA2A 4HH1A 1VRCA 4K6CA 5DGTA 5E7JA 2Q5EA 3ABTA 4OU0A 1JQAA 2QUZA 1MMAA 2Q1UA 3DEFA 3K0AB 1S2NA 4JMLA 4F3NA 3QVGB 4ENPA 1I1HA 1DKMA 1LEHA 5FO5A 5IP7J 4Z3OA 2VHVA 2YKGA 1JR2A 2PCLA 1NF2A 2R7DA 1YWGO 3BKXA 1MDBA 5JVDB 3GLGA 5F98A 1Q5PA 2OXFA 4XEHA 2CDAA 5L45A 1L9XA 1T2EA 2VTBB 5ALKA 3QYFA 3JW8A 1NY5A 1FFDA 5FPKA 3FFBA 4PZCA 1ISRA 1EH5A 2OHHA 1Y5MA 3PGVA 2NV2B 3MPUA 3ZQ7A 5JO9A 3B73A 1OXSC 3SDBA 1YMUA 2XC7A 1J0DA 2E7ZA 3FUWA 4M3GA 3M6MD 3QY9A 4X6LA 3D8BA 4YRNA 5B6JA 2GF2A 3NCTA 4C01A 2AFIB 2P4SA 1I5ZA 3WYCA 1YZVA 3H2KA 2EKDA 2XYRA 1OFCX 2JFUA 2PNJA 2WIAA 3IUSA 8LDHA 3RD5A 3N8KA 1JJAA 4ZTFA 1CJBA 2XSDC 1EFUA 2X1LA 3ASVA 2C5FA 3AB7A 1T26A 1IRXA 2TECE 4AP6A 2GDJA 2HDOA 2I7CA 2XZTA 2GA9A 5DXJA 4KR7A 1FJ2A 4LZJA 4MTDA 1OFTA 1Z2DA 3GN1A 2J3QA 5CYVA 3JZIA 1RPAA 3FNQA 4UU7A 3LXXA 2IAIA 4WPGA 4YA6A 2PS9A 3B78A 3EG9A 1JHRA 1M6WA 1MQ8B 3AERB 4BL5A 4AG5A 2MSYA 2UUBB 4AY2A 1R0ZA 2VDKB 4CR8A 3S1AB 2V7PA 4Q37A 5AI4A 5FWDA 3KFXA 2TDXA 1W1WA 2CNLA 1NGSA 1W2WB 2FFQA 2JI9A 2YWCA 3I9KA 3LA2A 4YIFA 4OKSA 3WSVA 4G5YA 2COKA 2VNAA 4KQJA 3OFSA 1R2QA 4FZJA 5CYOA 3T41A 1EVLA 3ZHBA 4DGWB 2ON6A 2AWOA 3K0CA 2Z6AA 1VP3A 2BCEA 2PDAA 4C0XA 2GKSA 3WIEA 5FCDA 2A4MA 4N41A 3B13B 4MJXA 1WGXA 2RNJA 2AQ8A 4IX1A 3I4CA 3H18A 3HKEA 2IGOA 5EP1A 2ODTX 1PS0A 1UDWA 2YHUA 3OEED 3JWIA 4YUYA 5DX0A 1TT7A 5B4UA 4ECEA 1JDSA 4OXQA 4MVJE 4ZZ2A 4BJ3A 5DM6F 4PYMA 1ZQ1A 1NVAA 2A9PA 2PG4A 3OM0A 2Z9DA 2AXLA 2W84A 2ZEJA 4MYRA 3IDAA 4ZVLA 3D3WA 4DV6B 2F3RA 3H5VA 2EX1A 5ERGB 3SC2B 4BBSJ