4PGNA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
b'PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein, family 7
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Transport protein
total genus 111
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pgnA00
2XWVA 4PAFA 4N15A 4OVRA 2WYKA 4PF8A 4N6KA 4OA4A 4PAKA 2HZKA 3U65A 4NG7A 4X8RA 4XEQA 2HZLA 4NQ8A 4MIJA 4XFEA 4NGUA 4PCDA 4O8MA 5I7IA 2PFZA 4P9KA 4PDHA 4XF5A 4P1LA 4DI3D 4MNPA 5CM6A 4PFBA 3B50A 5I5PA 4MEVA 4MMPA 4OVPA 4NX1A 4N17A 2XWKA 2XWIA 3FXBA 4MX6A 4YZZA 2ZZXA 4PBHA 4OANA 2VPOA 4YICA 4PFIA 2CEXA 2V4CA 4N91A 4MNIA 4PE3A 4N6DA 4N8YA 4DI4B 4PC9A 4PGPA 4PGNA 4OVQA 4P3LA 2XXKA 4N8GA 4MCOA 2XA5A 4PBQA 4UABA 4MNCA 4P1EA 2CEYA 4NHBA 4O7MA 4NF0A 4P8BA 4MAGA 4N4UA 3GYYA 4OVSA 4NN3A 2WX9A 2VPNA 2XWOA 4O94A 4X04A 4OVTA 4LN5A 2ZZWA 2PFYA 2ZZVA 4P56A 4P47A 4MHFA 4PAIA 5LTCA 5IGAA 5IZZA 4PDDA 2WYPA 2HPGA 4PFRA 4PETA 5IM2A 4PF6A 4NAPA
chains in the Genus database with same CATH superfamily
2E1SA 4OHNA 3D4CA 1AL3A 3DP8A 4JDFA 1QUKA 4OVRA 5ET6A 4ZE9A 4OA4A 2F7AA 1MDQA 3LSFB 4M4GA 3S9EA 2F35A 1B5JA 5EHMA 2HHMA 4FATA 3HPIA 2B4LA 1OQHA 5F1QA 1IMAA 3A29A 5J16A 2DQVA 4LATA 5L8DA 1A40A 3O29A 5EQ7A 5HM4B 1KZ8A 4PQJA 4N81A 1MY2A 1H3DA 3FGSA 2XXQA 5H8QA 1B3HA 1Y3PA 2O1LA 1BKAA 4WXJA 4F2OA 4H0WA 4ZDMA 3DLNA 5EQ9A 3VVDA 3H6WA 5H8HB 1MY3A 4DI4B 3ZSFA 3FIRA 1Y20A 4N8GA 4QFKA 4GWWA 4MCOA 3TAJA 1XC1A 1Z7NE 1GTKA 4ELQA 2Y7PA 3TODA 4MBPA 3EN3A 1LBCA 1TFAA 2PYYA 4NF0A 3T93B 3GBAA 2XXPA 3GYYA 3MVYA 3BIHA 4C1UA 4OEUA 1A8FA 2F3DA 2DYXA 4H46A 1JW1A 1VSOA 5I3SA 3S4UA 1Q35A 3DP4A 1MPBA 2CZHA 2ZXTA 1Y9UA 3A3CA 3N6UA 4EXLA 2B65A 5H8QB 1FBCA 4HTGA 4R75A 3T22A 3N26A 3T96B 2F6PA 4ONYA 3V83A 4NWCA 1D9QA 1FPDA 3UGWA 5HPQA 1XS5A 4U21A 3U72A 2ONRA 3H6UA 4H45A 4O8MA 3D1RA 1ATGA 4OEVA 2RINA 1SYHA 4HW8A 3CG1A 2F6GA 1RKMA 3E9XA 1MM7A 3VDFA 1DSNA 4YU0A 3KSXA 4MMPA 3W9WA 4ESXA 4YZZA 2OBGA 5TP9A 4YICA 3E4RA 3MP8A 2QRYA 2PVUA 3K6XA 4QXDA 2Y7IA 3JYRA 1AWBA 4IO4A 1SI1A 2NWJA 1KA0A 5KCJA 3C4MA 4WKMA 4P0IA 3FXQA 1B3GA 3KJTA 4HXVA 4RA1A 4P1EA 3FVKA 1IXIA 3U92A 5L9MA 2VPNA 1QULA 4QFPA 5BUUA 4H6DA 2I0BA 4X1DA 1USYE 5EQAA 3LSWA 3UN6A 1B3FA 2WBBA 3PV0E 4I40A 4JVDA 2QMXA 2P3VA 4QBAA 4MHFA 3LUZA 5I2NA 4ESWA 1INPA 4ZE8A 1N7WA 4R73A 1DMBA 4G4PA 1CNQA 1H44A 3SERA 4BDMA 5TP9B 1CB6A 1B1HA 1NV3A 3FV2A 3K6WA 1ZIUA 2Z22A 2H98A 2RCBA 5KCJB 4GX6A 1POTA 3MW0A 3ONMA 4PDHA 2O7IA 3N6TA 3JZJA 5I5PA 4DLDA 4KR5A 4EF2A 2ANJA 3RPLA 4X1BA 3SEUA 1SPIA 4ECFA 3C32A 4FIMA 2CEXA 4G8NA 2V4CA 3QAXA 2ONSA 1NUZA 3IOUA 4RPOA 2DWAA 4YMAA 3TCHA 5I2NB 1OIBA 4PFTA 4LP2B 3MZBA 1JETA 1FPJA 4OQOA 4AS4A 3MC2A 4EQBA 4OERA 3GBBA 2H4IA 1RDXA 2AIXA 3BFUA 4KQPA 4IB2A 3KEIA 4X04A 4Z7EA 1FBPA 4THIA 3TZAA 1VFEA 1NMUA 4HCYA 1IMCA 3HHGA 3HO7A 4HCWA 2I3VA 3TFLA 4N07A 1B5IA 1B0HA 2F7CA 5AE4A 3C35A 1UTBA 1IXGA 3RPLB 3MBPA 3RUMA 1POY1 1QKAA 2QMWA 1FBEA 3IJOB 3O9PA 1FBFA 4NG7A 2NXOA 4NMYA 4OESA 3IK6B 4XFEA 3RTFB 2O7UA 4NE4A 3GXAA 3O6HA 4ZEFA 5I7IA 4QSEA 4MF3A 4I62A 2PBWA 1TXFA 3LSLA 2YJPA 2G93A 4PFBA 4G2ZA 2XHDA 1YCJA 4FORA 1UTHA 3EHTA 1DBZA 2DVZA 4FBPA 4RYAA 3TEPA 2O68A 4PBHA 2RC8A 2DP8A 4ND9A 5CRYA 3UA8A 1AOVA 4JWYA 4BDQA 2OX3A 3G3JA 5F24A 2HXWA 2XXIA 3RT8A 3N5LA 4PGPA 2Q2CA 4LZ8A 4KI0E 4KCCA 4JSOA 1UTBB 3MZ9A 1B1XA 3KN7A 2Y84A 4YB5A 1LBBA 4NHBA 4O3BA 2KR0A 2D21A 4JVCA 1QJMA 1NL5A 1WODA 4JWXA 1LBXA 1FJ9A 3QMFA 2Z8FA 4F3SA 2XXTA 1FTLA 4R6YA 5LTCA 3VVFA 2HQ0A 1QW0A 2I58A 1FW0A 3RNNA 1UTHB 3M3KA 3MJNA 3CFLA 1PBQA 3IJXB 2NUVA 1SDXA 5IAIA 4R74A 4N13A 3MAMA 5CC2A 3U65A 2H5YA 3FUZA 3H6TA 3FZVA 2O1MA 4U1ZA 1ZMGA 4QHQA 4QSDA 4IGTA 4FE8A 3KSJA 4F1VA 1DTGA 3RPWA 3E13X 1SW1A 1MQHA 1DPEA 1LFIA 2XX9A 3CHGA 3G3FA 3QUJA 2MKZA 3LBSA 1EZOA 5F7VA 1LAHE 4I9DA 2REJA 3TELA 1FQDA 2CZKA 2B3FA 2QVUA 2I6EA 4X9TA 4R6KA 3JV9A 1DK4A 3CR9A 1ELJA 1B6HA 1SW5A 1G0HA 1MXVA 3I3VA 1IZ1A 4GBVA 1NUYA 4PBQA 1B46A 3FVNA 5ET5A 3R26A 3DM0A 3OSQA 1B58A 1UIVA 4LVQA 1FPEA 1SW4A 1O64A 3RTWB 1NV4A 4LUBA 2RF1A 3IO4A 3KJ7A 4FEBA 2ZZVA 3MQ9A 3FASA 3CG3A 4U23A 5CMKA 1A99A 1LAGE 1A8EA 3VLUA 2UYFA 4PF6A 2PMSA 2Q9TA 3PMXA 2Y5LA 5FHNA 3IX1A 4H8JA 4C0RA 4PAFA 4JWOA 4E0XA 3VXCA 3SDFA 1FQAA 2DWIA 3S2VA 4I1DA 1KWHA 3QYTA 4FJPA 3LR1A 3OD7A 2UVGA 1LBYA 1FPKA 4GIZA 3RT6B 1MPDA 4R72A 3VLWA 3CI8A 2FIEA 5ET7A 2P3NA 1QUJA 4XIGQ 5L9SA 2PCRA 1LCFA 4NF4A 3HHFA 2OWSA 1UIUA 2DE3A 1NKXA 4KYDA 3G3IA 4YKPA 1LFGA 2OK2A 3MVXA 2AL5A 1B3LA 4KPTA 3H7MA 4O7IA 5CMCA 4DCYA 2GQ1A 4P0GA 4F1UA 3R7XA 5BWJA 5TPAA 4O3CA 2PT1A 2Z23A 4NN3A 3VFJA 1FTAA 1N04A 5CMMA 3ROJA 3ZKLA 1GGGA 1D4NA 2VP1A 4F2QA 1FPGA 3M3LA 3MPLA 4PAIA 3TCFA 3T0JA 4U1OA 2YLNA 4TOZA 5IM2A 1HSJA 1LAFE 2ZYNA 3VE1B 1FTKA 2KLFA 3KBZA 4H67A 2UVIA 4NF4B 3CFXA 1LB9A 1P1WA 4K3FA 1G0IA 4RNSA 1NH7A 4KD5A 4BDNA 4JVIA 2D5WA 2FHYA 4P1LA 4NEDA 4PTKA 4OFJA 5IZ3A 3EF7A 3V5AA 4OYVA 5TPAB 4N17A 3PPOA 3ODBA 4GX3A 3K1NA 3PPPA 3O6IA 5I58A 1EH3A 1ZTYA 2XD2A 4IY6A 4RJZA 1LCTA 5LOMA 4N6DA 2I48A 5JEIA 2GHBA 5ISUA 1EZ9A 1I6QA 1MH4A 3OO9A 2F36A 2H25A 3LUYA 1AH5A 1B2HA 1M5DA 5DTBA 4OFLA 3RY3A 2OWTA 3ZS6A 2F5XA 1D3KA 5AA2A 1N3WA 4AB6A 3IR1A 3U1OA 5EHSA 1FQBA 3MP1A 3OENA 1RDYA 3O97A 2XXWA 4PDDA 2HPGA 5IZ3B 2KQZA 2DE4A 4U4SA 2WEFA 1A7LA 4GWOA 4I3YA 2HEUA 3HCQA 3C33A 2R71A 3HFUA 4N15A 4UACA 5EYHA 5I58B 1QVSA 3G3KA 1FQEA 1IITA 4XXUA 4XKRA 4NF5A 4M1VA 3MZ1A 1YPNA 2GH9A 1RYOA 3KN3A 2O6AA 2I4CA 4ZS9A 3U94A 1OLAA 1AIVA 3SEWA 3LSXA 4POXA 5DVJA 4R9GA 3C31A 1DCUA 1O7TA 4FECA 2XWKA 5H8NA 3ZKKA 1EZPA 3B7DA 3SESA 1NNTA 2QL3A 3PMVA 4U2RA 1FCKA 5H8SA 4GOTA 4GFRA 4MNIA 3PUZE 4GXAA 4WEPA 4R6HA 2BJJX 1NUXA 2RCAA 3N94A 4KYEA 1TFDA 2Q74A 1IMDA 3FVGA 2GRVA 1FPBA 3E79A 1B7HA 4NF5B 5K2XA 1I69A 3DP6A 3FXUA 3TQWA 3FD3A 1OVTA 2JJKA 3OEMA 4MFIA 1II5A 4E0WA 1WDNA 1LAXA 1N7XA 3K00A 2F8DA 3O28A 2P2AA 1M5CA 3EQ1A 1LB8A 4H5FA 2ALUA 2H9BA 4PE5B 1P1QA 4ELPA 2B3BA 3KN8A 1Q1KA 1MRPA 2QSXA 5ICTA 4MLVA 1MQDA 4F18A 1LSTA 1M5EA 5DEXA 3C34A 4TLMB 4YKJA 3WAFA 4PCDA 1MQGA 4DZ1A 1SBPA 2PFZA 4DXUA 3KG2A 1R6ZA 2HAUA 4O3AA 1B52A 2Q88A 3OELA 3TQLA 1A55A 1MY4A 1PB8A 2CMOA 3PTYA 4IO3A 4R2BA 5M2VA 1PB7A 3FXRA 3SEVA 2VD2A 2XWIA 2XXRA 2ZYOA 1NNPA 2V25A 3VV5A 4GWSA 1GV8A 2O69A 1IMBA 1DPPA 3KC0A 1JQFA 2NOOA 1FJ6A 4PP0A 3PU5A 3V89B 3BIGA 1SI0A 3T1BA 2FVZA 3TKDA 2XXKA 4FAJA 1H43A 4QF9A 2XA5A 1LBVA 3PMWA 1VR5A 4HE1A 2XXYA 2FNCA 3I6VA 1S50A 5KZTA 4ZEKA 5IZ1A 1JNFA 2QS2A 4OVSA 1OVBA 1IXCA 4IY5A 5DEXB 4GWYA 2ZYMA 3FV1A 3K01A 2Y7KA 1B32A 4OVTA 1NV7A 4H1XA 1NNFA 4BDLA 5ELVA 1NH8A 3V8XB 4F31B 5FTHA 1LFHA 4KCDA 2XXXA 2UXAA 4FEDA 3T66A 4DXCA 5I2KA 2ZMBA 2E0SA 4G77A 2THIA 3O2AA 3TCGA 3OEKA 3UIFA 4Q30B 2A5TA 1FRPA 2X7PA 1LLSA 3OO8A 4NQ8A 3QXMA 3H3GA 4ZEDA 2OWZA 1RYXA 3B6QA 1S9TA 2V3UA 4LZ7A 5CM6A 5CI5A 1IIWA 4Q8RA 1FPFA 4NX1A 1MPCA 3AXFA 3U93A 4PFIA 3PD9A 1NUWA 3HV1A 4IGRA 2OJTA 2LAOA 1M5FA 4IO5A 5CMBA 3EHSA 3MSTA 4OVQA 3W9VA 4P3LA 5I2KB 4GL0A 5CBRA 1I6BA 3HN0A 2CEYA 4MLQA 1GVCA 5A5LA 4Q0CA 4MAGA 4BLAA 2I0CA 1XT8A 3W15C 1PB9A 2A5TB 1VFDA 1P1UA 4XKQA 2M8CA 4GXSB 2RC7A 1KA1A 4GL8A 2FA7A 4PFUA 4OETA 4QFOA 2DOJA 2Z8EA 1VE4A 4OFOA 2DWHA 2B4MA 4Z0IA 2UVJA 3MWBA 5DW8A 1FQFA 2QJEA 5FTIA 4X48A 4IR8A 4NAPA 4GRKA 1BIYA 2XWVA 4QSCA 2QVVA 3MP6A 2WYKA 4PF8A 4GVOA 1URDA 5AA2D 1N76A 2Z8DA 5I57A 2V3TA 5JK4A 3IOTA 3IFAA 1HSEA 4HE2A 1FTMA 4NTLA 3Q29A 1JEUA 3O66A 1Y3NA 3IAZA 5ICQA 3OO7A 3B50A 3K6UA 3TTRA 2HAVA 3QUFA 1FPLA 4UA8A 2Q89A 2VPOA 4QRZA 3MVWA 4EDPA 1XVYA 4GBWA 2ZNTA 1PC3A 3TTNA 4LQ5A 1H45A 3Q26A 4GWZA 3CIJA 4PC9A 5KDTA 5TU0A 4BDRA 3BBRA 2ZYKA 2Q8MA 4ZZAA 2A5SA 4IO2A 1MS7A 1ZBMA 1B7UA 4N6PA 4POWA 3U8QA 2CZLA 3I5OA 4C1TA 2QVRA 3VVEA 3R6UA 4G8HA 5A5XA 4BDOA 4F3BA 1LEVA 1N3XA 3C36A 3MPKA 5JTYA 4F1YA 2P0SA 1YTVA 2I4BA 5I57B 3A3UA 2QFLA 1NV1A 5AA3A 2XWOA 4O94A 2VOZA 1IEJA 1YAEA 4OMBA 2NVUB 5CBSA 4F22A 1TT1A 1LBWA 5ITOA 1FTOA 3UP9A 5IGAA 3IFCA 3B6TA 3D4GA 4YKKA 3M3FA 4H65A 4PETA 3TYHA 1K9ZA 3SZPA 1R9QA 2ONKE 2IEEA 4TLLB 2CZIA 1FBGA 1JP4A 4RK9A 1B4HA 1Z7ME 1FSAA 4HE0A 4LA9A 4XEQA 2HZLA 2PT2A 3A09A 1JVXA 5KDTB 1PEBA 4JBZA 3T9XB 4GX4A 4LZ5A 4XKPA 2R6GE 5DVIA 4NF6A 5A5XB 4MEVA 3CVGA 5JTYB 1M5BA 2Q2AA 3QSLA 2GHAA 5ESYA 5EYFA 2GFEA 1BK4A 4DIGA 1B9JA 3FJMA 3SEYA 3O6GA 3LV0A 2I3WA 3MVZA 1XI6A 1IMFA 1B5HA 1XOCA 2HCAA 2VD3A 4MNCA 4R9FA 4MJOA 3M8UA 3QIMA 3OOAA 4GWUA 3GLBA 3PPNA 4H8IA 4ZZEA 4ISUA 4GQOA 4EUOA 4YMBA 2OZZA 5FHMA 4OVJA 2PFYA 4G8MA 4P56A 2VT5A 4F39A 1SD3A 4KYSA 1Y3QA 4U4XA 5L9OA 2XXVA 5IZZA 4NF6B 4G68A 1B7ZA 1OQGA 1Q9DA 4JB7A 1K9YA 3T9UA 1NFTA 2V3QA 3LC8A 4DXBA 1MY1A 1N0TA 4YAHX 1USYH 4Q5TA 1SYIA 3RLFE 5I59A 4G61A 5H8FA 3KGCA 3ECRA 1UQWA 1IUDA 4YKIA 1MXWA 2F97A 4P11A 4NGUA 3VXBA 1ZU0A 3RGYA 2O84X 3TTLA 2F34A 3Q25A 1YXIA 3K0VA 1LBZA 3UK4A 3IB0A 1OLCA 1JW5A 2PX1A 1B0LA 4ELRA 3GZGA 4RK2A 2DE2A 5DT6A 4MX6A 2ZZXA 4R2FA 1FQCA 1NV0A 4LONB 1CE2A 3THIA 4LQ2A 1HSLA 3DELB 5T3JA 1MQJA 1URSA 5IKBA 2VGQA 3B8BA 4N8YA 4G68B 1GR2A 1AMFA 3P7IA 1S7YA 2ABHA 3PPRA 1Y1MA 1FTJA 2OCUA 2QS4A 3B6WA 5AA2B 1IXHA 5I59B 1F9BA 5H8FB 1D9VA 2F7BA 3USDA 1MM6A 2XX8A 3IOWA 2Y7RA 1QKBA 4LN5A 4GLIA 2ZNUA 1ZKBA 4P47A 1L5TA 3T9HB 3G3GA 2WYPA 1OMPA 3KFMA 1T0KA 3CRBA 3KOTA 3RQTA 3K1MA 1ANFA 2P1SA 1B3EA 1IMEA 3IOVA 3SETA 3ILUB 1EYJA 4N6KA 1DOTA 2HZKA 4I8CA 1MXYA 4ELOA 2I49A 2F78A 4MIJA 5B7DA 2XXHA 3PPQA 4EXKA 4NWDA 5I56A 1B05A 4OWDA 3E3KA 3IB1A 2G29A 5H8NB 4MNPA 1JW4A 1Y4CA 4OZ9A 3PD8A 3TPAA 3QK6A 2OLBA 2FYIA 3FJ7A 3UORA 1PBPA 1NI9A 4XKNA 3VLVA 2DXRA 2DS9A 4F3PA 1Y4TA 5FHOA 3L6HA 2XXUA 3KC1A 1ZJLA 2L5VA 3NOHA 4GF8A 3K02A 3TDJA 2DSFA 4AB5A 1YZ0A 5ET8A 1PDAA 2DVCA 3OXNA 2DXYA 2X7QA 5LDZA 4P8BA 3IB2A 4N4UA 4AS5A 5I84A 4DE8A 4ZEIA 2R8TA 3OMBA 5EYGA 3TTKA 4IO7A 2VHAA 2R9JA 1US5A 3H06B 4YB7A 5I56B 2ZZWA 1D9YA 1EYKA 2IA4A 1N84A 4I3EA 4ZECA 4PFRA 4KXPA 1XVXA 1JEVA 4JXIA 1BP5A 1MG1A 1MQIA 2X26A 3BFTA 3EKIA 2YPNA 3S9LC 1P1OA 4F3GA 1B4ZA 1NV5A 4X8RA 1URGA 3IORA 2H99A 4HS7A 3HSTA 3S9NC 3SEXA 4RXLA 4NF8A 2Y7WA 1SVXB 1B51A 3EPEA 3IO6A 5AA4A 3FBPA 4KFQA 3PGFA 4P9KA 2DWJA 3CFZA 4TQUQ 1JVYA 4KHZE 1I6AA 5ITPA 1VDWA 3FVOA 3PUVE 3T9VA 3RN8A 2WKYA 1O63A 3FXBA 4GWXA 1FBDA 2Y5KA 4OTEA 4OANA 5EQ8A 4DDDA 1J1NA 3K2DA 2RC9A 4F29A 2WBDA 5FBPA 1BLFA 4F19A 4N91A 4JSDA 2FBPA 1ZLQA 3H6VA 2O51A 1B40A 3KZGA 3C9HA 3Q27A 5AA1A 3ISPA 4PFWA 4MH5A 4UABA 3TTMA 3F11A 1MXXA 4O7MA 1IQ7A 3OO6A 2D3IA 1LGBC 4OENA 1WVJA 1BTJA 5DVFA 2HFBA 1US4A 1NV6A 4NF8B 3FJGA 4U22A 4XTCQ 5AA4B 3G7WA 3PUYE 1R1NA 1P99A 4EQ7A 1A54A 5DYHA 2XX7A 3RYDA 3KBRA 1QGXA 2UYEA 2HXRA 1EYIA 2Q8JA 1MY0A 3ILTB 1TWYA 3WAEA 4IO6A 4EQ9A 3G3HA 4PAKA 4AQ4A 1MXZA 5B70A 4DCXA 3IL1B 4EF1A 1XHYA 3SKPA 3EHUA 3MUQA 3BKIB 1SQYA 1QUIA 1SW2A 3TUSA 1Y1ZA 1YYZA 4XF5A 1MH3A 4DI3D 2UVHA 2AYSA 4YB6A 1NNKA 2FIXA 4OVPA 1DTZA 5K2YA 2BJIA 2V84A 2REGA 3TMGA 2F3BA 1EU8A 3MYUA 4RY1A 3OSRA 3KOSA 3E78A 2V93A 4PE3A 3H03A 4PFYA 4RPNA 4PGNA 1MXUA 1R9LA 3S9MC 3PUXE 4GD5A 1NV2A 4ZEBA 1H76A 1P1NA 2W7YA 3K6VA 4L17A 2QS3A 2ZNSA 3CSBA 2AL4A 4QFLA 4QFNA 2WX9A 2QPQA 3K4UA 3FATA 4OXVA 2RKMA 3CSGA 1FBHA 2XD3A 4WEDA 1FPIA 3PUWE 5J1DA 1MDP1 2ESNA 5HBCA 3L6GA 4G68C 5H8HA 1RDZA 3K1PA 4H5GA 3H4ZA 2QS1A 3Q28A 2DDKA
chains in the Genus database with same CATH topology
2V3QA 4OVRA 5ET6A 3U65A 4OA4A 4G61A 4F18A 2HHMA 4F1VA 4NGUA 2B4LA 4PCDA 1IMAA 3A29A 5J16A 2PFZA 1YXIA 1LBZA 5EQ7A 1KZ8A 3PTYA 3CHGA 4N81A 2DE2A 2XWIA 2MKZA 4MX6A 2ZZXA 4GWSA 1NV0A 1IMBA 3KC0A 2CZKA 2QVUA 1FJ6A 4X9TA 5T3JA 5EQ9A 1DK4A 3BIGA 3T1BA 2FVZA 3B8BA 4N8YA 4DI4B 1G0HA 2XXKA 4N8GA 4GWWA 4MCOA 4GBVA 2XA5A 1LBVA 1NUYA 4PBQA 4HE1A 5ET5A 4NF0A 3GYYA 5IZ1A 1FPEA 4OVSA 3BIHA 4GWYA 2F3DA 1NV4A 4OVTA 1NV7A 4LN5A 4H46A 5I3SA 2ZZVA 4P47A 2CZHA 2WYPA 4PF6A 2Q9TA 2Y5LA 1IMEA 1FBCA 4PAFA 1EYJA 4N6KA 2HZKA 1FRPA 1D9QA 1FPDA 4NQ8A 4MIJA 2OWZA 4H45A 4O8MA 3D1RA 1LBYA 1FPKA 4MNPA 5CM6A 4MMPA 1FPFA 2FIEA 3W9WA 4NX1A 5ET7A 4YZZA 2P3NA 4YICA 4PFIA 1NI9A 1NUWA 2PCRA 2DE3A 4QXDA 3KC1A 1AWBA 2L5VA 3NOHA 3MSTA 4OVQA 3W9VA 4P3LA 1KA0A 1YZ0A 5ET8A 4O7IA 4HXVA 4P1EA 2CEYA 2GQ1A 5A5LA 5LDZA 4F1UA 4P8BA 4MAGA 4N4UA 4AS5A 2R8TA 4NN3A 5EYGA 2VPNA 1FTAA 3ROJA 5EQAA 1KA1A 2WBBA 2ZZWA 4I40A 4JVDA 2P3VA 1FPGA 4QBAA 4MHFA 4PAIA 3LUZA 1EYKA 3T0JA 4I3EA 2B4MA 4KXPA 4PFRA 5DW8A 1INPA 5IM2A 4IR8A 4NAPA 1CNQA 2XWVA 2QVVA 3EKIA 3KBZA 2WYKA 4PF8A 1NV5A 1NV3A 4X8RA 1G0IA 5JK4A 3IFAA 4HE2A 4JVIA 4GX6A 3FBPA 2FHYA 4P9KA 4PDHA 4P1LA 4PTKA 3B50A 5I5PA 5IZ3A 1VDWA 4N17A 3RPLA 3FXBA 4GWXA 1SPIA 1FBDA 2Y5KA 4GX3A 1FPLA 5EQ8A 4OANA 2VPOA 2CEXA 2V4CA 1NUZA 4GBWA 2WBDA 5FBPA 4F19A 4N91A 2FBPA 4N6DA 4GWZA 4PC9A 2Q8MA 3ISPA 4UABA 2QVRA 1FPJA 4O7MA 4AS4A 1LEVA 2F5XA 1RDXA 2QFLA 1NV1A 2XWOA 4O94A 4X04A 1NV6A 1FBPA 4HCYA 1IMCA 1LBWA 4HCWA 1RDYA 5IGAA 3IFCA 4PDDA 2HPGA 5IZ3B 3RYDA 2KQZA 2DE4A 4PETA 1QGXA 1K9ZA 3SZPA 2WEFA 2HXRA 3RPLB 1EYIA 2CZIA 4I3YA 1FBGA 1JP4A 3HFUA 4N15A 5EYHA 4PAKA 1FBEA 1FSAA 1FBFA 4NG7A 4HE0A 4XEQA 2HZLA 4M1VA 4XFEA 5I7IA 1YYZA 4GX4A 4XF5A 4DI3D 4PFBA 4MEVA 2FIXA 4OVPA 1DCUA 2XWKA 1DBZA 2DVZA 4FBPA 2BJIA 4PBHA 2F3BA 5ESYA 3MYUA 2OX3A 5F24A 4MNIA 1BK4A 3E78A 4PE3A 4PGPA 4PGNA 3LV0A 1XI6A 1IMFA 1NUXA 1NV2A 2Q74A 1IMDA 4MNCA 4MJOA 4NHBA 1FPBA 3E79A 2KR0A 4GWUA 2WX9A 4JVCA 2QPQA 1FBHA 1FPIA 5J1DA 1LBXA 2JJKA 1FJ9A 2PFYA 3QMFA 4P56A 2VT5A 1RDZA 5LTCA 5IZZA 1Q9DA 2DDKA 1K9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWV A;  4PAF A;  4N15 A;  4OVR A;  2WYK A;  4PF8 A;  4N6K A;  4OA4 A;  4PAK A;  2HZK A;  3U65 A;  4NG7 A;  4X8R A;  4XEQ A;  2HZL A;  4NQ8 A;  4MIJ A;  4XFE A;  4NGU A;  4PCD A;  4O8M A;  5I7I A;  2PFZ A;  4P9K A;  4PDH A;  4XF5 A;  4P1L A;  4DI3 D;  4MNP A;  5CM6 A;  4PFB A;  3B50 A;  5I5P A;  4MEV A;  4MMP A;  4OVP A;  4NX1 A;  4N17 A;  2XWK A;  2XWI A;  3FXB A;  4MX6 A;  4YZZ A;  2ZZX A;  4PBH A;  4OAN A;  2VPO A;  4YIC A;  4PFI A;  2CEX A;  2V4C A;  4N91 A;  4MNI A;  4PE3 A;  4N6D A;  4N8Y A;  4DI4 B;  4PC9 A;  4PGP A;  4PGN A;  4OVQ A;  4P3L A;  2XXK A;  4N8G A;  4MCO A;  2XA5 A;  4PBQ A;  4UAB A;  4MNC A;  4P1E A;  2CEY A;  4NHB A;  4O7M A;  4NF0 A;  4P8B A;  4MAG A;  4N4U A;  3GYY A;  4OVS A;  4NN3 A;  2WX9 A;  2VPN A;  2XWO A;  4O94 A;  4X04 A;  4OVT A;  4LN5 A;  2ZZW A;  2PFY A;  2ZZV A;  4P56 A;  4P47 A;  4MHF A;  4PAI A;  5LTC A;  5IGA A;  5IZZ A;  4PDD A;  2WYP A;  2HPG A;  4PFR A;  4PET A;  5IM2 A;  4PF6 A;  4NAP A; 
#chains in the Genus database with same CATH topology
 2E1S A;  4OHN A;  3D4C A;  1AL3 A;  3DP8 A;  4JDF A;  1QUK A;  4OVR A;  5ET6 A;  4ZE9 A;  4OA4 A;  2F7A A;  1MDQ A;  3LSF B;  4M4G A;  3S9E A;  2F35 A;  1B5J A;  5EHM A;  2HHM A;  4FAT A;  3HPI A;  2B4L A;  1OQH A;  5F1Q A;  1IMA A;  3A29 A;  5J16 A;  2DQV A;  4LAT A;  5L8D A;  1A40 A;  3O29 A;  5EQ7 A;  5HM4 B;  1KZ8 A;  4PQJ A;  4N81 A;  1MY2 A;  1H3D A;  3FGS A;  2XXQ A;  5H8Q A;  1B3H A;  1Y3P A;  2O1L A;  1BKA A;  4WXJ A;  4F2O A;  4H0W A;  4ZDM A;  3DLN A;  5EQ9 A;  3VVD A;  3H6W A;  5H8H B;  1MY3 A;  4DI4 B;  3ZSF A;  3FIR A;  1Y20 A;  4N8G A;  4QFK A;  4GWW A;  4MCO A;  3TAJ A;  1XC1 A;  1Z7N E;  1GTK A;  4ELQ A;  2Y7P A;  3TOD A;  4MBP A;  3EN3 A;  1LBC A;  1TFA A;  2PYY A;  4NF0 A;  3T93 B;  3GBA A;  2XXP A;  3GYY A;  3MVY A;  3BIH A;  4C1U A;  4OEU A;  1A8F A;  2F3D A;  2DYX A;  4H46 A;  1JW1 A;  1VSO A;  5I3S A;  3S4U A;  1Q35 A;  3DP4 A;  1MPB A;  2CZH A;  2ZXT A;  1Y9U A;  3A3C A;  3N6U A;  4EXL A;  2B65 A;  5H8Q B;  1FBC A;  4HTG A;  4R75 A;  3T22 A;  3N26 A;  3T96 B;  2F6P A;  4ONY A;  3V83 A;  4NWC A;  1D9Q A;  1FPD A;  3UGW A;  5HPQ A;  1XS5 A;  4U21 A;  3U72 A;  2ONR A;  3H6U A;  4H45 A;  4O8M A;  3D1R A;  1ATG A;  4OEV A;  2RIN A;  1SYH A;  4HW8 A;  3CG1 A;  2F6G A;  1RKM A;  3E9X A;  1MM7 A;  3VDF A;  1DSN A;  4YU0 A;  3KSX A;  4MMP A;  3W9W A;  4ESX A;  4YZZ A;  2OBG A;  5TP9 A;  4YIC A;  3E4R A;  3MP8 A;  2QRY A;  2PVU A;  3K6X A;  4QXD A;  2Y7I A;  3JYR A;  1AWB A;  4IO4 A;  1SI1 A;  2NWJ A;  1KA0 A;  5KCJ A;  3C4M A;  4WKM A;  4P0I A;  3FXQ A;  1B3G A;  3KJT A;  4HXV A;  4RA1 A;  4P1E A;  3FVK A;  1IXI A;  3U92 A;  5L9M A;  2VPN A;  1QUL A;  4QFP A;  5BUU A;  4H6D A;  2I0B A;  4X1D A;  1USY E;  5EQA A;  3LSW A;  3UN6 A;  1B3F A;  2WBB A;  3PV0 E;  4I40 A;  4JVD A;  2QMX A;  2P3V A;  4QBA A;  4MHF A;  3LUZ A;  5I2N A;  4ESW A;  1INP A;  4ZE8 A;  1N7W A;  4R73 A;  1DMB A;  4G4P A;  1CNQ A;  1H44 A;  3SER A;  4BDM A;  5TP9 B;  1CB6 A;  1B1H A;  1NV3 A;  3FV2 A;  3K6W A;  1ZIU A;  2Z22 A;  2H98 A;  2RCB A;  5KCJ B;  4GX6 A;  1POT A;  3MW0 A;  3ONM A;  4PDH A;  2O7I A;  3N6T A;  3JZJ A;  5I5P A;  4DLD A;  4KR5 A;  4EF2 A;  2ANJ A;  3RPL A;  4X1B A;  3SEU A;  1SPI A;  4ECF A;  3C32 A;  4FIM A;  2CEX A;  4G8N A;  2V4C A;  3QAX A;  2ONS A;  1NUZ A;  3IOU A;  4RPO A;  2DWA A;  4YMA A;  3TCH A;  5I2N B;  1OIB A;  4PFT A;  4LP2 B;  3MZB A;  1JET A;  1FPJ A;  4OQO A;  4AS4 A;  3MC2 A;  4EQB A;  4OER A;  3GBB A;  2H4I A;  1RDX A;  2AIX A;  3BFU A;  4KQP A;  4IB2 A;  3KEI A;  4X04 A;  4Z7E A;  1FBP A;  4THI A;  3TZA A;  1VFE A;  1NMU A;  4HCY A;  1IMC A;  3HHG A;  3HO7 A;  4HCW A;  2I3V A;  3TFL A;  4N07 A;  1B5I A;  1B0H A;  2F7C A;  5AE4 A;  3C35 A;  1UTB A;  1IXG A;  3RPL B;  3MBP A;  3RUM A;  1POY 1;  1QKA A;  2QMW A;  1FBE A;  3IJO B;  3O9P A;  1FBF A;  4NG7 A;  2NXO A;  4NMY A;  4OES A;  3IK6 B;  4XFE A;  3RTF B;  2O7U A;  4NE4 A;  3GXA A;  3O6H A;  4ZEF A;  5I7I A;  4QSE A;  4MF3 A;  4I62 A;  2PBW A;  1TXF A;  3LSL A;  2YJP A;  2G93 A;  4PFB A;  4G2Z A;  2XHD A;  1YCJ A;  4FOR A;  1UTH A;  3EHT A;  1DBZ A;  2DVZ A;  4FBP A;  4RYA A;  3TEP A;  2O68 A;  4PBH A;  2RC8 A;  2DP8 A;  4ND9 A;  5CRY A;  3UA8 A;  1AOV A;  4JWY A;  4BDQ A;  2OX3 A;  3G3J A;  5F24 A;  2HXW A;  2XXI A;  3RT8 A;  3N5L A;  4PGP A;  2Q2C A;  4LZ8 A;  4KI0 E;  4KCC A;  4JSO A;  1UTB B;  3MZ9 A;  1B1X A;  3KN7 A;  2Y84 A;  4YB5 A;  1LBB A;  4NHB A;  4O3B A;  2KR0 A;  2D21 A;  4JVC A;  1QJM A;  1NL5 A;  1WOD A;  4JWX A;  1LBX A;  1FJ9 A;  3QMF A;  2Z8F A;  4F3S A;  2XXT A;  1FTL A;  4R6Y A;  5LTC A;  3VVF A;  2HQ0 A;  1QW0 A;  2I58 A;  1FW0 A;  3RNN A;  1UTH B;  3M3K A;  3MJN A;  3CFL A;  1PBQ A;  3IJX B;  2NUV A;  1SDX A;  5IAI A;  4R74 A;  4N13 A;  3MAM A;  5CC2 A;  3U65 A;  2H5Y A;  3FUZ A;  3H6T A;  3FZV A;  2O1M A;  4U1Z A;  1ZMG A;  4QHQ A;  4QSD A;  4IGT A;  4FE8 A;  3KSJ A;  4F1V A;  1DTG A;  3RPW A;  3E13 X;  1SW1 A;  1MQH A;  1DPE A;  1LFI A;  2XX9 A;  3CHG A;  3G3F A;  3QUJ A;  2MKZ A;  3LBS A;  1EZO A;  5F7V A;  1LAH E;  4I9D A;  2REJ A;  3TEL A;  1FQD A;  2CZK A;  2B3F A;  2QVU A;  2I6E A;  4X9T A;  4R6K A;  3JV9 A;  1DK4 A;  3CR9 A;  1ELJ A;  1B6H A;  1SW5 A;  1G0H A;  1MXV A;  3I3V A;  1IZ1 A;  4GBV A;  1NUY A;  4PBQ A;  1B46 A;  3FVN A;  5ET5 A;  3R26 A;  3DM0 A;  3OSQ A;  1B58 A;  1UIV A;  4LVQ A;  1FPE A;  1SW4 A;  1O64 A;  3RTW B;  1NV4 A;  4LUB A;  2RF1 A;  3IO4 A;  3KJ7 A;  4FEB A;  2ZZV A;  3MQ9 A;  3FAS A;  3CG3 A;  4U23 A;  5CMK A;  1A99 A;  1LAG E;  1A8E A;  3VLU A;  2UYF A;  4PF6 A;  2PMS A;  2Q9T A;  3PMX A;  2Y5L A;  5FHN A;  3IX1 A;  4H8J A;  4C0R A;  4PAF A;  4JWO A;  4E0X A;  3VXC A;  3SDF A;  1FQA A;  2DWI A;  3S2V A;  4I1D A;  1KWH A;  3QYT A;  4FJP A;  3LR1 A;  3OD7 A;  2UVG A;  1LBY A;  1FPK A;  4GIZ A;  3RT6 B;  1MPD A;  4R72 A;  3VLW A;  3CI8 A;  2FIE A;  5ET7 A;  2P3N A;  1QUJ A;  4XIG Q;  5L9S A;  2PCR A;  1LCF A;  4NF4 A;  3HHF A;  2OWS A;  1UIU A;  2DE3 A;  1NKX A;  4KYD A;  3G3I A;  4YKP A;  1LFG A;  2OK2 A;  3MVX A;  2AL5 A;  1B3L A;  4KPT A;  3H7M A;  4O7I A;  5CMC A;  4DCY A;  2GQ1 A;  4P0G A;  4F1U A;  3R7X A;  5BWJ A;  5TPA A;  4O3C A;  2PT1 A;  2Z23 A;  4NN3 A;  3VFJ A;  1FTA A;  1N04 A;  5CMM A;  3ROJ A;  3ZKL A;  1GGG A;  1D4N A;  2VP1 A;  4F2Q A;  1FPG A;  3M3L A;  3MPL A;  4PAI A;  3TCF A;  3T0J A;  4U1O A;  2YLN A;  4TOZ A;  5IM2 A;  1HSJ A;  1LAF E;  2ZYN A;  3VE1 B;  1FTK A;  2KLF A;  3KBZ A;  4H67 A;  2UVI A;  4NF4 B;  3CFX A;  1LB9 A;  1P1W A;  4K3F A;  1G0I A;  4RNS A;  1NH7 A;  4KD5 A;  4BDN A;  4JVI A;  2D5W A;  2FHY A;  4P1L A;  4NED A;  4PTK A;  4OFJ A;  5IZ3 A;  3EF7 A;  3V5A A;  4OYV A;  5TPA B;  4N17 A;  3PPO A;  3ODB A;  4GX3 A;  3K1N A;  3PPP A;  3O6I A;  5I58 A;  1EH3 A;  1ZTY A;  2XD2 A;  4IY6 A;  4RJZ A;  1LCT A;  5LOM A;  4N6D A;  2I48 A;  5JEI A;  2GHB A;  5ISU A;  1EZ9 A;  1I6Q A;  1MH4 A;  3OO9 A;  2F36 A;  2H25 A;  3LUY A;  1AH5 A;  1B2H A;  1M5D A;  5DTB A;  4OFL A;  3RY3 A;  2OWT A;  3ZS6 A;  2F5X A;  1D3K A;  5AA2 A;  1N3W A;  4AB6 A;  3IR1 A;  3U1O A;  5EHS A;  1FQB A;  3MP1 A;  3OEN A;  1RDY A;  3O97 A;  2XXW A;  4PDD A;  2HPG A;  5IZ3 B;  2KQZ A;  2DE4 A;  4U4S A;  2WEF A;  1A7L A;  4GWO A;  4I3Y A;  2HEU A;  3HCQ A;  3C33 A;  2R71 A;  3HFU A;  4N15 A;  4UAC A;  5EYH A;  5I58 B;  1QVS A;  3G3K A;  1FQE A;  1IIT A;  4XXU A;  4XKR A;  4NF5 A;  4M1V A;  3MZ1 A;  1YPN A;  2GH9 A;  1RYO A;  3KN3 A;  2O6A A;  2I4C A;  4ZS9 A;  3U94 A;  1OLA A;  1AIV A;  3SEW A;  3LSX A;  4POX A;  5DVJ A;  4R9G A;  3C31 A;  1DCU A;  1O7T A;  4FEC A;  2XWK A;  5H8N A;  3ZKK A;  1EZP A;  3B7D A;  3SES A;  1NNT A;  2QL3 A;  3PMV A;  4U2R A;  1FCK A;  5H8S A;  4GOT A;  4GFR A;  4MNI A;  3PUZ E;  4GXA A;  4WEP A;  4R6H A;  2BJJ X;  1NUX A;  2RCA A;  3N94 A;  4KYE A;  1TFD A;  2Q74 A;  1IMD A;  3FVG A;  2GRV A;  1FPB A;  3E79 A;  1B7H A;  4NF5 B;  5K2X A;  1I69 A;  3DP6 A;  3FXU A;  3TQW A;  3FD3 A;  1OVT A;  2JJK A;  3OEM A;  4MFI A;  1II5 A;  4E0W A;  1WDN A;  1LAX A;  1N7X A;  3K00 A;  2F8D A;  3O28 A;  2P2A A;  1M5C A;  3EQ1 A;  1LB8 A;  4H5F A;  2ALU A;  2H9B A;  4PE5 B;  1P1Q A;  4ELP A;  2B3B A;  3KN8 A;  1Q1K A;  1MRP A;  2QSX A;  5ICT A;  4MLV A;  1MQD A;  4F18 A;  1LST A;  1M5E A;  5DEX A;  3C34 A;  4TLM B;  4YKJ A;  3WAF A;  4PCD A;  1MQG A;  4DZ1 A;  1SBP A;  2PFZ A;  4DXU A;  3KG2 A;  1R6Z A;  2HAU A;  4O3A A;  1B52 A;  2Q88 A;  3OEL A;  3TQL A;  1A55 A;  1MY4 A;  1PB8 A;  2CMO A;  3PTY A;  4IO3 A;  4R2B A;  5M2V A;  1PB7 A;  3FXR A;  3SEV A;  2VD2 A;  2XWI A;  2XXR A;  2ZYO A;  1NNP A;  2V25 A;  3VV5 A;  4GWS A;  1GV8 A;  2O69 A;  1IMB A;  1DPP A;  3KC0 A;  1JQF A;  2NOO A;  1FJ6 A;  4PP0 A;  3PU5 A;  3V89 B;  3BIG A;  1SI0 A;  3T1B A;  2FVZ A;  3TKD A;  2XXK A;  4FAJ A;  1H43 A;  4QF9 A;  2XA5 A;  1LBV A;  3PMW A;  1VR5 A;  4HE1 A;  2XXY A;  2FNC A;  3I6V A;  1S50 A;  5KZT A;  4ZEK A;  5IZ1 A;  1JNF A;  2QS2 A;  4OVS A;  1OVB A;  1IXC A;  4IY5 A;  5DEX B;  4GWY A;  2ZYM A;  3FV1 A;  3K01 A;  2Y7K A;  1B32 A;  4OVT A;  1NV7 A;  4H1X A;  1NNF A;  4BDL A;  5ELV A;  1NH8 A;  3V8X B;  4F31 B;  5FTH A;  1LFH A;  4KCD A;  2XXX A;  2UXA A;  4FED A;  3T66 A;  4DXC A;  5I2K A;  2ZMB A;  2E0S A;  4G77 A;  2THI A;  3O2A A;  3TCG A;  3OEK A;  3UIF A;  4Q30 B;  2A5T A;  1FRP A;  2X7P A;  1LLS A;  3OO8 A;  4NQ8 A;  3QXM A;  3H3G A;  4ZED A;  2OWZ A;  1RYX A;  3B6Q A;  1S9T A;  2V3U A;  4LZ7 A;  5CM6 A;  5CI5 A;  1IIW A;  4Q8R A;  1FPF A;  4NX1 A;  1MPC A;  3AXF A;  3U93 A;  4PFI A;  3PD9 A;  1NUW A;  3HV1 A;  4IGR A;  2OJT A;  2LAO A;  1M5F A;  4IO5 A;  5CMB A;  3EHS A;  3MST A;  4OVQ A;  3W9V A;  4P3L A;  5I2K B;  4GL0 A;  5CBR A;  1I6B A;  3HN0 A;  2CEY A;  4MLQ A;  1GVC A;  5A5L A;  4Q0C A;  4MAG A;  4BLA A;  2I0C A;  1XT8 A;  3W15 C;  1PB9 A;  2A5T B;  1VFD A;  1P1U A;  4XKQ A;  2M8C A;  4GXS B;  2RC7 A;  1KA1 A;  4GL8 A;  2FA7 A;  4PFU A;  4OET A;  4QFO A;  2DOJ A;  2Z8E A;  1VE4 A;  4OFO A;  2DWH A;  2B4M A;  4Z0I A;  2UVJ A;  3MWB A;  5DW8 A;  1FQF A;  2QJE A;  5FTI A;  4X48 A;  4IR8 A;  4NAP A;  4GRK A;  1BIY A;  2XWV A;  4QSC A;  2QVV A;  3MP6 A;  2WYK A;  4PF8 A;  4GVO A;  1URD A;  5AA2 D;  1N76 A;  2Z8D A;  5I57 A;  2V3T A;  5JK4 A;  3IOT A;  3IFA A;  1HSE A;  4HE2 A;  1FTM A;  4NTL A;  3Q29 A;  1JEU A;  3O66 A;  1Y3N A;  3IAZ A;  5ICQ A;  3OO7 A;  3B50 A;  3K6U A;  3TTR A;  2HAV A;  3QUF A;  1FPL A;  4UA8 A;  2Q89 A;  2VPO A;  4QRZ A;  3MVW A;  4EDP A;  1XVY A;  4GBW A;  2ZNT A;  1PC3 A;  3TTN A;  4LQ5 A;  1H45 A;  3Q26 A;  4GWZ A;  3CIJ A;  4PC9 A;  5KDT A;  5TU0 A;  4BDR A;  3BBR A;  2ZYK A;  2Q8M A;  4ZZA A;  2A5S A;  4IO2 A;  1MS7 A;  1ZBM A;  1B7U A;  4N6P A;  4POW A;  3U8Q A;  2CZL A;  3I5O A;  4C1T A;  2QVR A;  3VVE A;  3R6U A;  4G8H A;  5A5X A;  4BDO A;  4F3B A;  1LEV A;  1N3X A;  3C36 A;  3MPK A;  5JTY A;  4F1Y A;  2P0S A;  1YTV A;  2I4B A;  5I57 B;  3A3U A;  2QFL A;  1NV1 A;  5AA3 A;  2XWO A;  4O94 A;  2VOZ A;  1IEJ A;  1YAE A;  4OMB A;  2NVU B;  5CBS A;  4F22 A;  1TT1 A;  1LBW A;  5ITO A;  1FTO A;  3UP9 A;  5IGA A;  3IFC A;  3B6T A;  3D4G A;  4YKK A;  3M3F A;  4H65 A;  4PET A;  3TYH A;  1K9Z A;  3SZP A;  1R9Q A;  2ONK E;  2IEE A;  4TLL B;  2CZI A;  1FBG A;  1JP4 A;  4RK9 A;  1B4H A;  1Z7M E;  1FSA A;  4HE0 A;  4LA9 A;  4XEQ A;  2HZL A;  2PT2 A;  3A09 A;  1JVX A;  5KDT B;  1PEB A;  4JBZ A;  3T9X B;  4GX4 A;  4LZ5 A;  4XKP A;  2R6G E;  5DVI A;  4NF6 A;  5A5X B;  4MEV A;  3CVG A;  5JTY B;  1M5B A;  2Q2A A;  3QSL A;  2GHA A;  5ESY A;  5EYF A;  2GFE A;  1BK4 A;  4DIG A;  1B9J A;  3FJM A;  3SEY A;  3O6G A;  3LV0 A;  2I3W A;  3MVZ A;  1XI6 A;  1IMF A;  1B5H A;  1XOC A;  2HCA A;  2VD3 A;  4MNC A;  4R9F A;  4MJO A;  3M8U A;  3QIM A;  3OOA A;  4GWU A;  3GLB A;  3PPN A;  4H8I A;  4ZZE A;  4ISU A;  4GQO A;  4EUO A;  4YMB A;  2OZZ A;  5FHM A;  4OVJ A;  2PFY A;  4G8M A;  4P56 A;  2VT5 A;  4F39 A;  1SD3 A;  4KYS A;  1Y3Q A;  4U4X A;  5L9O A;  2XXV A;  5IZZ A;  4NF6 B;  4G68 A;  1B7Z A;  1OQG A;  1Q9D A;  4JB7 A;  1K9Y A;  3T9U A;  1NFT A;  2V3Q A;  3LC8 A;  4DXB A;  1MY1 A;  1N0T A;  4YAH X;  1USY H;  4Q5T A;  1SYI A;  3RLF E;  5I59 A;  4G61 A;  5H8F A;  3KGC A;  3ECR A;  1UQW A;  1IUD A;  4YKI A;  1MXW A;  2F97 A;  4P11 A;  4NGU A;  3VXB A;  1ZU0 A;  3RGY A;  2O84 X;  3TTL A;  2F34 A;  3Q25 A;  1YXI A;  3K0V A;  1LBZ A;  3UK4 A;  3IB0 A;  1OLC A;  1JW5 A;  2PX1 A;  1B0L A;  4ELR A;  3GZG A;  4RK2 A;  2DE2 A;  5DT6 A;  4MX6 A;  2ZZX A;  4R2F A;  1FQC A;  1NV0 A;  4LON B;  1CE2 A;  3THI A;  4LQ2 A;  1HSL A;  3DEL B;  5T3J A;  1MQJ A;  1URS A;  5IKB A;  2VGQ A;  3B8B A;  4N8Y A;  4G68 B;  1GR2 A;  1AMF A;  3P7I A;  1S7Y A;  2ABH A;  3PPR A;  1Y1M A;  1FTJ A;  2OCU A;  2QS4 A;  3B6W A;  5AA2 B;  1IXH A;  5I59 B;  1F9B A;  5H8F B;  1D9V A;  2F7B A;  3USD A;  1MM6 A;  2XX8 A;  3IOW A;  2Y7R A;  1QKB A;  4LN5 A;  4GLI A;  2ZNU A;  1ZKB A;  4P47 A;  1L5T A;  3T9H B;  3G3G A;  2WYP A;  1OMP A;  3KFM A;  1T0K A;  3CRB A;  3KOT A;  3RQT A;  3K1M A;  1ANF A;  2P1S A;  1B3E A;  1IME A;  3IOV A;  3SET A;  3ILU B;  1EYJ A;  4N6K A;  1DOT A;  2HZK A;  4I8C A;  1MXY A;  4ELO A;  2I49 A;  2F78 A;  4MIJ A;  5B7D A;  2XXH A;  3PPQ A;  4EXK A;  4NWD A;  5I56 A;  1B05 A;  4OWD A;  3E3K A;  3IB1 A;  2G29 A;  5H8N B;  4MNP A;  1JW4 A;  1Y4C A;  4OZ9 A;  3PD8 A;  3TPA A;  3QK6 A;  2OLB A;  2FYI A;  3FJ7 A;  3UOR A;  1PBP A;  1NI9 A;  4XKN A;  3VLV A;  2DXR A;  2DS9 A;  4F3P A;  1Y4T A;  5FHO A;  3L6H A;  2XXU A;  3KC1 A;  1ZJL A;  2L5V A;  3NOH A;  4GF8 A;  3K02 A;  3TDJ A;  2DSF A;  4AB5 A;  1YZ0 A;  5ET8 A;  1PDA A;  2DVC A;  3OXN A;  2DXY A;  2X7Q A;  5LDZ A;  4P8B A;  3IB2 A;  4N4U A;  4AS5 A;  5I84 A;  4DE8 A;  4ZEI A;  2R8T A;  3OMB A;  5EYG A;  3TTK A;  4IO7 A;  2VHA A;  2R9J A;  1US5 A;  3H06 B;  4YB7 A;  5I56 B;  2ZZW A;  1D9Y A;  1EYK A;  2IA4 A;  1N84 A;  4I3E A;  4ZEC A;  4PFR A;  4KXP A;  1XVX A;  1JEV A;  4JXI A;  1BP5 A;  1MG1 A;  1MQI A;  2X26 A;  3BFT A;  3EKI A;  2YPN A;  3S9L C;  1P1O A;  4F3G A;  1B4Z A;  1NV5 A;  4X8R A;  1URG A;  3IOR A;  2H99 A;  4HS7 A;  3HST A;  3S9N C;  3SEX A;  4RXL A;  4NF8 A;  2Y7W A;  1SVX B;  1B51 A;  3EPE A;  3IO6 A;  5AA4 A;  3FBP A;  4KFQ A;  3PGF A;  4P9K A;  2DWJ A;  3CFZ A;  4TQU Q;  1JVY A;  4KHZ E;  1I6A A;  5ITP A;  1VDW A;  3FVO A;  3PUV E;  3T9V A;  3RN8 A;  2WKY A;  1O63 A;  3FXB A;  4GWX A;  1FBD A;  2Y5K A;  4OTE A;  4OAN A;  5EQ8 A;  4DDD A;  1J1N A;  3K2D A;  2RC9 A;  4F29 A;  2WBD A;  5FBP A;  1BLF A;  4F19 A;  4N91 A;  4JSD A;  2FBP A;  1ZLQ A;  3H6V A;  2O51 A;  1B40 A;  3KZG A;  3C9H A;  3Q27 A;  5AA1 A;  3ISP A;  4PFW A;  4MH5 A;  4UAB A;  3TTM A;  3F11 A;  1MXX A;  4O7M A;  1IQ7 A;  3OO6 A;  2D3I A;  1LGB C;  4OEN A;  1WVJ A;  1BTJ A;  5DVF A;  2HFB A;  1US4 A;  1NV6 A;  4NF8 B;  3FJG A;  4U22 A;  4XTC Q;  5AA4 B;  3G7W A;  3PUY E;  1R1N A;  1P99 A;  4EQ7 A;  1A54 A;  5DYH A;  2XX7 A;  3RYD A;  3KBR A;  1QGX A;  2UYE A;  2HXR A;  1EYI A;  2Q8J A;  1MY0 A;  3ILT B;  1TWY A;  3WAE A;  4IO6 A;  4EQ9 A;  3G3H A;  4PAK A;  4AQ4 A;  1MXZ A;  5B70 A;  4DCX A;  3IL1 B;  4EF1 A;  1XHY A;  3SKP A;  3EHU A;  3MUQ A;  3BKI B;  1SQY A;  1QUI A;  1SW2 A;  3TUS A;  1Y1Z A;  1YYZ A;  4XF5 A;  1MH3 A;  4DI3 D;  2UVH A;  2AYS A;  4YB6 A;  1NNK A;  2FIX A;  4OVP A;  1DTZ A;  5K2Y A;  2BJI A;  2V84 A;  2REG A;  3TMG A;  2F3B A;  1EU8 A;  3MYU A;  4RY1 A;  3OSR A;  3KOS A;  3E78 A;  2V93 A;  4PE3 A;  3H03 A;  4PFY A;  4RPN A;  4PGN A;  1MXU A;  1R9L A;  3S9M C;  3PUX E;  4GD5 A;  1NV2 A;  4ZEB A;  1H76 A;  1P1N A;  2W7Y A;  3K6V A;  4L17 A;  2QS3 A;  2ZNS A;  3CSB A;  2AL4 A;  4QFL A;  4QFN A;  2WX9 A;  2QPQ A;  3K4U A;  3FAT A;  4OXV A;  2RKM A;  3CSG A;  1FBH A;  2XD3 A;  4WED A;  1FPI A;  3PUW E;  5J1D A;  1MDP 1;  2ESN A;  5HBC A;  3L6G A;  4G68 C;  5H8H A;  1RDZ A;  3K1P A;  4H5G A;  3H4Z A;  2QS1 A;  3Q28 A;  2DDK A; 
#chains in the Genus database with same CATH homology
 2V3Q A;  4OVR A;  5ET6 A;  3U65 A;  4OA4 A;  4G61 A;  4F18 A;  2HHM A;  4F1V A;  4NGU A;  2B4L A;  4PCD A;  1IMA A;  3A29 A;  5J16 A;  2PFZ A;  1YXI A;  1LBZ A;  5EQ7 A;  1KZ8 A;  3PTY A;  3CHG A;  4N81 A;  2DE2 A;  2XWI A;  2MKZ A;  4MX6 A;  2ZZX A;  4GWS A;  1NV0 A;  1IMB A;  3KC0 A;  2CZK A;  2QVU A;  1FJ6 A;  4X9T A;  5T3J A;  5EQ9 A;  1DK4 A;  3BIG A;  3T1B A;  2FVZ A;  3B8B A;  4N8Y A;  4DI4 B;  1G0H A;  2XXK A;  4N8G A;  4GWW A;  4MCO A;  4GBV A;  2XA5 A;  1LBV A;  1NUY A;  4PBQ A;  4HE1 A;  5ET5 A;  4NF0 A;  3GYY A;  5IZ1 A;  1FPE A;  4OVS A;  3BIH A;  4GWY A;  2F3D A;  1NV4 A;  4OVT A;  1NV7 A;  4LN5 A;  4H46 A;  5I3S A;  2ZZV A;  4P47 A;  2CZH A;  2WYP A;  4PF6 A;  2Q9T A;  2Y5L A;  1IME A;  1FBC A;  4PAF A;  1EYJ A;  4N6K A;  2HZK A;  1FRP A;  1D9Q A;  1FPD A;  4NQ8 A;  4MIJ A;  2OWZ A;  4H45 A;  4O8M A;  3D1R A;  1LBY A;  1FPK A;  4MNP A;  5CM6 A;  4MMP A;  1FPF A;  2FIE A;  3W9W A;  4NX1 A;  5ET7 A;  4YZZ A;  2P3N A;  4YIC A;  4PFI A;  1NI9 A;  1NUW A;  2PCR A;  2DE3 A;  4QXD A;  3KC1 A;  1AWB A;  2L5V A;  3NOH A;  3MST A;  4OVQ A;  3W9V A;  4P3L A;  1KA0 A;  1YZ0 A;  5ET8 A;  4O7I A;  4HXV A;  4P1E A;  2CEY A;  2GQ1 A;  5A5L A;  5LDZ A;  4F1U A;  4P8B A;  4MAG A;  4N4U A;  4AS5 A;  2R8T A;  4NN3 A;  5EYG A;  2VPN A;  1FTA A;  3ROJ A;  5EQA A;  1KA1 A;  2WBB A;  2ZZW A;  4I40 A;  4JVD A;  2P3V A;  1FPG A;  4QBA A;  4MHF A;  4PAI A;  3LUZ A;  1EYK A;  3T0J A;  4I3E A;  2B4M A;  4KXP A;  4PFR A;  5DW8 A;  1INP A;  5IM2 A;  4IR8 A;  4NAP A;  1CNQ A;  2XWV A;  2QVV A;  3EKI A;  3KBZ A;  2WYK A;  4PF8 A;  1NV5 A;  1NV3 A;  4X8R A;  1G0I A;  5JK4 A;  3IFA A;  4HE2 A;  4JVI A;  4GX6 A;  3FBP A;  2FHY A;  4P9K A;  4PDH A;  4P1L A;  4PTK A;  3B50 A;  5I5P A;  5IZ3 A;  1VDW A;  4N17 A;  3RPL A;  3FXB A;  4GWX A;  1SPI A;  1FBD A;  2Y5K A;  4GX3 A;  1FPL A;  5EQ8 A;  4OAN A;  2VPO A;  2CEX A;  2V4C A;  1NUZ A;  4GBW A;  2WBD A;  5FBP A;  4F19 A;  4N91 A;  2FBP A;  4N6D A;  4GWZ A;  4PC9 A;  2Q8M A;  3ISP A;  4UAB A;  2QVR A;  1FPJ A;  4O7M A;  4AS4 A;  1LEV A;  2F5X A;  1RDX A;  2QFL A;  1NV1 A;  2XWO A;  4O94 A;  4X04 A;  1NV6 A;  1FBP A;  4HCY A;  1IMC A;  1LBW A;  4HCW A;  1RDY A;  5IGA A;  3IFC A;  4PDD A;  2HPG A;  5IZ3 B;  3RYD A;  2KQZ A;  2DE4 A;  4PET A;  1QGX A;  1K9Z A;  3SZP A;  2WEF A;  2HXR A;  3RPL B;  1EYI A;  2CZI A;  4I3Y A;  1FBG A;  1JP4 A;  3HFU A;  4N15 A;  5EYH A;  4PAK A;  1FBE A;  1FSA A;  1FBF A;  4NG7 A;  4HE0 A;  4XEQ A;  2HZL A;  4M1V A;  4XFE A;  5I7I A;  1YYZ A;  4GX4 A;  4XF5 A;  4DI3 D;  4PFB A;  4MEV A;  2FIX A;  4OVP A;  1DCU A;  2XWK A;  1DBZ A;  2DVZ A;  4FBP A;  2BJI A;  4PBH A;  2F3B A;  5ESY A;  3MYU A;  2OX3 A;  5F24 A;  4MNI A;  1BK4 A;  3E78 A;  4PE3 A;  4PGP A;  4PGN A;  3LV0 A;  1XI6 A;  1IMF A;  1NUX A;  1NV2 A;  2Q74 A;  1IMD A;  4MNC A;  4MJO A;  4NHB A;  1FPB A;  3E79 A;  2KR0 A;  4GWU A;  2WX9 A;  4JVC A;  2QPQ A;  1FBH A;  1FPI A;  5J1D A;  1LBX A;  2JJK A;  1FJ9 A;  2PFY A;  3QMF A;  4P56 A;  2VT5 A;  1RDZ A;  5LTC A;  5IZZ A;  1Q9D A;  2DDK A;  1K9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...