4PGNA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein, family 7
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Transport protein
total genus 111
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pgnA00
5IM2A 4OVRA 4DI4B 4PBQA 4MHFA 2ZZVA 4OVQA 4MX6A 2XXKA 4PFIA 5I5PA 4MIJA 2WX9A 4PETA 4OANA 5IGAA 4MNIA 2XWVA 2HPGA 4LN5A 2WYKA 4MCOA 4PC9A 4OVSA 4PBHA 4OVPA 4NG7A 4OA4A 2VPNA 4MNPA 4PDHA 2XWIA 2XWOA 2ZZWA 4MEVA 5LTCA 4N17A 4MNCA 4MMPA 4XEQA 2PFYA 5IZZA 2HZKA 4PDDA 4YZZA 4O94A 4PAIA 2HZLA 2ZZXA 4NN3A 4XFEA 4P8BA 4OVTA 4PFBA 4PFRA 4PF8A 3B50A 4N4UA 4X04A 4NGUA 2XA5A 4NHBA 4UABA 4MAGA 4DI3D 2V4CA 4PF6A 4P3LA 4PGPA 4N15A 4P1LA 3FXBA 4N8YA 4O7MA 4N6KA 2XWKA 4P9KA 4YICA 5I7IA 4NAPA 4N6DA 2CEYA 3GYYA 4X8RA 4PAKA 4NQ8A 4P56A 4XF5A 4PCDA 4PGNA 4N91A 4PE3A 2PFZA 4O8MA 3U65A 4NF0A 4NX1A 4N8GA 4P1EA 5CM6A 2VPOA 2WYPA 2CEXA 4P47A 4PAFA
chains in the Genus database with same CATH superfamily
3D4GA 4F1UA 4PBQA 4QSDA 3HFUA 3T93B 2XX9A 4HXVA 4OETA 4POXA 3MPLA 1DTGA 3T9HB 3TAJA 3CSBA 1NV4A 2P3NA 3K1MA 4JSOA 1J1NA 1IMAA 1DPEA 2REJA 2VT5A 3F11A 2RINA 4F39A 2M8CA 3KOSA 1L5TA 4Z0IA 3U93A 4NF5B 1Y3QA 3SEWA 2HXRA 3VVEA 2O7IA 1GVCA 5FHMA 3SEYA 1EYJA 3KC1A 4O3CA 1QUKA 1IZ1A 5ISUA 4PP0A 4R74A 3IB1A 3U8QA 2DE3A 1PC3A 3PPRA 2ZYKA 1B05A 3O6HA 4YKKA 1BKAA 3H6UA 2OX3A 4P0IA 1B6HA 4P1LA 4O7MA 1LBBA 2FYIA 2JJKA 1IEJA 4U4XA 1I6QA 3R26A 3A29A 5EQAA 3MAMA 4EXKA 3O29A 1R9QA 4R73A 1M5CA 3IFCA 1AL3A 4FORA 4O7IA 2CMOA 4OFLA 4QFPA 3T0JA 1MPCA 4Q0CA 4BDRA 3RGYA 1WDNA 4EDPA 3KJTA 3PMXA 3MZ9A 1NNPA 1Q35A 3OO6A 2H98A 1B5IA 1O63A 4PAFA 3C34A 1PDAA 3L6GA 3IO4A 3LSWA 4MLQA 3TQLA 1DK4A 2OZZA 2XXWA 4OVQA 4YKJA 3N94A 1CE2A 3HSTA 2IEEA 2ZYNA 2F3BA 5I59B 4ELOA 3JZJA 4OANA 2RF1A 2ZYOA 4N81A 1P1QA 1Q9DA 3FJMA 2GQ1A 4ND9A 1MS7A 3FJ7A 4NG7A 1XHYA 2QPQA 1NKXA 5TU0A 1MXVA 3VLUA 5DVJA 2QS2A 2W7YA 3MQ9A 3IB0A 1PEBA 2Z8DA 1GGGA 2V25A 1ELJA 5DTBA 2IA4A 1CB6A 2B3FA 3MJNA 3OSRA 1IQ7A 4H45A 2DVZA 2RC7A 4JXIA 4PF8A 4RY1A 5B7DA 1NUYA 4RK9A 2DVCA 4NE4A 3TCHA 3VXBA 1A55A 4WKMA 3THIA 4ESXA 3M3FA 1ZKBA 2KQZA 2I6EA 2F78A 4F3PA 2XX7A 3BIGA 2D5WA 1Y9UA 4G68A 4LA9A 3U65A 3K00A 4U21A 3EF7A 1M5BA 2CZIA 1DCUA 4IO6A 1BIYA 4F31B 1TFDA 3KEIA 2WYPA 1B58A 4N13A 1II5A 5B70A 2O68A 4R6HA 1S50A 2YJPA 2F34A 1A8EA 4KYSA 4H65A 2PBWA 4QHQA 5TPAB 1YCJA 3DELB 3IOVA 5H8FB 3LC8A 4MLVA 2WX9A 5AA2A 1UIVA 5I84A 1IMCA 2VPNA 4R2FA 1NH7A 1D9QA 5H8QA 1SW1A 4BDOA 4MNPA 1Y1MA 3W9VA 4MNCA 3TZAA 4BDMA 3S9LC 4PDDA 5HBCA 3DP4A 1FQAA 3ONMA 5L9SA 4LVQA 1XOCA 2VD3A 1DPPA 2I48A 4EQ9A 4N4UA 1YTVA 3DP6A 1XVXA 2RC8A 4FE8A 5ICTA 1MQGA 1A7LA 2Q88A 4GWSA 4KQPA 4JVIA 3C36A 3MZBA 3A3CA 2QMWA 4P56A 3FZVA 1N0TA 4QFNA 4LUBA 1FTAA 3HPIA 2GRVA 3KN3A 3KSJA 1G0HA 3MVZA 5L9MA 4MF3A 1MDQA 1B7HA 1N3WA 3P7IA 1LBXA 5IZ1A 5CC2A 4GRKA 5FTHA 2O6AA 4IGTA 2MKZA 1IXIA 3N6TA 4PFYA 3C4MA 3BFUA 4OTEA 3PTYA 1INPA 3DLNA 3T9XB 1LAGE 4NF6A 3T96B 1QUIA 5K2XA 3RTWB 4RPOA 3KSXA 2F7AA 1N04A 4OWDA 5IGAA 3N26A 1VR5A 1OVTA 3UGWA 1LBVA 3UIFA 4OVPA 2ZNUA 4GWXA 2GH9A 4G2ZA 2D21A 1K9ZA 2XXUA 4OFOA 5J16A 3MYUA 3VE1B 3C35A 3Q29A 3G3FA 4G68B 2PFYA 4NF4A 4P11A 3KBZA 2HZKA 1B4HA 2O7UA 1LAFE 3PGFA 4Q8RA 1MQHA 3VLVA 1Y4TA 2OLBA 3U72A 4ZEIA 2VOZA 3B6QA 4H46A 1LFHA 4FEDA 4KPTA 4NHBA 4DLDA 1QUJA 3O66A 4I8CA 3GYYA 1MXUA 3VXCA 5AA2B 2ZMBA 2KLFA 1A8FA 3CSGA 4JWXA 4I40A 4JVDA 2FIXA 4OHNA 4FAJA 2B4MA 1B4ZA 4HE0A 4HTGA 1B3HA 2VP1A 4P1EA 1MQIA 2VGQA 3CR9A 3E79A 1LSTA 1MH4A 4EQ7A 1MXYA 3ECRA 2F97A 5AA2D 4GWOA 3TKDA 2F5XA 4G8MA 1POY1 3FXQA 1N76A 5CI5A 2XXRA 3MP8A 3CRBA 4JVCA 2ONKE 4R2BA 4OFJA 1B1XA 1LB9A 3V5AA 4TLMB 4ZS9A 2PVUA 2QRYA 4RJZA 4U1OA 1QJMA 3S9MC 2ESNA 5M2VA 5AA4A 1DOTA 1R9LA 5TP9B 4DXCA 5LDZA 3SDFA 3H6WA 1Y3NA 3PPNA 1UIUA 3MC2A 1QGXA 3O9PA 3FV2A 3OXNA 2D3IA 1SYHA 2F6PA 2UVGA 5H8NA 3TPAA 1B32A 2P0SA 2OWTA 4GBVA 4RYAA 2VHAA 4NN3A 3QYTA 1H43A 4LP2B 1NNKA 2V93A 2XXHA 1SI1A 2V4CA 3DM0A 1FPEA 1URSA 4F18A 4H8JA 4NF6B 1JW1A 4WEPA 3SEXA 5J1DA 1B1HA 2BJIA 5I58A 5ESYA 3C9HA 3IOWA 3T66A 3UN6A 1Y20A 2QMXA 4HCWA 1LFGA 1MQDA 1EZOA 1FCKA 2DWIA 2XXYA 3T22A 4NX1A 2HXWA 3KC0A 4NF8B 1MPBA 4PTKA 1OLCA 3SEVA 5H8HB 3EHTA 2XD3A 4H5GA 1JVXA 4GWZA 2UYFA 3QXMA 4GWUA 5CMMA 1FPGA 3M3LA 2PCRA 3PPPA 3CFZA 4KFQA 4PE5B 3H03A 1JW4A 2O51A 1AMFA 2XXIA 1QVSA 2XWVA 4ELQA 4EQBA 1EZ9A 4AS5A 4LN5A 1IITA 2O1MA 2R8TA 2V84A 4PBHA 4IO3A 1UTHA 2QS4A 4JSDA 4ZZAA 1IMBA 2XWIA 2XWOA 2NVUB 1FQBA 2Q9TA 2HEUA 4GX4A 5IZZA 4DCXA 3SESA 1Y4CA 4FBPA 1YZ0A 3TTKA 1POTA 3N6UA 3HN0A 1UTBB 4KI0E 3TTMA 1RDXA 1H76A 3K02A 3ISPA 3EKIA 2OBGA 3VVDA 1FBPA 2O1LA 3BIHA 4G68C 3S4UA 3PU5A 1NMUA 2XXXA 2Z8EA 5ET8A 4XXUA 3IX1A 3UORA 2DXRA 4JBZA 4GX3A 4YB6A 2F7CA 3H6VA 5DT6A 4DDDA 2QFLA 3EHSA 2ONSA 4ESWA 1P1NA 3MWBA 3I5OA 3I3VA 3FATA 4N8GA 1B5JA 3FVOA 3W15C 4DE8A 4G61A 4ZEKA 4QFLA 3FIRA 3E3KA 1DMBA 1FQEA 5K2YA 2AL4A 2DOJA 1BLFA 3O6IA 4G8NA 2PX1A 5KCJA 2ZZVA 3K6UA 4ZE9A 5CMKA 3QIMA 1OVBA 3H3GA 5ET7A 4E0XA 1JW5A 5F7VA 2I3WA 3K6WA 1M5DA 5KDTA 4Z7EA 4C1UA 2ABHA 3JV9A 1M5FA 4MEVA 1LFIA 3Q28A 5JTYA 3OMBA 2OCUA 4N07A 2Z23A 4IY5A 1K9YA 4OZ9A 4YZZA 1QKBA 1SW5A 2RKMA 1S9TA 3G3GA 5JK4A 5ET5A 2HAVA 1OQHA 3MP6A 1JP4A 3QSLA 2Q74A 3M8UA 1FBDA 2FA7A 3H6TA 4OEVA 1DSNA 3QUJA 2RC9A 5I2KB 4R75A 4Q5TA 4DIGA 3TELA 3TMGA 1GTKA 3PUZE 2QJEA 4ONYA 4OYVA 5AA3A 1JETA 3C32A 4YB5A 3KN7A 1NL5A 3CI8A 3FXRA 2O69A 1CNQA 5EYFA 1ZIUA 4FATA 4LQ5A 4GIZA 5CMBA 3ZS6A 2LAOA 4YKPA 1MM7A 4F3GA 2DS9A 5DVFA 1SDXA 3CG3A 1ZBMA 4LZ8A 1RDZA 4F1VA 3IR1A 3B6WA 3O97A 4MHFA 3KZGA 1IXHA 2F35A 2REGA 1QKAA 1TFAA 1A40A 3QMFA 4PETA 4F3SA 3T9UA 3CIJA 3TODA 4PFTA 1ZMGA 4MCOA 4PC9A 4OVSA 4EXLA 4R6YA 1BTJA 3B7DA 5A5XA 3TUSA 3VVFA 4POWA 4QFKA 4GOTA 2WKYA 1B0HA 3MVXA 5DW8A 5EQ8A 3ILTB 3G3HA 5F1QA 3WAFA 3V8XB 3KG2A 2OWSA 4O94A 3PUVE 4Q30B 3G3KA 2ZZXA 2H5YA 3HCQA 3ZKLA 3D1RA 2XA5A 5KCJB 3VDFA 2Q2AA 3BBRA 3UA8A 2XWKA 4KXPA 4P9KA 3K1NA 1Z7ME 2CEYA 4X8RA 3DP8A 4OESA 1HSEA 4U4SA 4F2QA 2HFBA 1B40A 4JB7A 5FBPA 3KN8A 3K6XA 4O8MA 1MM6A 2B3BA 2XXQA 3HO7A 1XC1A 1JQFA 2PT1A 1P1OA 4ZZEA 1NV5A 4WXJA 2H9BA 1YAEA 2R71A 2OJTA 4O3BA 1US4A 1LCTA 4H5FA 3FJGA 3EQ1A 1I6AA 3TTNA 4IR8A 4ECFA 2DSFA 3L6HA 4DXUA 1PBPA 4QSCA 5I5PA 3CFLA 4ISUA 3FV1A 1XS5A 2I0BA 5EYHA 5F24A 3ILUB 4MNIA 3PUWE 3TCGA 3VFJA 2WYKA 2THIA 4OA4A 1TT1A 2FNCA 4X1BA 3IFAA 2O84X 1MXZA 1O7TA 1N7WA 4N17A 4MMPA 1NFTA 4XEQA 3H7MA 3MBPA 3G3IA 3IJOB 1Y1ZA 4GL0A 4RA1A 2HQ0A 1FPLA 1MY2A 3TDJA 1VE4A 4I1DA 2UXAA 4XIGQ 2B65A 2ZXTA 4XFEA 1F9BA 2FIEA 1NV3A 2HCAA 3B50A 1I6BA 4C0RA 4GQOA 2G93A 4UABA 1KA0A 4I3EA 1BP5A 3ODBA 5JEIA 4F19A 4LONB 1EYIA 1MDP1 3VLWA 4R9FA 4N6DA 1SVXB 2FHYA 5FHNA 3IAZA 4PE3A 1AWBA 5A5XB 5I56A 5DVIA 3SETA 1SPIA 3N5LA 3RNNA 5CM6A 4I9DA 4H1XA 4ZEBA 5DYHA 1MG1A 3LSFB 3JYRA 1P1UA 3ZKKA 4MH5A 4ZEFA 3K2DA 1FPBA 1SD3A 2XXKA 5H8QB 1TXFA 3FD3A 2QSXA 1H3DA 4HE2A 4GXAA 1IMDA 4KYEA 4MFIA 2Y7RA 3KGCA 2HPGA 1P99A 2FVZA 1M5EA 3IORA 4NTLA 2NXOA 2QL3A 3A09A 1VDWA 2P2AA 4IO7A 5I57A 3K01A 2HZLA 5FTIA 3K1PA 3SZPA 3FVNA 2X7QA 3Q26A 4P8BA 4GVOA 4NF5A 3ZSFA 3S2VA 4NEDA 4FJPA 4GD5A 4PF6A 3U1OA 1RYXA 4ZECA 2Q89A 4DXBA 4PCDA 1MXWA 5IZ3A 1AH5A 4U1ZA 1NV1A 1B46A 3RTFB 3R7XA 3I6VA 3IL1B 3OELA 2V3QA 3HHGA 4OERA 3SERA 1FJ9A 4C1TA 3T1BA 1Y3PA 1O64A 3PUXE 1D4NA 4OENA 1DBZA 5IM2A 4AS4A 4OVRA 4JDFA 1MY3A 1LGBC 3U94A 2QVRA 4YB7A 3HHFA 5DEXA 3Q25A 5I3SA 1LBZA 4GWYA 1NV6A 2PT2A 1G0IA 4RNSA 3OEKA 1FPKA 4NF4B 1NNTA 2I49A 5L8DA 4L17A 4BDNA 4X9TA 3UK4A 5HPQA 4H8IA 4R6KA 2AYSA 3GBBA 3E13X 3K4UA 3TFLA 2ZZWA 1S7YA 3PV0E 1MH3A 5I59A 3PPOA 3VV5A 2QS1A 3WAEA 2KR0A 3PMWA 5ET6A 1FSAA 4X48A 5ITOA 1SBPA 1LBWA 1MPDA 4F29A 1USYE 4U2RA 1VFEA 4TQUQ 4KR5A 4ZEDA 4LZ7A 1FBGA 4OQOA 1MY1A 1NH8A 2QS3A 2Y7PA 2DE2A 5CRYA 2V3TA 1FTOA 1LBYA 5T3JA 1YYZA 3TYHA 2Y84A 4TLLB 4ELRA 4QBAA 4PAKA 1D3KA 4XKQA 4PGNA 1FTKA 2UYEA 4N91A 4IO5A 1ATGA 3RT8A 2AIXA 1XVYA 3LSLA 4LZ5A 2V3UA 4F22A 3USDA 4P47A 1NUXA 3CHGA 4DCYA 5I57B 4DI4B 4GLIA 2OWZA 1JEVA 3NOHA 3RT6B 1URGA 3CFXA 5AA4B 1JVYA 3K6VA 3B6TA 4GX6A 3PUYE 4MX6A 1QULA 4H6DA 4LATA 5AA1A 4IO4A 4F2OA 4GXSB 1MRPA 1B51A 2A5TA 2ALUA 1GV8A 1IMEA 3KFMA 2Q8JA 1R6ZA 1BK4A 5EQ7A 2Y7IA 5TPAA 1H44A 5H8NB 3ROJA 1YPNA 4XKRA 3OENA 4HW8A 3K0VA 5H8FA 5IZ3B 3V89B 4BDQA 1FBHA 4IGRA 4LQ2A 1GR2A 2ZNSA 1EYKA 1EH3A 1JNFA 2G29A 4P0GA 2DXYA 4GBWA 3OD7A 1B9JA 3RQTA 3T9VA 4GFRA 5I58B 4G77A 4K3FA 3W9WA 4YKIA 2Q2CA 4X04A 1NNFA 4HE1A 3G7WA 5DEXB 3SKPA 2Z8FA 3FASA 4YICA 2XXPA 3IB2A 5I7IA 1FJ6A 4PQJA 3LV0A 3IOTA 4X1DA 4AB5A 3V83A 4HS7A 2PFZA 1PB9A 1RYOA 2Z22A 4GF8A 1RKMA 3FGSA 1MQJA 2F36A 3BKIB 2RCAA 5EQ9A 4MJOA 5CBSA 1PB7A 2DP8A 4M4GA 1NV0A 3BFTA 1I69A 2P3VA 4YMAA 3GBAA 4GL8A 2CZHA 1UTHB 1FBEA 4ELPA 5KZTA 1B52A 5I2NA 2H25A 4NWDA 1FTJA 3KOTA 1FQFA 5IKBA 1LEVA 2YLNA 5LOMA 1FPIA 4JWOA 1OIBA 2F6GA 3QK6A 3MW0A 4FEBA 3C33A 2R6GE 3RPLA 3HV1A 4DZ1A 1FPFA 1IIWA 3TQWA 1FBFA 2YPNA 1FQCA 4PAIA 4OEUA 1HSJA 4PFBA 3LSXA 2I0CA 5A5LA 2ZYMA 4OMBA 3H4ZA 2X7PA 4OXVA 1WODA 1B2HA 4U23A 2A5TB 3MZ1A 1SW2A 1LBCA 4QXDA 2NOOA 4F3BA 1OQGA 3R6UA 4QF9A 1XT8A 1FTMA 5ELVA 2DQVA 2CZLA 2GHBA 4XKNA 4MBPA 3CG1A 4N6PA 4F1YA 1VSOA 5EHMA 1N7XA 1Z7NE 2UVJA 2QVUA 1TWYA 2XD2A 2Y5LA 5ITPA 2I3VA 2L5VA 4O3AA 4PFWA 1LB8A 4NF0A 2WBBA 3TCFA 1MY0A 2Y7KA 3C31A 3PD8A 2F8DA 3QAXA 2XXVA 4HCYA 1NUWA 2I4CA 4BLAA 5KDTB 2AL5A 4THIA 4QRZA 4ZE8A 1B5HA 1T0KA 3MPKA 3EHUA 5JTYB 2A5SA 3E78A 4KCCA 4G8HA 3RN8A 1ZJLA 3GZGA 4H0WA 5BWJA 1KWHA 2B4LA 3EN3A 1ZU0A 2WEFA 3OO7A 1N3XA 1KZ8A 1LAXA 4I3YA 3IO6A 2UVHA 2F7BA 4IB2A 3RPWA 1D9VA 3H06B 5TP9A 1Q1KA 3GLBA 4FIMA 3GXAA 1R1NA 2Y7WA 5ICQA 1AIVA 1UQWA 4XTCQ 1AOVA 2PMSA 4PFRA 4NMYA 2DYXA 2E1SA 1A99A 1SQYA 4NGUA 1LCFA 1LAHE 2Y5KA 4P3LA 1FQDA 4KD5A 1FPDA 4N15A 4N8YA 3RUMA 5I2NB 3KJ7A 3OO8A 3M3KA 4U22A 3PMVA 3RLFE 4RK2A 1P1WA 1NUZA 2PYYA 3KBRA 4OVJA 2NUVA 1RDYA 2XHDA 3FUZA 4QSEA 2WBDA 3RYDA 5HM4B 3RPLB 2CEXA 4UA8A 1PBQA 1QW0A 3LUYA 2XXTA 3FXUA 5EHSA 3MVYA 4NF8A 2I4BA 4PFIA 1N84A 5H8HA 2DWAA 1FBCA 1D9YA 4YU0A 4I62A 4ZDMA 1PB8A 4KCDA 1KA1A 1FW0A 1B3GA 4PDHA 3IK6B 5LTCA 2DE4A 2BJJX 4R9GA 4R72A 4NWCA 3OOAA 2I58A 2H4IA 1IXGA 2ONRA 5EYGA 3CVGA 4IY6A 3RY3A 1FPJA 1MXXA 1NI9A 4OVTA 4PFUA 1YXIA 3TTLA 3O28A 4YAHX 2HAUA 2ZNTA 4MAGA 3TTRA 3OSQA 1IXCA 1US5A 4NAPA 1UTBA 2XX8A 3MP1A 4BDLA 2GHAA 4M1VA 4WEDA 3D4CA 3FBPA 4NQ8A 1SW4A 5H8SA 3QUFA 5AE4A 3S9NC 4XKPA 1NV7A 1IUDA 1EU8A 2Q8MA 4FECA 3UP9A 3LR1A 3SEUA 4AQ4A 2CZKA 3MSTA 4IO2A 4JWYA 1SYIA 4EF2A 2FBPA 1B7ZA 5L9OA 2DDKA 1A54A 5BUUA 1LLSA 1VFDA 4KYDA 2RCBA 4UACA 1B0LA 3O2AA 1URDA 1MY4A 2DWHA 4MIJA 2HHMA 3FVGA 1FTLA 4QFOA 4GWWA 4G4PA 1ANFA 1JEUA 3OEMA 3AXFA 2R9JA 3G3JA 3IJXB 3MVWA 3O6GA 4E0WA 3S9EA 4KHZE 1B7UA 1B3EA 3IOUA 3OO9A 3PPQA 1XI6A 3MUQA 3Q27A 1B3LA 1OMPA 1OLAA 3B8BA 4EUOA 5IAIA 2P1SA 4RXLA 2ANJA 5CBRA 3FVKA 1ZLQA 1IMFA 1H45A 3LUZA 5FHOA 2GFEA 1FRPA 2E0SA 5CMCA 2F3DA 3LBSA 4DI3D 4TOZA 4PGPA 4RPNA 3FXBA 4AB6A 5I56B 4N6KA 3A3UA 1B3FA 2H99A 2QVVA 4EF1A 4H67A 2UVIA 3E4RA 1EZPA 2DWJA 4YMBA 4XF5A 3TEPA 2OK2A 1ZTYA 1HSLA 2X26A 5I2KA 1NV2A 3E9XA 1SI0A 1WVJA 2NWJA 1DTZA 3EPEA 2VPOA 3PD9A 1USYH 2VD2A 3U92A
chains in the Genus database with same CATH topology
2P3VA 4F1UA 4PBQA 2F5XA 3HFUA 4HXVA 2CZHA 4IR8A 1FBEA 5I5PA 1NV4A 2P3NA 4JVCA 5EYHA 5F24A 1IMAA 4MNIA 2VT5A 2WYKA 1LEVA 1FPIA 5LDZA 4OA4A 3IFAA 1QGXA 4N17A 4MMPA 4XEQA 2HXRA 3RPLA 1FPFA 1FBFA 1FPLA 1EYJA 3KC1A 4PAIA 4GBVA 4NN3A 4XFEA 2FIEA 1NV3A 4PFBA 3B50A 2DE3A 4UABA 5A5LA 2V4CA 2OX3A 1FPEA 1KA0A 4F18A 4P1LA 4I3EA 4O7MA 2JJKA 4F19A 5J1DA 1EYIA 2BJIA 3A29A 4N6DA 4QXDA 5EQAA 2FHYA 5ESYA 3IFCA 4HCWA 4O7IA 3T0JA 4PE3A 1AWBA 4NX1A 1SPIA 3KC0A 2QVUA 4PTKA 5CM6A 2Y5LA 2L5VA 4NF0A 4PAFA 2WBBA 4GWZA 4GWUA 1DK4A 1FPGA 1FPBA 4OVQA 2PCRA 4HCYA 1NUWA 2XXKA 4HE2A 1IMDA 2F3BA 4OANA 4N81A 3E78A 2XWVA 2HPGA 1Q9DA 4AS5A 2GQ1A 4LN5A 2R8TA 4PBHA 4NG7A 2B4LA 2QPQA 2FVZA 2WEFA 1IMBA 2XWIA 2XWOA 1KZ8A 4I3YA 2Q9TA 4GX4A 5IZZA 1VDWA 4FBPA 1YZ0A 2HZLA 3SZPA 4P8BA 4H45A 2DVZA 4PFRA 4PF8A 1RDXA 4NGUA 3ISPA 3EKIA 1NUYA 2Y5KA 4PF6A 4P3LA 4N15A 1FPDA 1FBPA 3BIHA 4N8YA 5ET8A 2KQZA 4GX3A 4PCDA 2QFLA 3BIGA 5IZ3A 1NV1A 3U65A 1NUZA 2V3QA 4N8GA 2CZIA 1DCUA 1FJ9A 1RDYA 2WBDA 3T1BA 4G61A 3RYDA 2WYPA 3RPLB 2CEXA 1DBZA 5IM2A 4AS4A 4OVRA 2QVRA 2ZZVA 4PFIA 5I3SA 1LBZA 4GWYA 5ET7A 1NV6A 1G0IA 2WX9A 1FBCA 1FPKA 1IMCA 1KA1A 2VPNA 1D9QA 4X9TA 4MNPA 4PDHA 2ZZWA 4MEVA 3W9VA 5LTCA 4MNCA 2DE4A 2KR0A 5ET6A 1FSAA 4PDDA 1K9YA 4YZZA 5JK4A 5ET5A 5EYGA 1LBWA 1FPJA 1JP4A 1NI9A 4OVTA 1YXIA 4N4UA 2Q74A 1FBDA 4MAGA 1FBGA 2DE2A 4GWSA 1LBYA 4NAPA 4JVIA 5T3JA 1YYZA 4M1VA 4QBAA 3FBPA 4PAKA 4NQ8A 4P56A 4PGNA 1FTAA 4N91A 1NV7A 2Q8MA 1CNQA 1G0HA 2CZKA 3MSTA 1LBXA 5IZ1A 2FBPA 2DDKA 4P47A 1NUXA 1RDZA 3CHGA 4DI4B 2MKZA 2OWZA 3NOHA 4F1VA 3PTYA 4MHFA 1INPA 4GX6A 4MX6A 3QMFA 4MIJA 1IMEA 2HHMA 4PETA 5IGAA 1BK4A 5EQ7A 4GWWA 4MCOA 1LBVA 4PC9A 3ROJA 4OVSA 4OVPA 4GWXA 1K9ZA 5J16A 3MYUA 1XI6A 5IZ3B 5DW8A 5EQ8A 2PFYA 3B8BA 1FBHA 2HZKA 3KBZA 4O94A 1EYKA 1IMFA 4GBWA 3LUZA 2ZZXA 1FRPA 3W9WA 4H46A 4X04A 2F3DA 3D1RA 2XA5A 4NHBA 4DI3D 4HE1A 4PGPA 3FXBA 4N6KA 2XWKA 4KXPA 4P9KA 4YICA 5I7IA 2QVVA 1FJ6A 2CEYA 3GYYA 4X8RA 3LV0A 4XF5A 5FBPA 2PFZA 4I40A 4JVDA 2FIXA 4O8MA 1NV2A 2B4MA 4HE0A 5EQ9A 1NV5A 4MJOA 4P1EA 2VPOA 3E79A 1NV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IM2 A;  4OVR A;  4DI4 B;  4PBQ A;  4MHF A;  2ZZV A;  4OVQ A;  4MX6 A;  2XXK A;  4PFI A;  5I5P A;  4MIJ A;  2WX9 A;  4PET A;  4OAN A;  5IGA A;  4MNI A;  2XWV A;  2HPG A;  4LN5 A;  2WYK A;  4MCO A;  4PC9 A;  4OVS A;  4PBH A;  4OVP A;  4NG7 A;  4OA4 A;  2VPN A;  4MNP A;  4PDH A;  2XWI A;  2XWO A;  2ZZW A;  4MEV A;  5LTC A;  4N17 A;  4MNC A;  4MMP A;  4XEQ A;  2PFY A;  5IZZ A;  2HZK A;  4PDD A;  4YZZ A;  4O94 A;  4PAI A;  2HZL A;  2ZZX A;  4NN3 A;  4XFE A;  4P8B A;  4OVT A;  4PFB A;  4PFR A;  4PF8 A;  3B50 A;  4N4U A;  4X04 A;  4NGU A;  2XA5 A;  4NHB A;  4UAB A;  4MAG A;  4DI3 D;  2V4C A;  4PF6 A;  4P3L A;  4PGP A;  4N15 A;  4P1L A;  3FXB A;  4N8Y A;  4O7M A;  4N6K A;  2XWK A;  4P9K A;  4YIC A;  5I7I A;  4NAP A;  4N6D A;  2CEY A;  3GYY A;  4X8R A;  4PAK A;  4NQ8 A;  4P56 A;  4XF5 A;  4PCD A;  4PGN A;  4N91 A;  4PE3 A;  2PFZ A;  4O8M A;  3U65 A;  4NF0 A;  4NX1 A;  4N8G A;  4P1E A;  5CM6 A;  2VPO A;  2WYP A;  2CEX A;  4P47 A;  4PAF A; 
#chains in the Genus database with same CATH topology
 3D4G A;  4F1U A;  4PBQ A;  4QSD A;  3HFU A;  3T93 B;  2XX9 A;  4HXV A;  4OET A;  4POX A;  3MPL A;  1DTG A;  3T9H B;  3TAJ A;  3CSB A;  1NV4 A;  2P3N A;  3K1M A;  4JSO A;  1J1N A;  1IMA A;  1DPE A;  2REJ A;  2VT5 A;  3F11 A;  2RIN A;  4F39 A;  2M8C A;  3KOS A;  1L5T A;  4Z0I A;  3U93 A;  4NF5 B;  1Y3Q A;  3SEW A;  2HXR A;  3VVE A;  2O7I A;  1GVC A;  5FHM A;  3SEY A;  1EYJ A;  3KC1 A;  4O3C A;  1QUK A;  1IZ1 A;  5ISU A;  4PP0 A;  4R74 A;  3IB1 A;  3U8Q A;  2DE3 A;  1PC3 A;  3PPR A;  2ZYK A;  1B05 A;  3O6H A;  4YKK A;  1BKA A;  3H6U A;  2OX3 A;  4P0I A;  1B6H A;  4P1L A;  4O7M A;  1LBB A;  2FYI A;  2JJK A;  1IEJ A;  4U4X A;  1I6Q A;  3R26 A;  3A29 A;  5EQA A;  3MAM A;  4EXK A;  3O29 A;  1R9Q A;  4R73 A;  1M5C A;  3IFC A;  1AL3 A;  4FOR A;  4O7I A;  2CMO A;  4OFL A;  4QFP A;  3T0J A;  1MPC A;  4Q0C A;  4BDR A;  3RGY A;  1WDN A;  4EDP A;  3KJT A;  3PMX A;  3MZ9 A;  1NNP A;  1Q35 A;  3OO6 A;  2H98 A;  1B5I A;  1O63 A;  4PAF A;  3C34 A;  1PDA A;  3L6G A;  3IO4 A;  3LSW A;  4MLQ A;  3TQL A;  1DK4 A;  2OZZ A;  2XXW A;  4OVQ A;  4YKJ A;  3N94 A;  1CE2 A;  3HST A;  2IEE A;  2ZYN A;  2F3B A;  5I59 B;  4ELO A;  3JZJ A;  4OAN A;  2RF1 A;  2ZYO A;  4N81 A;  1P1Q A;  1Q9D A;  3FJM A;  2GQ1 A;  4ND9 A;  1MS7 A;  3FJ7 A;  4NG7 A;  1XHY A;  2QPQ A;  1NKX A;  5TU0 A;  1MXV A;  3VLU A;  5DVJ A;  2QS2 A;  2W7Y A;  3MQ9 A;  3IB0 A;  1PEB A;  2Z8D A;  1GGG A;  2V25 A;  1ELJ A;  5DTB A;  2IA4 A;  1CB6 A;  2B3F A;  3MJN A;  3OSR A;  1IQ7 A;  4H45 A;  2DVZ A;  2RC7 A;  4JXI A;  4PF8 A;  4RY1 A;  5B7D A;  1NUY A;  4RK9 A;  2DVC A;  4NE4 A;  3TCH A;  3VXB A;  1A55 A;  4WKM A;  3THI A;  4ESX A;  3M3F A;  1ZKB A;  2KQZ A;  2I6E A;  2F78 A;  4F3P A;  2XX7 A;  3BIG A;  2D5W A;  1Y9U A;  4G68 A;  4LA9 A;  3U65 A;  3K00 A;  4U21 A;  3EF7 A;  1M5B A;  2CZI A;  1DCU A;  4IO6 A;  1BIY A;  4F31 B;  1TFD A;  3KEI A;  2WYP A;  1B58 A;  4N13 A;  1II5 A;  5B70 A;  2O68 A;  4R6H A;  1S50 A;  2YJP A;  2F34 A;  1A8E A;  4KYS A;  4H65 A;  2PBW A;  4QHQ A;  5TPA B;  1YCJ A;  3DEL B;  3IOV A;  5H8F B;  3LC8 A;  4MLV A;  2WX9 A;  5AA2 A;  1UIV A;  5I84 A;  1IMC A;  2VPN A;  4R2F A;  1NH7 A;  1D9Q A;  5H8Q A;  1SW1 A;  4BDO A;  4MNP A;  1Y1M A;  3W9V A;  4MNC A;  3TZA A;  4BDM A;  3S9L C;  4PDD A;  5HBC A;  3DP4 A;  1FQA A;  3ONM A;  5L9S A;  4LVQ A;  1XOC A;  2VD3 A;  1DPP A;  2I48 A;  4EQ9 A;  4N4U A;  1YTV A;  3DP6 A;  1XVX A;  2RC8 A;  4FE8 A;  5ICT A;  1MQG A;  1A7L A;  2Q88 A;  4GWS A;  4KQP A;  4JVI A;  3C36 A;  3MZB A;  3A3C A;  2QMW A;  4P56 A;  3FZV A;  1N0T A;  4QFN A;  4LUB A;  1FTA A;  3HPI A;  2GRV A;  3KN3 A;  3KSJ A;  1G0H A;  3MVZ A;  5L9M A;  4MF3 A;  1MDQ A;  1B7H A;  1N3W A;  3P7I A;  1LBX A;  5IZ1 A;  5CC2 A;  4GRK A;  5FTH A;  2O6A A;  4IGT A;  2MKZ A;  1IXI A;  3N6T A;  4PFY A;  3C4M A;  3BFU A;  4OTE A;  3PTY A;  1INP A;  3DLN A;  3T9X B;  1LAG E;  4NF6 A;  3T96 B;  1QUI A;  5K2X A;  3RTW B;  4RPO A;  3KSX A;  2F7A A;  1N04 A;  4OWD A;  5IGA A;  3N26 A;  1VR5 A;  1OVT A;  3UGW A;  1LBV A;  3UIF A;  4OVP A;  2ZNU A;  4GWX A;  2GH9 A;  4G2Z A;  2D21 A;  1K9Z A;  2XXU A;  4OFO A;  5J16 A;  3MYU A;  3VE1 B;  3C35 A;  3Q29 A;  3G3F A;  4G68 B;  2PFY A;  4NF4 A;  4P11 A;  3KBZ A;  2HZK A;  1B4H A;  2O7U A;  1LAF E;  3PGF A;  4Q8R A;  1MQH A;  3VLV A;  1Y4T A;  2OLB A;  3U72 A;  4ZEI A;  2VOZ A;  3B6Q A;  4H46 A;  1LFH A;  4FED A;  4KPT A;  4NHB A;  4DLD A;  1QUJ A;  3O66 A;  4I8C A;  3GYY A;  1MXU A;  3VXC A;  5AA2 B;  2ZMB A;  2KLF A;  1A8F A;  3CSG A;  4JWX A;  4I40 A;  4JVD A;  2FIX A;  4OHN A;  4FAJ A;  2B4M A;  1B4Z A;  4HE0 A;  4HTG A;  1B3H A;  2VP1 A;  4P1E A;  1MQI A;  2VGQ A;  3CR9 A;  3E79 A;  1LST A;  1MH4 A;  4EQ7 A;  1MXY A;  3ECR A;  2F97 A;  5AA2 D;  4GWO A;  3TKD A;  2F5X A;  4G8M A;  1POY 1;  3FXQ A;  1N76 A;  5CI5 A;  2XXR A;  3MP8 A;  3CRB A;  4JVC A;  2ONK E;  4R2B A;  4OFJ A;  1B1X A;  1LB9 A;  3V5A A;  4TLM B;  4ZS9 A;  2PVU A;  2QRY A;  4RJZ A;  4U1O A;  1QJM A;  3S9M C;  2ESN A;  5M2V A;  5AA4 A;  1DOT A;  1R9L A;  5TP9 B;  4DXC A;  5LDZ A;  3SDF A;  3H6W A;  1Y3N A;  3PPN A;  1UIU A;  3MC2 A;  1QGX A;  3O9P A;  3FV2 A;  3OXN A;  2D3I A;  1SYH A;  2F6P A;  2UVG A;  5H8N A;  3TPA A;  1B32 A;  2P0S A;  2OWT A;  4GBV A;  4RYA A;  2VHA A;  4NN3 A;  3QYT A;  1H43 A;  4LP2 B;  1NNK A;  2V93 A;  2XXH A;  1SI1 A;  2V4C A;  3DM0 A;  1FPE A;  1URS A;  4F18 A;  4H8J A;  4NF6 B;  1JW1 A;  4WEP A;  3SEX A;  5J1D A;  1B1H A;  2BJI A;  5I58 A;  5ESY A;  3C9H A;  3IOW A;  3T66 A;  3UN6 A;  1Y20 A;  2QMX A;  4HCW A;  1LFG A;  1MQD A;  1EZO A;  1FCK A;  2DWI A;  2XXY A;  3T22 A;  4NX1 A;  2HXW A;  3KC0 A;  4NF8 B;  1MPB A;  4PTK A;  1OLC A;  3SEV A;  5H8H B;  3EHT A;  2XD3 A;  4H5G A;  1JVX A;  4GWZ A;  2UYF A;  3QXM A;  4GWU A;  5CMM A;  1FPG A;  3M3L A;  2PCR A;  3PPP A;  3CFZ A;  4KFQ A;  4PE5 B;  3H03 A;  1JW4 A;  2O51 A;  1AMF A;  2XXI A;  1QVS A;  2XWV A;  4ELQ A;  4EQB A;  1EZ9 A;  4AS5 A;  4LN5 A;  1IIT A;  2O1M A;  2R8T A;  2V84 A;  4PBH A;  4IO3 A;  1UTH A;  2QS4 A;  4JSD A;  4ZZA A;  1IMB A;  2XWI A;  2XWO A;  2NVU B;  1FQB A;  2Q9T A;  2HEU A;  4GX4 A;  5IZZ A;  4DCX A;  3SES A;  1Y4C A;  4FBP A;  1YZ0 A;  3TTK A;  1POT A;  3N6U A;  3HN0 A;  1UTB B;  4KI0 E;  3TTM A;  1RDX A;  1H76 A;  3K02 A;  3ISP A;  3EKI A;  2OBG A;  3VVD A;  1FBP A;  2O1L A;  3BIH A;  4G68 C;  3S4U A;  3PU5 A;  1NMU A;  2XXX A;  2Z8E A;  5ET8 A;  4XXU A;  3IX1 A;  3UOR A;  2DXR A;  4JBZ A;  4GX3 A;  4YB6 A;  2F7C A;  3H6V A;  5DT6 A;  4DDD A;  2QFL A;  3EHS A;  2ONS A;  4ESW A;  1P1N A;  3MWB A;  3I5O A;  3I3V A;  3FAT A;  4N8G A;  1B5J A;  3FVO A;  3W15 C;  4DE8 A;  4G61 A;  4ZEK A;  4QFL A;  3FIR A;  3E3K A;  1DMB A;  1FQE A;  5K2Y A;  2AL4 A;  2DOJ A;  1BLF A;  3O6I A;  4G8N A;  2PX1 A;  5KCJ A;  2ZZV A;  3K6U A;  4ZE9 A;  5CMK A;  3QIM A;  1OVB A;  3H3G A;  5ET7 A;  4E0X A;  1JW5 A;  5F7V A;  2I3W A;  3K6W A;  1M5D A;  5KDT A;  4Z7E A;  4C1U A;  2ABH A;  3JV9 A;  1M5F A;  4MEV A;  1LFI A;  3Q28 A;  5JTY A;  3OMB A;  2OCU A;  4N07 A;  2Z23 A;  4IY5 A;  1K9Y A;  4OZ9 A;  4YZZ A;  1QKB A;  1SW5 A;  2RKM A;  1S9T A;  3G3G A;  5JK4 A;  5ET5 A;  2HAV A;  1OQH A;  3MP6 A;  1JP4 A;  3QSL A;  2Q74 A;  3M8U A;  1FBD A;  2FA7 A;  3H6T A;  4OEV A;  1DSN A;  3QUJ A;  2RC9 A;  5I2K B;  4R75 A;  4Q5T A;  4DIG A;  3TEL A;  3TMG A;  1GTK A;  3PUZ E;  2QJE A;  4ONY A;  4OYV A;  5AA3 A;  1JET A;  3C32 A;  4YB5 A;  3KN7 A;  1NL5 A;  3CI8 A;  3FXR A;  2O69 A;  1CNQ A;  5EYF A;  1ZIU A;  4FAT A;  4LQ5 A;  4GIZ A;  5CMB A;  3ZS6 A;  2LAO A;  4YKP A;  1MM7 A;  4F3G A;  2DS9 A;  5DVF A;  1SDX A;  3CG3 A;  1ZBM A;  4LZ8 A;  1RDZ A;  4F1V A;  3IR1 A;  3B6W A;  3O97 A;  4MHF A;  3KZG A;  1IXH A;  2F35 A;  2REG A;  1QKA A;  1TFA A;  1A40 A;  3QMF A;  4PET A;  4F3S A;  3T9U A;  3CIJ A;  3TOD A;  4PFT A;  1ZMG A;  4MCO A;  4PC9 A;  4OVS A;  4EXL A;  4R6Y A;  1BTJ A;  3B7D A;  5A5X A;  3TUS A;  3VVF A;  4POW A;  4QFK A;  4GOT A;  2WKY A;  1B0H A;  3MVX A;  5DW8 A;  5EQ8 A;  3ILT B;  3G3H A;  5F1Q A;  3WAF A;  3V8X B;  3KG2 A;  2OWS A;  4O94 A;  3PUV E;  4Q30 B;  3G3K A;  2ZZX A;  2H5Y A;  3HCQ A;  3ZKL A;  3D1R A;  2XA5 A;  5KCJ B;  3VDF A;  2Q2A A;  3BBR A;  3UA8 A;  2XWK A;  4KXP A;  4P9K A;  3K1N A;  1Z7M E;  2CEY A;  4X8R A;  3DP8 A;  4OES A;  1HSE A;  4U4S A;  4F2Q A;  2HFB A;  1B40 A;  4JB7 A;  5FBP A;  3KN8 A;  3K6X A;  4O8M A;  1MM6 A;  2B3B A;  2XXQ A;  3HO7 A;  1XC1 A;  1JQF A;  2PT1 A;  1P1O A;  4ZZE A;  1NV5 A;  4WXJ A;  2H9B A;  1YAE A;  2R71 A;  2OJT A;  4O3B A;  1US4 A;  1LCT A;  4H5F A;  3FJG A;  3EQ1 A;  1I6A A;  3TTN A;  4IR8 A;  4ECF A;  2DSF A;  3L6H A;  4DXU A;  1PBP A;  4QSC A;  5I5P A;  3CFL A;  4ISU A;  3FV1 A;  1XS5 A;  2I0B A;  5EYH A;  5F24 A;  3ILU B;  4MNI A;  3PUW E;  3TCG A;  3VFJ A;  2WYK A;  2THI A;  4OA4 A;  1TT1 A;  2FNC A;  4X1B A;  3IFA A;  2O84 X;  1MXZ A;  1O7T A;  1N7W A;  4N17 A;  4MMP A;  1NFT A;  4XEQ A;  3H7M A;  3MBP A;  3G3I A;  3IJO B;  1Y1Z A;  4GL0 A;  4RA1 A;  2HQ0 A;  1FPL A;  1MY2 A;  3TDJ A;  1VE4 A;  4I1D A;  2UXA A;  4XIG Q;  2B65 A;  2ZXT A;  4XFE A;  1F9B A;  2FIE A;  1NV3 A;  2HCA A;  3B50 A;  1I6B A;  4C0R A;  4GQO A;  2G93 A;  4UAB A;  1KA0 A;  4I3E A;  1BP5 A;  3ODB A;  5JEI A;  4F19 A;  4LON B;  1EYI A;  1MDP 1;  3VLW A;  4R9F A;  4N6D A;  1SVX B;  2FHY A;  5FHN A;  3IAZ A;  4PE3 A;  1AWB A;  5A5X B;  5I56 A;  5DVI A;  3SET A;  1SPI A;  3N5L A;  3RNN A;  5CM6 A;  4I9D A;  4H1X A;  4ZEB A;  5DYH A;  1MG1 A;  3LSF B;  3JYR A;  1P1U A;  3ZKK A;  4MH5 A;  4ZEF A;  3K2D A;  1FPB A;  1SD3 A;  2XXK A;  5H8Q B;  1TXF A;  3FD3 A;  2QSX A;  1H3D A;  4HE2 A;  4GXA A;  1IMD A;  4KYE A;  4MFI A;  2Y7R A;  3KGC A;  2HPG A;  1P99 A;  2FVZ A;  1M5E A;  3IOR A;  4NTL A;  2NXO A;  2QL3 A;  3A09 A;  1VDW A;  2P2A A;  4IO7 A;  5I57 A;  3K01 A;  2HZL A;  5FTI A;  3K1P A;  3SZP A;  3FVN A;  2X7Q A;  3Q26 A;  4P8B A;  4GVO A;  4NF5 A;  3ZSF A;  3S2V A;  4NED A;  4FJP A;  4GD5 A;  4PF6 A;  3U1O A;  1RYX A;  4ZEC A;  2Q89 A;  4DXB A;  4PCD A;  1MXW A;  5IZ3 A;  1AH5 A;  4U1Z A;  1NV1 A;  1B46 A;  3RTF B;  3R7X A;  3I6V A;  3IL1 B;  3OEL A;  2V3Q A;  3HHG A;  4OER A;  3SER A;  1FJ9 A;  4C1T A;  3T1B A;  1Y3P A;  1O64 A;  3PUX E;  1D4N A;  4OEN A;  1DBZ A;  5IM2 A;  4AS4 A;  4OVR A;  4JDF A;  1MY3 A;  1LGB C;  3U94 A;  2QVR A;  4YB7 A;  3HHF A;  5DEX A;  3Q25 A;  5I3S A;  1LBZ A;  4GWY A;  1NV6 A;  2PT2 A;  1G0I A;  4RNS A;  3OEK A;  1FPK A;  4NF4 B;  1NNT A;  2I49 A;  5L8D A;  4L17 A;  4BDN A;  4X9T A;  3UK4 A;  5HPQ A;  4H8I A;  4R6K A;  2AYS A;  3GBB A;  3E13 X;  3K4U A;  3TFL A;  2ZZW A;  1S7Y A;  3PV0 E;  1MH3 A;  5I59 A;  3PPO A;  3VV5 A;  2QS1 A;  3WAE A;  2KR0 A;  3PMW A;  5ET6 A;  1FSA A;  4X48 A;  5ITO A;  1SBP A;  1LBW A;  1MPD A;  4F29 A;  1USY E;  4U2R A;  1VFE A;  4TQU Q;  4KR5 A;  4ZED A;  4LZ7 A;  1FBG A;  4OQO A;  1MY1 A;  1NH8 A;  2QS3 A;  2Y7P A;  2DE2 A;  5CRY A;  2V3T A;  1FTO A;  1LBY A;  5T3J A;  1YYZ A;  3TYH A;  2Y84 A;  4TLL B;  4ELR A;  4QBA A;  4PAK A;  1D3K A;  4XKQ A;  4PGN A;  1FTK A;  2UYE A;  4N91 A;  4IO5 A;  1ATG A;  3RT8 A;  2AIX A;  1XVY A;  3LSL A;  4LZ5 A;  2V3U A;  4F22 A;  3USD A;  4P47 A;  1NUX A;  3CHG A;  4DCY A;  5I57 B;  4DI4 B;  4GLI A;  2OWZ A;  1JEV A;  3NOH A;  3RT6 B;  1URG A;  3CFX A;  5AA4 B;  1JVY A;  3K6V A;  3B6T A;  4GX6 A;  3PUY E;  4MX6 A;  1QUL A;  4H6D A;  4LAT A;  5AA1 A;  4IO4 A;  4F2O A;  4GXS B;  1MRP A;  1B51 A;  2A5T A;  2ALU A;  1GV8 A;  1IME A;  3KFM A;  2Q8J A;  1R6Z A;  1BK4 A;  5EQ7 A;  2Y7I A;  5TPA A;  1H44 A;  5H8N B;  3ROJ A;  1YPN A;  4XKR A;  3OEN A;  4HW8 A;  3K0V A;  5H8F A;  5IZ3 B;  3V89 B;  4BDQ A;  1FBH A;  4IGR A;  4LQ2 A;  1GR2 A;  2ZNS A;  1EYK A;  1EH3 A;  1JNF A;  2G29 A;  4P0G A;  2DXY A;  4GBW A;  3OD7 A;  1B9J A;  3RQT A;  3T9V A;  4GFR A;  5I58 B;  4G77 A;  4K3F A;  3W9W A;  4YKI A;  2Q2C A;  4X04 A;  1NNF A;  4HE1 A;  3G7W A;  5DEX B;  3SKP A;  2Z8F A;  3FAS A;  4YIC A;  2XXP A;  3IB2 A;  5I7I A;  1FJ6 A;  4PQJ A;  3LV0 A;  3IOT A;  4X1D A;  4AB5 A;  3V83 A;  4HS7 A;  2PFZ A;  1PB9 A;  1RYO A;  2Z22 A;  4GF8 A;  1RKM A;  3FGS A;  1MQJ A;  2F36 A;  3BKI B;  2RCA A;  5EQ9 A;  4MJO A;  5CBS A;  1PB7 A;  2DP8 A;  4M4G A;  1NV0 A;  3BFT A;  1I69 A;  2P3V A;  4YMA A;  3GBA A;  4GL8 A;  2CZH A;  1UTH B;  1FBE A;  4ELP A;  5KZT A;  1B52 A;  5I2N A;  2H25 A;  4NWD A;  1FTJ A;  3KOT A;  1FQF A;  5IKB A;  1LEV A;  2YLN A;  5LOM A;  1FPI A;  4JWO A;  1OIB A;  2F6G A;  3QK6 A;  3MW0 A;  4FEB A;  3C33 A;  2R6G E;  3RPL A;  3HV1 A;  4DZ1 A;  1FPF A;  1IIW A;  3TQW A;  1FBF A;  2YPN A;  1FQC A;  4PAI A;  4OEU A;  1HSJ A;  4PFB A;  3LSX A;  2I0C A;  5A5L A;  2ZYM A;  4OMB A;  3H4Z A;  2X7P A;  4OXV A;  1WOD A;  1B2H A;  4U23 A;  2A5T B;  3MZ1 A;  1SW2 A;  1LBC A;  4QXD A;  2NOO A;  4F3B A;  1OQG A;  3R6U A;  4QF9 A;  1XT8 A;  1FTM A;  5ELV A;  2DQV A;  2CZL A;  2GHB A;  4XKN A;  4MBP A;  3CG1 A;  4N6P A;  4F1Y A;  1VSO A;  5EHM A;  1N7X A;  1Z7N E;  2UVJ A;  2QVU A;  1TWY A;  2XD2 A;  2Y5L A;  5ITP A;  2I3V A;  2L5V A;  4O3A A;  4PFW A;  1LB8 A;  4NF0 A;  2WBB A;  3TCF A;  1MY0 A;  2Y7K A;  3C31 A;  3PD8 A;  2F8D A;  3QAX A;  2XXV A;  4HCY A;  1NUW A;  2I4C A;  4BLA A;  5KDT B;  2AL5 A;  4THI A;  4QRZ A;  4ZE8 A;  1B5H A;  1T0K A;  3MPK A;  3EHU A;  5JTY B;  2A5S A;  3E78 A;  4KCC A;  4G8H A;  3RN8 A;  1ZJL A;  3GZG A;  4H0W A;  5BWJ A;  1KWH A;  2B4L A;  3EN3 A;  1ZU0 A;  2WEF A;  3OO7 A;  1N3X A;  1KZ8 A;  1LAX A;  4I3Y A;  3IO6 A;  2UVH A;  2F7B A;  4IB2 A;  3RPW A;  1D9V A;  3H06 B;  5TP9 A;  1Q1K A;  3GLB A;  4FIM A;  3GXA A;  1R1N A;  2Y7W A;  5ICQ A;  1AIV A;  1UQW A;  4XTC Q;  1AOV A;  2PMS A;  4PFR A;  4NMY A;  2DYX A;  2E1S A;  1A99 A;  1SQY A;  4NGU A;  1LCF A;  1LAH E;  2Y5K A;  4P3L A;  1FQD A;  4KD5 A;  1FPD A;  4N15 A;  4N8Y A;  3RUM A;  5I2N B;  3KJ7 A;  3OO8 A;  3M3K A;  4U22 A;  3PMV A;  3RLF E;  4RK2 A;  1P1W A;  1NUZ A;  2PYY A;  3KBR A;  4OVJ A;  2NUV A;  1RDY A;  2XHD A;  3FUZ A;  4QSE A;  2WBD A;  3RYD A;  5HM4 B;  3RPL B;  2CEX A;  4UA8 A;  1PBQ A;  1QW0 A;  3LUY A;  2XXT A;  3FXU A;  5EHS A;  3MVY A;  4NF8 A;  2I4B A;  4PFI A;  1N84 A;  5H8H A;  2DWA A;  1FBC A;  1D9Y A;  4YU0 A;  4I62 A;  4ZDM A;  1PB8 A;  4KCD A;  1KA1 A;  1FW0 A;  1B3G A;  4PDH A;  3IK6 B;  5LTC A;  2DE4 A;  2BJJ X;  4R9G A;  4R72 A;  4NWC A;  3OOA A;  2I58 A;  2H4I A;  1IXG A;  2ONR A;  5EYG A;  3CVG A;  4IY6 A;  3RY3 A;  1FPJ A;  1MXX A;  1NI9 A;  4OVT A;  4PFU A;  1YXI A;  3TTL A;  3O28 A;  4YAH X;  2HAU A;  2ZNT A;  4MAG A;  3TTR A;  3OSQ A;  1IXC A;  1US5 A;  4NAP A;  1UTB A;  2XX8 A;  3MP1 A;  4BDL A;  2GHA A;  4M1V A;  4WED A;  3D4C A;  3FBP A;  4NQ8 A;  1SW4 A;  5H8S A;  3QUF A;  5AE4 A;  3S9N C;  4XKP A;  1NV7 A;  1IUD A;  1EU8 A;  2Q8M A;  4FEC A;  3UP9 A;  3LR1 A;  3SEU A;  4AQ4 A;  2CZK A;  3MST A;  4IO2 A;  4JWY A;  1SYI A;  4EF2 A;  2FBP A;  1B7Z A;  5L9O A;  2DDK A;  1A54 A;  5BUU A;  1LLS A;  1VFD A;  4KYD A;  2RCB A;  4UAC A;  1B0L A;  3O2A A;  1URD A;  1MY4 A;  2DWH A;  4MIJ A;  2HHM A;  3FVG A;  1FTL A;  4QFO A;  4GWW A;  4G4P A;  1ANF A;  1JEU A;  3OEM A;  3AXF A;  2R9J A;  3G3J A;  3IJX B;  3MVW A;  3O6G A;  4E0W A;  3S9E A;  4KHZ E;  1B7U A;  1B3E A;  3IOU A;  3OO9 A;  3PPQ A;  1XI6 A;  3MUQ A;  3Q27 A;  1B3L A;  1OMP A;  1OLA A;  3B8B A;  4EUO A;  5IAI A;  2P1S A;  4RXL A;  2ANJ A;  5CBR A;  3FVK A;  1ZLQ A;  1IMF A;  1H45 A;  3LUZ A;  5FHO A;  2GFE A;  1FRP A;  2E0S A;  5CMC A;  2F3D A;  3LBS A;  4DI3 D;  4TOZ A;  4PGP A;  4RPN A;  3FXB A;  4AB6 A;  5I56 B;  4N6K A;  3A3U A;  1B3F A;  2H99 A;  2QVV A;  4EF1 A;  4H67 A;  2UVI A;  3E4R A;  1EZP A;  2DWJ A;  4YMB A;  4XF5 A;  3TEP A;  2OK2 A;  1ZTY A;  1HSL A;  2X26 A;  5I2K A;  1NV2 A;  3E9X A;  1SI0 A;  1WVJ A;  2NWJ A;  1DTZ A;  3EPE A;  2VPO A;  3PD9 A;  1USY H;  2VD2 A;  3U92 A; 
#chains in the Genus database with same CATH homology
 2P3V A;  4F1U A;  4PBQ A;  2F5X A;  3HFU A;  4HXV A;  2CZH A;  4IR8 A;  1FBE A;  5I5P A;  1NV4 A;  2P3N A;  4JVC A;  5EYH A;  5F24 A;  1IMA A;  4MNI A;  2VT5 A;  2WYK A;  1LEV A;  1FPI A;  5LDZ A;  4OA4 A;  3IFA A;  1QGX A;  4N17 A;  4MMP A;  4XEQ A;  2HXR A;  3RPL A;  1FPF A;  1FBF A;  1FPL A;  1EYJ A;  3KC1 A;  4PAI A;  4GBV A;  4NN3 A;  4XFE A;  2FIE A;  1NV3 A;  4PFB A;  3B50 A;  2DE3 A;  4UAB A;  5A5L A;  2V4C A;  2OX3 A;  1FPE A;  1KA0 A;  4F18 A;  4P1L A;  4I3E A;  4O7M A;  2JJK A;  4F19 A;  5J1D A;  1EYI A;  2BJI A;  3A29 A;  4N6D A;  4QXD A;  5EQA A;  2FHY A;  5ESY A;  3IFC A;  4HCW A;  4O7I A;  3T0J A;  4PE3 A;  1AWB A;  4NX1 A;  1SPI A;  3KC0 A;  2QVU A;  4PTK A;  5CM6 A;  2Y5L A;  2L5V A;  4NF0 A;  4PAF A;  2WBB A;  4GWZ A;  4GWU A;  1DK4 A;  1FPG A;  1FPB A;  4OVQ A;  2PCR A;  4HCY A;  1NUW A;  2XXK A;  4HE2 A;  1IMD A;  2F3B A;  4OAN A;  4N81 A;  3E78 A;  2XWV A;  2HPG A;  1Q9D A;  4AS5 A;  2GQ1 A;  4LN5 A;  2R8T A;  4PBH A;  4NG7 A;  2B4L A;  2QPQ A;  2FVZ A;  2WEF A;  1IMB A;  2XWI A;  2XWO A;  1KZ8 A;  4I3Y A;  2Q9T A;  4GX4 A;  5IZZ A;  1VDW A;  4FBP A;  1YZ0 A;  2HZL A;  3SZP A;  4P8B A;  4H45 A;  2DVZ A;  4PFR A;  4PF8 A;  1RDX A;  4NGU A;  3ISP A;  3EKI A;  1NUY A;  2Y5K A;  4PF6 A;  4P3L A;  4N15 A;  1FPD A;  1FBP A;  3BIH A;  4N8Y A;  5ET8 A;  2KQZ A;  4GX3 A;  4PCD A;  2QFL A;  3BIG A;  5IZ3 A;  1NV1 A;  3U65 A;  1NUZ A;  2V3Q A;  4N8G A;  2CZI A;  1DCU A;  1FJ9 A;  1RDY A;  2WBD A;  3T1B A;  4G61 A;  3RYD A;  2WYP A;  3RPL B;  2CEX A;  1DBZ A;  5IM2 A;  4AS4 A;  4OVR A;  2QVR A;  2ZZV A;  4PFI A;  5I3S A;  1LBZ A;  4GWY A;  5ET7 A;  1NV6 A;  1G0I A;  2WX9 A;  1FBC A;  1FPK A;  1IMC A;  1KA1 A;  2VPN A;  1D9Q A;  4X9T A;  4MNP A;  4PDH A;  2ZZW A;  4MEV A;  3W9V A;  5LTC A;  4MNC A;  2DE4 A;  2KR0 A;  5ET6 A;  1FSA A;  4PDD A;  1K9Y A;  4YZZ A;  5JK4 A;  5ET5 A;  5EYG A;  1LBW A;  1FPJ A;  1JP4 A;  1NI9 A;  4OVT A;  1YXI A;  4N4U A;  2Q74 A;  1FBD A;  4MAG A;  1FBG A;  2DE2 A;  4GWS A;  1LBY A;  4NAP A;  4JVI A;  5T3J A;  1YYZ A;  4M1V A;  4QBA A;  3FBP A;  4PAK A;  4NQ8 A;  4P56 A;  4PGN A;  1FTA A;  4N91 A;  1NV7 A;  2Q8M A;  1CNQ A;  1G0H A;  2CZK A;  3MST A;  1LBX A;  5IZ1 A;  2FBP A;  2DDK A;  4P47 A;  1NUX A;  1RDZ A;  3CHG A;  4DI4 B;  2MKZ A;  2OWZ A;  3NOH A;  4F1V A;  3PTY A;  4MHF A;  1INP A;  4GX6 A;  4MX6 A;  3QMF A;  4MIJ A;  1IME A;  2HHM A;  4PET A;  5IGA A;  1BK4 A;  5EQ7 A;  4GWW A;  4MCO A;  1LBV A;  4PC9 A;  3ROJ A;  4OVS A;  4OVP A;  4GWX A;  1K9Z A;  5J16 A;  3MYU A;  1XI6 A;  5IZ3 B;  5DW8 A;  5EQ8 A;  2PFY A;  3B8B A;  1FBH A;  2HZK A;  3KBZ A;  4O94 A;  1EYK A;  1IMF A;  4GBW A;  3LUZ A;  2ZZX A;  1FRP A;  3W9W A;  4H46 A;  4X04 A;  2F3D A;  3D1R A;  2XA5 A;  4NHB A;  4DI3 D;  4HE1 A;  4PGP A;  3FXB A;  4N6K A;  2XWK A;  4KXP A;  4P9K A;  4YIC A;  5I7I A;  2QVV A;  1FJ6 A;  2CEY A;  3GYY A;  4X8R A;  3LV0 A;  4XF5 A;  5FBP A;  2PFZ A;  4I40 A;  4JVD A;  2FIX A;  4O8M A;  1NV2 A;  2B4M A;  4HE0 A;  5EQ9 A;  1NV5 A;  4MJO A;  4P1E A;  2VPO A;  3E79 A;  1NV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...