4PGGA

Caffeic acid o-methyltransferase from sorghum bicolor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
360
structure length
360
Chain Sequence
ATAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKALAAEEVVARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFDESVSTLVDVGGGIGATLHAITSHHSHIRGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVTTDAVPKAQGVFHVDMIMLAHNPGGRERYEREFRDLAKAAGFSGFKATYIYANAWAIEFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the Structure and Catalytic Mechanism of Sorghum bicolor Caffeic Acid O-Methyltransferase and the Structural Impact of Three brown midrib12 Mutations.
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 116
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.1.1.68: Caffeate O-methyltransferase.
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pggA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pggA02
1YYVA 3VFZA 1OYYA 1L3LA 4LD5A 3CLOA 4N9HA 3R0QA 4ZH4F 3H92A 4K2EA 3K1NA 3KP4A 3HNRA 2NXEA 4IRIA 5BW5A 4PIMA 1FYKA 4M71A 2JRTA 5BP7A 3DXYA 1R1TA 5E8GA 4O6JA 3BXOA 2E5WA 2IDKA 2Q0OA 3W6KB 1OPCA 4ESBA 2P3OA 3TR6A 5LGNA 4F85A 1QQIA 3G8AA 4FSXA 1KYWA 2A07F 2PX4A 5BMZA 2XVCA 3M6UA 4E2XA 2OQRA 3E5UA 1JG3A 3T0IA 4M9ZA 3BWYA 3HVIA 5GOZA 1NBHA 5H6QA 3R0AA 3COAC 4G6QA 4FX0A 2VE9A 5CVRA 2ZFUA 4GOOD 5K05A 2K86A 3NDJA 4YV2A 2AOUA 5CVJA 4DNCA 4RGXA 1ODDA 5K1YA 3P9IA 2DI3A 1Z9CA 3ID6C 2KIUA 4EJOA 2VDUE 5E8RA 3QPHA 5IT9K 4I0AA 1R58A 3SHFA 1YS7A 1M6EX 1OYWA 5LQUA 4RTRA 3MB5A 5FULA 2QY6A 1E2XA 4HRAA 4MTLA 2XHKA 3DXJF 2UZKA 5BOXA 3T7SA 1B9MA 5EEGA 4P7GA 1WKMA 1W4MA 4DCGA 2IA1A 4XUCA 3T0YA 4LJZF 3ZMUA 1H9TA 2P4WA 3UA4A 3ERED 1JR4A 4L9NA 3EVAA 2QQ9A 4HF0A 4GCVA 3IL2A 4CKBA 3HSRA 4IKPA 1G3TA 5C9ZA 1ZGJA 3S2WA 5BPIA 2PLWA 2JPBA 1DDNA 1BBYA 3ECHA 4IVNA 4IJAA 3IYLW 5IKMA 3PTAA 2XVMA 4P7KA 3HHHA 3FRHA 3EVEA 5KYGA 2H11A 4HF2A 3R61A 5EEHA 5TJJA 4FHTA 3PFGA 3BGDA 5FADA 2UYCA 5K0LA 2A5YB 3PT9A 3B5IA 3TM4A 2OBFA 1RZ4A 1VL5A 2EJTA 2YUIA 5T64A 4HGZA 5AIQA 4UHTA 3ISPA 4IPAA 2PT9A 1Q0SA 2EX4A 2EG5A 3P9KA 2V1DA 5DLYA 1ZQ9A 2OPBA 1N7JA 1O3QA 2HTSA 3WTZA 3HCEA 4EKIA 2PQ8A 4EJVA 4M7RA 2OZUA 2ESHA 2M8EA 3QRFF 3OU7A 3LA7A 1F3LA 2AOTB 2YVLA 3C6KA 1O7FA 2GA1A 1PDNC 3F6OA 4HX7A 3E6MA 1ZLKA 5E9WA 3E8SA 3SMQA 3O31A 3M8EA 5A2QK 3EVCA 1YF3A 2HEOA 5LQKA 3VOEA 1Q0TA 4B8XA 3C3WA 2ELHA 5EGSA 1XB4A 2O61A 4ZYEA 1TLHB 1I1SA 2ZTHA 3M8FA 2XRNA 4LB5A 3O6BB 5D5UB 4PCAA 3ZMVA 2ETHA 3GJYA 5EMKA 4XUDA 4UOEA 2DW4A 3I59A 5H20A 4OIPF 5CVEA 3DXXA 1UCRA 1ZHFA 1ZG1A 1VLMA 1K6OA 4RTLA 1P2FA 2DLLA 5FD5A 3NMUF 3ELUA 4U7PB 2NP7A 1XGSA 5L3EA 2P6SA 2XIGA 1IXRC 2FRHA 1WG8A 3IRQA 1E17A 3HIFA 3OV8A 4V0QA 2EFNA 1DCTA 1P4AA 2RV8A 4C06A 2VBYA 3WGHA 4QTTB 1J2XA 4HF1A 3OU2A 2AS0A 3GCZA 5DRTA 3M33A 2OU2A 3V8JA 4RTKA 2HQNA 2I62A 2BM9A 4ER3A 1LDDA 2C6YA 5KQRA 3P8ZA 5GWXA 4DKJA 2DPDA 3TOAA 3GVAA 6PAXA 3DMHA 3PB3A 4A2UA 3DPLC 2IGTA 4HDVA 4S04A 5DEQA 1UB9A 3HA5A 1K78B 5DD4A 4ISCA 1CF7B 4MHTA 4HV5A 2PJPA 3M6XA 4ATNA 1RJFA 5KVRA 3WE2A 1HXDA 2AN3A 1D2GA 3B7PA 2Q8KA 4PCLA 3VC1A 3C0KA 5EMJA 3CBGA 4GYIA 2KRFA 1QANA 2GLUA 3F8MA 1M6YA 4MEYF 1X1BA 2QRVA 4X60A 1FT9A 1OR7A 4GQBA 3EVZA 4IF4A 1VIDA 2FQ3A 3P2KA 5K5QA 3TDZC 5LGUA 2M45A 2P5LC 5BW4A 4XSXF 3V8LA 1PP8F 2CMHA 4BQAA 5EQJB 2HTEA 4HGYA 4ZYHA 2PVCA 3D2LA 1ON1A 4WVLA 2GZWA 3HYIA 1T39A 1T43A 2VBZA 1MGTA 3JSPA 1D5VA 1D2CA 4FP9A 1Y0UA 2LD4A 1BC8C 3FM5A 3LHDA 3HTXA 2L02A 4YMGA 1X1DA 3SSOA 2GB4A 3FX3A 2DQLA 4WCGA 2YXLA 5LBQA 1WRJA 2OYRA 5T6BA 1G3WA 4CWAA 3FPFA 2CFXA 4AX8A 4G7ZF 2PV0A 2Y48A 4UVCA 4PYOA 4PYNA 3R60A 3UJ9A 4CYDA 3LL7A 5DT2A 2N47A 3I5UA 4LB6B 2WC2A 4NQWA 2G70A 1QPMA 3LDUA 4KVZA 2VOPA 5K5RA 2NNNA 2EFOA 3ME5A 3HVKA 4OU0A 4RVFA 2O3FA 4EJTA 4HBLA 1K7AA 4G94A 3UWPA 4C03A 3L2CA 5KS2A 2OQGA 2JH9A 4GUAA 4OX9Y 4HSGA 3EYYA 3MTIA 1X1CA 3AXSA 4YUVA 2R3SA 1NT2A 1IW7F 5HDNA 1YUBA 1FYMA 1IN7A 3SQNA 1SFUA 4G7OF 3GFLA 3QU6A 5GM2A 2X4HA 1LNWA 1XCJA 5EKXA 4HQEA 1H0MA 1F1ZA 4QLCU 3KQSA 2AXLA 3KR1A 3MGGA 1LQ1A 3PX3A 2B2CA 5LHGA 4E31A 3CUOA 2Y1WA 2P7CB 2ORED 1JHFA 1EAMA 4I01A 4X61A 2DK8A 2NXCA 3VODA 1H1DA 5E20A 1L3CA 5DWQA 3M9AA 2P5VA 2FU4A 3PQKA 2K02A 3G2MA 3L9FA 4Q47A 4EK9A 2C7PA 3LKZA 2ZCJA 3DTNA 2FOKA 2GS9A 1KQ0A 2I7CA 2UWMA 2HQRA 3DUWA 1FSHA 2OA4A 2HYFA 3L7WA 2H1RA 4MNUA 4LG0A 2OY0A 4FZVA 3I59B 2IJLA 2KJCA 2ZZKA 3E05A 2ZFWA 2BV6A 4Y17A 3QP5A 3MAJA 3QOXA 2XV4S 2PX2A 1TQMA 2DPUA 1YZ3A 2Z6AA 5LQAA 5GIPE 4Y15A 3KE2A 1PUEE 2F5FA 3BUSA 3PVCA 5HDGA 1BI1A 4WXDA 3SX0A 4KRGA 3EEOA 3U9GA 4R6XA 4M73A 4ZYDA 5LEJA 4AD9A 4LK1F 3GO4A 5E2BA 2ZNYA 1IF1A 4HW0A 2XYRA 1TNTA 5B1SA 3GU3A 2HOEA 4YFNF 2O07A 4OA5A 4P9FA 3LSTA 4IV0A 5DTQA 2RDPA 4AUKA 3A26A 3BP8A 2HZTA 5E9JA 5HVQC 2AOWA 4M9XA 1FBSA 3FTCA 3BPVA 3MQ2A 4GC9A 2XYVA 5K0FA 2AOTA 4U0WA 4FT8A 3R9XB 1ONVA 4U7TB 5CVIA 2V1XA 3EMDA 2YU3A 1IXKA 2ESNA 2FK7A 4BLWA 1X3UA 2VC0A 3EVGA 4O29A 5HLIA 1W7PD 4CKEA 1BIAA 2L01A 5FB2A 1CF7A 1HQCA 3NWBA 4V0RA 1C0WA 5K0CA 2FF4A 3MZYA 4QVKA 4DMGA 2RKHA 2CYYA 5FA5A 1BN5A 3HSFA 1GXQA 3A25A 4HZFA 4CXFA 1QYRA 5L3CA 2BE5F 2DTRA 1EQAA 4M37A 1WS6A 4MIKA 4XSZF 4M9SA 4OQEA 2K27A 4JXJA 1MDMA 3Q7EA 3DMFA 2I9KA 3EVDA 1R23A 1YFLA 1SKMA 4DQ2A 1KQ9A 5F2OA 2IP2A 1P39A 3MTEA 1NHAA 4E30A 4KMUX 1FBNA 1KIAA 1J9IA 4FGZA 4HA8A 3DULA 2HDCA 4LLNA 2J5PA 2VDVE 4RGRA 4AIJA 3WODF 3TKAA 2OAZA 5KK1A 4QQNA 1HSJA 4U7DA 2W25A 1HW2A 1IRGA 4RAYA 2PI0A 1HW5A 3WTXC 4QPNA 5C0OE 1ZG5A 1D3YA 3OE4A 3PFHA 5FQOA 1DUSA 9MHTA 4X41A 5DYMA 3OU6A 2A14A 2EA4A 4EM0B 1Q1HA 3CTAA 4R79A 2JHPA 5HIKA 1RIOH 5DCFA 4H0EA 3WGGA 2OXTA 2W57A 4PYLA 3LQRA 1AF7A 1IUYA 5JHUA 2FMYA 3QP6A 3CDHA 2ZKZA 5H02A 3HUGA 4OMYA 4KT5C 1NV8A 2FPOA 3UFBA 1BC5A 1Z05A 1BOOA 3PS9A 4E70A 4BLVA 1XDUA 3G88A 4FT2A 3BGVA 2LF7A 1BHJA 2UZ4A 5CYVA 5FFXA 2O6GE 2FMLA 4MTEA 3H3ZA 2E1CA 1FY7A 3EEYA 4CKCA 4L9TA 1OR8A 4FS8A 1B1BA 2MC3A 3E5XA 2XKOA 3EGVA 5F2NA 2JSCA 1RJGA 2ZZNA 4E33A 3GFIA 2FRXA 2IBTA 4YFKF 5D6FA 3UJAA 3KP6A 3E3VA 1G6Q1 5ILSA 2O57A 2PWYA 5TRDA 2VC1A 2OD5A 1K78A 1NW7A 2QBYA 3BT7A 2WTEA 1VQ1A 5HOOA 3HVJA 4RWZA 5HZMA 1YG2A 4C05A 5D4RA 3O7WA 3GF2A 4RTJA 1XVAA 4GF5A 1A04A 4L18B 1GHCA 4HAMA 1FNNA 1D8JA 1KU7A 3ZN1A 5LLQA 4ER0A 1P91A 4PZJA 4B09A 2P7HA 3P71T 3EYIA 3KQPA 1UFMA 1HKSA 5FO5A 1J5YA 5L3GA 3WTYC 4XRFA 1H9GA 3KPJA 1DPUA 1ZARA 1R5GA 5FLXK 5DXAA 2D1HA 2QYOA 1JGSA 3THSA 3IHTA 4KN7X 3ABUA 2VOOA 4G8XA 1N7IA 3KQYA 2HV9A 4JK1X 3LCCA 3LA2A 2V74B 4BYYA 4E32A 5GIOE 4AWXB 3KCCA 5EG5A 4X63A 2A3SA 5DM1A 5FQNA 2P3QA 3V97A 4A12A 3KPUA 3HA3A 3SVZA 4E2YA 2ZLBA 4R8RA 3BZBA 3ERCA 2CWWA 1F5TA 4XBFA 3R4KA 4WF2A 3ZMZA 4RGSA 4MQVA 3C3YA 2NNWB 2EJRA 1D8KA 3QU3A 5D5VB 1YO5C 1DUXC 3I54A 3DV8A 1RUOA 5D1NA 2P35A 4HLYA 3EVFA 4WWCA 5IT9Z 1LB2A 1VBFA 3R3HA 3QOPA 4I98B 3SXJA 2CMGA 3BOQA 4YIFA 1V3FA 3BZ6A 2NXJA 5EPEA 4QDKA 2A69F 4EQZA 3JAMZ 3G5TA 1EH7A 2W84A 3JWIA 4I0BA 1HW1A 1KP9A 2VN2A 3RPQA 2AOXA 2CGPA 5EKUA 2L4MA 5EVJA 3DP7A 3SZPA 1VPTA 2VZ9A 3S68A 2K7LA 3T7TA 5E9QA 4CICA 3FHZA 1G3YA 5ICGA 4LG0B 3KPYA 5CUQA 4A0XA 3DLIA 4EMSA 1LDKB 2HFHA 1BM9A 4RB1A 2FYTA 2CG4A 1SD7A 1J0RA 4ENMA 4CTJA 4B17A 1S29A 3CUQA 5DX8A 2W85A 2JT1A 2ZXJA 3T8TA 3FM3A 2YQZA 4Y30A 5P8WA 2PSSA 2ONYA 1XDSA 2HMYB 1TNSA 1JG4A 5LQNA 2YX7A 2XAGA 2HWKA 5E18F 3BROA 3EPPA 1LVAA 3SM3A 4ER6A 3B3GA 4RS8A 4RVHA 4PYIA 1IN5A 3ROUA 3WTUC 3MZHA 2DBBA 5CCXA 3AWIA 1LDJA 2NP6A 2BEOA 5BXYA 3BJAA 3NRVA 1B42A 4BY9E 2DO7A 3HOTA 2ISZA 1SFXA 1RI1A 3P2EA 3RPUA 3K0LA 2AVNA 4M38A 4R1HA 2D45A 4KDRA 4EJUA 3THRA 4EKGA 1G8SA 4G7HF 2JPCA 5DTRA 3LGAA 5DM4A 1FC3A 4M6XA 2IIPA 3CJNA 1ZH5A 1X1AA 1KGSA 3GZ6A 3M6VA 4RVDA 2GXBA 4UVBA 5FFZA 1OYIA 4ENJA 2ZIFA 1RI5A 3T5XA 4RX1A 2MLGA 3JWHA 3M4XA 2C7RA 3HM2A 3OZRA 5F2KA 5DD8A 2BBYA 4Q5SF 1AQJA 1BJAA 3SXYA 3KZZA 4AIHA 3DFGA 2RQPA 5LHHA 3ZMSA 3TKYA 3E23A 3RKXA 2XUBA 5ICEA 3GRZA 4JBAA 3F8BA 1J75A 3R24A 1FX7A 4QWQA 2GWRA 3KLNA 2VT3A 4DZRA 1I9GA 3ELKA 5FCDA 2P41A 4ETSA 1XXLA 1QO0D 3KKZA 2A61A 3HRSA 1TW2A 2WK1A 3O2PE 5CVDA 2MH2A 2Z33A 3FZVA 1O9HA 2GA9A 4DF3A 1XMKA 5D5XB 2PWPA 3ER8A 3KHKA 2H6CA 3MHTA 2Y75A 2QBYB 4ZZLA 3RJPA 4L0YB 2AN5A 1G4DA 3M7GA 1Z7UA 1NW8A 2ZULA 5DX0A 4M36A 3GRYA 3DR5A 4GC5A 2OO3A 4RTPA 5LEKA 1HMYA 4K6MA 1BC7C 2XAJA 1YTYA 4RTQA 5E1WA 2GIVA 3GGDA 2O05A 3E6BA 1IN4A 5EHGA 5ILUA 1G6NA 2EFQA 3JTHA 3K2ZA 2GAFA 3OFJA 5EMMA 1WSUA 4EVIA 4LK0F 3G3ZA 4ZZDA 4PYMA 4QPPA 2QE6A 5ERIA 4C04A 1SAXA 5FWDA 4TV7A 2CL5A 3IKVA 4CTKA 5LHIA 1QAOA 3I71A 4RTNA 1W7PA 2PLYA 3ZP5A 4GGGA 1R36A 4MWZA 3SSMA 1LJ9A 2CQKA 1RI2A 2IH4A 3TLJA 5JR3A 3PFIA 1RJEA 2Z99A 3IRRA 3HCFA 1Z6RA 2ESRA 4ASNA 3DH0A 1FLIA 2PG4A 3KEOA 1FZPB 3GUDA 4QTUB 4KUMA 2P7VB 4IRGA 3GFMA 4CZZA 3N97A 4CXMA 4MQ4A 2UYQA 1IN6A 1XGOA 3Q5FA 3L8DA 2ZZMA 4BP3A 3KFWX 3FYDA 2B25A 5LRSA 2GQQA 2EJUA 3GFJA 3LBFA 4L7VA 3KQMA 2ACJA 1IXCA 3B73A 4ZYGA 4YUXA 2NNYA 1O57A 2EB7A 1UHWA 3IKTA 2JHAA 3WSTA 5HS8A 2VBXA 4KFCA 2OZVA 2O03A 5LQRA 2MLKA 5HIMA 2EV6A 1N2XA 2AOUB 1QGPA 4RAZA 3TO6A 4OINF 2GH1A 5F1RA 3KPWA 1U5TB 3I0TA 3GRUA 4LGWA 2MA3A 5J8CA 3A7DA 3WTWC 4IV8A 1USTA 1Z6TA 3FMQA 4UXNA 2KKOA 4ER7A 2WWYA 2AN4A 2RVCA 5HILA 3FTDA 2K4BA 2V1UA 4N9IA 4MGRA 1AOYA 5LRRA 4FX4A 4RB0A 2ZNZA 2G71A 3F6VA 1I27A 2O8XA 4EQQA 2K4MA 5HS7A 1S7OA 5H6RA 3FXRA 5EMLA 1U8RA 4HTFB 3RDIA 5K0BA 3KP5A 2HWVA 4N0BA 1OKRA 3P7NA 1XN7A 3FUWA 3AXTA 2PKWA 3NVKI 3GIWA 3HCDA 3TRKA 2P6TA 3G5LA 3ML6A 5FA8A 5FHRA 2YPRA 2DFIA 4YG2F 3CO7C 4AZVA 4F86A 3W6JB 1SMYF 1S6LA 1KHHA 2QWWA 3F8FA 3A7EA 1R1UA 3HSEA 4XLNF 2EK5A 5IT3A 3F21A 1QBJA 3GLXA 4RGUA 5K0GA 4OBWA 1T38A 1ZRDA 5DXJA 5T67A 1G38A 3FYCA 3REOA 4LG1A 3B02A 3OFKA 2CWEA 1AV6A 3KZYA 4A0YA 4FR0A 5FWAA 3MWMA 2O0YA 5BQTA 2GPYA 3IC7A 4G56A 3QV2A 1YB2A 5CVVA 3AAFA 4GO1A 1O9GA 3TOSA 3RW9A 3L09A 4I7HA 2YX4A 2DK5A 1XCLA 2IFTA 3U2RA 5K03A 2BM8A 2OB1A 5EZSA 2NRAC 5EZQA 3F23A 1HNNA 5FTWA 3TMAA 3VB2A 1J7KA 3CVOA 5ICFA 2FNAA 3G89A 3IV6A 4RSRA 2G72A 3I53A 2YR2A 3CC8A 4KNYA 3GW2A 4U7BA 5K09A 1RNLA 3FTEA 2B3TA 3KU1A 4ENNA 3OE5A 4F7ZA 3CGGA 1L9KA 4UNOA 3NTVA 1BOAA 3FRIA 1BI3A 4KWCA 5DUIA 5HLGA 3RODA 1KPHA 1RI3A 3UZUA 2EFWA 4P5OA 3K9TA 5HLHA 3B89A 2QQAA 3NEUA 1FBQA 2EV0A 2OBPA 4KA4A 1REPC 3LCVB 4YUYA 4YUWA 1T98A 2P3LA 1FWZA 2E1NA 4O5VA 4BP1A 2FCAA 4OMZA 2ZMEA 2A6HF 3UJBA 3KQTA 2F5EA 1M0EA 3V4GA 1SQFA 5HOQA 2EWNA 3HCCA 1AWCA 3RYRA 3GXOA 2OZ6A 2ZBKA 1QAQA 5DX1A 1IAWA 2IW5A 4LWOA 3FMRA 2HYGD 3RYPA 1R8XA 1EH8A 3HHGA 2FE3A 1WXXA 2J5OA 4YV0A 4MEXF 1G3SA 4HLXA 3HRTA 4GOMD 3EQLF 5E1ZB 3AJDA 2WV0A 3F3XA 3KQQA 1SD4A 4CHUA 1BI2A 5M5BA 1QZYA 1Z1DA 2XROA 2AOVA 2PFBA 3FUUA 4OOIA 2NS0A 1MDMB 1JSXA 2L4AA 2QZ8A 1U3EM 3F72A 2Z6QA 2XBMA 5K0EA 3CUQB 3E6CC 2BR4A 3VYWA 2IBSA 3DOUA 2VE8A 2NYUA 4IRHA 8MHTA 5BS6A 5K0NA 5AONA 5JVTA 1MKMA 1NV9A 5LQJA 1IXSB 4A5MA 1J59A 1FJXA 2BYVE 1L3BA 3SGLA 1YIOA 1O3TA 4CDGA 1U2ZA 2UYHA 4L0ZB 1OMIA 4ER5A 4KIBA 4GBED 4Y2HA 1RI7A 1IZ1A 5CVUA 4KN4X 2M1BA 2Z9OA 3RIRA 3CJRA 3FPHA 3CO6C 1XD7A 3E97A 2WA1A 1LEBA 4PCQA 5DUKA 1YW9A 3KR0A 3EVBA 4PYQA 3OZSA 7MHTA 1G55A 2LF8A 1I1NA 5CLSA 1U6GA 3FTFA 4XCXA 3SR4A 3K69A 1B6AA 5DV5A 3JSOA 2IA2A 3BWBA 4A6EA 2LKPA 1K79A 2G7HA 3PQJA 2JTVA 1HSTA 3ELYA 5F64A 5KQSA 4RB3C 2QUFA 4OQDA 1U2WA 3R6TA 1KXZA 4BH9A 4NHJA 4MTDA 1WWXA 5E2AA 4HDUA 3IHUA 5D6EA 4DQ0A 5JUWA 2IPQX 1EH6A 3Q9VA 1JTFA 2XAFA 4IWNA 1X19A 2E7XA 5DDGA 5J8FA 1KQ8A 2V79A 3TO9A 3KQWA 1JXSA 1EG2A 5ICCA 4HC4A 1I6XA 3MCTA 1NKVA 3UA3A 2XASA 4PWYA 5LSAA 2FBKA 1FBUA 1XSDA 3FMSA 2FXAA 4Y13A 5FGMA 2STWA 3MAGA 1IM8A 1KU2A 3K6RA 4RV9A 1YW8A 2QENA 2CSOA 2BH2A 1BKYA 2VXZA 1MJBA 5EIFA 3CCFA 3DLCA 4HX4A 1ZN2A 3T1BA 3BKWA 2PMUA 2VT2A 5EIWA 3CKKA 2P5KA 4BHPA 1VP9A 2TDXA 2DAOA 1UWVA 4PINA 3LAPA 4ESJA 1U78A 3J81Z 3BWGA 4GOND 2R7DA 2V9VA 4PNEA 5HIIA 3BPXA 1W5SA 3WU0A 1L1EA 3U81A 1Z3CA 1SQGA 3LDFA 4LECA 3QAHA 1P1BA 3U1DA 2H6BA 3DQVC 4IHTA 5GP1A 4YV1A 4PONA 3V8VA 4YFXF 3VEPA 5D5WB 4LLGF 4D0PA 2ZIEA 1S3JA 1FPQA 2E7WA 3F22A 4DA4A 3HA7A 1W7PB 3BY6A 1AQIA 1XCBA 3P2IA 2P1DA 1XGMA 3DPTA 3TOBA 2AVDA 1R1VA 3LA3A 4PGHA 4BAYA 3CUQC 2XKPA 2M87A 4WXHA 1UFKA 1V39A 3UJ8A 3KLOA 2PXXA 3LQQA 2IH2A 1YZHA 1DP7P 2ZWVA 5L3BA 1HKTA 5ERGB 1HKQA 3I9FA 2HNKA 3KP2A 3EMBA 3UJ6A 3ULQB 3L00A 3E5QA 5MHTA 1I5ZA 4P55A 3N4MA 2YX1A 2V7EA 1XDZA 1IY9A 3WTSC 3HEMA 2M30A 1NW5A 4E2ZA 3HRMA 4AZSA 3KP3A 5EOVA 5A2QZ 3DMGA 3ZPLA 3MEXA 3V7RA 3PX2A 3FPJA 3OOPA 5E17F 3FUVA 1NE2A 2VBWA 4ESFA 5K5OA 2P7IA 2NXNA 4LFUA 2WA2A 2OB2A 1EV7A 1SG9A 3FPEA 4UVAA 3CJQA 4MQ9F 4ENKA 1CGPA 4F84A 3MCZA 1U5TC 1ZRFA 3UJDA 1XSVA 3ZMTA 5K8VA 5DCMA 3A4TA 2V6CA 3LX6A 1P1CA 1I1GA 4BHCA 2IH5A 1NW3A 3KEQA 3JWGA 5K0JA 4RTMA 4WK8F 2PGXA 2H94A 4HV6A 1USSA 1INLA 2PXAA 1L3IA 3GYHX 4PIPA 5JI6A 1ULYA 1MHTA 4KDPA 3JW4A 4PYKA 5D8LB 2ZJ2A 3J80Z 1VTNC 2BR5A 4BXUA 1JQEA 3EGEA 5E1DA 2CW0F 1Y8CA 2MD5A 5JFRA 2ZMEB 2UXNA 2D2WA 3EETA 1RUNA 3B3FA 4CGZA 4U0VA 2VODA 1ORIA 3BWMA 5FUBA 2STTA 3R6SA 1EJ0A 3NQOA 3HP7A 2UXXA 4P9UA 3LPMA 3WU1B 3OZTA 3M70A 4U88A 3ELWA 4KMFA 5K01A 1SUSA 2IPXA 2HTJA 3LBYA 3ZQ7A 2Y0MA 3GEZA 1YW7A 2C7QA 3LECA 3GX4X 2HGCA 3BJOA 3FXUA 4G9YA 3ZMDA 2PX5A 1R6AA 3ECOA 5DTMA 3TQSA 3FUTA 5GINE 1JE8A 4H0NA 5LR6A 1EJ6A 3GWZA 3ABTA 3DEUA 1TBXA 2Q2EA 2IVMA 2F5CA 3I64A 2L54A 3TQNA 5FLXZ 3ORHA 5DSXA 1ZLJA 3SZTA 1S8NA 3VC2A 2ZVJA 2VONA 2LNBA 3T8RA 3TM5A 3K1MA 2P40A 3TPZA 4R05A 1TQPA 3G8BA 2AS5F 4L9VA 4ON0A 1I4WA 4UUVA 2YSRA 1SFEA 2CO5A 3QPTA 2ZWAA 3TO7A 3ZN0A 3JAMK 1WXWA 5CJ9A 2G8NA 3BGIA 1SD5A 3HOSA 2F5DA 4P58A 4FSDA 2ZBPA 2KJBA 3TFWA 3I4PA 2LDUA 4OA8A 4OIRF 1KU3A 2IRFG 2YXDA 5DRYA 4PYJA 4OIQF 3G2QA 3T7RA 1IN8A 2JHCA 5EHIA 3LFKA 3KQOA 3H3UA 2FNPA 5E1BA 4WX9A 1O3SA 3HCAA 3X0DA 2JG3A 4KIFA 2BZGA 3NWEA 4GEKA 1ORHA 3Q87B 1FP1D 1LEAA 3NJRA 1VE3A 2ERCA 5E1OA 4G6DA 1YQAA 4NB5A 2ZBQA 4C4AA 1QNTA 3WE3A 4HOBA 4EV0A 3F8NA 2KIFA 1KPGA 3C1DA 2XAHA 1ZGAA 2PBIA 5U4XA 2RC4A 1VP3A 3M6WA 1FP2A 2C7OA 3EDPA 1JHHA 1R5HA 1B59A 1TW3A 2GA2A 3KP7A 2NAZA 1MJAA 2P8JA 2X0LA 4M72A 3DF8A 4GOLD 4KIGA 3RKWA 3O4FA 3UJ7A 4C08A 1R00A 2EFPA 2MBFA 4AIKA 3LKDA 3WG9A 2MH9A 2YTZA 1FYLA 2VDWA 1RJDA 3H2BA 4NECA 5DM2A 2AR0A 3Q9SA 4C07A 3QOWA 4IHSA 1ZYRF 2G7UA 1KPIA 1JQ3A 2FA5A 2KIMA 4M74A 3SFZA 5BPDA 3G2OA 3V7SA 3GDHA 4E2WA 2B78A 4IXAA 2G9WA 3BDDA 4KDCA 4QDJA 3GRRA 2D1VA 3NDIA 3GNLA 3HCBA 2FEZA 1R74A 5KVAA 1KYZA 5LGTA 2XYQA 2Z3YA 5F6FA 3C6MA 4M6YA 2QQBA 3D5LA 4L9JA 1TPYA 3MERA 2I6GA 4RTSA 1Z91A 4EGZA 1TQIA 3V7CA 3IWFA 1JTEA 3IEIA 2BR3A 4P96A 1G8AA 1P4WA 2JJQA 4OIOF 2DULA 2IDJA 1HBXG 5CD1A 5EC8A 1YFHA 1U5TA 4R6WA 2XAQA 4Q48A 4RVGA 3G73A 3DKWA 3P97A 4X1OA 5D4SA 3MQ0A 2H27A 3JWJA 4QVGA 5CCBA 4WXCA 1B4AA 3C3PA 4EM1A 3J80K 2QLZA 2PMHA 1UIRA 4RTOA 2YR0A 2EA2A 1B9NA 3E7PA 4BLUA 3EUHA 3F4KA 4YIIA 2ZCWA 2O0LA 2BGCA 2K4JA 3PLAE 2XVAA 5CIYA 1DL5A 1PP7U 5J6XA 4O3MA 5LQCA 4Z2YA 2M5WA 2PY6A 3R0JA 1P6RA 2NYXA 4YMHA 1JG2A 1WZNA 5HDKA 2OKCA 3WGIA 1R18A 3M1EA 3SSNA 3BKXA 3GRVA 1R22A 3O3KA 1SMTA 4RB2C 4P7JA 1O3RA 2F8LA 2Y1XA 3G7UA 3TGNA 1T6SA 1GXPA 4L5JA 1JSZA 1TTYA 2DT5A 2EFJA 2VP3A 2PN6A 4BNCA 2PT6A 4OBXA 3FF5A 1JG1A 2PBFA 2COMA 3ELDA 3UBTA 1S7AA 3MFKA 1YFJA 5FD6A 1WY7A 2F2EA 4I09A 3KETA 5AIPA 5E1XA 1P92A 5DCMB 5HFJA 2PX8A 1IRFA 1MD0A 5ED4A 3C18A 1QAMA 1ZREA 3TDUC 1KU9A 2EV5A 2HKXA 2L3DA 2ZW9A 2A6EF 4HH4A 2UYOA 3HTSB 1WI9A 2HS5A 2ZO4A 1XMAA 2B9EA 1NW6A 3KPVA 4A5NA 5E1MA 1KA8A 2CKDA 2GXGA 3WTVC 4UV8A 3UJCA 3FWEA 3E6DA 1YS6A 2PJDA 1DPRA 4XLPF 2O06A 1RI4A 3JTGA 4UV9A 3G2PA 1R8YA 2R6ZA 5D1HA 2LSOA 3K0BA 1ZKDA 4AZWA 10MHA 2GAUA 1G60A 1ZRCA 3AY0A 4RYLA 2FBHA 2FK8A 1SUIA 3ANXA 4DM3A 2RGVA 3VSEA 2G1PA 4S05A 5DSTA 2QVOA 4I2OA 1XGNA 1ON2A 4EJWA 2HR1A 4EM2A 4POOA 2ZBRA 4KYWA 2RN7A 3KR2A 4LLLA 4A6DA 4CO8A 2QRVB 3I58A 1NBIA 4MHGA 3EGIA 2ZSUA 1L0OC 3KR9A 2W24A 1T0FA 3NVMB 1P4XA 4YUZA 1XTPA 1R7JA 2R7FA 1BI0A 4R8SA 1F4KA 2RNJA 4JQFA 1XJ5A 3HTUA 3DXZA 1F9NA 5C1IA 3J81K 1MJ9A 3RKYA 5CM2Z 5HEKA 4XUEA 4HYEA 2DQRA 4LMYA 2IT0A 3CJTA 4KW7A 3D0SA 2H00A 2KW5A 4ZTBA 4GYGA 3IWZA 2FSWA 5DPMA 4PDKA 3RI4A 3RIEA 1XSXA 1JQDA 2Z6UA 1MZBA 3WTTC 4I02A 1STZA 5DM0A 1ZG3A 2XGXA 1KR5A 4HTFA 5GM1A 3HRUA 3NW9A 2PXCA 2JZYA 2IA0A 2FBIA 4FT4A 1W5TA 1XCVA 4HG2A 2ONZA 2AZTA 1UHMA 2PEXA 3P9CA 1SVUA 4GXOA 3B3JA 1FSEA 2VS1A 1YLFA 3OPNA 4BHBA 1GVJA 1QZZA 2A68F 4HQMA 2Q41A 3V8KA 3GZ5A 1WQ2A 3F8CA 2ISYA 3P9NA 1PJZA 5HS9A 2DU9A 1D2HA 3LWFA 4U0YA 4R8HA 1MJFA 4LWPA 1T2KA 2FHPA 3HVHA 3GO5A 2JH8A 5D8KB 4PGGA 3A27A 3OCJA 4Q4ZF 3J7AO 4DCMA 1BIBA 1V4RA 3K1PA 2ZIGA 5HIJA 4EGYA 3LDGA 3FPGA 2H09A 5FHQA 4QQKA 4HX8A 3KQVA 3RTRA 5L3FA 4L5IA 4A0ZA 4AVPA 2Z5UA 5E8IA 1O54A 2ADMA 5IH3A 2ADUA 2HR3A 3BWCA 3FUXA 3FZGA 5ILVA 1ZAOA 1SD6A 4P7FA 2B0LA 1F38A 4KICA 3LCUA 3LAJA 3BJ6A 5L3DA 5E8JA 2DPMA 5G02A 2P8TA 3ER9A 4AZTA 3FXQA 1PRYA 1FOKA 2YXEA 3C7JA 1EIZA 2QM3A 2HKOA 1O7LA
chains in the Genus database with same CATH superfamily
1TYEB 5K45A 3TI7A 1RWXA 3ORRA 3R0QA 3COZA 1XDGA 2XVXA 3HNRA 4BO0A 2IOFK 4IRIA 2UZ1B 3E84A 2AFHB 5ALWA 3TOVA 2WF9A 3SE0A 4DCSA 4DTCA 2O8VA 5M3BA 2DP4E 1CHNA 2DZDA 3N5CA 4ZOLB 4DZPA 1KSHA 3ABMH 1X7WB 1U3CA 2XTNA 1UP7A 4EATA 2QP3A 3K10A 3U31A 2PZJA 4JEMA 5TARA 4EQ6A 3FE2A 1CR0A 1RYHA 3BXOA 2ZPAA 5H0IA 4Y6RA 4WMLA 3W6KB 4OO3A 4ESBA 2X9QA 1F8FA 3Q6NA 5KVQA 1M73E 3I3OA 7MDHA 3B6AA 4JP3A 3IIIA 5EXXA 1A9QA 1UK6A 2GTPA 1NL3A 3G8AA 2QYTA 3H0KA 5JDCC 2MW8A 5J2UF 1Y33E 1QDEA 4AY3A 2PX4A 5LP6C 3UCEA 4AMYA 3OQOA 4WK6A 2Y1EA 3K2BA 1E2FA 4H15A 3W3AA 4UEKA 4AFNA 4HAOA 2HSEA 3LU1A 3AQIA 4OB8A 4ZOEA 4KPUA 3PNVA 1H1LB 4GL4A 5LL6P 1JG3A 4WA7A 3FY4A 1JA0A 2BUAA 2P4EA 2VTVA 1RQLA 4GWLA 4M9ZA 2CD9A 2XOXA 4WOCA 3IPRA 4TL7A 3KJHA 1XGKA 4PO8A 1AGPA 2JLSA 4AVYA 2D59A 3SDSA 4FX0A 4J1TA 3ZJ4A 1Z0KA 4QASA 1YB6A 2YWXA 4QJ3A 5E3HA 1FP7A 1D7AA 4GDFA 2R6DA 3QPAA 5ADUS 1MORA 5HQ3B 3LK7A 1ZIOA 2VZ8A 4WY5A 3UBMA 4E7OA 2F3TA 2PE5A 3SHTA 1Z9CA 4D96A 2ZRAA 3ID6C 3TEDA 4RZSA 2QTMA 4IJWA 2KIUA 3VSAA 4EJOA 3HJNA 1VCOA 1K5GA 5E8RA 5B36A 5IT9K 1L4HA 2VDLB 4TMTA 2R8PA 2D5CA 2Q5FA 4L4ZA 4O4LB 1XIVA 3HSKA 2JGRA 3O8OB 3CCYA 3OSUA 3NONA 3IJ5A 1MU0A 2WHXA 1LLFA 3BRWD 5D84A 1CS0A 5WRFA 3S1SA 3GLIA 4ZRNA 4RTRA 3GX1A 3WL5A 3MB5A 5FULA 4IHKA 4PTLA 1VJ1A 3C3XA 2XE8A 1QVVA 2Y93A 4R8KA 4HBZA 5J4LA 2DXIA 1EDBA 3DXJF 2UZKA 4A93J 1WF3A 5BOXA 1O77A 2VDPB 4FFVA 1Y3BE 2ZWMA 4K2AA 5H9VA 4IIXA 5K3BA 5EEGA 2JAXA 3BC1A 2EFYA 1V3VA 4AZ0B 1TO6A 5I6DA 4I3FA 2CJFA 3ZJVA 2JCVA 2P2ZA 2V5VA 2QSHX 3T94A 5AOCA 1QWOA 4NBQA 3B1WA 3DE1X 2C8JA 1CR1A 4LJZF 3LUCA 3NFYA 3QQAA 5ALKA 4QARA 4C9YA 5K3DA 3OJXA 4F5ZA 4EEFG 1OBHA 4PC1A 1YS9A 2DWQA 2V6IA 3UA4A 5JBIA 3ERED 2XWQA 4PAWA 4D3XA 4L9NA 3Q3EA 4E12A 3GNQA 3KJEA 2TS1A 3DKKA 2QN9A 3RSGA 3H18A 3D3NA 3WLFA 4F38A 3U44A 1M1YB 3OYIA 2MJLA 4CKBA 3R3YA 4IKPA 4PPYA 2C78A 1YUNA 3QPDA 5BPIA 1DX4A 1TFRA 3MWYW 3GK3A 5TSDA 3G82C 4C3ZA 4CCMA 3EVEA 1P44A 1VSUA 3LNQA 4IZHA 5ALZA 5JI2E 2OHOA 4GZ5A 4NCKA 4AQ7A 4DBQA 2R5ZB 4FHTA 1Z5ZA 2FZ4A 1G8JA 1HF3A 1N2EA 1ZDMA 2ZI5A 3LUDA 3F6EX 3OY9A 1A5BB 2NMVA 4BVEA 1AVTA 4U8GA 5T6MA 2VP2A 2OFWA 1JHMA 1A9YA 2YMMA 3DBOB 3QKRB 4UTPA 3TM4A 3V4FA 3IUNA 2R7RA 2D1QA 2OBFA 3L3BA 4W82A 1RZ4A 3OIPA 2EJTA 2OMEA 2YUIA 1VXOA 3EULA 1E77A 4X6UA 3H4MA 3IAM6 5AIQA 4HGZA 3DTYA 3LYAA 4RHFA 4IPAA 2OM6A 2PT9A 3ILVA 3KJQA 5K7FA 2DFPA 3H2GA 2EG5A 1T33A 2ZRLA 4BUCA 1NRIA 3H36A 2IYOA 2V1DA 3WIEA 1NI4B 4IIEA 1ZQ9A 1O3QA 2HTSA 2HCBA 1GGMA 2HN9A 4AJLA 1KI8A 4QU5A 4F9FA 4M7RA 1CZRA 1JFFB 1UFOA 3AHFA 5BSTA 2ESHA 2OC6A 3PUZA 4XCQA 3TSYA 1SBYA 4OOFA 4B7AA 4F9GA 5L3VA 3VZRA 3PDWA 3H5IA 1GTSA 3C7KA 3OF5A 3KZMA 3OU7A 1QQAA 1GN9A 3FR8A 4DDHA 3NC1C 4WLFA 3GTOJ 2FWNA 3GOQA 2X3YA 3INTA 5DIFA 5EINA 4EA8A 3HN6A 3SMQA 1IAQA 5AKJA 2DHDA 2HEOA 2F64A 2X8LA 3OP4A 4MQMA 4A0FA 1BCRA 1JIQA 1YA4A 4J1TC 4I4TF 3RAPR 4JI4B 1Q0TA 2B5VA 1ZGHA 2G9VA 4QAQA 3C3WA 1AKHA 3GFGA 1XB4A 2XMZA 4DGQA 1DFIA 4F4CA 3WV4A 1XTZA 3H1BA 3Q3VA 4TVBA 3BXZA 2FMIA 1GTVA 3H19A 3CLKA 1U9CA 3LRPA 2OESA 3Q3GE 4BTVA 3F5SA 1VI5A 1ULHA 1Z5WA 5LMNB 2IY8A 5DKFA 4F4UA 3ZMVA 4M21A 2R5ZA 3PR3A 1N2GA 4GW3A 5JH7F 1EWRA 3QWFA 4XUDA 3AU8A 5DIZA 3BORA 2HHAA 4C5BA 3PL1A 1Z13A 3JAWB 4G9EA 3L79A 5JISA 3AM3A 4MUIA 4OY3A 3HDTA 2E18A 5MN4A 3ROPA 2P2LA 4EGQA 1DBRA 1M34B 3I4FA 3WFJA 2WAXA 1VLMA 4HQKA 2IYRA 3CISA 4MP3A 3CNEA 1P2FA 2B8NA 4OLFA 3HGMA 3LNTA 2FUG1 4FEAA 4GXRA 5CNKA 3SLGA 5CDUA 5F0CA 2ZBUA 3PE4A 1RZVA 3NDRA 2NP7A 1KY4A 2A7QA 2CQQA 2XIGA 4LYFA 5IJ0B 1IXRC 5DBHX 2ZUCA 1E17A 2QN8A 3OV8A 3AUAA 2VRCA 2W4MA 2VJIA 4ALLA 4Q9JA 2DG2A 1YDMA 3V4PB 2GUWA 4RIFA 2C4VA 4MCIA 4ND5A 1XDWA 2RV8A 5ESXA 3RVLA 1FMJA 2E49A 1YC2A 4KE9A 1J6UA 1X8JA 1XA3A 5LP6A 1HSZA 5C8YB 3GJXC 5DRTA 4BY9E 1QC5B 1VHJA 4REQB 2BP7A 3M33A 2OU2A 9ATCA 1WAMA 3JZMA 1IEVA 4B9AA 1XK6A 2BDUA 3Q12A 5FKJA 3ZGLA 3KAQA 3KYCB 3LWZA 3GJ7A 4NFSA 3N2KB 4E5SA 4AKTA 4P08A 2GK7A 4ARZA 1S2IA 3OZWA 4L76A 2GAIA 4MS3A 3FCEA 5T4HA 4Z1OA 1PD1A 4ZI7A 4DKJA 5JJBA 1PL7A 2VQCA 3TOAA 3RYFA 5EWMB 5IKXA 5LCXA 2VAPA 4FBLA 5LYJF 1M2VA 1X2EA 3OLVA 4Y6QA 4GQIA 1YGYA 2YYAA 5CITA 4TM8A 5JARA 4DYCA 4KQ9A 1PTJA 1DDIA 3DAGA 2E4ZA 3ZWDA 1LKZA 2ME0A 1UWCA 4PS0A 4TPKA 3HRHA 1U81A 1YHYA 5IDQA 1RRCA 2HPVA 1CF7B 1D5CA 1FK8A 3STVA 3M6XA 5CB4F 1M34A 3BMXA 1XZ8A 1E1CB 2BDTA 4G5OA 4KZPA 1X1SA 1ZK0A 3FKQA 5KVRA 3M3DA 3RJTA 1HDEA 4JR0A 1KAGA 4XWKA 5IAAA 2E6KA 2XDQB 3DVSX 4WK4B 5BRJA 2P0EA 1W4CA 1SWVA 2PU7A 1U1CA 3E3NA 2QNBA 2YBDA 3JZIA 5AM0A 4PCLA 3HDYA 4IIJF 4BXOB 3VC1A 1J00A 1L4LA 5EMJA 1BFKA 3ERMA 1JGTA 4RPHA 5T3UA 4BL5A 4WCFB 2JVIA 1I13A 3OZCA 4LXIA 4NQWB 4QDTA 1EFUA 2GLUA 1FOXA 2R6AA 1DAIA 2RIPA 1M6YA 1XCMA 3PWZA 3M83A 2QRMA 5AVKA 2C20A 3WNBA 3CZ6A 4XKJA 3SI7A 2XF5A 2QNRA 1IGNA 2O0MA 1WTAA 2WP8J 3EVZA 3F46A 4JP1A 3FOZA 2OCCH 4W9NA 1JJVA 4IQ4A 3RH0A 1OH5A 2P5LC 5ED0A 3CSUA 1E2NA 2PNJA 2FSHA 3VZSA 5JATA 3D3QA 1PP8F 1W76A 2QN7A 4JFAA 1EFTA 1NJ5A 2IYXA 2OLJA 2QV0A 2BCEA 3VR2A 4C0XA 5DGCA 1NLYA 1S0UA 2ZSJA 2HTEA 5CBPA 2VDWB 3OBIA 4E7HA 1ON1A 1L5ZA 4UW9A 5EP3A 3U9TA 3UTCA 2DA5A 3HYIA 3QJGA 5LWQA 1S3SA 5TQJA 4IH9A 1SO8A 4J2HA 2IYEA 2F8TA 1UFVA 3JSPA 3C6ZA 3KTOA 2XQKA 4HXGA 1JAHA 2UAGA 1KH3A 4HRXA 5B3AA 4LRYA 2VPPA 3VZBA 1KO5A 4BNWA 4A69C 3PPWA 3QBEA 1VCMA 2G8LA 1TDJA 1YJBA 4MICA 4E22A 4YMGA 1FJXA 2GB4A 1YDEA 3SS7X 4DCJA 4E6PA 5A4IS 2QJWA 5JS6A 4V0ME 2AG1A 4F46A 4ZO8A 3HB0A 3ROKA 1XJQA 2R6GA 3RIXA 1W1WA 2M32A 3CUWA 5KSPA 3WS7A 1E2DA 3SC4A 4EB6A 1U98A 2P4SA 3PL8A 2QV7A 4TVKA 4PVCA 3TFOA 3LVRE 1I6LA 1JLKA 5DNDA 2CFXA 1YCFA 3DT9A 4XQ9A 5JLAA 2PV0A 4C76A 2JAUA 1N3IA 5E95A 4V2IA 4PNZA 3M5PA 2BHLA 1XT6A 2D2EA 1MR3F 3R60A 1CKEA 4GM4A 4PRYA 4EYSA 1GNVA 3H16A 2GOMA 3GHHA 1XTVA 2N47A 3R0ZA 3B1XA 4HLNA 2WC2A 4NQWA 3H9JA 5I9IA 3T1TA 1YIAA 3GTKJ 4M1SA 4HDRB 2BY1A 4XONA 4YJ3A 3SN6A 1WA5A 1XWIA 4NDLA 3PXUA 1P9QC 3IAM2 1FFWA 3LVQE 2ZUTA 2GSWA 3TUJC 3VVBA 3ZHYA 4YMVA 1VQMI 4B4DA 3A28A 3DM9B 3R77A 2JIPA 4RVFA 3FNQA 2O3FA 2IXTA 2DA4A 3D4BA 3WRXA 4RA9A 2QUIA 5F98A 3I9LA 3CWQA 4G94A 1JHZA 1O89A 4WN9B 4FWTA 5F3DA 1JUSA 6CHYA 2OQGA 2JH9A 3IBGA 4IILA 4U7WA 3T0FA 2QTHA 1LBHA 3MTIA 2C84A 4YUVA 1I4OA 1UXKA 2Q4TA 2RAEA 5HDNA 4U87A 1DAOA 1ZBQA 2EW8A 2P6MA 3KEMA 4PZDA 1IBSA 4UNQA 4FMCB 4YX9A 3OC0A 3GFLA 3E9MA 2IHKA 3BRQA 1DRJA 1GZHB 3HDVA 2HHCA 4G5QA 1LNWA 4PZ9A 2QSGX 3I01A 2BFWA 2YC2C 3FNHA 3NHSA 3W5DA 1MH3A 4O4HF 2QQFA 1Y9EA 1X9IA 3IIEA 1RAIA 3HO6A 1YIJI 2QL5A 5C4JJ 1GL6A 3MGGA 4HX2A 4NE2A 2W2QA 2OV4A 4D9HA 5K09A 1GUZA 4G8CA 2VATA 2YJ5A 3FAZA 3TDMA 3ZGYA 3CX8A 2R5WA 3MUOA 4ZI7F 5HXAA 1UMCB 1BHO1 2QTGA 2D7DA 2QW0X 1Q84A 2ODQA 3BR6A 3KVOA 3DS8A 1Z8NA 4J1NA 5BY2A 1R49A 1A5TA 1J56A 3QIVA 2ODPA 3O83A 1HEYA 1ND5A 2F9FA 3V34A 4IDFA 1AIPA 2GCNA 2O20A 2DK8A 1LEHA 2FCRA 1F12A 1NYQA 2NXCA 1MJGA 1SCJA 2NVBA 1O0CA 1USVA 1H1DA 2CXPA 1TVMA 2L17A 1FU8A 4KMOA 3ZV7A 2EIJH 3OCXA 4D44A 1UBLS 2IX3A 3CLSC 2FU4A 2DPGA 1ZN9A 4BFUA 2Q5JA 5BSRA 3L9FA 3H84A 3HDHA 1THGA 4UCFA 4AUMA 4C01A 4Z3KA 1KK3A 5C5DA 1KEKA 4XRMA 3DTNA 1SCUA 5K6AA 5J5VA 2B36A 3DE6X 4WBNA 2C9DA 2FOKA 5ADWA 4KR2A 2B9VA 2L7KA 3Q9LA 2D2IA 3C4VA 4JYMA 2L2OA 3FVQA 2UWMA 3A4YA 1OJ7A 4AMUA 3TUIC 1K9SA 1Z0DA 1JI0A 1CPYA 2O7VA 3HWX1 1WMFA 4GICA 4LJ6A 4BBPA 4D4KA 3FFAA 1T36B 1JMKC 3TQQA 3EXHA 1R8QA 4Y67A 4J0FA 4ZO4A 3WE7A 4O0LA 4HEA1 2ZZKA 3E05A 3FIUA 1P2VA 2CJPA 2Q2QA 4MEAA 4MWEA 2DMNA 2B98A 3S2FA 5HJEA 1H2AS 3QKUA 1TQMA 1MMAA 2UUCB 4JL8A 1KI3A 1DJLA 2C59A 3QEKA 2ICAA 5ECWA 1CUFA 3TEJA 2BGUA 1I0IA 4DE5A 1JYSA 4DNOA 5LQAA 5THKA 1K66A 1TQ6A 2OD7A 4OI2A 5I9LA 3BUSA 3PVCA 1N1GA 3VC3A 1Z12A 4RPCA 3TRJA 4X62B 2G9UA 3EEOA 4DB2A 4KRGA 2PS1A 1YR7A 3FPBA 3CCUI 2TECE 4CM9A 3OEED 3O9MA 4D0LB 3AMVA 2XQVA 4ZYDA 1UR5A 4AD9A 3HB1A 1X2BA 2R1UA 4MWTA 3GO4A 4AQDA 3O82A 1ANKA 2QLTA 2ZNYA 1A9PA 4XM2A 5ALQA 2GZAA 1JXOA 2IYYA 2XYRA 4MB0A 3JYNA 4U9HS 1PJCA 5B1SA 2O07A 4Z3OA 1KJNA 1I1QB 4P9FA 3GW8A 3O4HA 4HPWA 4O25A 3TH5A 4GX5A 1MABB 4IOMA 4OK5A 3TLYA 3VTZA 1I10A 4DC1A 3A26A 4KREA 3BP8A 2HZTA 3ZR8X 4N40A 4AECA 5IPFA 4B3TB 4AKGA 1WCWA 5KWSA 3HPHA 4M9XA 1O87A 3ZU3A 1EWQA 4WFIA 3FTCA 5K0FA 1P4GA 2GZ1A 2XPUA 3CS3A 4LJKA 1J8QA 4P1ZA 3LV8A 4A8TA 1R9JA 4DOZA 3NHZA 4OREX 4U0WA 3S6JA 5JS7A 3OZAA 4X66B 2HXIA 1Z5NA 5COQA 3T3OA 1TEZA 3CJRB 3PF9A 2OTLI 1OCZH 3H2ZA 3M1LA 2JMWA 4M7WA 5FRNA 5FP0A 1KS2A 3NXSA 2PMBA 3R4CA 4UPEA 1Q14A 3RIMA 4E5PA 4QHYA 1FTZA 2BMEA 1FNBA 2LCFA 2VTDA 4XX0B 3EVGA 3IPYA 1AF4A 1AN0A 5HLIA 3TZBA 1W7PD 4CKEA 4Y6PA 1A72A 2ZB2A 5DGHA 3P2YA 2X0EA 3NWBA 5G41A 1X3LA 3PEUA 3NTQA 4CNQA 2OF7A 3JASA 4IRXA 3MZYA 4QVKA 5B37A 1XL0A 4AM8A 2B21A 5FA5A 1BN5A 1SULA 3SNKA 4CXFA 5FV7A 3EXFB 1J9ZA 5BNGA 1R3UA 2QRNA 2VVTA 2E1MC 5L3CA 2BE5F 4L15A 1EQAA 4LNUB 4ZV4A 3S93A 3T34A 1XZJA 3FKIJ 2XD9A 4KH0A 4PC3A 3PEEA 4XSZF 2JFWA 3IMFA 1WHSA 4FR2A 5HPYB 4MKIA 5BWBA 1TJNA 2SBTA 2Y1DA 1XTRA 1WGXA 3O8HA 1QH8B 2PH5A 4OQEA 2ETXA 2X0FA 4JXJA 4LBWA 4A2WA 1FDUA 4EHAA 3Q7EA 2FR8C 2Z95A 3IH4A 2R48A 2ZJBA 3DMFA 3PJDA 1U3WA 4R71A 2VQFB 1R23A 4BE7B 1QPZA 5GOTA 2ZS8A 4NKRA 1SC7A 5FLKA 1P39A 1TXGA 2YV2A 1ECPA 2EFDB 1HF0A 4KMUX 1FBNA 2W6ID 3BC8A 1KIAA 3OMXA 4FFOA 1J9IA 4OSPA 4ZXPA 1G8KA 3NEJA 4QC2A 2RBGA 1Y6QA 1HZJA 2VZ0A 4FQ5A 3W8EA 2REOA 4AZ3B 4HA8A 1JR3D 3DULA 3V1YA 4Y7CA 4C78A 2BW0A 1E7YA 5KWVA 1C29B 2VEDA 3ZXXA 2DYRH 5JAIA 1KQ3A 4OXKA 2DMTA 2B30A 4LRUA 1OXTA 4I5FA 3K5IA 3PGXA 2OAZA 1SM4A 3MGKA 3URKA 1ILEA 1DI0A 5JAMA 5JLJA 4EG3A 3CF4G 3GG9A 2J0VA 2VHCA 1HW2A 1IRGA 1W73A 3OQHA 2ZVDA 1AKNA 5M5WJ 5C3UA 3D6NB 1CWUA 2RCNA 2AFHE 1HW5A 5C0OE 1Y1TA 3KS9A 2WT9A 4HK4A 3DZCA 4NVRA 2XCLA 5BSGA 4J0DA 1XNGA 3KB2A 3W7BA 3ESAA 3IAAA 5FQOA 3IMKA 2I6SA 5JSZB 4X41A 1N5LA 3OU6A 1NNEA 2CB9A 4CCJA 5EWMA 4L9WA 3TW0A 4L5EA 4B8ZA 4G1EB 1ZM2A 3M4OJ 2B7CA 2H29A 3AY3A 2RK4A 3DPSA 2AZDA 1FCJA 1ZNWA 2JGJA 3N9IA 2OCLA 4R9UC 5TQ2B 4ZN6A 4R79A 5HGXA 2GFHA 5GP9A 4WA8A 1FJLA 3RVRA 2VT7A 2PJRB 3C7AA 3W3AD 4BE9A 3NHYA 1I3OA 2YN0A 4FBMA 4L57A 1M33A 2ZRGA 3DCYA 3OT1A 4N3CA 2P5UA 4URHA 4AX4A 4OX9B 1ZM3A 1XNJA 1RYDA 2TSYB 3QFRA 4PYLA 4CYCB 4CTOA 4TLEA 1QYWA 4ZQFA 3T3EA 1XEWX 1UKYA 2ISCA 2M0MA 4PAGA 3HUGA 1XU4A 2ZRHA 4QIHA 3FK7A 3V7FA 1AD2A 4DQXA 1YE5A 4KT5C 3P19A 1JDNA 4ZOCA 1BC5A 4IIUA 3TXXA 1Z05A 5KB3A 3OS0A 1EFVB 4BJ6A 1YWGO 4JU8A 5DWVA 1DE0A 3VH1A 1UMBA 3CPJB 2I7DA 2ZIWB 1E5DA 2XE4A 4FT2A 4CSWA 4JOSA 5F77A 3KWJA 5H1YA 3V8QA 3G5MA 5JTTA 1E6KA 2RGNC 1XDDA 1XZGA 5LXTB 3FOFC 1VKHA 1E2BA 1C4KA 2I54A 2ZG6A 3H3ZA 4UPDA 1HYQA 1NG1A 1Q50A 1MQ9A 1UC5B 1CE8A 4MJ3A 4EA7A 4L9TA 3NORA 1EVQA 2HMTA 2OCGA 1IXZA 2CVHA 2VQSA 4PFOA 2VPLA 2WZDA 2G0EA 3LWDA 1B1BA 3QI2A 1VNDA 3QWAA 4WL0A 4Z4CA 2EWMA 2RB4A 3QRWA 3QEBZ 1IHYA 1ENHA 3E27A 4HPJB 1J1ZA 3C7CB 2ZZNA 2J46A 3BH6A 1YL7A 5FKLA 3JYHA 3QVUA 3HXQA 3U5ZB 1VTKA 4WINA 2GDZA 3DBHB 3UJAA 3KP6A 2KB0A 2O57A 4M3FA 5ILSA 1I33A 2PWYA 3BTVA 3QVVA 3DC7A 1LUAA 5SY6A 4AC0A 4BWYA 4FGWA 1C9KA 1FW8A 1NW7A 3TLKA 4OI0A 1LVUA 1UBFA 3HL2A 2W0MA 3CUYA 2A9FA 3D5EA 3O8OA 1W2GA 5HOOA 1YKFA 3R23A 2YY7A 3JRCA 4W7HA 5LIPA 5HZMA 3KSBC 5F1JA 1PGQA 4C05A 4JQYA 4LJ5A 1SU6A 5D4RA 1A76A 4UUBA 4BNIA 3N75A 1JEEA 1S2GA 1ZX1A 2HUPA 5HTOA 3GF2A 1EUDA 3H5AA 1BVRA 4X1IA 2B92A 4LNAA 1A04A 1WBDA 1UG0A 3CCMI 1S5PA 3W7AA 4CPDA 4D9JA 2EC5A 4ZC8A 4HAMA 4MIMA 5K4GA 2P5YA 1FNNA 1T5BA 4D80A 2ZRDA 2W98A 4JQZA 1EZ1A 2HI3A 3EW9A 2J5RA 2OECA 2Q5LA 3QP9A 4DPLA 1FP4A 2L0KA 1EF4A 2AI2A 4MMYB 4DV6B 3V8BA 2WMDA 4PZJA 1QRRA 2X6WA 3QU7A 3FDZB 2P7HA 2RQQA 5UKDA 5IUNC 3TR0A 1UKVY 4U2FA 1UFMA 2JBAB 4KZKA 4MQEA 4OXRA 1UMBB 2X2OA 2GPWA 4N7BA 4YFVA 3NWTA 1UJNA 1J5YA 2V7VA 5L3GA 1MSEC 2C1XA 1WCMJ 3MEQA 3PFCA 2FPMA 2QX6A 2FXVA 4H2DA 1FTGA 4PICA 6AT1A 4LI3X 1ZGCA 2KI5A 3A1FA 4U00A 5KKNB 1N5RA 1ZUWA 3FKSA 4OL9A 4GPD1 3GPBA 5JAHA 2BGGA 1SD1A 2J6HA 3D8UA 3TLGB 3E03A 1G3QA 4MR9A 3SSAA 3THSA 3ROQA 4J03A 3PQEA 3DZIA 1IUOA 3NHPA 5K0ZA 1M83A 4NF2A 5HKLA 3SZGA 3OHSX 3KQYA 1IZ0A 1R88A 1IOZA 4JK1X 1YBFA 2HJGA 3ECCA 3JTEA 1YRWA 3UMBA 2L9RA 4R41A 4F12A 2PZMA 4IWYA 4RNCA 2JKZA 4ZQGA 5GIOE 4AWXB 3RYCA 2A3SA 4B45A 4C21A 4Y18A 5FQNA 1ZS9A 3ZDZB 1AZWA 2V7WA 3KPUA 3PRKE 1N6KA 1QIEA 4C6RA 5CEFA 1JMYA 3WYFA 2FE4A 5E9AA 3H9QA 1D6NA 4R8RA 4E2YA 3HRIA 1ABBA 4LOKA 1H05A 1Z77A 4JEHA 2YFHA 4XBFA 2DCMA 3R4KA 5EYRA 5EDNA 3K0HA 3TL6A 3DWLE 1N9GB 3H2JA 2IEAA 5DEIA 4DBLE 1B3RA 4JP8A 5E6UA 1N34B 4PZZA 3AHDA 1ES9A 2NNWB 3DVQX 1D8KA 2LGJA 5D5VB 2VHQA 2ZIUB 2VUHB 3DDOA 1C1DA 1LDMA 1W35A 4YIRX 2IS2A 1RUOA 4QU9A 3R09A 2H8RA 3GFVA 4MRRA 4FX2A 4BJ5A 3KWLA 4BQPA 4HLYA 3RS5A 1VFPA 1JQ5A 1L5FA 1QHYA 3EVFA 1K0UA 1U9YA 2AE1A 4IHVA 4WWCA 3JRWA 3M6LA 4FYXA 1FMLA 1XB2A 5LU8A 4OFWA 5IT9Z 4K9DA 4OIMA 4D8VA 2GD0A 5JY6A 1WEKA 4I81A 2UVDA 2I6TA 2F59A 3FDZA 5E3MA 1KEVA 2B2NA 2CMGA 4ZAWA 1LSOA 3K94A 4GMHA 3ZGVA 4P1WA 2GAAA 3L46A 3G7SA 2HL6A 3WQQA 1JDTA 3ZY3A 3W5BA 2O48X 4QDKA 1DX6A 2A69F 5HZKA 1BXGA 3JAMZ 1TKCA 4W4TA 1QE5A 3EFEA 5HYVA 4XIJA 1IJKA 2RI6A 1WCIA 3QFFA 2DGDA 1F6BA 4DDVA 4RH0A 4BX2A 4I4CA 1KP9A 2P0WA 1KC1A 2XBUA 1WW3A 2CGPA 3SLRA 4CF5A 3AX6A 1T8IA 5D87A 1XROA 3KSUA 4DQKA 4ESVA 1SCBA 2GXAA 2WAEA 1GN8A 1WXFA 2ODTX 3C6XA 3S68A 2CFCA 1NNI1 4JROA 5SY9A 4L0QA 3FHZA 1T36A 1G3YA 2YYZA 4L5BA 2VYVA 1V8FA 2L7FP 3O84A 3HP4A 1RXYA 2GCEA 4A0XA 4BMSA 4QAJA 3ANLA 5FO0A 3HKEB 3DLIA 4EHDA 1LDKB 3U62A 1KMMA 3W0LB 4KRFA 2GMWA 2AH5A 1NAIA 2V9ZA 3A0UA 2QMQA 3N39C 3QZUA 1FF9A 1G0OA 4RB1A 4MB2A 5ENDA 2R7ZJ 1ETXA 1AGNA 6PFKA 2WTUA 5B58C 5GAGJ 3ER6A 4U5XA 3ZD7A 1K4KA 3D5TA 2OSBA 2PKEA 2X0DA 5AJVB 3SX2A 1UBTS 1BMFD 4B17A 4DABA 1M0WA 1P9LA 1CW2B 2IYFA 1TCBA 2R7UA 3CUQA 1N0WA 1RWVA 3B2NA 1UZNA 5DX8A 5HGJA 3T8TA 1A35A 1GIAA 2IYPA 5L53A 1Q0RA 2XVYA 5E6RA 1W9HA 1YQWA 3KOXA 2QXYA 3ZGNA 1XVLA 5T7BA 1WJ5A 3DE4X 5L8VA 3CO5A 3RZDJ 1Y7IA 3EUWA 3TX2A 2XUQA 3KUCA 1B8OA 1I80A 3N6VA 2XAGA 1YZNA 1GGVA 2HWKA 2NZXA 2ORIA 5E18F 2V6FA 2J3MA 3EPPA 1LVAA 3FCCA 3KDSE 2C92A 1IG0A 2R96A 3HRKA 4PBSA 3GC6A 5K3AA 3D4OA 2RK3A 3N6XA 1UANA 2P9FA 2Q3JA 1I24A 4RLSA 4BQSA 2X48A 2Q0HA 3OKCA 4Z53A 4W5NA 2NPOA 4JNCA 4ZOLF 2Q6IA 2IY7A 1IN5A 3QUBA 1YO6A 4PK4A 1HZZA 2JWTA 4DBRA 2VG8A 5FLEX 2LK2A 1T4CB 4OUKX 1KORA 2OLEA 3N2YA 3P0RA 3VPBA 3GFBA 1E2QA 5C4XJ 1QF9A 1T0UA 3BMNA 3G6WA 2NP6A 2FWIA 1I2CA 4C0LA 2H1LA 1CQZA 4JI3B 4O3FA 3RPUA 4KFUA 4XPZA 5E7MA 3S28A 4HCJA 3VHLB 2DYSH 2D45A 4EJUA 3VNRA 4UHEA 4BKOA 2WVGA 2P9JA 2Y2ZA 3TDNA 4X3CA 4UHBA 3OMWA 2FJ0A 5B3KA 3LOQA 5IKOA 3QEOA 3EY9A 4Q66C 2LY9A 1G8SA 5IT4A 5JBQA 5DTRA 3RC1A 2QTZA 4RNDB 1XVUA 2W2LA 2RH8A 1MIOB 3ETGA 2JJYA 2XLCA 4UVEA 4HRIA 3M0EA 1VPLA 3GEEA 3CJNA 2FD5A 2CNWD 3JQ8A 5FOWA 2AN9A 3GZ6A 3WAGA 3OTOB 3C2HA 4BACA 1OH7A 3LXMA 2KT0A 4WEQA 4ENJA 2IUUA 2B82A 3QEAZ 1GGHA 2JB9A 1BWRA 4KE8A 1Y0NA 5EXDA 1KXJA 1QNFA 2D1RA 4NE7A 1A9SA 5F2KA 1A7AA 4TKUA 2D3TA 3IP3A 1G2OA 1TAHA 1WKVA 4HAXA 3MXTA 4Q5SF 3DFKA 2NSDA 4QGHA 3BCBA 3SIPA 1RLOA 2W1OA 3AYXB 1GNPA 3GZTB 5A4MS 1E9DA 5KNDH 3USCS 2P91A 2FSVC 1JXQA 4QSHA 3KB8A 1QP0A 4P4LA 3E1GA 5GY7A 4CMEC 1S4MA 4JQCA 3RKRA 3TKYA 2R8EA 3A9VA 1RRJA 4FDMA 3AEQA 4FI3C 3RKXA 4LVUA 3SQMA 2Z3WA 3UK1A 3WISA 4JBAA 4CKWB 3GLHE 4QJIA 1UBHS 4QWQA 4UULA 2XUKA 5KNLA 1GFSA 3RC2A 1Q12A 3EXG2 4OQMA 1JIIA 4PW0A 5IBRA 2D5VA 2C4HA 3I30X 4DZRA 2E5NA 1EK5A 4XQ0A 4XRGA 1CJCA 3S3OA 4XJVA 5IAOA 1T4CA 1VE7A 4TX1A 3LFTA 2G07A 1RKVA 4ITRC 4D8YA 4KH1A 3ZHRA 3IIMA 5CT8A 2G63A 3SZOA 3EXIB 1JJIA 1YZLA 3I39X 3HRSA 4UU7A 3WRYC 1NUAA 1GV5A 2PBLA 2W2KA 4FIZA 3NT4A 1YVDA 5KTKA 2KSQA 2QLNA 3LVBA 2MH2A 1XRSB 1UBOS 1E1DA 3FZYA 3IV7A 1QV7A 2XDAA 3IUJA 2UVPA 3Q2KA 3Q9NA 3QWIA 4GMXA 1EMDA 4LNHA 4WDQA 5CKTA 2AHOA 5D5XB 4X7MA 3RNLA 2B63J 1LSSA 2J9XB 3CX7A 3KHKA 2GN8A 4I1SA 1Z06A 5KHDA 2FFJA 2QBYB 4CDRA 1OX4A 1W5AA 2WV1A 1NBME 4EDFA 1LDYA 4EF5A 2R8XA 1TM7E 2O23A 5BN4A 4D9GA 2F4IA 3DPIA 1NW8A 2W2OA 1SCDA 3PNOA 5B5EC 2W6CX 3ANNA 3GRYA 1RXWA 1PJBA 5DN6A 4GC5A 3T9FA 4EZEA 1NMEA 2F6CA 5LEKA 3IPAA 4X65B 1M67A 3KOOA 1MVOA 2WUDA 4LJ9A 4GAEA 3X3HA 2ES4A 2GBFA 3FWKA 3IV9A 4IFBA 4PV7A 2XAJA 1DG9A 2WUVA 3NYQA 4PANA 3W9YA 2QVCA 5KJFA 4PYRA 2J9FB 3TQFA 3VPDA 2LBFB 3QY0A 5JFOA 5DHRA 3ICQB 2FE1A 3KXPA 5IBPA 1Z63A 1G6NA 2E87A 2PT7A 1T5HX 3A01A 5A5FA 3G79A 4R2MA 4I9NA 4BNMA 1CEXA 5ICMA 1QRUA 2AKEA 2C83A 3R3WA 1T1EA 4G3XA 4IDEA 4XVCA 3THYB 3G3ZA 1XRMA 1OC2A 1Y63A 2YFYA 1MDBA 1VDZA 3OOYA 3Q0IA 4DG5A 1VQLI 1E9RA 3HPQA 4U7PB 4NZPA 1SAXA 2TMDA 3PKIA 3O8CA 3CZ5A 1FS5A 4RA9B 1TX4B 2CNNA 4OHPA 2D74A 4NPAA 3O47A 1E9EA 1L7NA 4Y2JA 4KHZA 4BIIA 5BN3B 5LHIA 4WLEA 2FX3A 3PVSA 3AHJA 1HE1C 3CUEF 4C6SA 5JCPA 2EBFX 5M3FJ 5EIEA 1TI7A 4NENA 2ACEA 2JA7J 4P8RA 5JBNA 3P9YA 2XWBF 3U3OA 5JTUA 2GRUA 2XZPA 3O2QB 4GGGA 1EUCB 1R36A 1IHOA 4DMMA 1KZ4A 1TJYA 3OTIA 2IU4A 1VRVA 1NXXA 2N1BA 2CQKA 2BGLA 1RI2A 3L7YA 4US1R 1F2UB 2IH4A 4HEHA 5TY0A 5JR3A 2J3QA 3F74A 3PFIA 1WBJB 4JJ4A 2PGNA 1V5FA 2R47A 3HCFA 3N1UA 1RIIA 2ZYSA 1VHDA 1U3GA 4MV6A 3DVAB 2H2AA 2VQDA 4IDCA 2N46A 1MHPA 3OZGA 4BP8A 5AW7A 4ASNA 1NQTA 3O4VA 4G67A 1O96A 2V9KA 4GMGA 2I66A 3M9XA 1FLIA 1PGPA 1W29A 4GYKA 4TUYF 5AK5A 4FE7A 2O52A 1SEVA 1G2HA 4EI9A 1PJ2A 4M2LA 4D5CA 2JCBA 4ND6A 4IKFA 4NS1A 3N97A 1GTL1 3JQDA 1YNSA 2GSDA 3QKIA 1EX6A 3A6DA 3QFCA 3S8YA 5FBWB 4HWSA 3NBQA 3RV4A 4MVJD 4U8HA 4ZKDA 4J9VA 2PT5A 3INNA 4DA6A 3DDUA 5LRSA 2EJUA 3IDZA 4G4GA 5DHUA 1UBNA 3QMMA 3IVMA 3BTUA 3IULA 3LBFA 1TECE 1NBOA 2GHQA 4NAUA 1JECA 2FFRA 3O2JA 4NS4A 5CEJA 4X6YA 2DFVA 4C7BA 5IG2A 4DCTA 4CUGA 1OI2A 4CV2A 5DM6F 3F2VA 1BMDA 3MKWB 2NNYA 4O02B 4KXQA 3C2GA 2G04A 1UHWA 3IKTA 2HEIA 2JHAA 3TAHA 2AF3C 5HS8A 2L7ZA 4KFCA 2OCPA 3DT6A 5IP7J 2HIGA 2WMNB 4D4GA 5LQRA 2C00A 5EJ5A 2KMUA 2KISA 1Z21A 2MLKA 3IAS2 1VB5A 3IELA 4NOKA 3KZ1E 4MOWA 4Q02A 4YH1A 3KYCA 5ARDA 1HG1A 2AOUB 1FOWA 1SVLA 2ZUWA 4JVLA 5FUMA 1QGPA 2A9RA 3G5AA 4XYEA 2DUUA 3DTVD 3QX7A 3T6KA 5JJIA 1B6TA 4J7CA 3H1CA 1ETKA 2CHUA 2CV1A 3I0TA 1NQUA 2TMKA 2FSGA 5K7HA 3A4LA 1K89A 4XXHA 5IASA 1E6CA 1R16A 3CN7A 4NMMA 4CIWA 4DJAA 2MA3A 3A7DA 1CV2A 4ETIA 1D1QA 3FMQA 2KKOA 3C7TA 1Y1KE 1G41A 1L6RA 3H9BA 1B0UA 1IY1A 3MJHA 3I73A 5KCZA 1WKBA 2MSWA 4IO0A 1JDBB 6ABPA 1K27A 4X44A 1RYEA 1B93A 3A31A 1SIWA 4N9IA 3G0DA 2PUBA 1OBCA 4IYRA 4FX4A 2CV2A 1ZISA 2A1TS 1XQYA 2JGNA 3DE0X 3OYMA 2IRWA 4N8EA 3RYHB 3TG8A 3PQ4A 3T3HA 4CCWA 1J5EB 5HS7A 1S7OA 4Z6YA 1QIGA 3COWA 3L1HA 2HA2A 1WXQA 3N8IA 1RKXA 3OX3A 3FXRA 1L7RA 1YQQA 4WKBA 1WU7A 3RRBA 4ZYLA 1KRWA 1U8RA 1FUKA 2AMJA 2QAIA 2J6CA 4JSTA 5TGZA 2Y1LA 4G09A 3FHLA 3DDCA 2FW1A 2HWVA 2X2FA 1GFZA 1UM8A 2IE8A 3UUWA 1ZQ1A 3F9KA 2R2GA 4KWEA 4OSOA 1GQYA 1Y6IA 1MJ5A 1RJ9B 2BFEA 2GI4A 2PHZA 2VJCA 3JQ6A 3QXJA 1DIBA 1BWPA 3LCRA 2GJ9A 4BNYA 4Q4CA 1E9VA 3AEYA 4BRZA 3AXTA 3FNEA 3ZHQA 3WRXC 1C4XA 1SOAA 3GIWA 4XORA 2VRBA 3HCDA 3R5KA 4NFLA 2P6TA 1GUYA 2WQ7A 1GU0A 3U1VA 4DB4A 4XLHA 5KYTA 1CY7A 3DBRB 2GXQA 5FHRA 4CQMA 1XMQB 1SVSA 3DKXA 2IHVA 4IJQA 4L73A 4RZUA 4TVSA 3F73A 1QFXA 3T3PB 2K3PA 2R93J 1F1JA 4NJOA 4HDCA 4A73A 3TL4X 3W6JB 4M6VA 3ETHA 3M6MD 1YI8A 4JOBA 4EJFA 3VH4A 3SVLA 1S6LA 4NHEA 2YIDA 4QLAA 2RHRA 4WOBA 2ECFA 2ZE8A 5FL7A 3WO0A 4B75A 3R8FA 1L4UA 2A3NA 3C15C 4Z9AA 1QBJA 5TR9A 3W5IA 5KYWA 4D4JA 4EKDA 2HT1A 3ADKA 4DC9A 4OBWA 1T38A 3JATA 2EDCA 5K3FB 5T67A 4E6KG 3FYCA 2WTNA 1P72A 3LX4A 4G4SO 4J0EA 4LG1A 4RF5A 4G5HA 5IDXA 1SHZA 2BFPA 4N5NA 1SKQA 3L7KA 4Q18A 5BWLA 4XK4A 1EESA 2Y27A 3LTEA 4YAKA 3A03A 4XMYA 3KZYA 1J4AA 4KLAA 1X13A 2AUNA 3G0BA 3MWMA 2O0YA 1YH3A 1ZFNA 3D6MA 1MZVA 1L4NA 1VIVA 5CVVA 2JK1A 4GO1A 4TYWA 4A5OA 1IV6A 4LRWA 3GVHA 4DJ5X 3ZLVA 3CWCA 4YQFA 2HOAA 4HMQA 2ZTLA 1B16A 2DK5A 1ISJA 4N4OB 2X6QA 5K03A 2BM8A 4CTNA 4UTNA 2LP4Y 4N5IX 5EZSA 3ZCQA 5EZQA 2FLWA 1HNNA 1ZELA 2XCIA 2ZBFA 3U0VA 5L4NA 1MC4A 4GKKB 1CP2A 1LE8B 1QYDA 1VF9A 2EFCB 4QU8A 4YJ3B 1W87A 2R8RA 2IVFA 4MGEA 2ZI6A 3MA0A 2EXXA 1Z7BA 3W6UA 2B4RO 1VJTA 4QATA 3GTJJ 2R84A 3AU9A 3KSDO 2PGOA 5KOYA 3NCHA 1D04A 1F8GA 4XB1A 1LSJA 1Y1VJ 2A92A 2YR2A 3H3JA 3IFSA 4L08A 4P31A 3A02A 4KNYA 1UJBA 4JP2A 3GW2A 2DF8A 2YOFA 1OW3B 2BOLA 3BL5A 3JVEA 4I9UA 3CX4A 4MEJA 5CLQA 5CTJA 2R6R1 4D7MA 3QE4A 4CM4A 1QQTA 2NGRA 5ERXA 1YI2I 1YR8A 2YN4A 2ZXHA 4RE5A 4DYHA 3I3LA 3DV0B 4NUBA 3O5AA 3FTEA 2B3TA 1JA9A 3ZXIA 3K4JA 1UBGA 2QLBA 3G2JA 4IS2A 1OXUA 3OZUA 3QM1A 1X42A 3HV2A 2BFCA 3BDAA 4F7ZA 2YZMA 3OE5A 4Q00A 5EE3A 3CGGA 2RD2A 4TWBA 3ZJTA 3ZNOA 4TSRA 1N5JA 2BDEA 4KWCA 2BHTA 3VV2A 3ZD9A 1VPVA 3WIOA 3TMKA 2FZLA 2LY2A 1M74A 2IP4A 4FEGA 5A4JA 3MVEA 3IP8A 2O8BB 1EZ4A 2P4HX 3UZUA 4B3XA 1LD3A 4DW6A 3OQ1A 3B1ZA 5JVDB 3SFVA 3QOYA 5HZHA 3CQZJ 2BGRA 3MLBA 3OHMA 4IIHA 4BEJA 3OVMA 3EA4A 3ND8A 3HY4A 3OWOA 4PXYA 1FBQA 5J5AA 2OBPA 4ZTZB 4A3FJ 3A05A 1MRSA 1REPC 1HE4A 1R1DA 2QN1A 3LCVB 2GF0A 3MXOA 4RH3A 2P3LA 2A9JA 1XU9A 1PZFA 2FP4A 3HXLA 4P93A 4BP1A 3OQNA 5LP6F 2FCAA 3WC4A 4WN3A 2JBWA 3H6GA 4KQFA 1U8UA 4UCWA 4LCBA 2VQ6A 1MC8A 5I7HA 4AO7A 4BNXA 1NQWA 4D8UA 1M0EA 2HPAA 3V4GA 4FXPA 1L4BA 1NNUA 1GDTA 5FI0B 4Y2XA 5HOQA 4TTSA 4UXJA 2G4VA 1EH5A 4GRDA 2B3DA 3GJ6A 1NYTA 1QUFA 3SS8A 5C1BA 1B72B 3L2QA 2W9XA 2XZTA 5L7WA 3ZE1B 2C03A 4LDQA 5K9ZA 3AERB 1AB5A 2HYGD 1QMPA 3ODGA 3RYPA 2FWPA 1R8XA 4NCXA 2QVGA 4PLYA 5IJXA 1NVWQ 1IVNA 2WOJA 3A1NA 3AL3A 3OM8A 2QQEA 2H1SA 4MQUA 1MB4A 3V3KA 1W94A 4HQOA 4HLXA 2IIQA 4ZODA 5TPZA 1FSGA 2E85A 2FQ4A 4EG5A 4M9CA 3AJDA 2WIFA 5DFAA 3BGWA 3HJUA 4EECA 2C61A 1KO4A 5IKEA 4DR4B 3DKRA 3UWKA 3PR1A 4FNOA 2Z9BA 4O8ZA 1RSZA 3NX4A 2Q28A 5JRZA 2SNIE 1BI2A 1Z4MA 2OK8A 2RB5A 3EUFA 1W36C 5M5BA 1KVUA 2BAGA 1QZYA 1SEUA 1E3JA 4RFSB 5KINB 3BD7A 4DA7A 1Z1DA 3IHLA 4RY8A 4UAUA 3ZGOA 3CT4A 5KYKA 1CBUA 1OX4B 1IDZA 3PZBA 4KRXA 2OBYA 3FYUA 4IMJB 1PYOA 1KZ1A 1Y81A 3O7MA 2AJDA 2BF7A 3C48A 4CLRB 3F72A 1YUMA 5AW6A 2ZM6B 2Z6QA 2BRUC 3QX8A 3MWJA 4RLFA 4UTZA 3LQFA 3VYWA 3PXXA 1BJZA 3TE7A 4N5DA 4YEDA 4P3XA 2XTMA 3I01M 1QGYA 1R4NA 1TWFJ 4HDSA 3ZEIA 2X0IA 3B36A 3I04M 3STXA 4D2IA 3FB1A 3I2FA 4CUKA 2Q7OE 1QM5A 2C5AA 2N0SA 5FNVB 2FPPB 2O9LA 2JGIA 2OCYC 5AONA 2ZTUA 4EPWA 1M1UA 2BXZA 2DTXA 2VXBA 4IY1A 1X8LA 1L4GA 2Q27A 4FLEA 4HEJA 5CHEA 1IXSB 3EOAI 1OYOA 3GFPA 4KBFA 4X91A 2X0RA 1L3BA 4BMYA 1YTUA 3SGLA 1U5CA 5REQB 1YIOA 1YACA 3HKDA 3UOAB 821PA 2JQ7A 3S16J 1U2ZA 1R2QA 1VHQA 2C4KA 5IZCC 3TQTA 2D1TA 1JYEA 4KV9A 3GA7A 4GBED 1JV2B 3L92A 1RI7A 2Y0SA 4QG3A 1A36A 4PFSA 4CG1A 5AW0A 1BOBA 1F48A 2IA5A 3R6LA 2FI1A 3M1AA 3RIRA 4GKAA 1CY6A 2EBWA 3CJRA 3FB4A 4O4JF 3KG2A 3FJYA 4OYHA 3ZVLA 4AWXA 1NF8A 2GTHA 4DNQA 1MGOA 3DZHA 1T5IA 3ZYZA 4L72A 5DUKA 3EVBA 2WJ3A 3WLHA 2WT4A 4PYQA 3AIOA 4YHHB 3OZSA 2REQA 3USZA 3KLBA 3CG0A 4BJ1A 1MO3A 7MHTA 2DKFA 3WKDA 2G9NA 4KO2S 4DT1A 4MMXB 4CLOA 3FTFA 4DZJA 1NJ6A 2B1GA 4BKXA 2PUVA 4XCXA 4YDSA 3SEAA 2GF2A 1W85A 3AV3A 3VJLA 5TEWA 3KCNA 1Q44A 4C2BA 2QMEA 3BWBA 4A6EA 4FDVA 2P2SA 4HGQA 3MOGA 5JCJA 4BLTA 4ENPA 4O6VA 3ST7A 3AP3A 4RZ2A 5H68A 2GPBA 4OAQA 3V46A 2JTVA 3D0RA 5KQSA 1W96A 3ELYA 4OQDA 2ZJZA 3RAEC 2QT0A 5DBFA 2IPMA 4MTDA 3FKJA 1WWXA 3YASA 5BV8A 4CEIA 2C2KA 1IC6A 3IHUA 1KP3A 1U28A 4RD1A 3I9NA 2ZC2A 1ZICA 4F3TA 4M54A 3KX2A 1NDHA 1DBQA 2XAFA 1NVBA 1ZIYA 4IWNA 1EI9A 3AZPA 4ZT4A 9LDTA 4JVOA 4ARZB 4CF4A 1KZGB 1H1LA 1VHLA 2GD6A 3EZFA 3HCOA 1JXSA 3FTNA 4QBIA 4URXR 3WGKA 1F9EA 2G6BA 3FSRA 3OX2A 3VSCA 3EPHA 3ZV5A 1C8LA 5EIBD 1TZJA 2R6CA 1FMCA 4KK4A 3DKVA 3JR7A 2KLOA 1NKVA 1BHQ1 1O6BA 3R44A 1WXGA 4OHBA 4ECEA 1FBUA 2VJDA 3BAZA 3FPSA 3FMSA 1XFDA 3DD1A 5EJEA 2F4NA 4L8GA 4IOCF 2STWA 3IALA 3WDLA 1E3WB 2HRZA 3D8TA 1GRNA 3ZZNA 2AG8A 2BY4A 4AT1A 4DMUB 1IM8A 1E4VA 2W6OA 3KJZA 1SFKA 1CT9A 3L8EA 2VXZA 2MR5A 1ZNQO 4N12A 4CIYA 3PFBA 5KTRA 2EF0A 3DLCA 4PSCA 3VPFA 3CLRC 3BH7A 5JSZA 5EJ8A 2PH1A 1SD2A 5CVCA 3JVDA 2HK6A 4NC7A 2XMRA 1RXCA 4KIUA 4MIOA 2O8CB 3HOZJ 4HSRA 5IT5A 4Y9DA 5CA1F 2K9SA 3U3ZA 2DAOA 3RKSA 3GZNB 2YWGA 1I94B 1XS9A 4QLOA 2C07A 4JOCA 3AM4A 4RENA 2FA9A 1EB9A 3HSYA 2ILTA 3IMEA 2E71A 1PYGA 3CG4A 1E3LA 4I1VA 5ELLA 1Y0BA 3VU9B 5HIIA 1NYLA 3BPXA 2RKBA 4BNFA 1I6HJ 4E3ZA 1V48A 2ARKA 4NARA 5C31A 5TE9A 4DIDA 2A0YA 1Z3CA 4REMA 3TIFA 2FLKA 4JX6A 3FFXA 3LDFA 2A6TA 1YDFA 2PKRA 5A2GA 3SJZA 3LO5A 4KQJA 1GD1O 2FFQA 4WECA 3V33A 4DA9A 1P1BA 4FMDF 4BB5A 4L6CA 3W8FA 3IBFA 1HA8A 1YHQI 2ONKA 2NU6A 1REQA 4YV1A 5KNCH 2BI4A 1PSWA 4TL9A 5DZSA 2OYCA 2GJAA 5HE8A 4WY8A 3V8VA 2PBRA 1SQ0A 1U0TA 3E22A 3GEMA 4EUHA 3JZAA 3FMGA 3BXEA 1Y9AA 2LOOA 3LCJA 1QH0A 2A9KA 3NO4A 1LFAA 2DFFA 1HTBA 1P2SA 5D5WB 4LLGF 4D0PA 1TYDE 3CINA 5GAJA 4FNGA 2GRJA 2VP0A 1U5AA 2E7WA 1H2ZA 3F22A 2FX5A 1SG6A 2NTVA 1F06A 2O0JA 2QG6A 1W7PB 4L3VA 4PNPA 3KD3A 1B0ZA 4C0BA 2W2TA 4K6GA 3MW8A 4AC9A 4Q9AA 1PN3A 1UCFA 1C9DB 5BUSA 4AG5A 3ZCTA 1N6NA 2HX1A 3P4UA 3R3UA 3ICCA 5KZMB 3JALA 1G291 1UMDA 3UKOA 1E1QD 1ECGA 2XMQA 4YV7A 1KAOA 1E2PA 4BAYA 4ABTA 1DXQA 5DYNA 3CUQC 1JFVA 3K6GA 2C2MA 3ORQA