4PGNA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Transport protein
molecule keywords Extracellular solute-binding protein, family 7
total genus 111
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pgnA00
4MX6A 4OVSA 4MMPA 4O8MA 2ZZVA 4PBQA 4N6DA 5IZZA 2HZLA 2ZZWA 4PDHA 4LN5A 4NGUA 4PBHA 4NN3A 4N15A 4X8RA 5IGAA 2XWOA 2WX9A 2ZZXA 4N17A 2XWKA 4MIJA 4MNIA 2VPOA 2V4CA 4O94A 4PETA 2CEYA 2PFYA 5I5PA 4PFIA 3B50A 4X04A 2HPGA 4UABA 3GYYA 4XFEA 4XF5A 4YZZA 4PDDA 4N4UA 4PAIA 4DI3D 4MNCA 4P3LA 2WYPA 4PF8A 4P8BA 4NX1A 3FXBA 4N8GA 5LTCA 4P1EA 4MHFA 4PAFA 2XWVA 2XWIA 5CM6A 4PGPA 4OVRA 4N6KA 4P47A 4NAPA 4YICA 4OVQA 4OA4A 4XEQA 4P1LA 4MNPA 4PFBA 4NF0A 4NQ8A 4MCOA 5IM2A 4NG7A 4MEVA 4N91A 4PAKA 4PGNA 2XXKA 4PC9A 3U65A 5I7IA 4PCDA 4DI4B 4OVPA 4P9KA 4MAGA 4OANA 2CEXA 2XA5A 4PF6A 4O7MA 4PFRA 4OVTA 2WYKA 2HZKA 4N8YA 4P56A 4PE3A 2VPNA 2PFZA 4NHBA
chains in the Genus database with same CATH superfamily
4GWUA 1D4NA 1NMUA 4OWDA 3TPAA 1B7UA 1N7XA 3KN3A 3LC8A 2G29A 2R9JA 1SBPA 3UA8A 2DE3A 2YJPA 3RN8A 1EZPA 1MXVA 1NV5A 1B4HA 2I49A 3KBZA 4MIJA 1VSOA 1IXIA 4QBAA 1URDA 1TT1A 4PETA 2OJTA 4ONYA 2B65A 2Y7IA 4FEBA 2F7AA 4GX6A 2HPGA 4QSCA 2Y7KA 4I1DA 4Q5TA 3IORA 4YB7A 3AXFA 1H3DA 2IEEA 3IX1A 2A5SA 4BDLA 4KYEA 4F19A 4H65A 4KQPA 2E0SA 1BIYA 1AH5A 4MLVA 4P0GA 2I4CA 4XEQA 4H46A 2XXIA 4MCOA 1YTVA 3R7XA 1FPBA 4NE4A 3SEYA 5TU0A 2F36A 2AL5A 3G3IA 1G0IA 4GQOA 4MAGA 4QHQA 4RA1A 1OIBA 1ZTYA 4IO2A 4F1VA 4I8CA 2XA5A 3TDJA 1P1QA 1P1UA 4GXSB 3QYTA 5CMKA 3Q27A 2QVVA 2WYKA 3FVOA 4RK9A 3KOTA 3QUFA 5LDZA 3CG1A 1NKXA 3LSWA 2PX1A 1PB7A 4IO6A 2A5TA 4GD5A 4IY5A 4R2FA 1JVXA 3CI8A 3ZKKA 1M5DA 4X1DA 4NMYA 3M8UA 4BLAA 1OQHA 3S2VA 3N6TA 1B7ZA 3Q25A 4TOZA 2P3NA 3SEUA 3L6HA 1EZOA 1PB9A 1KA1A 1US5A 4PE5B 3PPPA 4MF3A 3THIA 2F97A 5KCJA 4F2QA 3TTRA 3MBPA 4OESA 4QFLA 4XFEA 4H1XA 3K0VA 3ILUB 1R1NA 4DI3D 1N3XA 1Q1KA 2F8DA 1UQWA 2DE2A 1LEVA 5LTCA 2GHBA 3W9WA 5CM6A 4G77A 4IGRA 3VV5A 3KC0A 4R74A 2H98A 3A29A 3K2DA 5I3SA 4PFBA 1A99A 1D9VA 5IKBA 4MEVA 1A55A 1NV0A 4JB7A 3O6HA 2XX9A 1XOCA 3DP6A 5I7IA 3VDFA 4KXPA 4U1OA 2H5YA 5H8QA 4HXVA 5AA4A 2GHAA 2A5TB 5J1DA 1AIVA 1B9JA 4DDDA 2Y5KA 2DWAA 1AL3A 2I48A 4IO3A 3VXBA 5FTHA 1FCKA 1M5BA 3TYHA 1FBGA 1JW4A 3MJNA 2QS2A 1JETA 1A8EA 4MFIA 1XHYA 4KR5A 3TCGA 4ESWA 3MVWA 3ROJA 3OMBA 4AB5A 1FTMA 1OLCA 4XKNA 1I6BA 1ATGA 2NXOA 3CRBA 4QRZA 1FBPA 4AQ4A 1SW4A 4EF2A 1RDZA 4F3BA 4H5FA 2O1MA 1VFEA 4P3LA 4ZS9A 3QXMA 3RPLA 4F18A 3C4MA 5DT6A 2XWVA 1PDAA 1NNTA 4DCXA 3R26A 3PUXE 4HW8A 2UVIA 1MY3A 4GWSA 5H8SA 3T9VA 3EPEA 2WBBA 3ZS6A 2B4LA 2I4BA 2ZYMA 1FBFA 3IL1B 1RYOA 3EQ1A 4PCDA 1VDWA 3U72A 4IB2A 4FBPA 4H8IA 4YMAA 4JDFA 3PMVA 3O29A 5H8HB 4BDMA 3KC1A 4G2ZA 4RJZA 3HFUA 4OVTA 2QVRA 4RXLA 1AOVA 4O3CA 3N26A 1FPJA 2GRVA 3QSLA 4IO5A 2RKMA 1A54A 3RPWA 1NUYA 4NN3A 2XWOA 5T3JA 3LBSA 2OLBA 5BUUA 1SPIA 1IMAA 5AA4B 1OVTA 3DP8A 2Y7PA 1P1OA 1IMFA 2XXPA 5KDTB 4NEDA 3M3KA 1MXXA 2VT5A 1NL5A 4XKQA 4F3PA 3TKDA 3E9XA 4F1UA 1YCJA 4HCWA 3UP9A 1LAGE 1FBDA 2DWIA 2W7YA 2PBWA 4X48A 4NX1A 2Y7RA 1Y20A 4U1ZA 2YLNA 5DEXB 1QUKA 4MHFA 2VD2A 3FJGA 2HCAA 3IR1A 2ANJA 4NAPA 3T0JA 1OLAA 3LUZA 4NF0A 3PPQA 3TZAA 2XD2A 1NV7A 2CZLA 3IO6A 4N91A 3FVGA 4JVIA 1P1WA 3MSTA 1JW5A 4RPOA 3UGWA 1UIUA 4O7MA 2R71A 4NF8B 2P0SA 1FPDA 1QGXA 5AA2B 1H44A 4PFUA 4YU0A 4ELPA 1R9QA 4LUBA 1JW1A 3H03A 2ONRA 3MVYA 4NHBA 1LAFE 4OQOA 3ONMA 2ZZVA 4N6DA 4X1BA 1MRPA 4ELQA 3TMGA 4WXJA 5F1QA 5AA2A 2Q9TA 3RPLB 4I3YA 3VXCA 2CMOA 1XVYA 1B7HA 1M5EA 4RNSA 3MVZA 4MNIA 1ELJA 1USYE 2QL3A 2HHMA 3B50A 3C35A 5TPAA 4GVOA 1MH4A 2OZZA 5DVIA 5JK4A 2UVHA 1Y1ZA 3O6IA 4PF8A 1ZJLA 3Q26A 4F3GA 2REJA 3K6XA 2X26A 1B46A 1LBCA 4YB6A 2O7IA 4P47A 3EF7A 4I40A 4YMBA 3USDA 5EYHA 1XC1A 2XX7A 2Y84A 1D3KA 2ONSA 3VVEA 5EYFA 5HBCA 4JWXA 3VLUA 1FSAA 4PFTA 4P9KA 3LV0A 3MVXA 4R73A 4KPTA 1Z7ME 3N5LA 4ECFA 3D1RA 2ZMBA 2REGA 1NH8A 3EHSA 3C9HA 4JXIA 4QFNA 2HZKA 1B2HA 2Q2AA 1VFDA 3IOWA 3UK4A 1FQCA 3BKIB 2I3VA 4LP2B 4NWDA 1NUXA 2NVUB 2QRYA 3I5OA 2ZYOA 4U21A 2V93A 1JEUA 2AYSA 1NV3A 3JYRA 5ITPA 3B6QA 2B4MA 1NI9A 2ABHA 4Z0IA 2VGQA 4IY6A 4ZECA 4N17A 3JZJA 4BDOA 4RPNA 1FQEA 5EQ9A 3SDFA 2F5XA 2QSXA 4GF8A 2XXUA 2DP8A 1EYIA 3OD7A 3MPLA 2Z8FA 4GWWA 3KJ7A 2F35A 3G3KA 4BDQA 4OYVA 1FQFA 3H6VA 4ESXA 3PTYA 1FW0A 3FZVA 5L9OA 4MNCA 4DXUA 1VR5A 4XKRA 4OFLA 3TTLA 5A5LA 3JV9A 1FBEA 5KDTA 2MKZA 2VD3A 2XWIA 3CHGA 3C36A 3CSGA 4F31B 3E78A 3ZSFA 3ZKLA 1EYKA 4G4PA 3KN7A 3IOUA 5I59B 2RCAA 1RDYA 4U4XA 2XXVA 2BJJX 1AWBA 4YKKA 3CSBA 3HCQA 3O66A 4POWA 3OSQA 3K4UA 4EUOA 2O68A 1IXHA 4JSOA 1D9YA 1HSEA 2HQ0A 3TFLA 2XXRA 4PE3A 5CC2A 3GXAA 4C1TA 1B3FA 2QS3A 2YPNA 1Y4TA 2P3VA 3HO7A 1UIVA 3G3FA 4O8MA 1PBPA 3SETA 3GBAA 3O6GA 2P2AA 1B05A 4NF6A 1SI1A 5K2XA 3OO8A 4FATA 1B3GA 1NUWA 2FBPA 4F2OA 5B7DA 1FPLA 4ZDMA 3OEMA 3UIFA 4FEDA 3I6VA 2VPOA 2AIXA 4GX3A 1FRPA 3UORA 3PPNA 2ONKE 4G8HA 3VVFA 4GWOA 4NF5B 4KD5A 4L17A 4UABA 4NWCA 4OXVA 4QFKA 3V5AA 4PDDA 2XX8A 4WEDA 4N07A 4Z7EA 4P8BA 3FUZA 3FXUA 1A40A 4C0RA 4GX4A 1FTOA 1VE4A 5A5XA 4OETA 4NF6B 2RC7A 3FVKA 3T1BA 1FPGA 1IMDA 1A7LA 4YKIA 3V8XB 4EDPA 4P1LA 1NH7A 2QS4A 5IM2A 5FHMA 2XXKA 3KJTA 4OERA 2KR0A 4OVPA 4KCDA 1Y3QA 5IZ1A 1PEBA 1O64A 2F34A 4G68A 3PD9A 3O28A 2H9BA 2ZYNA 4PP0A 4YB5A 1YYZA 3RUMA 2P1SA 5EQ7A 1DMBA 2F6GA 5J16A 5HM4B 2Q74A 4HS7A 3GLBA 1BLFA 5CI5A 4FAJA 2DWJA 4LZ5A 1ZIUA 2OWTA 4LVQA 2PT2A 3BFTA 1PB8A 1Y3PA 2HEUA 2R6GE 3IJXB 5I58A 4PFIA 4NF4B 1H45A 1B6HA 1B3HA 2VP1A 5A5XB 2QMXA 3HHFA 4LONB 4MLQA 4R9GA 4IGTA 4OZ9A 2BJIA 4YAHX 2DVZA 4R2BA 4TQUQ 4IR8A 3QK6A 1N04A 3OSRA 4PGPA 1IUDA 3ISPA 2DE4A 3L6GA 1KWHA 4OVQA 4OA4A 4OEVA 4GL8A 5L9MA 2GFEA 3I3VA 1MPBA 4WKMA 4X9TA 3CVGA 2OWZA 3KSJA 4DXBA 4I3EA 4WEPA 1SVXB 2FIXA 4XTCQ 1UTBB 4MH5A 1P1NA 2OWSA 3SEVA 4LQ2A 3M3FA 4RY1A 1IXCA 4GWXA 1GTKA 3TUSA 3PMWA 1MH3A 3VE1B 1O7TA 2XXWA 2PCRA 4F22A 1MPDA 4G8NA 4P56A 1B4ZA 2FYIA 1H43A 2PFZA 1FPKA 1R9LA 2Q89A 1XS5A 2V3QA 2CZHA 4GL0A 4MMPA 3U93A 5H8FA 3PUWE 1YXIA 1LBZA 5IZ3A 4LA9A 4YKPA 5IGAA 3EHUA 1FQBA 2UYEA 3TTMA 4BDNA 4H45A 5CMMA 4F29A 3MP1A 4UA8A 3EHTA 2UVGA 4DIGA 5AA2D 3T96B 2UYFA 1MY4A 2F3DA 3KOSA 4FJPA 1JP4A 4N81A 3SESA 4R9FA 3K1MA 3GYYA 5M2VA 3OXNA 2GQ1A 1XI6A 4HE2A 4O3AA 3H6UA 4MJOA 3R6UA 3V83A 1ZBMA 4GRKA 4P1EA 5DVJA 4NF5A 1LSTA 2Y5LA 4ELOA 1UTHB 4U2RA 3C33A 2HXRA 5EHSA 1DBZA 1MM6A 1SYHA 5CBSA 1S9TA 1UTBA 4NG7A 3MQ9A 4PAKA 3C34A 3FXQA 2D21A 1Y1MA 1SDXA 2KQZA 4TLLB 2GH9A 3K02A 1M5CA 2QPQA 3TAJA 5H8NA 1KA0A 1B5IA 2QS1A 4DXCA 1LCTA 4JBZA 1LLSA 3CG3A 3W15C 1OQGA 2L5VA 4N8YA 5AA3A 4LATA 4OFJA 4NF8A 3MUQA 5I2KA 3KG2A 2NUVA 5ITOA 4DLDA 3H06B 4N6PA 5HPQA 1FQDA 4G8MA 3S4UA 4X8RA 4GXAA 5I57B 3SEWA 3K6VA 3HN0A 4F1YA 1FPIA 4EQ9A 3E3KA 1IITA 3MYUA 1TFAA 5EHMA 4LQ5A 4E0XA 4DE8A 4ZZEA 3FIRA 4K3FA 4H67A 2O7UA 5EYGA 5I5PA 2VHAA 4F39A 3U92A 1WVJA 1DSNA 3Q28A 4PAIA 5ET6A 4FORA 1IZ1A 3CR9A 3W9VA 1FJ9A 3SERA 5I58B 4N8GA 4QFOA 4OTEA 4N6KA 5ELVA 1DCUA 1IQ7A 3A3UA 1MQGA 2X7PA 3H4ZA 4I62A 1LBYA 2O1LA 3D4CA 3PGFA 3CIJA 2XD3A 3U65A 4XXUA 1FTLA 2R8TA 2Q8MA 1DPEA 1JNFA 1I6AA 1P99A 3MZBA 3OO7A 4PFRA 2DS9A 1GVCA 1N3WA 4THIA 1GGGA 4PFYA 1LAXA 3G3JA 4H6DA 2VPNA 3MZ9A 2B3BA 2HAUA 3VVDA 1QKBA 3HHGA 2PYYA 5B70A 4RK2A 2Z8EA 4R72A 4EQBA 3IFCA 3GZGA 3T93B 4U23A 3RQTA 1DTGA 1M5FA 3K1NA 4AB6A 2LAOA 4LN5A 1IIWA 4PBHA 2OBGA 2FIEA 5L9SA 3IK6B 2JJKA 1B1HA 1MS7A 4GOTA 4ZEKA 1SD3A 3TQWA 4I9DA 3CFZA 2CEYA 5L8DA 2WEFA 1N76A 3KFMA 4ZEBA 3OEKA 2HXWA 2AL4A 2ZYKA 3IAZA 3B6WA 3E4RA 2WYPA 1J1NA 1MPCA 3O9PA 2DYXA 4IO4A 5AE4A 1EH3A 3FGSA 3LSLA 5I56B 4KCCA 4F3SA 1MXYA 3SKPA 4POXA 3MZ1A 2XXTA 2F78A 2CZIA 4MNPA 5DYHA 3VLWA 3IB2A 3ECRA 3T9XB 4HE1A 3MP8A 1QW0A 4PTKA 2I0CA 1FPEA 2O84X 1JQFA 2CEXA 3O2AA 1KZ8A 3K1PA 4PF6A 2UVJA 3DELB 3N94A 3OO6A 4YKJA 1B3EA 4ZEDA 1LFIA 1QJMA 5IAIA 2HFBA 3U94A 1XT8A 2ESNA 1MG1A 1NNFA 3K01A 3T9UA 1II5A 1NV2A 3PPRA 5ISUA 1LB9A 1B52A 3ILTB 2FNCA 4OMBA 4AS5A 3PU5A 5BWJA 3H6TA 2D3IA 1MY0A 3FD3A 1S7YA 1TFDA 2QFLA 1EYJA 4QFPA 1Y4CA 1LAHE 2H25A 5I2NA 2DSFA 1I69A 1MDP1 5KCJB 2XXHA 4RYAA 1URSA 3N6UA 5ET8A 1UTHA 3TELA 1NUZA 5CMBA 1RDXA 2FVZA 1B32A 4OVRA 1B1XA 2I3WA 3PUZE 4OHNA 3CFLA 1N7WA 5FBPA 3FJMA 2ALUA 1Q9DA 5I2KB 1NNKA 3V89B 1IEJA 3KGCA 2X7QA 3FVNA 4N13A 3SZPA 2DWHA 1FJ6A 4ZEFA 5DEXA 4Q8RA 2ZXTA 4DI4B 1LBXA 2PVUA 3DM0A 5ET5A 3PV0E 3HSTA 3B6TA 3BIGA 3IOTA 3T66A 3TCHA 3ODBA 4ISUA 3MC2A 3UN6A 4U22A 4JVCA 2QVUA 2RF1A 1YAEA 5TP9B 1LBWA 3RNNA 3E79A 1IMEA 5TPAB 2Z22A 4JWYA 4PBQA 4KYDA 3U1OA 1B51A 5I56A 2HZLA 1B5HA 1BKAA 2VOZA 3TODA 5H8NB 1MDQA 3OELA 1B58A 1ANFA 1B5JA 3TQLA 4OVJA 1EZ9A 1FTAA 1LFGA 3EN3A 1B0LA 2H99A 1GV8A 5JTYA 4H8JA 1PBQA 3WAEA 4OFOA 1D9QA 3E13X 3MPKA 5K2YA 1MQHA 1MXWA 1TXFA 2WBDA 4QXDA 3MW0A 5KZTA 1FTKA 1PC3A 1Z7NE 1S50A 3S9EA 4R75A 3G7WA 4IO7A 3RTFB 4GIZA 3D4GA 4NQ8A 3BBRA 5F24A 3S9MC 4BDRA 1QVSA 2F7BA 1SW2A 3FV2A 3IJOB 5JTYB 3VFJA 1JEVA 1ZLQA 4QSEA 4KFQA 1TWYA 4AS4A 3P7IA 5DTBA 3H6WA 3MAMA 3RYDA 4G68C 3PUVE 1MQIA 1HSJA 3FASA 3T9HB 4KYSA 4EQ7A 1RKMA 2HAVA 5DVFA 1FTJA 3QUJA 1NFTA 1NV6A 2ZNUA 1F9BA 3FXRA 1B3LA 5H8QB 1ZMGA 3G3HA 3QMFA 4NGUA 4Q30B 3KN8A 1MY1A 1EU8A 4TLMB 3B8BA 1XVXA 2F6PA 4OENA 4O94A 3RTWB 5ICTA 4R6YA 4GWYA 2PFYA 1USYH 1K9YA 2Q88A 2O51A 1MXZA 3IOVA 4PFWA 2XXQA 4QF9A 3DLNA 2V84A 1OVBA 1ZKBA 1FQAA 3QIMA 2CZKA 1NV4A 1T0KA 4GLIA 1CB6A 2ZNTA 3OOAA 3TEPA 1SI0A 4UACA 2V3TA 3SEXA 2FHYA 2M8CA 3FATA 5H8HA 2UXAA 2FA7A 2XXXA 4NF4A 4EF1A 1BP5A 1ZU0A 2Z8DA 1YPNA 5F7VA 1MXUA 2WKYA 1A8FA 1DOTA 4FECA 3BFUA 3K00A 1SYIA 3PMXA 2DVCA 1CE2A 2XXYA 1L5TA 1LCFA 4R6KA 2V25A 5CMCA 2Y7WA 3H7MA 4FE8A 1JVYA 3OO9A 1DPPA 2XHDA 2H4IA 3S9NC 4GBVA 4U4SA 3KBRA 1POY1 4HCYA 3C32A 4LZ7A 1QKAA 1I6QA 2G93A 3LSXA 2I6EA 4FIMA 2Z23A 4PDHA 4E0WA 1H76A 3G3GA 4N15A 3PPOA 1IMBA 2WX9A 5EQ8A 5TP9A 1LBBA 2ZZXA 2NWJA 4GFRA 1MY2A 1SW5A 3T22A 3RT8A 3OENA 4P0IA 1WDNA 3Q29A 5CRYA 3KSXA 5ICQA 1WODA 3O97A 3BIHA 4EXKA 3RLFE 5CBRA 3IB1A 3TCFA 1R6ZA 4YZZA 5I57A 1NNPA 3HV1A 1FBCA 4N4UA 5H8FB 4DZ1A 3HPIA 5IZ3B 4GBWA 1OMPA 4ZE8A 3FXBA 1MM7A 2NOOA 4XKPA 3VLVA 2I58A 4KI0E 1CNQA 1IMCA 2DQVA 3IO4A 1POTA 1B0HA 1GR2A 4G68B 1LB8A 1O63A 2DXYA 4XIGQ 3FBPA 4P11A 3H3GA 4M1VA 4PGNA 3LR1A 1DK4A 2OX3A 4HTGA 3U8QA 1Q35A 1QUIA 4H0WA 4OANA 1FPFA 2RCBA 2DXRA 2ZNSA 2O69A 4OEUA 1SW1A 4DCYA 4ZZAA 1IXGA 3K6WA 4O7IA 4JWOA 2Q8JA 3QAXA 5DW8A 4ZEIA 3DP4A 1LFHA 1BK4A 2O6AA 3NOHA 1HSLA 1INPA 3C31A 4PQJA 1NV1A 4LZ8A 2IA4A 1YZ0A 3PD8A 3S9LC 5JEIA 4MX6A 4OVSA 5I84A 4QSDA 4Q0CA 3EKIA 3TTNA 1N0TA 1K9ZA 1N84A 1QUJA 5IZZA 3MWBA 2ZZWA 2F3BA 5FTIA 3LUYA 4O3BA 3KZGA 1B40A 2D5WA 2XWKA 5AA1A 3KEIA 2F7CA 4EXLA 2V4CA 1QULA 3RGYA 4HE0A 4GWZA 4X04A 3TTKA 1LGBC 3FJ7A 4XF5A 1Y3NA 2RC9A 2RC8A 2B3FA 3FV1A 2QMWA 2KLFA 2OK2A 5I2NB 3A09A 3LSFB 4JSDA 2OCUA 4KHZE 3A3CA 4R6HA 2V3UA 5ESYA 3GBBA 1G0HA 4PAFA 4ND9A 1SQYA 2DOJA 2QJEA 3WAFA 2THIA 1US4A 4C1UA 4YICA 1LBVA 3F11A 4H5GA 1AMFA 1FBHA 1Y9UA 3MP6A 1RYXA 2PT1A 5ET7A 3RY3A 5FHOA 4JVDA 4PC9A 3K6UA 5LOMA 1URGA 5FHNA 3PUYE 1BTJA 3B7DA 3M3LA 4ELRA 1DTZA 2Q2CA 1MQJA 4NTLA 5I59A 4M4GA 2PMSA 3IB0A 3IFAA 2DDKA 2E1SA 2I0BA 4MBPA 3RT6B 1MQDA 4ZE9A 4G61A 2RINA 3CFXA 5EQAA
chains in the Genus database with same CATH topology
4MX6A 4GWUA 1FPJA 2V3QA 2CZHA 4OVSA 4MMPA 4O8MA 5J16A 1NV6A 1FBGA 4GBVA 2ZZVA 3EKIA 4PBQA 2Q74A 4N6DA 1K9ZA 3IFCA 4HCYA 5IZZA 1NV2A 1YXIA 2HZLA 2ZZWA 1LBZA 5IZ3A 3QMFA 1NV3A 4PDHA 4LN5A 4NGUA 5I7IA 1NUYA 4PBHA 4NN3A 2DE3A 2B4MA 1IMBA 2Q9TA 4I3YA 1NI9A 2F3BA 2WX9A 2XWOA 4N15A 4X8RA 5EQ8A 5T3JA 3ROJA 4AS5A 1NUWA 2ZZXA 4H45A 2FBPA 2FIEA 1SPIA 2JJKA 4N17A 1IMAA 1FPLA 3B8BA 2XWKA 2P3NA 1FPIA 1NV5A 5EQ9A 3KBZA 2F5XA 4MIJA 3MYUA 4MNIA 2VPOA 2V4CA 1KA1A 2QFLA 4O94A 3RPLB 1EYJA 1IMFA 4QBAA 1EYIA 1FTAA 4PETA 2HHMA 2CEYA 2PFYA 4GWYA 2WEFA 4GX3A 4HE0A 1FRPA 2F3DA 3BIHA 4GWWA 1K9YA 4PFIA 5EYGA 5I5PA 3B50A 4GWZA 1JP4A 2VT5A 4GX6A 4N81A 4X04A 1FBPA 2HPGA 4UABA 3GYYA 1RDZA 4XFEA 4XF5A 4YZZA 3PTYA 2GQ1A 4PDDA 4F1UA 1FBCA 4N4UA 4PAIA 5ET6A 4HCWA 4DI3D 1XI6A 4HE2A 5JK4A 2BJIA 2DVZA 4MNCA 2WYPA 1FBDA 1D9QA 4P3LA 5ET8A 5IZ3B 4GBWA 4IR8A 3W9VA 5A5LA 4PF8A 4P8BA 1FJ9A 1FBEA 1NUZA 1RDXA 2DE2A 4MJOA 4PTKA 2WBDA 2CZKA 4NX1A 2FVZA 1LEVA 3FXBA 4GX4A 4QXDA 1NV4A 5ESYA 4N8GA 5LTCA 4P1EA 1G0HA 4MHFA 2MKZA 4PAFA 2XWVA 2XWIA 3W9WA 4F19A 3CHGA 5CM6A 4PGPA 4OVRA 2Y5LA 3ISPA 2DE4A 3E78A 4N6KA 3KC0A 4GWSA 1EYKA 4P47A 2HXRA 4I40A 1FPGA 1IMDA 3T1BA 1CNQA 1IMCA 5FBPA 4NAPA 4YICA 2FHYA 1DBZA 3T0JA 1LBVA 4OVQA 1DCUA 3A29A 4OA4A 1Q9DA 4XEQA 1FBHA 4H46A 4P1LA 5I3SA 5EYHA 2CZIA 3LUZA 4MNPA 4NF0A 4NQ8A 4PFBA 4MCOA 3FBPA 1RDYA 5F24A 1FPBA 5IM2A 4NG7A 1LBYA 1NV7A 2WBBA 4M1VA 4MEVA 1NV0A 2B4LA 2XXKA 4N91A 4PAKA 1FBFA 4PGNA 5ET7A 1DK4A 1FJ6A 1AWBA 2OX3A 4JVDA 4PC9A 4X9TA 1FSAA 2KR0A 4HE1A 2R8TA 3U65A 4KXPA 4PCDA 2OWZA 4OVPA 1LBXA 4I3EA 1VDWA 1FPEA 1G0IA 3MSTA 2FIXA 4JVIA 4MAGA 3LV0A 4OANA 4P9KA 5ET5A 5IZ1A 4FBPA 4HXVA 2KQZA 1FPFA 4F1VA 2CEXA 1KZ8A 2XA5A 4AS4A 3SZPA 3D1RA 5J1DA 4PF6A 3BIGA 2QPQA 4GWXA 4O7MA 3KC1A 3RYDA 1KA0A 4PFRA 3IFAA 2DDKA 1FPDA 2Y5KA 3HFUA 4OVTA 2QVVA 2WYKA 2PCRA 2QVRA 5IGAA 2HZKA 1QGXA 1YYZA 3RPLA 2L5VA 4JVCA 4O7IA 2QVUA 4N8YA 4P56A 4F18A 4PE3A 5DW8A 1BK4A 5LDZA 1LBWA 2VPNA 3NOHA 1INPA 5EQ7A 2Q8MA 3E79A 2PFZA 1NV1A 1FPKA 1IMEA 2P3VA 1YZ0A 4NHBA 4G61A 4DI4B 5EQAA 1NUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MX6 A;  4OVS A;  4MMP A;  4O8M A;  2ZZV A;  4PBQ A;  4N6D A;  5IZZ A;  2HZL A;  2ZZW A;  4PDH A;  4LN5 A;  4NGU A;  4PBH A;  4NN3 A;  4N15 A;  4X8R A;  5IGA A;  2XWO A;  2WX9 A;  2ZZX A;  4N17 A;  2XWK A;  4MIJ A;  4MNI A;  2VPO A;  2V4C A;  4O94 A;  4PET A;  2CEY A;  2PFY A;  5I5P A;  4PFI A;  3B50 A;  4X04 A;  2HPG A;  4UAB A;  3GYY A;  4XFE A;  4XF5 A;  4YZZ A;  4PDD A;  4N4U A;  4PAI A;  4DI3 D;  4MNC A;  4P3L A;  2WYP A;  4PF8 A;  4P8B A;  4NX1 A;  3FXB A;  4N8G A;  5LTC A;  4P1E A;  4MHF A;  4PAF A;  2XWV A;  2XWI A;  5CM6 A;  4PGP A;  4OVR A;  4N6K A;  4P47 A;  4NAP A;  4YIC A;  4OVQ A;  4OA4 A;  4XEQ A;  4P1L A;  4MNP A;  4PFB A;  4NF0 A;  4NQ8 A;  4MCO A;  5IM2 A;  4NG7 A;  4MEV A;  4N91 A;  4PAK A;  4PGN A;  2XXK A;  4PC9 A;  3U65 A;  5I7I A;  4PCD A;  4DI4 B;  4OVP A;  4P9K A;  4MAG A;  4OAN A;  2CEX A;  2XA5 A;  4PF6 A;  4O7M A;  4PFR A;  4OVT A;  2WYK A;  2HZK A;  4N8Y A;  4P56 A;  4PE3 A;  2VPN A;  2PFZ A;  4NHB A; 
#chains in the Genus database with same CATH topology
 4GWU A;  1D4N A;  1NMU A;  4OWD A;  3TPA A;  1B7U A;  1N7X A;  3KN3 A;  3LC8 A;  2G29 A;  2R9J A;  1SBP A;  3UA8 A;  2DE3 A;  2YJP A;  3RN8 A;  1EZP A;  1MXV A;  1NV5 A;  1B4H A;  2I49 A;  3KBZ A;  4MIJ A;  1VSO A;  1IXI A;  4QBA A;  1URD A;  1TT1 A;  4PET A;  2OJT A;  4ONY A;  2B65 A;  2Y7I A;  4FEB A;  2F7A A;  4GX6 A;  2HPG A;  4QSC A;  2Y7K A;  4I1D A;  4Q5T A;  3IOR A;  4YB7 A;  3AXF A;  1H3D A;  2IEE A;  3IX1 A;  2A5S A;  4BDL A;  4KYE A;  4F19 A;  4H65 A;  4KQP A;  2E0S A;  1BIY A;  1AH5 A;  4MLV A;  4P0G A;  2I4C A;  4XEQ A;  4H46 A;  2XXI A;  4MCO A;  1YTV A;  3R7X A;  1FPB A;  4NE4 A;  3SEY A;  5TU0 A;  2F36 A;  2AL5 A;  3G3I A;  1G0I A;  4GQO A;  4MAG A;  4QHQ A;  4RA1 A;  1OIB A;  1ZTY A;  4IO2 A;  4F1V A;  4I8C A;  2XA5 A;  3TDJ A;  1P1Q A;  1P1U A;  4GXS B;  3QYT A;  5CMK A;  3Q27 A;  2QVV A;  2WYK A;  3FVO A;  4RK9 A;  3KOT A;  3QUF A;  5LDZ A;  3CG1 A;  1NKX A;  3LSW A;  2PX1 A;  1PB7 A;  4IO6 A;  2A5T A;  4GD5 A;  4IY5 A;  4R2F A;  1JVX A;  3CI8 A;  3ZKK A;  1M5D A;  4X1D A;  4NMY A;  3M8U A;  4BLA A;  1OQH A;  3S2V A;  3N6T A;  1B7Z A;  3Q25 A;  4TOZ A;  2P3N A;  3SEU A;  3L6H A;  1EZO A;  1PB9 A;  1KA1 A;  1US5 A;  4PE5 B;  3PPP A;  4MF3 A;  3THI A;  2F97 A;  5KCJ A;  4F2Q A;  3TTR A;  3MBP A;  4OES A;  4QFL A;  4XFE A;  4H1X A;  3K0V A;  3ILU B;  1R1N A;  4DI3 D;  1N3X A;  1Q1K A;  2F8D A;  1UQW A;  2DE2 A;  1LEV A;  5LTC A;  2GHB A;  3W9W A;  5CM6 A;  4G77 A;  4IGR A;  3VV5 A;  3KC0 A;  4R74 A;  2H98 A;  3A29 A;  3K2D A;  5I3S A;  4PFB A;  1A99 A;  1D9V A;  5IKB A;  4MEV A;  1A55 A;  1NV0 A;  4JB7 A;  3O6H A;  2XX9 A;  1XOC A;  3DP6 A;  5I7I A;  3VDF A;  4KXP A;  4U1O A;  2H5Y A;  5H8Q A;  4HXV A;  5AA4 A;  2GHA A;  2A5T B;  5J1D A;  1AIV A;  1B9J A;  4DDD A;  2Y5K A;  2DWA A;  1AL3 A;  2I48 A;  4IO3 A;  3VXB A;  5FTH A;  1FCK A;  1M5B A;  3TYH A;  1FBG A;  1JW4 A;  3MJN A;  2QS2 A;  1JET A;  1A8E A;  4MFI A;  1XHY A;  4KR5 A;  3TCG A;  4ESW A;  3MVW A;  3ROJ A;  3OMB A;  4AB5 A;  1FTM A;  1OLC A;  4XKN A;  1I6B A;  1ATG A;  2NXO A;  3CRB A;  4QRZ A;  1FBP A;  4AQ4 A;  1SW4 A;  4EF2 A;  1RDZ A;  4F3B A;  4H5F A;  2O1M A;  1VFE A;  4P3L A;  4ZS9 A;  3QXM A;  3RPL A;  4F18 A;  3C4M A;  5DT6 A;  2XWV A;  1PDA A;  1NNT A;  4DCX A;  3R26 A;  3PUX E;  4HW8 A;  2UVI A;  1MY3 A;  4GWS A;  5H8S A;  3T9V A;  3EPE A;  2WBB A;  3ZS6 A;  2B4L A;  2I4B A;  2ZYM A;  1FBF A;  3IL1 B;  1RYO A;  3EQ1 A;  4PCD A;  1VDW A;  3U72 A;  4IB2 A;  4FBP A;  4H8I A;  4YMA A;  4JDF A;  3PMV A;  3O29 A;  5H8H B;  4BDM A;  3KC1 A;  4G2Z A;  4RJZ A;  3HFU A;  4OVT A;  2QVR A;  4RXL A;  1AOV A;  4O3C A;  3N26 A;  1FPJ A;  2GRV A;  3QSL A;  4IO5 A;  2RKM A;  1A54 A;  3RPW A;  1NUY A;  4NN3 A;  2XWO A;  5T3J A;  3LBS A;  2OLB A;  5BUU A;  1SPI A;  1IMA A;  5AA4 B;  1OVT A;  3DP8 A;  2Y7P A;  1P1O A;  1IMF A;  2XXP A;  5KDT B;  4NED A;  3M3K A;  1MXX A;  2VT5 A;  1NL5 A;  4XKQ A;  4F3P A;  3TKD A;  3E9X A;  4F1U A;  1YCJ A;  4HCW A;  3UP9 A;  1LAG E;  1FBD A;  2DWI A;  2W7Y A;  2PBW A;  4X48 A;  4NX1 A;  2Y7R A;  1Y20 A;  4U1Z A;  2YLN A;  5DEX B;  1QUK A;  4MHF A;  2VD2 A;  3FJG A;  2HCA A;  3IR1 A;  2ANJ A;  4NAP A;  3T0J A;  1OLA A;  3LUZ A;  4NF0 A;  3PPQ A;  3TZA A;  2XD2 A;  1NV7 A;  2CZL A;  3IO6 A;  4N91 A;  3FVG A;  4JVI A;  1P1W A;  3MST A;  1JW5 A;  4RPO A;  3UGW A;  1UIU A;  4O7M A;  2R71 A;  4NF8 B;  2P0S A;  1FPD A;  1QGX A;  5AA2 B;  1H44 A;  4PFU A;  4YU0 A;  4ELP A;  1R9Q A;  4LUB A;  1JW1 A;  3H03 A;  2ONR A;  3MVY A;  4NHB A;  1LAF E;  4OQO A;  3ONM A;  2ZZV A;  4N6D A;  4X1B A;  1MRP A;  4ELQ A;  3TMG A;  4WXJ A;  5F1Q A;  5AA2 A;  2Q9T A;  3RPL B;  4I3Y A;  3VXC A;  2CMO A;  1XVY A;  1B7H A;  1M5E A;  4RNS A;  3MVZ A;  4MNI A;  1ELJ A;  1USY E;  2QL3 A;  2HHM A;  3B50 A;  3C35 A;  5TPA A;  4GVO A;  1MH4 A;  2OZZ A;  5DVI A;  5JK4 A;  2UVH A;  1Y1Z A;  3O6I A;  4PF8 A;  1ZJL A;  3Q26 A;  4F3G A;  2REJ A;  3K6X A;  2X26 A;  1B46 A;  1LBC A;  4YB6 A;  2O7I A;  4P47 A;  3EF7 A;  4I40 A;  4YMB A;  3USD A;  5EYH A;  1XC1 A;  2XX7 A;  2Y84 A;  1D3K A;  2ONS A;  3VVE A;  5EYF A;  5HBC A;  4JWX A;  3VLU A;  1FSA A;  4PFT A;  4P9K A;  3LV0 A;  3MVX A;  4R73 A;  4KPT A;  1Z7M E;  3N5L A;  4ECF A;  3D1R A;  2ZMB A;  2REG A;  1NH8 A;  3EHS A;  3C9H A;  4JXI A;  4QFN A;  2HZK A;  1B2H A;  2Q2A A;  1VFD A;  3IOW A;  3UK4 A;  1FQC A;  3BKI B;  2I3V A;  4LP2 B;  4NWD A;  1NUX A;  2NVU B;  2QRY A;  3I5O A;  2ZYO A;  4U21 A;  2V93 A;  1JEU A;  2AYS A;  1NV3 A;  3JYR A;  5ITP A;  3B6Q A;  2B4M A;  1NI9 A;  2ABH A;  4Z0I A;  2VGQ A;  4IY6 A;  4ZEC A;  4N17 A;  3JZJ A;  4BDO A;  4RPN A;  1FQE A;  5EQ9 A;  3SDF A;  2F5X A;  2QSX A;  4GF8 A;  2XXU A;  2DP8 A;  1EYI A;  3OD7 A;  3MPL A;  2Z8F A;  4GWW A;  3KJ7 A;  2F35 A;  3G3K A;  4BDQ A;  4OYV A;  1FQF A;  3H6V A;  4ESX A;  3PTY A;  1FW0 A;  3FZV A;  5L9O A;  4MNC A;  4DXU A;  1VR5 A;  4XKR A;  4OFL A;  3TTL A;  5A5L A;  3JV9 A;  1FBE A;  5KDT A;  2MKZ A;  2VD3 A;  2XWI A;  3CHG A;  3C36 A;  3CSG A;  4F31 B;  3E78 A;  3ZSF A;  3ZKL A;  1EYK A;  4G4P A;  3KN7 A;  3IOU A;  5I59 B;  2RCA A;  1RDY A;  4U4X A;  2XXV A;  2BJJ X;  1AWB A;  4YKK A;  3CSB A;  3HCQ A;  3O66 A;  4POW A;  3OSQ A;  3K4U A;  4EUO A;  2O68 A;  1IXH A;  4JSO A;  1D9Y A;  1HSE A;  2HQ0 A;  3TFL A;  2XXR A;  4PE3 A;  5CC2 A;  3GXA A;  4C1T A;  1B3F A;  2QS3 A;  2YPN A;  1Y4T A;  2P3V A;  3HO7 A;  1UIV A;  3G3F A;  4O8M A;  1PBP A;  3SET A;  3GBA A;  3O6G A;  2P2A A;  1B05 A;  4NF6 A;  1SI1 A;  5K2X A;  3OO8 A;  4FAT A;  1B3G A;  1NUW A;  2FBP A;  4F2O A;  5B7D A;  1FPL A;  4ZDM A;  3OEM A;  3UIF A;  4FED A;  3I6V A;  2VPO A;  2AIX A;  4GX3 A;  1FRP A;  3UOR A;  3PPN A;  2ONK E;  4G8H A;  3VVF A;  4GWO A;  4NF5 B;  4KD5 A;  4L17 A;  4UAB A;  4NWC A;  4OXV A;  4QFK A;  3V5A A;  4PDD A;  2XX8 A;  4WED A;  4N07 A;  4Z7E A;  4P8B A;  3FUZ A;  3FXU A;  1A40 A;  4C0R A;  4GX4 A;  1FTO A;  1VE4 A;  5A5X A;  4OET A;  4NF6 B;  2RC7 A;  3FVK A;  3T1B A;  1FPG A;  1IMD A;  1A7L A;  4YKI A;  3V8X B;  4EDP A;  4P1L A;  1NH7 A;  2QS4 A;  5IM2 A;  5FHM A;  2XXK A;  3KJT A;  4OER A;  2KR0 A;  4OVP A;  4KCD A;  1Y3Q A;  5IZ1 A;  1PEB A;  1O64 A;  2F34 A;  4G68 A;  3PD9 A;  3O28 A;  2H9B A;  2ZYN A;  4PP0 A;  4YB5 A;  1YYZ A;  3RUM A;  2P1S A;  5EQ7 A;  1DMB A;  2F6G A;  5J16 A;  5HM4 B;  2Q74 A;  4HS7 A;  3GLB A;  1BLF A;  5CI5 A;  4FAJ A;  2DWJ A;  4LZ5 A;  1ZIU A;  2OWT A;  4LVQ A;  2PT2 A;  3BFT A;  1PB8 A;  1Y3P A;  2HEU A;  2R6G E;  3IJX B;  5I58 A;  4PFI A;  4NF4 B;  1H45 A;  1B6H A;  1B3H A;  2VP1 A;  5A5X B;  2QMX A;  3HHF A;  4LON B;  4MLQ A;  4R9G A;  4IGT A;  4OZ9 A;  2BJI A;  4YAH X;  2DVZ A;  4R2B A;  4TQU Q;  4IR8 A;  3QK6 A;  1N04 A;  3OSR A;  4PGP A;  1IUD A;  3ISP A;  2DE4 A;  3L6G A;  1KWH A;  4OVQ A;  4OA4 A;  4OEV A;  4GL8 A;  5L9M A;  2GFE A;  3I3V A;  1MPB A;  4WKM A;  4X9T A;  3CVG A;  2OWZ A;  3KSJ A;  4DXB A;  4I3E A;  4WEP A;  1SVX B;  2FIX A;  4XTC Q;  1UTB B;  4MH5 A;  1P1N A;  2OWS A;  3SEV A;  4LQ2 A;  3M3F A;  4RY1 A;  1IXC A;  4GWX A;  1GTK A;  3TUS A;  3PMW A;  1MH3 A;  3VE1 B;  1O7T A;  2XXW A;  2PCR A;  4F22 A;  1MPD A;  4G8N A;  4P56 A;  1B4Z A;  2FYI A;  1H43 A;  2PFZ A;  1FPK A;  1R9L A;  2Q89 A;  1XS5 A;  2V3Q A;  2CZH A;  4GL0 A;  4MMP A;  3U93 A;  5H8F A;  3PUW E;  1YXI A;  1LBZ A;  5IZ3 A;  4LA9 A;  4YKP A;  5IGA A;  3EHU A;  1FQB A;  2UYE A;  3TTM A;  4BDN A;  4H45 A;  5CMM A;  4F29 A;  3MP1 A;  4UA8 A;  3EHT A;  2UVG A;  4DIG A;  5AA2 D;  3T96 B;  2UYF A;  1MY4 A;  2F3D A;  3KOS A;  4FJP A;  1JP4 A;  4N81 A;  3SES A;  4R9F A;  3K1M A;  3GYY A;  5M2V A;  3OXN A;  2GQ1 A;  1XI6 A;  4HE2 A;  4O3A A;  3H6U A;  4MJO A;  3R6U A;  3V83 A;  1ZBM A;  4GRK A;  4P1E A;  5DVJ A;  4NF5 A;  1LST A;  2Y5L A;  4ELO A;  1UTH B;  4U2R A;  3C33 A;  2HXR A;  5EHS A;  1DBZ A;  1MM6 A;  1SYH A;  5CBS A;  1S9T A;  1UTB A;  4NG7 A;  3MQ9 A;  4PAK A;  3C34 A;  3FXQ A;  2D21 A;  1Y1M A;  1SDX A;  2KQZ A;  4TLL B;  2GH9 A;  3K02 A;  1M5C A;  2QPQ A;  3TAJ A;  5H8N A;  1KA0 A;  1B5I A;  2QS1 A;  4DXC A;  1LCT A;  4JBZ A;  1LLS A;  3CG3 A;  3W15 C;  1OQG A;  2L5V A;  4N8Y A;  5AA3 A;  4LAT A;  4OFJ A;  4NF8 A;  3MUQ A;  5I2K A;  3KG2 A;  2NUV A;  5ITO A;  4DLD A;  3H06 B;  4N6P A;  5HPQ A;  1FQD A;  4G8M A;  3S4U A;  4X8R A;  4GXA A;  5I57 B;  3SEW A;  3K6V A;  3HN0 A;  4F1Y A;  1FPI A;  4EQ9 A;  3E3K A;  1IIT A;  3MYU A;  1TFA A;  5EHM A;  4LQ5 A;  4E0X A;  4DE8 A;  4ZZE A;  3FIR A;  4K3F A;  4H67 A;  2O7U A;  5EYG A;  5I5P A;  2VHA A;  4F39 A;  3U92 A;  1WVJ A;  1DSN A;  3Q28 A;  4PAI A;  5ET6 A;  4FOR A;  1IZ1 A;  3CR9 A;  3W9V A;  1FJ9 A;  3SER A;  5I58 B;  4N8G A;  4QFO A;  4OTE A;  4N6K A;  5ELV A;  1DCU A;  1IQ7 A;  3A3U A;  1MQG A;  2X7P A;  3H4Z A;  4I62 A;  1LBY A;  2O1L A;  3D4C A;  3PGF A;  3CIJ A;  2XD3 A;  3U65 A;  4XXU A;  1FTL A;  2R8T A;  2Q8M A;  1DPE A;  1JNF A;  1I6A A;  1P99 A;  3MZB A;  3OO7 A;  4PFR A;  2DS9 A;  1GVC A;  1N3W A;  4THI A;  1GGG A;  4PFY A;  1LAX A;  3G3J A;  4H6D A;  2VPN A;  3MZ9 A;  2B3B A;  2HAU A;  3VVD A;  1QKB A;  3HHG A;  2PYY A;  5B70 A;  4RK2 A;  2Z8E A;  4R72 A;  4EQB A;  3IFC A;  3GZG A;  3T93 B;  4U23 A;  3RQT A;  1DTG A;  1M5F A;  3K1N A;  4AB6 A;  2LAO A;  4LN5 A;  1IIW A;  4PBH A;  2OBG A;  2FIE A;  5L9S A;  3IK6 B;  2JJK A;  1B1H A;  1MS7 A;  4GOT A;  4ZEK A;  1SD3 A;  3TQW A;  4I9D A;  3CFZ A;  2CEY A;  5L8D A;  2WEF A;  1N76 A;  3KFM A;  4ZEB A;  3OEK A;  2HXW A;  2AL4 A;  2ZYK A;  3IAZ A;  3B6W A;  3E4R A;  2WYP A;  1J1N A;  1MPC A;  3O9P A;  2DYX A;  4IO4 A;  5AE4 A;  1EH3 A;  3FGS A;  3LSL A;  5I56 B;  4KCC A;  4F3S A;  1MXY A;  3SKP A;  4POX A;  3MZ1 A;  2XXT A;  2F78 A;  2CZI A;  4MNP A;  5DYH A;  3VLW A;  3IB2 A;  3ECR A;  3T9X B;  4HE1 A;  3MP8 A;  1QW0 A;  4PTK A;  2I0C A;  1FPE A;  2O84 X;  1JQF A;  2CEX A;  3O2A A;  1KZ8 A;  3K1P A;  4PF6 A;  2UVJ A;  3DEL B;  3N94 A;  3OO6 A;  4YKJ A;  1B3E A;  4ZED A;  1LFI A;  1QJM A;  5IAI A;  2HFB A;  3U94 A;  1XT8 A;  2ESN A;  1MG1 A;  1NNF A;  3K01 A;  3T9U A;  1II5 A;  1NV2 A;  3PPR A;  5ISU A;  1LB9 A;  1B52 A;  3ILT B;  2FNC A;  4OMB A;  4AS5 A;  3PU5 A;  5BWJ A;  3H6T A;  2D3I A;  1MY0 A;  3FD3 A;  1S7Y A;  1TFD A;  2QFL A;  1EYJ A;  4QFP A;  1Y4C A;  1LAH E;  2H25 A;  5I2N A;  2DSF A;  1I69 A;  1MDP 1;  5KCJ B;  2XXH A;  4RYA A;  1URS A;  3N6U A;  5ET8 A;  1UTH A;  3TEL A;  1NUZ A;  5CMB A;  1RDX A;  2FVZ A;  1B32 A;  4OVR A;  1B1X A;  2I3W A;  3PUZ E;  4OHN A;  3CFL A;  1N7W A;  5FBP A;  3FJM A;  2ALU A;  1Q9D A;  5I2K B;  1NNK A;  3V89 B;  1IEJ A;  3KGC A;  2X7Q A;  3FVN A;  4N13 A;  3SZP A;  2DWH A;  1FJ6 A;  4ZEF A;  5DEX A;  4Q8R A;  2ZXT A;  4DI4 B;  1LBX A;  2PVU A;  3DM0 A;  5ET5 A;  3PV0 E;  3HST A;  3B6T A;  3BIG A;  3IOT A;  3T66 A;  3TCH A;  3ODB A;  4ISU A;  3MC2 A;  3UN6 A;  4U22 A;  4JVC A;  2QVU A;  2RF1 A;  1YAE A;  5TP9 B;  1LBW A;  3RNN A;  3E79 A;  1IME A;  5TPA B;  2Z22 A;  4JWY A;  4PBQ A;  4KYD A;  3U1O A;  1B51 A;  5I56 A;  2HZL A;  1B5H A;  1BKA A;  2VOZ A;  3TOD A;  5H8N B;  1MDQ A;  3OEL A;  1B58 A;  1ANF A;  1B5J A;  3TQL A;  4OVJ A;  1EZ9 A;  1FTA A;  1LFG A;  3EN3 A;  1B0L A;  2H99 A;  1GV8 A;  5JTY A;  4H8J A;  1PBQ A;  3WAE A;  4OFO A;  1D9Q A;  3E13 X;  3MPK A;  5K2Y A;  1MQH A;  1MXW A;  1TXF A;  2WBD A;  4QXD A;  3MW0 A;  5KZT A;  1FTK A;  1PC3 A;  1Z7N E;  1S50 A;  3S9E A;  4R75 A;  3G7W A;  4IO7 A;  3RTF B;  4GIZ A;  3D4G A;  4NQ8 A;  3BBR A;  5F24 A;  3S9M C;  4BDR A;  1QVS A;  2F7B A;  1SW2 A;  3FV2 A;  3IJO B;  5JTY B;  3VFJ A;  1JEV A;  1ZLQ A;  4QSE A;  4KFQ A;  1TWY A;  4AS4 A;  3P7I A;  5DTB A;  3H6W A;  3MAM A;  3RYD A;  4G68 C;  3PUV E;  1MQI A;  1HSJ A;  3FAS A;  3T9H B;  4KYS A;  4EQ7 A;  1RKM A;  2HAV A;  5DVF A;  1FTJ A;  3QUJ A;  1NFT A;  1NV6 A;  2ZNU A;  1F9B A;  3FXR A;  1B3L A;  5H8Q B;  1ZMG A;  3G3H A;  3QMF A;  4NGU A;  4Q30 B;  3KN8 A;  1MY1 A;  1EU8 A;  4TLM B;  3B8B A;  1XVX A;  2F6P A;  4OEN A;  4O94 A;  3RTW B;  5ICT A;  4R6Y A;  4GWY A;  2PFY A;  1USY H;  1K9Y A;  2Q88 A;  2O51 A;  1MXZ A;  3IOV A;  4PFW A;  2XXQ A;  4QF9 A;  3DLN A;  2V84 A;  1OVB A;  1ZKB A;  1FQA A;  3QIM A;  2CZK A;  1NV4 A;  1T0K A;  4GLI A;  1CB6 A;  2ZNT A;  3OOA A;  3TEP A;  1SI0 A;  4UAC A;  2V3T A;  3SEX A;  2FHY A;  2M8C A;  3FAT A;  5H8H A;  2UXA A;  2FA7 A;  2XXX A;  4NF4 A;  4EF1 A;  1BP5 A;  1ZU0 A;  2Z8D A;  1YPN A;  5F7V A;  1MXU A;  2WKY A;  1A8F A;  1DOT A;  4FEC A;  3BFU A;  3K00 A;  1SYI A;  3PMX A;  2DVC A;  1CE2 A;  2XXY A;  1L5T A;  1LCF A;  4R6K A;  2V25 A;  5CMC A;  2Y7W A;  3H7M A;  4FE8 A;  1JVY A;  3OO9 A;  1DPP A;  2XHD A;  2H4I A;  3S9N C;  4GBV A;  4U4S A;  3KBR A;  1POY 1;  4HCY A;  3C32 A;  4LZ7 A;  1QKA A;  1I6Q A;  2G93 A;  3LSX A;  2I6E A;  4FIM A;  2Z23 A;  4PDH A;  4E0W A;  1H76 A;  3G3G A;  4N15 A;  3PPO A;  1IMB A;  2WX9 A;  5EQ8 A;  5TP9 A;  1LBB A;  2ZZX A;  2NWJ A;  4GFR A;  1MY2 A;  1SW5 A;  3T22 A;  3RT8 A;  3OEN A;  4P0I A;  1WDN A;  3Q29 A;  5CRY A;  3KSX A;  5ICQ A;  1WOD A;  3O97 A;  3BIH A;  4EXK A;  3RLF E;  5CBR A;  3IB1 A;  3TCF A;  1R6Z A;  4YZZ A;  5I57 A;  1NNP A;  3HV1 A;  1FBC A;  4N4U A;  5H8F B;  4DZ1 A;  3HPI A;  5IZ3 B;  4GBW A;  1OMP A;  4ZE8 A;  3FXB A;  1MM7 A;  2NOO A;  4XKP A;  3VLV A;  2I58 A;  4KI0 E;  1CNQ A;  1IMC A;  2DQV A;  3IO4 A;  1POT A;  1B0H A;  1GR2 A;  4G68 B;  1LB8 A;  1O63 A;  2DXY A;  4XIG Q;  3FBP A;  4P11 A;  3H3G A;  4M1V A;  4PGN A;  3LR1 A;  1DK4 A;  2OX3 A;  4HTG A;  3U8Q A;  1Q35 A;  1QUI A;  4H0W A;  4OAN A;  1FPF A;  2RCB A;  2DXR A;  2ZNS A;  2O69 A;  4OEU A;  1SW1 A;  4DCY A;  4ZZA A;  1IXG A;  3K6W A;  4O7I A;  4JWO A;  2Q8J A;  3QAX A;  5DW8 A;  4ZEI A;  3DP4 A;  1LFH A;  1BK4 A;  2O6A A;  3NOH A;  1HSL A;  1INP A;  3C31 A;  4PQJ A;  1NV1 A;  4LZ8 A;  2IA4 A;  1YZ0 A;  3PD8 A;  3S9L C;  5JEI A;  4MX6 A;  4OVS A;  5I84 A;  4QSD A;  4Q0C A;  3EKI A;  3TTN A;  1N0T A;  1K9Z A;  1N84 A;  1QUJ A;  5IZZ A;  3MWB A;  2ZZW A;  2F3B A;  5FTI A;  3LUY A;  4O3B A;  3KZG A;  1B40 A;  2D5W A;  2XWK A;  5AA1 A;  3KEI A;  2F7C A;  4EXL A;  2V4C A;  1QUL A;  3RGY A;  4HE0 A;  4GWZ A;  4X04 A;  3TTK A;  1LGB C;  3FJ7 A;  4XF5 A;  1Y3N A;  2RC9 A;  2RC8 A;  2B3F A;  3FV1 A;  2QMW A;  2KLF A;  2OK2 A;  5I2N B;  3A09 A;  3LSF B;  4JSD A;  2OCU A;  4KHZ E;  3A3C A;  4R6H A;  2V3U A;  5ESY A;  3GBB A;  1G0H A;  4PAF A;  4ND9 A;  1SQY A;  2DOJ A;  2QJE A;  3WAF A;  2THI A;  1US4 A;  4C1U A;  4YIC A;  1LBV A;  3F11 A;  4H5G A;  1AMF A;  1FBH A;  1Y9U A;  3MP6 A;  1RYX A;  2PT1 A;  5ET7 A;  3RY3 A;  5FHO A;  4JVD A;  4PC9 A;  3K6U A;  5LOM A;  1URG A;  5FHN A;  3PUY E;  1BTJ A;  3B7D A;  3M3L A;  4ELR A;  1DTZ A;  2Q2C A;  1MQJ A;  4NTL A;  5I59 A;  4M4G A;  2PMS A;  3IB0 A;  3IFA A;  2DDK A;  2E1S A;  2I0B A;  4MBP A;  3RT6 B;  1MQD A;  4ZE9 A;  4G61 A;  2RIN A;  3CFX A;  5EQA A; 
#chains in the Genus database with same CATH homology
 4MX6 A;  4GWU A;  1FPJ A;  2V3Q A;  2CZH A;  4OVS A;  4MMP A;  4O8M A;  5J16 A;  1NV6 A;  1FBG A;  4GBV A;  2ZZV A;  3EKI A;  4PBQ A;  2Q74 A;  4N6D A;  1K9Z A;  3IFC A;  4HCY A;  5IZZ A;  1NV2 A;  1YXI A;  2HZL A;  2ZZW A;  1LBZ A;  5IZ3 A;  3QMF A;  1NV3 A;  4PDH A;  4LN5 A;  4NGU A;  5I7I A;  1NUY A;  4PBH A;  4NN3 A;  2DE3 A;  2B4M A;  1IMB A;  2Q9T A;  4I3Y A;  1NI9 A;  2F3B A;  2WX9 A;  2XWO A;  4N15 A;  4X8R A;  5EQ8 A;  5T3J A;  3ROJ A;  4AS5 A;  1NUW A;  2ZZX A;  4H45 A;  2FBP A;  2FIE A;  1SPI A;  2JJK A;  4N17 A;  1IMA A;  1FPL A;  3B8B A;  2XWK A;  2P3N A;  1FPI A;  1NV5 A;  5EQ9 A;  3KBZ A;  2F5X A;  4MIJ A;  3MYU A;  4MNI A;  2VPO A;  2V4C A;  1KA1 A;  2QFL A;  4O94 A;  3RPL B;  1EYJ A;  1IMF A;  4QBA A;  1EYI A;  1FTA A;  4PET A;  2HHM A;  2CEY A;  2PFY A;  4GWY A;  2WEF A;  4GX3 A;  4HE0 A;  1FRP A;  2F3D A;  3BIH A;  4GWW A;  1K9Y A;  4PFI A;  5EYG A;  5I5P A;  3B50 A;  4GWZ A;  1JP4 A;  2VT5 A;  4GX6 A;  4N81 A;  4X04 A;  1FBP A;  2HPG A;  4UAB A;  3GYY A;  1RDZ A;  4XFE A;  4XF5 A;  4YZZ A;  3PTY A;  2GQ1 A;  4PDD A;  4F1U A;  1FBC A;  4N4U A;  4PAI A;  5ET6 A;  4HCW A;  4DI3 D;  1XI6 A;  4HE2 A;  5JK4 A;  2BJI A;  2DVZ A;  4MNC A;  2WYP A;  1FBD A;  1D9Q A;  4P3L A;  5ET8 A;  5IZ3 B;  4GBW A;  4IR8 A;  3W9V A;  5A5L A;  4PF8 A;  4P8B A;  1FJ9 A;  1FBE A;  1NUZ A;  1RDX A;  2DE2 A;  4MJO A;  4PTK A;  2WBD A;  2CZK A;  4NX1 A;  2FVZ A;  1LEV A;  3FXB A;  4GX4 A;  4QXD A;  1NV4 A;  5ESY A;  4N8G A;  5LTC A;  4P1E A;  1G0H A;  4MHF A;  2MKZ A;  4PAF A;  2XWV A;  2XWI A;  3W9W A;  4F19 A;  3CHG A;  5CM6 A;  4PGP A;  4OVR A;  2Y5L A;  3ISP A;  2DE4 A;  3E78 A;  4N6K A;  3KC0 A;  4GWS A;  1EYK A;  4P47 A;  2HXR A;  4I40 A;  1FPG A;  1IMD A;  3T1B A;  1CNQ A;  1IMC A;  5FBP A;  4NAP A;  4YIC A;  2FHY A;  1DBZ A;  3T0J A;  1LBV A;  4OVQ A;  1DCU A;  3A29 A;  4OA4 A;  1Q9D A;  4XEQ A;  1FBH A;  4H46 A;  4P1L A;  5I3S A;  5EYH A;  2CZI A;  3LUZ A;  4MNP A;  4NF0 A;  4NQ8 A;  4PFB A;  4MCO A;  3FBP A;  1RDY A;  5F24 A;  1FPB A;  5IM2 A;  4NG7 A;  1LBY A;  1NV7 A;  2WBB A;  4M1V A;  4MEV A;  1NV0 A;  2B4L A;  2XXK A;  4N91 A;  4PAK A;  1FBF A;  4PGN A;  5ET7 A;  1DK4 A;  1FJ6 A;  1AWB A;  2OX3 A;  4JVD A;  4PC9 A;  4X9T A;  1FSA A;  2KR0 A;  4HE1 A;  2R8T A;  3U65 A;  4KXP A;  4PCD A;  2OWZ A;  4OVP A;  1LBX A;  4I3E A;  1VDW A;  1FPE A;  1G0I A;  3MST A;  2FIX A;  4JVI A;  4MAG A;  3LV0 A;  4OAN A;  4P9K A;  5ET5 A;  5IZ1 A;  4FBP A;  4HXV A;  2KQZ A;  1FPF A;  4F1V A;  2CEX A;  1KZ8 A;  2XA5 A;  4AS4 A;  3SZP A;  3D1R A;  5J1D A;  4PF6 A;  3BIG A;  2QPQ A;  4GWX A;  4O7M A;  3KC1 A;  3RYD A;  1KA0 A;  4PFR A;  3IFA A;  2DDK A;  1FPD A;  2Y5K A;  3HFU A;  4OVT A;  2QVV A;  2WYK A;  2PCR A;  2QVR A;  5IGA A;  2HZK A;  1QGX A;  1YYZ A;  3RPL A;  2L5V A;  4JVC A;  4O7I A;  2QVU A;  4N8Y A;  4P56 A;  4F18 A;  4PE3 A;  5DW8 A;  1BK4 A;  5LDZ A;  1LBW A;  2VPN A;  3NOH A;  1INP A;  5EQ7 A;  2Q8M A;  3E79 A;  2PFZ A;  1NV1 A;  1FPK A;  1IME A;  2P3V A;  1YZ0 A;  4NHB A;  4G61 A;  4DI4 B;  5EQA A;  1NUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...