4PGNA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein, family 7
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Transport protein
total genus 111
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pgnA00
4MEVA 4X04A 2XXKA 4PGPA 4N6DA 2XWOA 4P1LA 4PDDA 4N8GA 4MCOA 4PBHA 4P47A 4MMPA 4X8RA 4YICA 4XFEA 3GYYA 4PAFA 4OVSA 5IGAA 4OVTA 2CEYA 2ZZVA 5I7IA 4O8MA 4P56A 4PAIA 4XEQA 4NGUA 4NAPA 2PFZA 4N15A 4PDHA 2ZZWA 4PETA 4N6KA 4P9KA 4OVPA 4P8BA 2XA5A 4NQ8A 2HPGA 2XWVA 4PAKA 5I5PA 2VPOA 4NG7A 4OVRA 3B50A 4P1EA 2PFYA 2XWKA 4N4UA 4UABA 2WYKA 4O7MA 4XF5A 4DI4B 4NF0A 2WX9A 4NX1A 2CEXA 2HZKA 2ZZXA 4MAGA 4O94A 5IM2A 4MNPA 4MX6A 2VPNA 4MNCA 4MNIA 4N17A 4P3LA 4PF6A 4N8YA 4MIJA 4PC9A 4PE3A 4OANA 2HZLA 4OVQA 4NN3A 4MHFA 2V4CA 4PGNA 5IZZA 4PF8A 4LN5A 5CM6A 4YZZA 4PFBA 4PFIA 4PFRA 4N91A 4PBQA 3FXBA 4NHBA 5LTCA 4OA4A 4DI3D 2WYPA 3U65A 2XWIA 4PCDA
chains in the Genus database with same CATH superfamily
2ZNSA 4U4XA 4PFYA 4TQUQ 1VSOA 3S9EA 3OO8A 1XOCA 1ZLQA 4IO7A 1OMPA 4G8NA 2XX9A 1IEJA 3T93B 3V83A 3C36A 4GWSA 5L9SA 2FHYA 3Q26A 1QKAA 1Z7NE 1MQIA 1DBZA 4KXPA 3OELA 4ZECA 1TWYA 1XHYA 1N3XA 4OVPA 2DYXA 2F7CA 1P1NA 1XI6A 3FJGA 1Y20A 4NF8A 2QMXA 4GX6A 5H8NA 3UORA 1Y3PA 1K9ZA 5KZTA 4OETA 4GXAA 3K2DA 3DELB 5JEIA 5HPQA 2V3UA 2XXYA 4GX3A 2PT1A 4LP2B 1Q9DA 5TP9B 4ZE9A 4OHNA 2OLBA 1USYE 4PC9A 4TLMB 3THIA 1LFHA 4LZ8A 3ILUB 4N13A 1JW1A 1KWHA 1I6QA 1GTKA 3MP6A 3W9VA 5JTYA 5EQAA 5ET6A 2ONRA 4QSDA 4PFRA 2HXWA 4ELQA 2DWIA 5J16A 1EZ9A 2A5TA 3EHTA 1VE4A 3Q28A 5JK4A 2Z22A 3QUJA 3TODA 1MG1A 4O3AA 1Y1MA 2DVCA 1HSJA 2HQ0A 1RDXA 4X1DA 1D3KA 3S9NC 4ND9A 2Q2AA 1CNQA 4G4PA 2VD2A 3I6VA 3ODBA 4NF4A 4I3YA 1MY0A 4OXVA 1QJMA 5TPAB 5IZ3A 2GRVA 3PPQA 2ZMBA 4JXIA 3Q29A 5EHMA 1B7ZA 4RA1A 4H0WA 2YJPA 2KR0A 3CI8A 4I62A 4YB7A 3K6WA 3LUZA 4GVOA 4F3SA 4C0RA 4R9FA 3MP1A 3JZJA 2XX7A 2WBDA 3KGCA 4LZ7A 4XTCQ 5CC2A 2WX9A 3PUXE 4NX1A 5ICQA 2CEXA 3P7IA 2F6PA 1IMCA 4C1TA 4PF6A 5IAIA 1FPIA 1JVYA 3MC2A 3Q25A 2Q8MA 4P0GA 3TDJA 4I8CA 4C1UA 4GXSB 1M5BA 4RPOA 2QVUA 1IZ1A 3E78A 1LCFA 4R74A 3FVNA 3RPWA 1B5JA 2QJEA 1QUIA 3QMFA 3PPPA 1CB6A 2I3WA 4R75A 3NOHA 5H8QB 3BBRA 4IGRA 1JW5A 3OD7A 4ZS9A 2JJKA 3MVXA 1URDA 1O64A 1FQBA 1MY4A 5FTIA 3K6UA 4N6DA 1OVBA 5EYFA 4I9DA 1RDYA 5ICTA 2O68A 1MS7A 3QXMA 3CRBA 3A29A 3GYYA 1NI9A 4BDQA 5FHOA 3R6UA 1QW0A 3G3IA 2NVUB 1NV1A 4ZZAA 4OFLA 3U72A 2E1SA 2YLNA 4LVQA 4N07A 1FQDA 3FASA 3FV1A 3SESA 3TTNA 1WDNA 4GWXA 2I0BA 1NUXA 4FBPA 1PBPA 3A3UA 4N6KA 3QAXA 1S9TA 1URSA 1SI0A 2XA5A 1H44A 2Y7KA 3UN6A 5I5PA 4THIA 1ZJLA 2I6EA 3SETA 4UABA 1LBCA 4RYAA 4YKJA 1YAEA 3UA8A 4XKNA 3EHSA 4OMBA 3O2AA 4TLLB 3IJOB 1VDWA 2NWJA 3PUVE 3OMBA 3A09A 2XD3A 4QXDA 3GBBA 4QSCA 2WEFA 4HE1A 4YAHX 2R9JA 4PF8A 4YZZA 4PBQA 2DP8A 3VXCA 3RGYA 3SEYA 2IA4A 4PFTA 5H8HA 1EYJA 3LR1A 3H4ZA 5FTHA 5I2NB 1FTOA 3G3FA 1DMBA 4DIGA 3K02A 3LSLA 2AIXA 2XXVA 1O7TA 2Y7WA 4PDDA 2W7YA 1MXWA 5AA1A 4WXJA 1A7LA 1Y1ZA 4H8JA 4YICA 5ITPA 3DM0A 3VLWA 5AA4A 3TQLA 4G68A 3T9VA 3E4RA 3OO6A 2CZIA 1DPPA 1LBVA 4DXCA 1JETA 5I58B 2VP1A 4F1YA 5CBSA 3W15C 4GWUA 3ILTB 4P8BA 3KBRA 2Q2CA 1B40A 1POTA 1XVXA 2HAVA 1ELJA 2ONKE 2GQ1A 1NNKA 1M5CA 1NV0A 3GBAA 4O7MA 4XF5A 3EQ1A 4H45A 2O7UA 3S9LC 1FPGA 2OWTA 4GL0A 3IOTA 3RUMA 5HM4B 5DEXB 3S4UA 2PX1A 2QPQA 4R72A 4MLQA 2I49A 1KA0A 2DVZA 2DOJA 4YMBA 1NV4A 4PGNA 3IB1A 3ZKLA 2Q88A 1ZTYA 4LN5A 4IY6A 4LONB 4KFQA 1N84A 3QUFA 4GD5A 3PMWA 1A8EA 4KD5A 5CMKA 3PU5A 5LOMA 3TFLA 3CFZA 3PUZE 2ESNA 4N8GA 1LBZA 4P47A 4MMPA 2B3FA 3TKDA 3IX1A 1B05A 2Y7RA 4KYDA 4JSOA 4YB5A 1H76A 3H6UA 4R73A 5T3JA 3KOSA 5ESYA 4FIMA 4JBZA 1PEBA 3T9HB 1US5A 5EQ9A 3KC1A 1UIVA 3IO6A 3UIFA 1MXUA 4I40A 1MXVA 5AA2B 4O3BA 1NH8A 1B5IA 1NNPA 4P9KA 4X48A 2GFEA 1LB9A 1DTGA 4GX4A 4AQ4A 2V3TA 4PAKA 2Y5KA 2O1LA 4ZEIA 4JVIA 4H8IA 3KJTA 4XIGQ 1N7XA 1B5HA 3FJ7A 4QRZA 4F3BA 1N0TA 3VFJA 1B52A 2PT2A 5KDTB 3B7DA 4U4SA 1B1XA 5AE4A 4MNCA 1N3WA 5I57A 1MPBA 4LATA 4MIJA 4ESXA 1IIWA 3VVEA 1BKAA 4EUOA 3ROJA 2O6AA 3O9PA 4NN3A 4GOTA 3ZKKA 4WKMA 4MHFA 3T66A 2V4CA 3OEMA 1B3EA 2PCRA 3TZAA 1NUZA 1MPCA 1HSEA 4F22A 3FXBA 1UTHB 3IOWA 3CSGA 2I58A 1NV3A 4H6DA 2I48A 2MKZA 2B4LA 3TMGA 3B6QA 2LAOA 1LCTA 2F34A 3EHUA 1OQHA 1B51A 1YXIA 3R26A 5F24A 2XXKA 1QVSA 3DP8A 4BDLA 2OK2A 5EHSA 3QK6A 1IUDA 1ZKBA 3F11A 4MCOA 5KCJA 3N6UA 3CIJA 3UP9A 3AXFA 1FJ6A 3M3KA 4JWXA 4PFWA 3KJ7A 2ABHA 4H5GA 1ANFA 2PYYA 2CEYA 4R2BA 3IFCA 3G3JA 1N04A 3C9HA 2P3VA 2PBWA 2Q9TA 4JSDA 1MXZA 3JV9A 3T0JA 4FATA 4PETA 1MDP1 3IOVA 2O84X 3CFXA 1LFGA 3KBZA 1YTVA 4YU0A 1EYIA 1LBXA 2XXRA 4RNSA 4XKPA 4U23A 1LBYA 1Y9UA 1B4HA 1MY1A 3HFUA 1GV8A 3HN0A 4OFJA 4M1VA 4Q30B 1D4NA 2QS2A 2L5VA 1KA1A 1AL3A 4ELOA 2DWAA 2XXXA 3FUZA 3RY3A 5M2VA 1Y3QA 3I5OA 1EU8A 1US4A 2FIEA 3MP8A 2GHBA 5J1DA 4R6HA 1RDZA 4F2OA 1NV2A 2RF1A 2REGA 2AL4A 3TCGA 3MZ9A 1FBHA 2RC8A 1ZMGA 3UK4A 1QGXA 1AOVA 2OCUA 1P99A 4EDPA 1QKBA 2V3QA 3U65A 1AIVA 4G61A 4BDMA 4E0XA 4PFUA 1NKXA 1P1WA 1L5TA 1TT1A 1MDQA 3JYRA 4PGPA 4YKKA 3CG1A 5TP9A 1FPJA 4EF1A 4GWYA 1IMDA 2Z8DA 4X1BA 2REJA 3RYDA 3K6VA 3SKPA 1D9YA 3RPLB 1OLCA 4F29A 2I4BA 4HS7A 2O69A 1JQFA 1Z7ME 3TAJA 4HXVA 1UQWA 3GXAA 4LUBA 2ALUA 1B1HA 3CVGA 2DSFA 3MWBA 3RPLA 1MQDA 1IMBA 2NXOA 4NG7A 4F18A 1DCUA 2OJTA 1POY1 3O6GA 3C4MA 1FPFA 1FPLA 3PMXA 1JEVA 2E0SA 2ZZXA 2HXRA 4O94A 4OYVA 4R9GA 1MRPA 1NV7A 2I4CA 3L6HA 4UACA 4ONYA 5I56B 4GLIA 2KQZA 3C35A 1XT8A 1Q35A 5TPAA 1GR2A 5ISUA 2VOZA 3CR9A 1SYIA 2I3VA 3EN3A 1EH3A 1G0IA 3RN8A 2QL3A 3MJNA 3TTRA 4PFBA 4GRKA 4IO6A 3HO7A 1FPDA 2UVJA 4R6KA 5BUUA 2F7AA 3O66A 4JVDA 3U93A 3K4UA 1H3DA 3G3GA 4F19A 1BLFA 1MQHA 1JEUA 1VR5A 3H3GA 4FECA 4ELRA 4X8RA 1B46A 1EYKA 2F35A 3KEIA 4NE4A 5I84A 5IGAA 3DP4A 4F39A 3PPNA 1MY2A 1R1NA 3UGWA 4O8MA 4MH5A 5CBRA 2HHMA 1NL5A 4PDHA 4H65A 2NUVA 4EXKA 3V5AA 2PVUA 1FBDA 1FPKA 4ELPA 1B3FA 1OLAA 5H8QA 3FXQA 2WBBA 2ZNUA 1LB8A 1IXCA 1B7UA 5L9MA 3M3LA 4NF0A 3K0VA 1BK4A 4GWOA 5A5LA 1BP5A 2B65A 1SDXA 5IM2A 4QFNA 4HW8A 4EF2A 4N17A 1SPIA 2F8DA 1UTBB 1NUWA 5A5XB 4IR8A 4OEUA 2AL5A 3V8XB 3LSFB 1HSLA 3HV1A 4QFLA 5H8FB 1SW2A 1OIBA 4AB5A 3T1BA 5ET8A 4PFIA 5ET5A 4XKQA 2QS1A 3VV5A 3TQWA 4IY5A 4DI3D 3FVGA 2XWIA 3KSXA 2XXTA 3OO7A 2RINA 1B0LA 1SW1A 4NEDA 3KN7A 2H25A 1LGBC 2VT5A 4PBHA 2VGQA 2O1MA 3TTLA 3LV0A 1MM6A 4OVJA 1LAXA 5H8SA 4HE0A 4OESA 3OEKA 1P1QA 4PAIA 4XEQA 1IMAA 2OX3A 4FEBA 4Z7EA 2UXAA 2OWZA 4KR5A 4DZ1A 5EYHA 1NV6A 2RKMA 3DP6A 1PC3A 2I0CA 2NOOA 5HBCA 4QSEA 2R6GE 2P1SA 4G77A 4YKIA 1FPEA 2H99A 3PUYE 4F2QA 5I2NA 3B50A 4OVRA 2B3BA 2CZLA 4IO4A 4ISUA 2ZNTA 4HCWA 3WAFA 5I59B 1IITA 2XXQA 4IO2A 5EQ8A 3SEWA 3KG2A 2ZYMA 4N8YA 1QULA 3G7WA 3SEUA 3TTMA 1FTKA 1B32A 5I58A 3I3VA 4OANA 1IXHA 1DK4A 3E79A 3TCHA 4ZE8A 4JDFA 3U92A 1NNTA 4HCYA 4FE8A 1FTLA 3PUWE 4JVCA 1LLSA 1JP4A 1LAFE 4I3EA 4KPTA 1MXXA 4NHBA 3FV2A 1OVTA 4OA4A 3KN3A 4F3GA 1B6HA 4KYEA 1GVCA 3TPAA 2XHDA 4F3PA 4LZ5A 1B0HA 3TCFA 4AS4A 3FVKA 3D4CA 1B58A 2UVIA 2CZKA 1WODA 3MSTA 4P1LA 1RYOA 2R8TA 2O7IA 5DEXA 5EQ7A 2XXWA 3H06B 5DVFA 3FVOA 1QUJA 4YMAA 1GGGA 1A8FA 1URGA 1PDAA 1XVYA 1MM7A 1NFTA 1M5FA 2DQVA 3IB2A 2P2AA 3OENA 4NAPA 3RLFE 3M8UA 3IR1A 3MZBA 4GF8A 3TUSA 3SEXA 4K3FA 5F1QA 3CSBA 1B9JA 3GLBA 3HSTA 1SVXB 1YYZA 2DXRA 3HPIA 5ELVA 1S50A 1Y4CA 3IFAA 2H98A 4H5FA 4ZDMA 3IORA 1INPA 4DCXA 5AA2A 1R9LA 3MW0A 2RCBA 3B8BA 3KN8A 4P11A 4POXA 1H43A 1R9QA 4H1XA 5TU0A 4KCCA 3K1NA 3W9WA 4U1OA 4G2ZA 5KDTA 2Z8EA 1FTMA 1VFDA 4M4GA 2FVZA 1SBPA 1J1NA 1IXIA 3K01A 5DVJA 3LSWA 1MY3A 4NF6B 3VLVA 3PGFA 1BTJA 3C32A 5B7DA 5CMMA 4R2FA 1FBGA 3RTWB 3GZGA 3G3HA 4KHZE 4NF6A 4NGUA 4TOZA 3MBPA 1M5DA 2PFZA 2M8CA 2UVGA 4ESWA 1UTHA 2H5YA 3E13X 2FYIA 4RY1A 4F1VA 3BFTA 2DE2A 4O3CA 1A40A 2F5XA 1DOTA 1UIUA 4G68C 3FZVA 4PTKA 3L6GA 4U22A 2F78A 2QS3A 1FSAA 2X7PA 1ATGA 1PB9A 3KC0A 2QRYA 3N94A 4MX6A 4MNIA 2QSXA 3D1RA 1B3GA 5CRYA 2ZXTA 2PMSA 3EF7A 4FEDA 4MF3A 2G29A 4GBVA 1PBQA 3EKIA 1USYH 2HZLA 4IO5A 4QHQA 5I2KB 3K00A 2UYEA 2ONSA 3B6WA 5IKBA 5IZZA 1I69A 3ONMA 3QIMA 1LSTA 1CE2A 1S7YA 1FQCA 2DDKA 3ZS6A 3FXRA 5LTCA 1Y3NA 5I2KA 4BDOA 1MQJA 5AA2D 4PCDA 4NF8B 3FBPA 4X04A 3PTYA 1FQEA 1MQGA 4NMYA 3HCQA 5H8NB 2Y7IA 4ZEFA 3O6IA 4I1DA 2B4MA 3Q27A 2FA7A 3RQTA 5B70A 4U1ZA 3OO9A 3TTKA 3T9UA 1FQAA 4IB2A 3RNNA 3BFUA 2IEEA 4DXBA 1N76A 3LSXA 4DCYA 4KCDA 3S9MC 1P1UA 2Y5LA 2QMWA 1FJ9A 2D5WA 1R6ZA 4AS5A 2ZZWA 3IK6B 3CHGA 4H46A 2DE3A 3LUYA 3VXBA 5JTYB 1FTJA 4OZ9A 2A5TB 5CI5A 2V93A 2DS9A 2DXYA 4N4UA 3PD9A 3PV0E 1NH7A 3N6TA 4RK2A 1NMUA 1QUKA 4QF9A 3K1MA 4F1UA 2ZYKA 2ZYOA 4PE3A 3H6TA 1LEVA 3PD8A 3IJXB 1A55A 1M5EA 4OVQA 3LBSA 4NF4B 3O6HA 4RK9A 2Q89A 1Q1KA 5IZ3B 3TEPA 4MJOA 4JWOA 3R7XA 3VVDA 5DT6A 3KFMA 4Q8RA 4Q0CA 5I3SA 3O29A 3TYHA 3VDFA 3MVWA 2QVRA 2XWOA 2DWHA 1B4ZA 3IOUA 3H03A 5I56A 1LBWA 1MH3A 4XFEA 4OVSA 2UVHA 1PB7A 1FBEA 3IB0A 3MVZA 5I7IA 5DW8A 2ANJA 3VE1B 2HEUA 1JW4A 2VHAA 2Y7PA 3MZ1A 1SW5A 4ECFA 4G8HA 3CFLA 1A99A 4JB7A 5BWJA 2G93A 3SERA 3B6TA 2P3NA 2GHAA 3V89B 3QSLA 4OEVA 2VPOA 5F7VA 4ZEBA 2F97A 3HHFA 3MVYA 3MUQA 2O51A 2HZKA 3KOTA 4ZEKA 4KI0E 1LAHE 4ZZEA 3FD3A 1VFEA 3DLNA 4LQ2A 1SW4A 3FIRA 1DSNA 1IQ7A 1I6BA 2ZYNA 4NF5B 1YPNA 4O7IA 4Q5TA 4WEDA 3OXNA 3T9XB 1YZ0A 4N91A 4NWCA 1IMFA 4GWWA 2X7QA 1YCJA 1T0KA 2KLFA 2HFBA 4NF5A 1AMFA 4MEVA 1DPEA 1NNFA 1LAGE 2D21A 1AWBA 4MBPA 3O97A 4L17A 5K2YA 5FHMA 1FRPA 2BJIA 1UTBA 4QFKA 5A5XA 3M3FA 1F9BA 3TELA 1RYXA 3S2VA 3SDFA 2P0SA 4E0WA 2Q8JA 2R71A 1O63A 4IO3A 4HTGA 4U2RA 2F6GA 3RTFB 5H8FA 1EZPA 4GBWA 4GWZA 3MPLA 4N15A 2BJJX 3FXUA 3E9XA 1OQGA 4BDRA 1FCKA 1ZU0A 4POWA 1Y4TA 4FJPA 3EPEA 1K9YA 2XWVA 4DE8A 1FW0A 2PFYA 1XC1A 3IAZA 1ZBMA 3LC8A 5H8HB 3KZGA 5CMCA 5L9OA 4DI4B 4WEPA 3C31A 2XXPA 2V84A 4G8MA 3A3CA 4GQOA 4OTEA 1FQFA 1SQYA 4UA8A 4DDDA 3KSJA 4MNPA 4MFIA 3OSQA 3BKIB 3FGSA 1MH4A 1AH5A 3WAEA 3QYTA 3BIHA 5AA4B 4EXLA 1TFDA 1TXFA 4G68B 1LFIA 3VLUA 2F36A 5FHNA 4EQBA 4PE5B 5LDZA 2QS4A 4OFOA 3N26A 1IMEA 2CMOA 1II5A 4FAJA 4N6PA 1JNFA 3MAMA 3PPRA 5I59A 3K1PA 4KQPA 1IXGA 3CG3A 2QFLA 4RXLA 2OZZA 4LQ5A 3MYUA 4FORA 1SYHA 2F3DA 4PAFA 3D4GA 3ZSFA 4DXUA 2OWSA 2FNCA 4OVTA 2ZZVA 1G0HA 1RKMA 2QVVA 4AB6A 2H4IA 3HHGA 4F31B 1H45A 3BIGA 3E3KA 2FIXA 3OOAA 4Z0IA 2XXHA 4X9TA 3H6WA 4JWYA 1TFAA 1DTZA 1LBBA 2AYSA 4P1EA 1PB8A 2WYKA 2XXIA 4IGTA 2H9BA 1MPDA 4HE2A 4RPNA 4PP0A 3T96B 2VPNA 4DLDA 1NV5A 4EQ7A 2A5SA 4H67A 1I6AA 2DWJA 3SEVA 3IO4A 3N5LA 4PQJA 4EQ9A 3C34A 4QFPA 2HCAA 4OERA 2DE4A 5CM6A 1SI1A 4MLVA 1FBFA 4XXUA 2RC9A 3VVFA 2V25A 3RT8A 2Z23A 5AA3A 1B7HA 4RJZA 1B3LA 3U8QA 4YB6A 2RC7A 4P0IA 4ZEDA 1XS5A 2THIA 3PMVA 3MQ9A 3OSRA 1KZ8A 4GFRA 1N7WA 4N81A 3C33A 2Z8FA 4NWDA 2YPNA 1A54A 5DYHA 3MPKA 4NTLA 4U21A 2OBGA 3IL1B 5I57B 4QBAA 4P56A 1WVJA 5IZ1A 5DTBA 3SZPA 2F3BA 4OQOA 2WKYA 2X26A 3FJMA 2UYFA 3U94A 5K2XA 5ITOA 4BDNA 4NQ8A 2HPGA 5DVIA 2GH9A 2HAUA 4QFOA 5L8DA 1P1OA 1SD3A 3USDA 3O28A 2XWKA 2XD2A 4BLAA 5CMBA 2Q74A 4LA9A 1FBPA 4GIZA 1FPBA 2CZHA 1MXYA 1EZOA 2XXUA 4MAGA 4KYSA 1B3HA 1BIYA 1D9VA 4GL8A 4P3LA 1FBCA 3U1OA 3PPOA 2VD3A 3H7MA 3H6VA 4R6YA 5KCJB 2RCAA 1JVXA 4OENA 3G3KA 3ISPA 3RT6B 1FTAA 2FBPA 3ECRA 1D9QA 4XKRA 5ET7A 1NUYA 2D3IA 4YKPA 2XX8A 2F7BA 5FBPA 1B2HA 3T22A 2Y84A 4OWDA 3FATA 2WYPA 1ZIUA 5EYGA 3K6XA
chains in the Genus database with same CATH topology
5I3SA 2QVRA 2XWOA 2VT5A 4N8GA 4PBHA 1LBZA 4P47A 4MMPA 3LV0A 1LBWA 4XFEA 4HE0A 4OVSA 5T3JA 1FBEA 5ESYA 5I7IA 5DW8A 4GWSA 4PAIA 4XEQA 1IMAA 2OX3A 5EQ9A 3KC1A 2FHYA 4I40A 1DBZA 4KXPA 2OWZA 5EYHA 1NV6A 4P9KA 4OVPA 1XI6A 4GX4A 2P3NA 1FPEA 4GX6A 2Y5KA 4PAKA 2VPOA 3B50A 4OVRA 4JVIA 1K9ZA 4HCWA 2HZKA 5EQ8A 4MNCA 4GX3A 1Q9DA 4N8YA 4MIJA 4PC9A 4OANA 1DK4A 3E79A 3ROJA 4NN3A 4O7IA 4HCYA 4MHFA 2V4CA 3W9VA 4JVCA 5EQAA 2PCRA 5ET6A 1JP4A 4PFRA 1NUZA 4I3EA 1YZ0A 4N91A 5J16A 1IMFA 3FXBA 4NHBA 4GWWA 4OA4A 5JK4A 1NV3A 2MKZA 2B4LA 4MEVA 5F24A 1AWBA 1YXIA 4AS4A 2XXKA 2CZKA 3MSTA 4P1LA 1FRPA 1RDXA 2BJIA 2R8TA 4MCOA 5EQ7A 1FJ6A 1CNQA 2CEYA 3IFCA 4I3YA 4GBWA 2P3VA 2Q9TA 4GWZA 4NAPA 5IZ3A 4N15A 3T0JA 4PETA 2KR0A 3KBZA 3LUZA 1K9YA 2XWVA 1EYIA 1LBXA 1LBYA 2PFYA 2WBDA 4DI4B 3HFUA 2WX9A 4NX1A 2CEXA 4M1VA 1YYZA 4MNPA 1IMCA 2L5VA 1KA1A 4PF6A 1FPIA 3IFAA 3BIHA 2Q8MA 2FIEA 1INPA 5J1DA 1RDZA 3B8BA 1NV2A 2QVUA 3E78A 5LDZA 1FBHA 1IMEA 1QGXA 3QMFA 3NOHA 3W9WA 2V3QA 3U65A 4G61A 2JJKA 2FVZA 2QFLA 4PGPA 4N6DA 1RDYA 3MYUA 1FPJA 2F3DA 4GWYA 3A29A 1IMDA 3GYYA 1NI9A 4PAFA 1FBGA 3RYDA 4OVTA 1NV1A 2ZZVA 1G0HA 2QVVA 3RPLB 4NGUA 2PFZA 3BIGA 4GWXA 1NUXA 2FIXA 4FBPA 4N6KA 4HXVA 2XA5A 4X9TA 4F1VA 2DE2A 3RPLA 1IMBA 2F5XA 5I5PA 4NG7A 4F18A 4P1EA 1DCUA 4PTKA 4UABA 1FPFA 2WYKA 1FSAA 1FPLA 4HE2A 2ZZXA 3KC0A 2HXRA 4O94A 4MX6A 2VPNA 4MNIA 3D1RA 1VDWA 1NV7A 1NV5A 2KQZA 4GBVA 4QXDA 3EKIA 2HZLA 1G0IA 2WEFA 4HE1A 5IZZA 4PF8A 2DE4A 5CM6A 4YZZA 4PFBA 1FBFA 4PBQA 2DDKA 5LTCA 1FPDA 1EYJA 4PCDA 4JVDA 3FBPA 4X04A 3PTYA 4F19A 2B4MA 4PDDA 1KZ8A 4N81A 4X8RA 4YICA 1EYKA 5IGAA 4QBAA 4O8MA 4P56A 2CZIA 5IZ1A 1LBVA 2Y5LA 3SZPA 1FJ9A 2F3BA 2HHMA 4PDHA 4AS5A 2ZZWA 3CHGA 4H46A 2DE3A 4GWUA 1FBDA 4P8BA 1FPKA 4NQ8A 2HPGA 2WBBA 2GQ1A 1NV0A 2XWKA 4N4UA 2Q74A 4O7MA 4XF5A 4NF0A 4H45A 1BK4A 1FBPA 5A5LA 1FPBA 2CZHA 1FPGA 4MAGA 5IM2A 4N17A 1FBCA 1SPIA 4P3LA 1NUWA 4F1UA 4IR8A 3ISPA 2QPQA 1FTAA 4PE3A 2FBPA 1LEVA 1D9QA 1KA0A 2DVZA 4OVQA 5ET7A 1NV4A 1NUYA 4PGNA 3T1BA 5IZ3B 4LN5A 5ET8A 4PFIA 4MJOA 5FBPA 5ET5A 4DI3D 2WYPA 5EYGA 2XWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEV A;  4X04 A;  2XXK A;  4PGP A;  4N6D A;  2XWO A;  4P1L A;  4PDD A;  4N8G A;  4MCO A;  4PBH A;  4P47 A;  4MMP A;  4X8R A;  4YIC A;  4XFE A;  3GYY A;  4PAF A;  4OVS A;  5IGA A;  4OVT A;  2CEY A;  2ZZV A;  5I7I A;  4O8M A;  4P56 A;  4PAI A;  4XEQ A;  4NGU A;  4NAP A;  2PFZ A;  4N15 A;  4PDH A;  2ZZW A;  4PET A;  4N6K A;  4P9K A;  4OVP A;  4P8B A;  2XA5 A;  4NQ8 A;  2HPG A;  2XWV A;  4PAK A;  5I5P A;  2VPO A;  4NG7 A;  4OVR A;  3B50 A;  4P1E A;  2PFY A;  2XWK A;  4N4U A;  4UAB A;  2WYK A;  4O7M A;  4XF5 A;  4DI4 B;  4NF0 A;  2WX9 A;  4NX1 A;  2CEX A;  2HZK A;  2ZZX A;  4MAG A;  4O94 A;  5IM2 A;  4MNP A;  4MX6 A;  2VPN A;  4MNC A;  4MNI A;  4N17 A;  4P3L A;  4PF6 A;  4N8Y A;  4MIJ A;  4PC9 A;  4PE3 A;  4OAN A;  2HZL A;  4OVQ A;  4NN3 A;  4MHF A;  2V4C A;  4PGN A;  5IZZ A;  4PF8 A;  4LN5 A;  5CM6 A;  4YZZ A;  4PFB A;  4PFI A;  4PFR A;  4N91 A;  4PBQ A;  3FXB A;  4NHB A;  5LTC A;  4OA4 A;  4DI3 D;  2WYP A;  3U65 A;  2XWI A;  4PCD A; 
#chains in the Genus database with same CATH topology
 2ZNS A;  4U4X A;  4PFY A;  4TQU Q;  1VSO A;  3S9E A;  3OO8 A;  1XOC A;  1ZLQ A;  4IO7 A;  1OMP A;  4G8N A;  2XX9 A;  1IEJ A;  3T93 B;  3V83 A;  3C36 A;  4GWS A;  5L9S A;  2FHY A;  3Q26 A;  1QKA A;  1Z7N E;  1MQI A;  1DBZ A;  4KXP A;  3OEL A;  4ZEC A;  1TWY A;  1XHY A;  1N3X A;  4OVP A;  2DYX A;  2F7C A;  1P1N A;  1XI6 A;  3FJG A;  1Y20 A;  4NF8 A;  2QMX A;  4GX6 A;  5H8N A;  3UOR A;  1Y3P A;  1K9Z A;  5KZT A;  4OET A;  4GXA A;  3K2D A;  3DEL B;  5JEI A;  5HPQ A;  2V3U A;  2XXY A;  4GX3 A;  2PT1 A;  4LP2 B;  1Q9D A;  5TP9 B;  4ZE9 A;  4OHN A;  2OLB A;  1USY E;  4PC9 A;  4TLM B;  3THI A;  1LFH A;  4LZ8 A;  3ILU B;  4N13 A;  1JW1 A;  1KWH A;  1I6Q A;  1GTK A;  3MP6 A;  3W9V A;  5JTY A;  5EQA A;  5ET6 A;  2ONR A;  4QSD A;  4PFR A;  2HXW A;  4ELQ A;  2DWI A;  5J16 A;  1EZ9 A;  2A5T A;  3EHT A;  1VE4 A;  3Q28 A;  5JK4 A;  2Z22 A;  3QUJ A;  3TOD A;  1MG1 A;  4O3A A;  1Y1M A;  2DVC A;  1HSJ A;  2HQ0 A;  1RDX A;  4X1D A;  1D3K A;  3S9N C;  4ND9 A;  2Q2A A;  1CNQ A;  4G4P A;  2VD2 A;  3I6V A;  3ODB A;  4NF4 A;  4I3Y A;  1MY0 A;  4OXV A;  1QJM A;  5TPA B;  5IZ3 A;  2GRV A;  3PPQ A;  2ZMB A;  4JXI A;  3Q29 A;  5EHM A;  1B7Z A;  4RA1 A;  4H0W A;  2YJP A;  2KR0 A;  3CI8 A;  4I62 A;  4YB7 A;  3K6W A;  3LUZ A;  4GVO A;  4F3S A;  4C0R A;  4R9F A;  3MP1 A;  3JZJ A;  2XX7 A;  2WBD A;  3KGC A;  4LZ7 A;  4XTC Q;  5CC2 A;  2WX9 A;  3PUX E;  4NX1 A;  5ICQ A;  2CEX A;  3P7I A;  2F6P A;  1IMC A;  4C1T A;  4PF6 A;  5IAI A;  1FPI A;  1JVY A;  3MC2 A;  3Q25 A;  2Q8M A;  4P0G A;  3TDJ A;  4I8C A;  4C1U A;  4GXS B;  1M5B A;  4RPO A;  2QVU A;  1IZ1 A;  3E78 A;  1LCF A;  4R74 A;  3FVN A;  3RPW A;  1B5J A;  2QJE A;  1QUI A;  3QMF A;  3PPP A;  1CB6 A;  2I3W A;  4R75 A;  3NOH A;  5H8Q B;  3BBR A;  4IGR A;  1JW5 A;  3OD7 A;  4ZS9 A;  2JJK A;  3MVX A;  1URD A;  1O64 A;  1FQB A;  1MY4 A;  5FTI A;  3K6U A;  4N6D A;  1OVB A;  5EYF A;  4I9D A;  1RDY A;  5ICT A;  2O68 A;  1MS7 A;  3QXM A;  3CRB A;  3A29 A;  3GYY A;  1NI9 A;  4BDQ A;  5FHO A;  3R6U A;  1QW0 A;  3G3I A;  2NVU B;  1NV1 A;  4ZZA A;  4OFL A;  3U72 A;  2E1S A;  2YLN A;  4LVQ A;  4N07 A;  1FQD A;  3FAS A;  3FV1 A;  3SES A;  3TTN A;  1WDN A;  4GWX A;  2I0B A;  1NUX A;  4FBP A;  1PBP A;  3A3U A;  4N6K A;  3QAX A;  1S9T A;  1URS A;  1SI0 A;  2XA5 A;  1H44 A;  2Y7K A;  3UN6 A;  5I5P A;  4THI A;  1ZJL A;  2I6E A;  3SET A;  4UAB A;  1LBC A;  4RYA A;  4YKJ A;  1YAE A;  3UA8 A;  4XKN A;  3EHS A;  4OMB A;  3O2A A;  4TLL B;  3IJO B;  1VDW A;  2NWJ A;  3PUV E;  3OMB A;  3A09 A;  2XD3 A;  4QXD A;  3GBB A;  4QSC A;  2WEF A;  4HE1 A;  4YAH X;  2R9J A;  4PF8 A;  4YZZ A;  4PBQ A;  2DP8 A;  3VXC A;  3RGY A;  3SEY A;  2IA4 A;  4PFT A;  5H8H A;  1EYJ A;  3LR1 A;  3H4Z A;  5FTH A;  5I2N B;  1FTO A;  3G3F A;  1DMB A;  4DIG A;  3K02 A;  3LSL A;  2AIX A;  2XXV A;  1O7T A;  2Y7W A;  4PDD A;  2W7Y A;  1MXW A;  5AA1 A;  4WXJ A;  1A7L A;  1Y1Z A;  4H8J A;  4YIC A;  5ITP A;  3DM0 A;  3VLW A;  5AA4 A;  3TQL A;  4G68 A;  3T9V A;  3E4R A;  3OO6 A;  2CZI A;  1DPP A;  1LBV A;  4DXC A;  1JET A;  5I58 B;  2VP1 A;  4F1Y A;  5CBS A;  3W15 C;  4GWU A;  3ILT B;  4P8B A;  3KBR A;  2Q2C A;  1B40 A;  1POT A;  1XVX A;  2HAV A;  1ELJ A;  2ONK E;  2GQ1 A;  1NNK A;  1M5C A;  1NV0 A;  3GBA A;  4O7M A;  4XF5 A;  3EQ1 A;  4H45 A;  2O7U A;  3S9L C;  1FPG A;  2OWT A;  4GL0 A;  3IOT A;  3RUM A;  5HM4 B;  5DEX B;  3S4U A;  2PX1 A;  2QPQ A;  4R72 A;  4MLQ A;  2I49 A;  1KA0 A;  2DVZ A;  2DOJ A;  4YMB A;  1NV4 A;  4PGN A;  3IB1 A;  3ZKL A;  2Q88 A;  1ZTY A;  4LN5 A;  4IY6 A;  4LON B;  4KFQ A;  1N84 A;  3QUF A;  4GD5 A;  3PMW A;  1A8E A;  4KD5 A;  5CMK A;  3PU5 A;  5LOM A;  3TFL A;  3CFZ A;  3PUZ E;  2ESN A;  4N8G A;  1LBZ A;  4P47 A;  4MMP A;  2B3F A;  3TKD A;  3IX1 A;  1B05 A;  2Y7R A;  4KYD A;  4JSO A;  4YB5 A;  1H76 A;  3H6U A;  4R73 A;  5T3J A;  3KOS A;  5ESY A;  4FIM A;  4JBZ A;  1PEB A;  3T9H B;  1US5 A;  5EQ9 A;  3KC1 A;  1UIV A;  3IO6 A;  3UIF A;  1MXU A;  4I40 A;  1MXV A;  5AA2 B;  4O3B A;  1NH8 A;  1B5I A;  1NNP A;  4P9K A;  4X48 A;  2GFE A;  1LB9 A;  1DTG A;  4GX4 A;  4AQ4 A;  2V3T A;  4PAK A;  2Y5K A;  2O1L A;  4ZEI A;  4JVI A;  4H8I A;  3KJT A;  4XIG Q;  1N7X A;  1B5H A;  3FJ7 A;  4QRZ A;  4F3B A;  1N0T A;  3VFJ A;  1B52 A;  2PT2 A;  5KDT B;  3B7D A;  4U4S A;  1B1X A;  5AE4 A;  4MNC A;  1N3W A;  5I57 A;  1MPB A;  4LAT A;  4MIJ A;  4ESX A;  1IIW A;  3VVE A;  1BKA A;  4EUO A;  3ROJ A;  2O6A A;  3O9P A;  4NN3 A;  4GOT A;  3ZKK A;  4WKM A;  4MHF A;  3T66 A;  2V4C A;  3OEM A;  1B3E A;  2PCR A;  3TZA A;  1NUZ A;  1MPC A;  1HSE A;  4F22 A;  3FXB A;  1UTH B;  3IOW A;  3CSG A;  2I58 A;  1NV3 A;  4H6D A;  2I48 A;  2MKZ A;  2B4L A;  3TMG A;  3B6Q A;  2LAO A;  1LCT A;  2F34 A;  3EHU A;  1OQH A;  1B51 A;  1YXI A;  3R26 A;  5F24 A;  2XXK A;  1QVS A;  3DP8 A;  4BDL A;  2OK2 A;  5EHS A;  3QK6 A;  1IUD A;  1ZKB A;  3F11 A;  4MCO A;  5KCJ A;  3N6U A;  3CIJ A;  3UP9 A;  3AXF A;  1FJ6 A;  3M3K A;  4JWX A;  4PFW A;  3KJ7 A;  2ABH A;  4H5G A;  1ANF A;  2PYY A;  2CEY A;  4R2B A;  3IFC A;  3G3J A;  1N04 A;  3C9H A;  2P3V A;  2PBW A;  2Q9T A;  4JSD A;  1MXZ A;  3JV9 A;  3T0J A;  4FAT A;  4PET A;  1MDP 1;  3IOV A;  2O84 X;  3CFX A;  1LFG A;  3KBZ A;  1YTV A;  4YU0 A;  1EYI A;  1LBX A;  2XXR A;  4RNS A;  4XKP A;  4U23 A;  1LBY A;  1Y9U A;  1B4H A;  1MY1 A;  3HFU A;  1GV8 A;  3HN0 A;  4OFJ A;  4M1V A;  4Q30 B;  1D4N A;  2QS2 A;  2L5V A;  1KA1 A;  1AL3 A;  4ELO A;  2DWA A;  2XXX A;  3FUZ A;  3RY3 A;  5M2V A;  1Y3Q A;  3I5O A;  1EU8 A;  1US4 A;  2FIE A;  3MP8 A;  2GHB A;  5J1D A;  4R6H A;  1RDZ A;  4F2O A;  1NV2 A;  2RF1 A;  2REG A;  2AL4 A;  3TCG A;  3MZ9 A;  1FBH A;  2RC8 A;  1ZMG A;  3UK4 A;  1QGX A;  1AOV A;  2OCU A;  1P99 A;  4EDP A;  1QKB A;  2V3Q A;  3U65 A;  1AIV A;  4G61 A;  4BDM A;  4E0X A;  4PFU A;  1NKX A;  1P1W A;  1L5T A;  1TT1 A;  1MDQ A;  3JYR A;  4PGP A;  4YKK A;  3CG1 A;  5TP9 A;  1FPJ A;  4EF1 A;  4GWY A;  1IMD A;  2Z8D A;  4X1B A;  2REJ A;  3RYD A;  3K6V A;  3SKP A;  1D9Y A;  3RPL B;  1OLC A;  4F29 A;  2I4B A;  4HS7 A;  2O69 A;  1JQF A;  1Z7M E;  3TAJ A;  4HXV A;  1UQW A;  3GXA A;  4LUB A;  2ALU A;  1B1H A;  3CVG A;  2DSF A;  3MWB A;  3RPL A;  1MQD A;  1IMB A;  2NXO A;  4NG7 A;  4F18 A;  1DCU A;  2OJT A;  1POY 1;  3O6G A;  3C4M A;  1FPF A;  1FPL A;  3PMX A;  1JEV A;  2E0S A;  2ZZX A;  2HXR A;  4O94 A;  4OYV A;  4R9G A;  1MRP A;  1NV7 A;  2I4C A;  3L6H A;  4UAC A;  4ONY A;  5I56 B;  4GLI A;  2KQZ A;  3C35 A;  1XT8 A;  1Q35 A;  5TPA A;  1GR2 A;  5ISU A;  2VOZ A;  3CR9 A;  1SYI A;  2I3V A;  3EN3 A;  1EH3 A;  1G0I A;  3RN8 A;  2QL3 A;  3MJN A;  3TTR A;  4PFB A;  4GRK A;  4IO6 A;  3HO7 A;  1FPD A;  2UVJ A;  4R6K A;  5BUU A;  2F7A A;  3O66 A;  4JVD A;  3U93 A;  3K4U A;  1H3D A;  3G3G A;  4F19 A;  1BLF A;  1MQH A;  1JEU A;  1VR5 A;  3H3G A;  4FEC A;  4ELR A;  4X8R A;  1B46 A;  1EYK A;  2F35 A;  3KEI A;  4NE4 A;  5I84 A;  5IGA A;  3DP4 A;  4F39 A;  3PPN A;  1MY2 A;  1R1N A;  3UGW A;  4O8M A;  4MH5 A;  5CBR A;  2HHM A;  1NL5 A;  4PDH A;  4H65 A;  2NUV A;  4EXK A;  3V5A A;  2PVU A;  1FBD A;  1FPK A;  4ELP A;  1B3F A;  1OLA A;  5H8Q A;  3FXQ A;  2WBB A;  2ZNU A;  1LB8 A;  1IXC A;  1B7U A;  5L9M A;  3M3L A;  4NF0 A;  3K0V A;  1BK4 A;  4GWO A;  5A5L A;  1BP5 A;  2B65 A;  1SDX A;  5IM2 A;  4QFN A;  4HW8 A;  4EF2 A;  4N17 A;  1SPI A;  2F8D A;  1UTB B;  1NUW A;  5A5X B;  4IR8 A;  4OEU A;  2AL5 A;  3V8X B;  3LSF B;  1HSL A;  3HV1 A;  4QFL A;  5H8F B;  1SW2 A;  1OIB A;  4AB5 A;  3T1B A;  5ET8 A;  4PFI A;  5ET5 A;  4XKQ A;  2QS1 A;  3VV5 A;  3TQW A;  4IY5 A;  4DI3 D;  3FVG A;  2XWI A;  3KSX A;  2XXT A;  3OO7 A;  2RIN A;  1B0L A;  1SW1 A;  4NED A;  3KN7 A;  2H25 A;  1LGB C;  2VT5 A;  4PBH A;  2VGQ A;  2O1M A;  3TTL A;  3LV0 A;  1MM6 A;  4OVJ A;  1LAX A;  5H8S A;  4HE0 A;  4OES A;  3OEK A;  1P1Q A;  4PAI A;  4XEQ A;  1IMA A;  2OX3 A;  4FEB A;  4Z7E A;  2UXA A;  2OWZ A;  4KR5 A;  4DZ1 A;  5EYH A;  1NV6 A;  2RKM A;  3DP6 A;  1PC3 A;  2I0C A;  2NOO A;  5HBC A;  4QSE A;  2R6G E;  2P1S A;  4G77 A;  4YKI A;  1FPE A;  2H99 A;  3PUY E;  4F2Q A;  5I2N A;  3B50 A;  4OVR A;  2B3B A;  2CZL A;  4IO4 A;  4ISU A;  2ZNT A;  4HCW A;  3WAF A;  5I59 B;  1IIT A;  2XXQ A;  4IO2 A;  5EQ8 A;  3SEW A;  3KG2 A;  2ZYM A;  4N8Y A;  1QUL A;  3G7W A;  3SEU A;  3TTM A;  1FTK A;  1B32 A;  5I58 A;  3I3V A;  4OAN A;  1IXH A;  1DK4 A;  3E79 A;  3TCH A;  4ZE8 A;  4JDF A;  3U92 A;  1NNT A;  4HCY A;  4FE8 A;  1FTL A;  3PUW E;  4JVC A;  1LLS A;  1JP4 A;  1LAF E;  4I3E A;  4KPT A;  1MXX A;  4NHB A;  3FV2 A;  1OVT A;  4OA4 A;  3KN3 A;  4F3G A;  1B6H A;  4KYE A;  1GVC A;  3TPA A;  2XHD A;  4F3P A;  4LZ5 A;  1B0H A;  3TCF A;  4AS4 A;  3FVK A;  3D4C A;  1B58 A;  2UVI A;  2CZK A;  1WOD A;  3MST A;  4P1L A;  1RYO A;  2R8T A;  2O7I A;  5DEX A;  5EQ7 A;  2XXW A;  3H06 B;  5DVF A;  3FVO A;  1QUJ A;  4YMA A;  1GGG A;  1A8F A;  1URG A;  1PDA A;  1XVY A;  1MM7 A;  1NFT A;  1M5F A;  2DQV A;  3IB2 A;  2P2A A;  3OEN A;  4NAP A;  3RLF E;  3M8U A;  3IR1 A;  3MZB A;  4GF8 A;  3TUS A;  3SEX A;  4K3F A;  5F1Q A;  3CSB A;  1B9J A;  3GLB A;  3HST A;  1SVX B;  1YYZ A;  2DXR A;  3HPI A;  5ELV A;  1S50 A;  1Y4C A;  3IFA A;  2H98 A;  4H5F A;  4ZDM A;  3IOR A;  1INP A;  4DCX A;  5AA2 A;  1R9L A;  3MW0 A;  2RCB A;  3B8B A;  3KN8 A;  4P11 A;  4POX A;  1H43 A;  1R9Q A;  4H1X A;  5TU0 A;  4KCC A;  3K1N A;  3W9W A;  4U1O A;  4G2Z A;  5KDT A;  2Z8E A;  1FTM A;  1VFD A;  4M4G A;  2FVZ A;  1SBP A;  1J1N A;  1IXI A;  3K01 A;  5DVJ A;  3LSW A;  1MY3 A;  4NF6 B;  3VLV A;  3PGF A;  1BTJ A;  3C32 A;  5B7D A;  5CMM A;  4R2F A;  1FBG A;  3RTW B;  3GZG A;  3G3H A;  4KHZ E;  4NF6 A;  4NGU A;  4TOZ A;  3MBP A;  1M5D A;  2PFZ A;  2M8C A;  2UVG A;  4ESW A;  1UTH A;  2H5Y A;  3E13 X;  2FYI A;  4RY1 A;  4F1V A;  3BFT A;  2DE2 A;  4O3C A;  1A40 A;  2F5X A;  1DOT A;  1UIU A;  4G68 C;  3FZV A;  4PTK A;  3L6G A;  4U22 A;  2F78 A;  2QS3 A;  1FSA A;  2X7P A;  1ATG A;  1PB9 A;  3KC0 A;  2QRY A;  3N94 A;  4MX6 A;  4MNI A;  2QSX A;  3D1R A;  1B3G A;  5CRY A;  2ZXT A;  2PMS A;  3EF7 A;  4FED A;  4MF3 A;  2G29 A;  4GBV A;  1PBQ A;  3EKI A;  1USY H;  2HZL A;  4IO5 A;  4QHQ A;  5I2K B;  3K00 A;  2UYE A;  2ONS A;  3B6W A;  5IKB A;  5IZZ A;  1I69 A;  3ONM A;  3QIM A;  1LST A;  1CE2 A;  1S7Y A;  1FQC A;  2DDK A;  3ZS6 A;  3FXR A;  5LTC A;  1Y3N A;  5I2K A;  4BDO A;  1MQJ A;  5AA2 D;  4PCD A;  4NF8 B;  3FBP A;  4X04 A;  3PTY A;  1FQE A;  1MQG A;  4NMY A;  3HCQ A;  5H8N B;  2Y7I A;  4ZEF A;  3O6I A;  4I1D A;  2B4M A;  3Q27 A;  2FA7 A;  3RQT A;  5B70 A;  4U1Z A;  3OO9 A;  3TTK A;  3T9U A;  1FQA A;  4IB2 A;  3RNN A;  3BFU A;  2IEE A;  4DXB A;  1N76 A;  3LSX A;  4DCY A;  4KCD A;  3S9M C;  1P1U A;  2Y5L A;  2QMW A;  1FJ9 A;  2D5W A;  1R6Z A;  4AS5 A;  2ZZW A;  3IK6 B;  3CHG A;  4H46 A;  2DE3 A;  3LUY A;  3VXB A;  5JTY B;  1FTJ A;  4OZ9 A;  2A5T B;  5CI5 A;  2V93 A;  2DS9 A;  2DXY A;  4N4U A;  3PD9 A;  3PV0 E;  1NH7 A;  3N6T A;  4RK2 A;  1NMU A;  1QUK A;  4QF9 A;  3K1M A;  4F1U A;  2ZYK A;  2ZYO A;  4PE3 A;  3H6T A;  1LEV A;  3PD8 A;  3IJX B;  1A55 A;  1M5E A;  4OVQ A;  3LBS A;  4NF4 B;  3O6H A;  4RK9 A;  2Q89 A;  1Q1K A;  5IZ3 B;  3TEP A;  4MJO A;  4JWO A;  3R7X A;  3VVD A;  5DT6 A;  3KFM A;  4Q8R A;  4Q0C A;  5I3S A;  3O29 A;  3TYH A;  3VDF A;  3MVW A;  2QVR A;  2XWO A;  2DWH A;  1B4Z A;  3IOU A;  3H03 A;  5I56 A;  1LBW A;  1MH3 A;  4XFE A;  4OVS A;  2UVH A;  1PB7 A;  1FBE A;  3IB0 A;  3MVZ A;  5I7I A;  5DW8 A;  2ANJ A;  3VE1 B;  2HEU A;  1JW4 A;  2VHA A;  2Y7P A;  3MZ1 A;  1SW5 A;  4ECF A;  4G8H A;  3CFL A;  1A99 A;  4JB7 A;  5BWJ A;  2G93 A;  3SER A;  3B6T A;  2P3N A;  2GHA A;  3V89 B;  3QSL A;  4OEV A;  2VPO A;  5F7V A;  4ZEB A;  2F97 A;  3HHF A;  3MVY A;  3MUQ A;  2O51 A;  2HZK A;  3KOT A;  4ZEK A;  4KI0 E;  1LAH E;  4ZZE A;  3FD3 A;  1VFE A;  3DLN A;  4LQ2 A;  1SW4 A;  3FIR A;  1DSN A;  1IQ7 A;  1I6B A;  2ZYN A;  4NF5 B;  1YPN A;  4O7I A;  4Q5T A;  4WED A;  3OXN A;  3T9X B;  1YZ0 A;  4N91 A;  4NWC A;  1IMF A;  4GWW A;  2X7Q A;  1YCJ A;  1T0K A;  2KLF A;  2HFB A;  4NF5 A;  1AMF A;  4MEV A;  1DPE A;  1NNF A;  1LAG E;  2D21 A;  1AWB A;  4MBP A;  3O97 A;  4L17 A;  5K2Y A;  5FHM A;  1FRP A;  2BJI A;  1UTB A;  4QFK A;  5A5X A;  3M3F A;  1F9B A;  3TEL A;  1RYX A;  3S2V A;  3SDF A;  2P0S A;  4E0W A;  2Q8J A;  2R71 A;  1O63 A;  4IO3 A;  4HTG A;  4U2R A;  2F6G A;  3RTF B;  5H8F A;  1EZP A;  4GBW A;  4GWZ A;  3MPL A;  4N15 A;  2BJJ X;  3FXU A;  3E9X A;  1OQG A;  4BDR A;  1FCK A;  1ZU0 A;  4POW A;  1Y4T A;  4FJP A;  3EPE A;  1K9Y A;  2XWV A;  4DE8 A;  1FW0 A;  2PFY A;  1XC1 A;  3IAZ A;  1ZBM A;  3LC8 A;  5H8H B;  3KZG A;  5CMC A;  5L9O A;  4DI4 B;  4WEP A;  3C31 A;  2XXP A;  2V84 A;  4G8M A;  3A3C A;  4GQO A;  4OTE A;  1FQF A;  1SQY A;  4UA8 A;  4DDD A;  3KSJ A;  4MNP A;  4MFI A;  3OSQ A;  3BKI B;  3FGS A;  1MH4 A;  1AH5 A;  3WAE A;  3QYT A;  3BIH A;  5AA4 B;  4EXL A;  1TFD A;  1TXF A;  4G68 B;  1LFI A;  3VLU A;  2F36 A;  5FHN A;  4EQB A;  4PE5 B;  5LDZ A;  2QS4 A;  4OFO A;  3N26 A;  1IME A;  2CMO A;  1II5 A;  4FAJ A;  4N6P A;  1JNF A;  3MAM A;  3PPR A;  5I59 A;  3K1P A;  4KQP A;  1IXG A;  3CG3 A;  2QFL A;  4RXL A;  2OZZ A;  4LQ5 A;  3MYU A;  4FOR A;  1SYH A;  2F3D A;  4PAF A;  3D4G A;  3ZSF A;  4DXU A;  2OWS A;  2FNC A;  4OVT A;  2ZZV A;  1G0H A;  1RKM A;  2QVV A;  4AB6 A;  2H4I A;  3HHG A;  4F31 B;  1H45 A;  3BIG A;  3E3K A;  2FIX A;  3OOA A;  4Z0I A;  2XXH A;  4X9T A;  3H6W A;  4JWY A;  1TFA A;  1DTZ A;  1LBB A;  2AYS A;  4P1E A;  1PB8 A;  2WYK A;  2XXI A;  4IGT A;  2H9B A;  1MPD A;  4HE2 A;  4RPN A;  4PP0 A;  3T96 B;  2VPN A;  4DLD A;  1NV5 A;  4EQ7 A;  2A5S A;  4H67 A;  1I6A A;  2DWJ A;  3SEV A;  3IO4 A;  3N5L A;  4PQJ A;  4EQ9 A;  3C34 A;  4QFP A;  2HCA A;  4OER A;  2DE4 A;  5CM6 A;  1SI1 A;  4MLV A;  1FBF A;  4XXU A;  2RC9 A;  3VVF A;  2V25 A;  3RT8 A;  2Z23 A;  5AA3 A;  1B7H A;  4RJZ A;  1B3L A;  3U8Q A;  4YB6 A;  2RC7 A;  4P0I A;  4ZED A;  1XS5 A;  2THI A;  3PMV A;  3MQ9 A;  3OSR A;  1KZ8 A;  4GFR A;  1N7W A;  4N81 A;  3C33 A;  2Z8F A;  4NWD A;  2YPN A;  1A54 A;  5DYH A;  3MPK A;  4NTL A;  4U21 A;  2OBG A;  3IL1 B;  5I57 B;  4QBA A;  4P56 A;  1WVJ A;  5IZ1 A;  5DTB A;  3SZP A;  2F3B A;  4OQO A;  2WKY A;  2X26 A;  3FJM A;  2UYF A;  3U94 A;  5K2X A;  5ITO A;  4BDN A;  4NQ8 A;  2HPG A;  5DVI A;  2GH9 A;  2HAU A;  4QFO A;  5L8D A;  1P1O A;  1SD3 A;  3USD A;  3O28 A;  2XWK A;  2XD2 A;  4BLA A;  5CMB A;  2Q74 A;  4LA9 A;  1FBP A;  4GIZ A;  1FPB A;  2CZH A;  1MXY A;  1EZO A;  2XXU A;  4MAG A;  4KYS A;  1B3H A;  1BIY A;  1D9V A;  4GL8 A;  4P3L A;  1FBC A;  3U1O A;  3PPO A;  2VD3 A;  3H7M A;  3H6V A;  4R6Y A;  5KCJ B;  2RCA A;  1JVX A;  4OEN A;  3G3K A;  3ISP A;  3RT6 B;  1FTA A;  2FBP A;  3ECR A;  1D9Q A;  4XKR A;  5ET7 A;  1NUY A;  2D3I A;  4YKP A;  2XX8 A;  2F7B A;  5FBP A;  1B2H A;  3T22 A;  2Y84 A;  4OWD A;  3FAT A;  2WYP A;  1ZIU A;  5EYG A;  3K6X A; 
#chains in the Genus database with same CATH homology
 5I3S A;  2QVR A;  2XWO A;  2VT5 A;  4N8G A;  4PBH A;  1LBZ A;  4P47 A;  4MMP A;  3LV0 A;  1LBW A;  4XFE A;  4HE0 A;  4OVS A;  5T3J A;  1FBE A;  5ESY A;  5I7I A;  5DW8 A;  4GWS A;  4PAI A;  4XEQ A;  1IMA A;  2OX3 A;  5EQ9 A;  3KC1 A;  2FHY A;  4I40 A;  1DBZ A;  4KXP A;  2OWZ A;  5EYH A;  1NV6 A;  4P9K A;  4OVP A;  1XI6 A;  4GX4 A;  2P3N A;  1FPE A;  4GX6 A;  2Y5K A;  4PAK A;  2VPO A;  3B50 A;  4OVR A;  4JVI A;  1K9Z A;  4HCW A;  2HZK A;  5EQ8 A;  4MNC A;  4GX3 A;  1Q9D A;  4N8Y A;  4MIJ A;  4PC9 A;  4OAN A;  1DK4 A;  3E79 A;  3ROJ A;  4NN3 A;  4O7I A;  4HCY A;  4MHF A;  2V4C A;  3W9V A;  4JVC A;  5EQA A;  2PCR A;  5ET6 A;  1JP4 A;  4PFR A;  1NUZ A;  4I3E A;  1YZ0 A;  4N91 A;  5J16 A;  1IMF A;  3FXB A;  4NHB A;  4GWW A;  4OA4 A;  5JK4 A;  1NV3 A;  2MKZ A;  2B4L A;  4MEV A;  5F24 A;  1AWB A;  1YXI A;  4AS4 A;  2XXK A;  2CZK A;  3MST A;  4P1L A;  1FRP A;  1RDX A;  2BJI A;  2R8T A;  4MCO A;  5EQ7 A;  1FJ6 A;  1CNQ A;  2CEY A;  3IFC A;  4I3Y A;  4GBW A;  2P3V A;  2Q9T A;  4GWZ A;  4NAP A;  5IZ3 A;  4N15 A;  3T0J A;  4PET A;  2KR0 A;  3KBZ A;  3LUZ A;  1K9Y A;  2XWV A;  1EYI A;  1LBX A;  1LBY A;  2PFY A;  2WBD A;  4DI4 B;  3HFU A;  2WX9 A;  4NX1 A;  2CEX A;  4M1V A;  1YYZ A;  4MNP A;  1IMC A;  2L5V A;  1KA1 A;  4PF6 A;  1FPI A;  3IFA A;  3BIH A;  2Q8M A;  2FIE A;  1INP A;  5J1D A;  1RDZ A;  3B8B A;  1NV2 A;  2QVU A;  3E78 A;  5LDZ A;  1FBH A;  1IME A;  1QGX A;  3QMF A;  3NOH A;  3W9W A;  2V3Q A;  3U65 A;  4G61 A;  2JJK A;  2FVZ A;  2QFL A;  4PGP A;  4N6D A;  1RDY A;  3MYU A;  1FPJ A;  2F3D A;  4GWY A;  3A29 A;  1IMD A;  3GYY A;  1NI9 A;  4PAF A;  1FBG A;  3RYD A;  4OVT A;  1NV1 A;  2ZZV A;  1G0H A;  2QVV A;  3RPL B;  4NGU A;  2PFZ A;  3BIG A;  4GWX A;  1NUX A;  2FIX A;  4FBP A;  4N6K A;  4HXV A;  2XA5 A;  4X9T A;  4F1V A;  2DE2 A;  3RPL A;  1IMB A;  2F5X A;  5I5P A;  4NG7 A;  4F18 A;  4P1E A;  1DCU A;  4PTK A;  4UAB A;  1FPF A;  2WYK A;  1FSA A;  1FPL A;  4HE2 A;  2ZZX A;  3KC0 A;  2HXR A;  4O94 A;  4MX6 A;  2VPN A;  4MNI A;  3D1R A;  1VDW A;  1NV7 A;  1NV5 A;  2KQZ A;  4GBV A;  4QXD A;  3EKI A;  2HZL A;  1G0I A;  2WEF A;  4HE1 A;  5IZZ A;  4PF8 A;  2DE4 A;  5CM6 A;  4YZZ A;  4PFB A;  1FBF A;  4PBQ A;  2DDK A;  5LTC A;  1FPD A;  1EYJ A;  4PCD A;  4JVD A;  3FBP A;  4X04 A;  3PTY A;  4F19 A;  2B4M A;  4PDD A;  1KZ8 A;  4N81 A;  4X8R A;  4YIC A;  1EYK A;  5IGA A;  4QBA A;  4O8M A;  4P56 A;  2CZI A;  5IZ1 A;  1LBV A;  2Y5L A;  3SZP A;  1FJ9 A;  2F3B A;  2HHM A;  4PDH A;  4AS5 A;  2ZZW A;  3CHG A;  4H46 A;  2DE3 A;  4GWU A;  1FBD A;  4P8B A;  1FPK A;  4NQ8 A;  2HPG A;  2WBB A;  2GQ1 A;  1NV0 A;  2XWK A;  4N4U A;  2Q74 A;  4O7M A;  4XF5 A;  4NF0 A;  4H45 A;  1BK4 A;  1FBP A;  5A5L A;  1FPB A;  2CZH A;  1FPG A;  4MAG A;  5IM2 A;  4N17 A;  1FBC A;  1SPI A;  4P3L A;  1NUW A;  4F1U A;  4IR8 A;  3ISP A;  2QPQ A;  1FTA A;  4PE3 A;  2FBP A;  1LEV A;  1D9Q A;  1KA0 A;  2DVZ A;  4OVQ A;  5ET7 A;  1NV4 A;  1NUY A;  4PGN A;  3T1B A;  5IZ3 B;  4LN5 A;  5ET8 A;  4PFI A;  4MJO A;  5FBP A;  5ET5 A;  4DI3 D;  2WYP A;  5EYG A;  2XWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...