4PGQA

Structure of human dna polymerase beta complexed with g in the template base paired with incoming non-hydrolyzable ttp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
324
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 112
structure length 324
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgqA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgqA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgqA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgqA03
3AU2A 4R65A 3C1ZA 4GC7A 5IILA 3K75D 4ECZA 1K1QA 4DF8A 4E0DA 1MQ2A 5J0SA 1UETA 4IG8A 2M9NA 4X4OA 3MR3A 4B9NA 4KLIA 1ZQSA 1AROP 2JEFA 9ICHA 2ZH3A 2F1HA 3FDSA 3JPRA 4NKUA 4RT3A 3V7LA 1ZQMA 4QZHA 1QSYA 1MIYA 4F5QA 2AJQA 1RZTA 8ICQA 4Q43A 4RNOA 4B9UA 3N97B 4IQWA 4KLLA 4PHDA 9ICEA 3JPQA 3EYZA 5F9LA 4DQQA 1S10A 5IIKA 4ELVA 2IMWP 3ISBA 4O3RA 5EWFA 2Q66A 4F92B 4XQ7A 3KTQA 3RRHA 1NKCA 3ZDEA 3OVBA 5J0WA 4QZFA 5DBAA 5J29A 9ICIA 3UQ0A 1JMSA 3B0XA 5KFRA 5KT6A 4BDPA 4RQ0A 5EWGA 2XGPA 3LWLA 2ASLA 2BKEA 2HHPA 3H37A 3MFIA 1V4AA 5DECA 5KT2A 4O5EA 4DL5A 1U48A 3C2KA 1JIHA 4RNNA 4DQSA 1KSPA 2R8GA 2HHTA 5J2JA 5DG7A 5KG5A 5HMMA 2ZJAA 4RUCA 4F5NA 4KLJA 4C8LA 5J2BA 3PR4A 1RYRA 4BGDA 5IIOA 2W9CA 8ICLA 5HR9A 4Z6FA 4RT2A 2HHUA 4I2FA 3GV7B 4NM2A 3RR7A 1ZQOA 4ATBA 4FHWA 4ECXA 4R8UB 4M9LA 4MEYA 5D4BA 2UVWA 5DQGA 9ICKA 5KFQA 2B21A 5CJ7A 1JAJA 4AT9B 3RJHA 4O5CA 3WFPA 4PGXA 3OJUA 3GIIA 4UBBA 4PHAA 4GLXA 3E2EA 3TQ1A 4IQTA 1UEVA 4TURA 2AGOA 3MFHA 2C22A 1NK5A 2ID1A 9ICBA 3ETLA 7ICRA 5L9XA 3SZ2A 1TK0A 2DPJA 2ISOA 4EEYA 4TUQA 1RXVA 5KG7A 2HVHA 4RWNA 9ICUA 2A1JB 5KFBA 5J2FA 4M6WA 3ZDBA 4LVSA 1S0VA 1BPEA 4O3SA 2ASJA 4Z6CA 5J0UA 3UPQA 1TFYA 4QWCA 5KFUA 1JQRA 3HT3A 2ZUCA 5IIIA 4PPXA 4RQ8A 3ZD9A 2LYHA 4DOBA 5KG4A 4R66A 3SI8A 4DSLA 1L3TA 4I2IA 3EZ5A 4DO9A 4I2DA 7ICGA 4NKTA 1QSLA 1T7PA 2BCSA 3V6JA 4FHYA 1ZYQA 3MR2A 1L5UA 8ICZA 3G6VA 1COOA 2AGPA 3H4BA 7ICMA 1ZQAA 9ICNA 2ZH5A 8ICSA 4J9LA 2BHNA 1BNOA 2ZH1A 4J9QA 1R8AA 3OV7A 4BWMA 4R63A 5D49A 1ZQRA 3T5HA 3LDAA 1ZQVA 4DF4A 2DR8A 4R8UA 3OJSA 3V7KA 8ICYA 1KTQA 5DG9A 4F4YA 1MQ3A 1LB2B 5DQHA 2PFPA 2ASDA 2M2WA 2WTFA 3MDCA 3LWMA 3ORYA 4DL7A 3RH5A 4EBCA 4RQ5A 1BVSA 4DFKA 3Q8KA 3HJ1A 3TAPA 1UA0A 1NKBA 5HREA 3GILA 8ICBA 1RXWA 1JX4A 4Z6DA 2XY6A 1L3SA 3JPNA 4F3OA 2HHVA 3T3FA 2BQ3A 3OSPA 1IM4A 4O5KA 3C23A 2BR0A 5J0XA 1NJWA 4M04A 3QZ7A 4I2GA 5KT5A 1ZQJA 1CEZA 2O5AA 1SL2A 1FA0A 4WC1A 2W8KA 4ECSA 2ZH2A 4RQ2A 1U4BA 3V72A 4MFFA 1Z00B 2NRXA 4RNMA 3GQCA 4DFJA 4MF2A 3TAQA 2ZUDA 4QZEA 4FS1A 3PX4A 1T8EA 2FPMA 2FLPA 3AQMA 8ICPA 2ZHBA 2XO7A 5KG0A 4RQ1A 1BPDA 4UAWA 2PFQA 4DFPA 3RJIA 3HWTA 5KT4A 1XSNA 2I9GA 5J2AA 5J2CA 3SV3A 9ICCA 2BCRA 2ZH7A 1JXEA 1ZQFA 2HHWA 3G6XA 4QWDA 4YMNA 2BGWA 2FLLA 4FHVA 8ICTA 4IRDA 2AU0A 4P4MA 1L3UA 4YXMA 1NJXA 2Q0ZX 4XA5A 4FBTA 1ZQDA 5HHHA 2BQUA 7ICTA 2W9CB 2ZJ5A 4O3NA 4RWPA 3SYZA 3C2LA 4J9SA 1JN3A 1ZQYA 4FH5A 4JV1A 4ATBB 4ED8A 2ISPA 4M2YA 4WC5A 4R64A 2ZH6A 4RPYA 3H4DA 3GIJA 3NGDA 1R8BA 3EW9A 3PO5A 2PI4A 4QZBA 1S0MA 1WOTA 4TQSA 1C7YA 4RQ6A 4QZGA 4J9KA 4KN7A 1NOMA 3PW5A 2ATLA 2Y1JA 2BE3A 9ICJA 3BDPA 5KFWA 8ICUA 5HC9A 4KTQA 1BPYA 7ICOA 1KFDA 4IRCA 3WFRE 4WC0A 4AT8A 2BQRA 4ED6A 4CCHA 3RRGA 4RUAA 8ICFA 1A77A 1TK5A 1IXRA 4EZ6A 2ZTDA 3JPPA 4M6WB 4F5RA 4M9GA 4I2JA 4IR9A 5C5JA 5J0PA 1Z00A 1KEJA 4QZIA 4GXIA 3V6KA 1T4GA 4ELTA 4ED0A 5KFGA 2ZH9A 3JPOA 3WFOA 3H38A 5KFPA 5HRLA 7ICQA 3RB4A 3Q8QB 4I27A 2RFFA 4NLKA 1BGXT 1MC8A 2RDJA 3C5GA 1NJZA 4GC6A 7ICUA 2XCPA 5KTQA 3UPSA 3UXOA 4F4WA 2FPLA 4MF8A 3C2MA 1KRPA 3LK9A 2ALZA 3IHQB 2ZH8A 2PFOA 3ZDCA 3T5KA 2ZUBA 5CWRA 4M9JA 2ZJ8A 5J2KA 3HPOA 5DB6A 1NK8A 2FMPA 4I2AA 2P6UA 1ZQHA 3MR6A 4DSEA 2XC9A 4KLOA 4E80A 2H5XA 2VA8A 4RPZA 4B9SA 2IBKA 3RJEA 4C8NA 2C2EA 2KFNA 1ZJMA 1UT5A 1SKWA 3AQNA 3OVAA 2HW3A 5CP2A 2GWSA 4ECUA 4E8FA 3BQ2A 4F50A 4F5OA 3KHLA 4UB2A 3V6HA 5KG1A 4UB5A 3H8WA 4YXJA 4KLDA 3OHAA 4DSIA 3BQTA 4O3PA 5KFFA 4O3OA 5J0RA 3KHHA 3RR8A 4IR1A 2DVIA 4QZCA 4ECYA 1EXNA 1KDHA 4F5PA 5KFKA 1ZQPA 1SKSA 4YG2A 3UXNA 1R89A 8ICKA 4DFMA 4AT7B 4FS2A 3PMNA 4EBJA 4YN4A 8ICXA 4X4SA 2ZTCA 4NLNA 4WC7A 4JK1A 5KFCA 1S0NA 1KFSA 4DS5A 4RWQA 4UAZA 4DQIA 4KLSA 4KLTA 4WC2A 4DLGA 9ICTA 4RQ3A 2W8LA 4QW8A 1SZPA 5F9NA 1PZNA 4DL2A 5J0YA 3H40A 4DL4A 4O9MA 1S77D 8ICVA 9ICAA 8ICCA 3GV5B 1XWLA 4EYHB 3H8JA 3OHBA 5J2HA 4DLEA 5IINA 4FHPA 1A76A 4Q45A 2PXIA 7ICNA 1WCLA 5KT7A 3QZ8A 5KFAA 2HHSA 5J2IA 3TARA 1SL0A 4M9NA 4E7XA 1RPLA 1TFRA 4TQRA 4DSJA 4RQ4A 4J9PA 4PHPA 8ICRA 1MIVA 3H7IA 4YVZA 3RH6A 4G3IA 1BNPA 1ZQTA 2DR9A 2KZ3A 1S76D 3PW0A 5DGAA 2J6UA 4B9TA 3C18A 4QZAA 3MR5A 8ICEA 3NTUA 1V9PA 1NZPA 4X0BA 4TUPA 4JV0A 5KFJA 1ZQBA 4YMMA 5F2VO 3WFSC 3GIMA 9ICLA 3GIKA 1XC9A 2IA6A 4XQ8A 9ICRA 2I1QA 5KG2A 2UVVA 3H39A 4NXZA 1HJPA 4ELUA 5HRIA 4YD2A 1X9WA 4I29A 4KLUA 3BQ1A 2KZZA 8ICAA 3JYYA 3GDXA 5HRFA 4WCWA 3H8SA 3PNCA 1N48A 3UQ2A 4P4OA 9ICGA 4X4TA 5BOLA 1NK6A 2BPFA 4KLQA 7ICEA 4IQUA 4MFAA 1OU5A 2HHQA 3AQKA 4AT8B 2BCUA 3JZ0A 7ICKA 7ICJA 3AQLA 4P4PA 2VA2A 1HUOA 4AT7A 4EYIB 3GFKB 9ICOA 5CA7A 4BWJA 4M9HA 4ECVA 1TV9A 4DOCA 1KFTA 2F1JA 1S0OA 1TAUA 1QTMA 1ZQZA 1XS9D 2R8KA 1ZQXA 5J0TA 4YFKA 1BPXA 1ZQWA 5L1KA 4FO6A 1UEUA 1UT8A 4F91B 5KFHA 3RBDA 3C66A 4FH3A 1WCNA 4QZDA 4M0AA 3RAQA 3RB3A 4P2HA 4XRHA 1L3VA 2R8JA 4NLGA 1PX5A 4WBYA 3OUYA 1ZQCA 2P6RA 4KLGA 2JZBB 3TFRA 2KTQA 1RYSA 1XU4A 3K4GA 5KG6A 3HW8A 3RJJA 3H3AA 3T5LA 2XGQA 3Q8MA 5BOMA 5HNKA 1ZQEA 4F4KA 1DGSA 9ICXA 2ZH4A 5DB8A 3C5FA 4BXOA 3PW4A 1MIWA 3B0YA 3RAXA 4DEZA 4JV2A 4X0AA 1ZQLA 3ZDDA 4I28A 2VANA 4I2HA 3OSNA 5KFLA 5KFZA 5L1JA 2BCVA 3LQCB 5KFEA 4EP7A 1H38A 3RJFA 1NK4A 3OGUA 3QEAZ 1UA1A 8ICOA 4YCXA 9ICQA 4DL6A 4WBZA 1TFWA 4DSKA 5KFNA 4TUSA 8ICIA 5J0QA 5J2EA 4ED7A 4KLMA 4YR3A 1X9SA 1XSPA 1XSLA 2IHNA 3G6YA 4UD4A 4LT6A 3RJKA 1ZQUA 5KFSA 4F2SA 2DR5A 2DR7A 3IM1A 4FBUA 2JEIA 2MUTA 4QWBA 1U49A 4RZRA 2FPKA 3MGIA 2UVRA 4C8OA 5DEDA 4YQWA 2DFLA 4J9MA 2KZMA 3PY8A 1XO1A 1VFGA 5EOZA 4NM1A 4B9VA 4C8MA 4PH5A 3BQ0A 2PBEA 4YR2A 9ICMA 7ICFA 2NRZA 3Q8LA 3RJGA 4ECWA 1ZJNA 2M2TA 4QWAA 4ECTA 3Q8SB 4I2CA 1MSWD 7ICHA 4KMUA 2HVIA 2DRBA 1Q79A 4ED1A 5L1IA 3RH4A 1ZETA 4Q8EA 2JZBA 3TI0A 1B22A 2F1IA 5DGBA 1CUKA 3ISDA 4J9OA 1QSSA 1NJYA 1TKDA 4UB1A 9ICFA 4UD5A 1U47A 4F2RA 4JWNA 3FYHA 7ICVA 4J9RA 1SL1A 3M9MB 2HHXA 4K4GA 4ZH4A 4DQPA 8ICHA 2RDIA 3Q8PB 2NRKA 3THVA 1ZQKA 3RB0A 1T3NA 2KN7A 5KG3A 1DK3A 2O1PA 2P66A 2V9WA 1KLNA 2V4RA 8ICJA 3KHGA 3PX6A 5KFMA 4GXKA 5HRKA 1Q78A 5KFTA 4WC4A 1U9LA 4IRKA 3ZD8A 4X5VA 2XCAA 4FHXA 3OVSA 4QWEA 4QZ9A 5KT3A 4M47A 4MFCA 2V4QA 5D46A 3RB6A 2BPGA 1BPBA 5DBCA 4X4QA 3TFSA 1YLQA 3HIYA 4NY8A 3PR5B 4X4PA 1Z3EB 5KFXA 1NO5A 4LZDA 4F4ZA 2NRWA 2AGQA 4UB4A 2JEJA 2ZTEA 5KFOA 1X2IA 5KFYA 2DRAA 1S97A 9ICPA 1B43A 3M8SA 1NK7A 4RU9A 4UBCA 5CHGA 1TVAA 5KFVA 4I2BA 4I2EA 3M9NB 2PI5A 2M2UA 3OUYB 5J0OA 4DWIA 3Q8RB 3MBYA 2C2RA 3RTVA 1U45A 9ICSA 2AQ4A 2NRVA 5DB9A 5HMLA 5HP4A 2FMQA 7ICIA 4Q8FA 3V7JA 5DDMA 4PGQA 2DPIA 4BXOB 7ICPA 2ZHAA 4EBEA 1Y88A 5J2DA 1N56A 1ZQQA 5DKWA 1NK9A 4GXJA 4YD1A 2BPCA 3PW2A 4KLFA 5IIMA 1D8LA 1TAQA 2KP7A 2Y1IA 4X4VA 2NRTA 4Q44A 2W9BB 5DDYA 3HX0A 4YR0A 4J9NA 1LV5A 4B9LA 4S3NA 4F8RA 2MAXA 5TZVA 4IQVA 1NK0A 3WFQE 4UQGA 3AUOA 1HUZA 4F93B 5CB1A 4RWOA 3PW7A 3ISCA 4ED3A 4O3QA 3KHRA 4RQ7A 1D9DA 4B9MA 1QLNA 8ICNA 1R8CA 4JWMA 2MUTB 4KITB 4UB3A 4F4XA 1S9FA 1X9MA 2VA3A 1DK2A 1ZQGA 5JUMA 3RBEA 4MEXA 5DLFA 7ICLA 1K1SA 4JUZA 4O0IA 4NLZA 1F5AA 4AT9A 3PX0A 4K4HA 4Z6EA 1DOQA 3AU6A 1D9FA 2M2VA 5HRDA 4M5DA 9ICWA 4X4NA 4K4IA 2R8IA 8ICGA 5DQIA 4X4UA 1JXLA 2FMSA 4DSFA 3C1YA 3C21A 9ICVA 1ZQIA 3EPIA 5EWEA 4ECQA 2JEGA 1KNYA 3NYBA 2FLNA 2BDPA 2KFZA 4WC6A 3PV8A 1SKRA 3SV4A 4HYKA 3QEBZ 3PO4A 3GV8B 4DOAA 1D8YA 3JPTA 4DL3A 2PFNA 2A1JA 5J2GA 4KLHA 3T5JA 3HP6A 3MGHA 5HHIA 1NKEA 4QW9A 8ICMA 5KFIA 4KLEA 3TANA 3MABA 3UXPA 2IHMA 2J6SA 5HRBA 4EBKA 5DB7A 4ECRA 2XY5A 5HRHA 5HRGA 5DBBA 4DQRA 1ZQNA 4PGYA 2C2DA 2W9BA 3PMLA 3L9DA 4X4RA 2XY7A 3JPSA 1VJ7A 5KFDA 3EPGA 4DS4A 3PVXA 2C28A 5IIJA 4C8KA 2UVUA 3M9OB 4RPXA 4EZ9A 1TK8A 4KN4A 2BCQA 7ICSA 4EBDA 5L1LA 4ED2A 4WC3A 3HJ4A 4YMOA 4LZGA 3QE9Y 4UAYA 5BPCA 4YP3A 2W9AA 3N4MB 2AQ0A 3MDAA 2J6TA 5DLGA 3BJYA 2R8HA 1BPZA 3ZDAA 8ICWA 2W9MA 5CR0A 3M8RA 4QZ8A 5DG8A 4PHEA 2OWOA 3EWAA 4XUSA
chains in the Genus database with same CATH superfamily
4E0DA 4C4TA 4LJXA 5J0SA 3U26A 3MR3A 4B9NA 5ALNA 4KLIA 3V7LA 1KKXA 4B6JA 1Q8KA 5AK3A 2I5HA 3N97B 1Z19A 3MGVA 9ICEA 5F9LA 4F92B 5J0WA 5J29A 2YMPA 5KT6A 2HHPA 1V4AA 4DL5A 1JIHA 4DQSA 1KSPA 5ALQA 2R8GA 2HHTA 5J2JA 3A0HU 8ICTA 4C8LA 5J2BA 3PR4A 2W9CA 5HR9A 4RT2A 1ZQOA 4ATBA 4M9LA 4MEYA 5DQGA 2B21A 3M7DA 1O08A 3WU2U 3OJUA 3GIIA 3TQ1A 2D3DA 1UEVA 2AGOA 2I6XA 9ICBA 7ICRA 5L9XA 2HMXA 3SZ2A 2ISOA 4EEYA 2YMLA 5ALTA 5KG7A 4RWNA 1SXDA 5KFBA 5J2FA 4M6WA 4LVSA 1BPEA 4O3SA 5J0UA 1TFYA 3KKAC 3E58A 3HT3A 2ZUCA 2KG5A 2LYHA 4R66A 5AKLA 1L3TA 4I2DA 4FFDA 3AN1A 7ICMA 9ICNA 4J9LA 5ALKA 2ZH1A 1R8AA 3OV7A 3QUQA 4BWMA 5D49A 2WF9A 1B0XA 4UATA 1ZQRA 3LDAA 1ZQVA 4DF4A 2KD1A 3V7KA 1KTQA 2ASDA 3ORYA 1CI4A 5ALFA 2H3ZA 3GILA 2ZIXB 2XY6A 2BQ3A 3F53A 3ER9B 3C23A 2O5AA 2JRZA 1SL2A 3FAHA 4RQ2A 3V72A 4RNMA 4P0QA 2FLPA 2XO7A 5GTIU 1BPDA 2PFQA 2LBOA 3HWTA 3CK6A 1PK1B 2KKPA 4OAHA 5AKYA 2FLLA 4FHVA 1F5SA 4IRDA 4P4MA 4YXMA 5AI4A 2A19A 2Q0ZX 7ICTA 4BUGA 4RWPA 1RG6A 4JV1A 3D2SA 2ISPA 1GPJA 2W54A 5AI5A 2ZH6A 1OW5A 3NGDA 1WOTA 4QZBA 2F8KA 4OJ6A 3LVWA 2KMDA 2BE3A 9ICJA 5KFWA 8ICUA 1BPYA 7ICOA 3WFRE 8ICFA 4RUAA 1TK5A 4F5RA 3JPPA 5C5JA 5J0PA 1N2XA 4ELTA 4ED0A 5KFGA 3WFOA 3H38A 2KVSA 3F5AA 7ICQA 2RFFA 1YT3A 4GC6A 5AM0A 5ALRA 5KTQA 1OXJA 2FPLA 4MF8A 2E8OA 2H3QA 3PSIA 3LK9A 2ZH8A 4LEYA 1Q46A 2ZUBA 5CWRA 2E1EA 4KX5A 2W04A 2FMPA 4I2AA 3KZIU 1PUZA 3MR6A 2XC9A 4E80A 4C8NA 3OVAA 2Y0SF 2W3SA 3V6HA 1VDVA 3H8WA 4YXJA 4KLDA 3OHAA 5KFFA 4O3PA 4O3OA 2DVIA 2EH9A 4NL9C 4YG2A 3UXNA 2M0NA 3NS1A 4AT7B 4FS2A 3NVYA 1WWUA 1ZRMA 2YQEA 5KFCA 5KL8B 4UAZA 2A1AA 2W8LA 4O9MA 2HSZA 4FHPA 3H8JA 4Q45A 5KT7A 5KFAA 4E7XA 5JTGA 1TFRA 1DGJA 8ICRA 3H7IA 2LPEA 1S76D 2EWRA 5DGAA 4US8A 4QZAA 2ZIWB 5AI6A 4JV0A 5KFJA 3GIMA 2IA6A 1MN8A 2KZZA 3S6JA 2A3VA 3PNCA 2FDRA 1NK6A 5T14A 1QQ7A 7ICEA 1SIJA 2O6KA 4MFAA 1OU5A 4AT8B 2BCUA 1XNSA 2VJ5A 4AT7A 3GFKB 9ICOA 4M9HA 1KFTA 1ZD3A 1QTMA 3K7DA 3NWIA 2PKEA 4YFKA 1BPXA 5L1KA 3C28A 4QZDA 4M0AA 2G07A 1PX5A 4XRHA 1L3VA 1DXSA 4KLGA 5KG6A 1T94A 2XGQA 1ZQEA 4N7RA 2CPRA 1DGSA 2ZH4A 5AK5A 5ALOA 1MIWA 5F3XB 4JV2A 5HR7A 3LQCB 5KFEA 1L7PA 4UAVA 3OGUA 3AL0B 1X9SA 1J97A 1XSLA 2E3TA 2IHNA 4O69A 4LT6A 3UM9A 4JLZA 4OAGA 2DR5A 3HJEA 2MUTA 4RZRA 3MGIA 5CFSA 3AQFA 1PVPA 2KZMA 3PY8A 2G06A 3M6ZA 3Q8LA 3RJGA 4ECTA 3Q8SB 4KMUA 2HVIA 5L1IA 1ZETA 5CFTA 2F1IA 3I1YA 3B9JA 3FYHA 3QX7A 4C7YA 4J9RA 8ICHA 2RHFA 1DK3A 1KLNA 5JTIA 4OJPA 5E79U 5KFTA 2EANA 4X5VA 2VKQA 1ZD2P 2F44A 4QZ9A 4QWEA 4Y2JA 5AKHA 2V4QA 3RB6A 2BPGA 5AKZA 3TFSA 4WJ3B 3PR5B 4X4PA 4LZDA 2LMRA 2AGQA 2MRLA 2JEJA 5KFOA 1S97A 3M8SA 1NK7A 4UBCA 1MA7A 3AQEA 4I2EA 2NO4A 3M9NB 2KICA 3Q8RB 3MBYA 1U45A 9ICSA 5HP4A 5DB9A 3CW2C 4ZOHC 5AI8A 3V7JA 1Q3VA 3L3FX 4GXJA 2BPCA 5IIMA 5AK4A 1D8LA 1ZXIA 2NRTA 1TAMA 4WOYA 4GFJA 5DDYA 3HX0A 4J9NA 2IUBA 2QARA 4F8RA 2MAXA 2B56A 5CB1A 2ZIUB 1QLNA 2WAQF 4KITB 1S9FA 4DFDA 4MEXA 5DLFA 1K1SA 4F71A 5ALPA 4K4HA 1DOQA 2E5SA 5HRDA 4K4IA 3HKZC 4CNQA 8ICGA 4X4UA 1JXLA 4DSFA 1ZD4A 5CRXA 4EEDA 2R18A 1QH9A 1UQVA 1SKRA 5ALEA 4HYKA 4Y2YA 3GV8B 3BS7A 4LEVA 2JGAA 2PFNA 3T5JA 5J8YA 2W7OA 1NKEA 4QW9A 4KLEA 3MABA 5HRBA 4LEZA 5DB7A 5HRHA 2EZXA 4PGYA 5KFDA 2OM6A 3EPGA 2C28A 4C8KA 5IIJA 4F4KA 7ICSA 4KN4A 1L6NA 4WC3A 2RP5A 4EBDA 4ED2A 4NLBA 5BPCA 3N4MB 3WKAA 3BJYA 1BPZA 2HBMA 5CR0A 5ALUA 4QZ8A 4PHEA 2OWOA 1M6YA 3AU2A 3K75D 3UMBA 2M9NA 4X4OA 2JEFA 2ZH3A 4NKUA 4QZHA 1QSYA 2F2AB 2YX8A 1RZTA 4IC9A 2E1FA 4Y2TA 4PHDA 1S10A 4OD0A 5IIKA 5AI9A 2IMWP 3ISBA 2Q66A 4XQ7A 3KTQA 3LVVA 5ALZA 1UCVA 4QZFA 2KHQA 3QU7A 3UQ0A 3B0XA 2XGPA 3LWLA 2FCLA 3H37A 5DECA 4O5EA 4RUCA 2ZJAA 4K98A 4BGDA 5IIOA 3OWGA 5ALGA 3CRXA 4I2FA 3RR7A 4FHWA 9ICKA 4AT9B 5CJ7A 3RJHA 4O5CA 3WFPA 4PHAA 3E2EA 3D2NA 2B6GA 1JUDA 3MFHA 2K8CB 1NK5A 3O0FA 4KMOB 2KHVA 2DPJA 1N62A 2B51A 4FO1A 3IG5A 2A1JB 1L7OA 1WWVA 3N7RC 3CP8A 4UASA 5IIIA 4RQ8A 5KG4A 3SI8A 2LYBA 3EZ5A 3DV9A 1QSLA 2BCSA 8ICZA 3H4BA 2ZH5A 2BHNA 4J9QA 2Y9UA 2FI1A 2BDUA 2WF5A 2DR8A 3HILA 5DG9A 1MQ3A 1YZ7A 2PFPA 2M2WA 2NRKA 1ZQJA 3LWMA 4EBCA 4RQ5A 1BVSA 3Q8KA 4Y2RA 1N60A 1RXWA 1JX4A 2XIDA 3JPNA 2AH5A 4Y2VA 3OSPA 4O5KA 4O68A 5KT5A 4MFFA 3GQCA 4QZEA 1T8EA 3AQMA 2HN2A 2XVTA 5ALVA 3WK9A 5J2AA 5J2CA 9ICCA 2HHWA 2AU0A 2NV3A 2KSOA 1NJXA 2W9CB 2ZJ5A 4O3NA 3C2LA 1JN3A 4FH5A 4ATBB 2W11A 4WC5A 4R64A 4RPYA 5ALYA 3H4DA 3GIJA 3QYPA 3EW9A 5AM3A 3PO5A 4MHVA 4RQ6A 4KN7A 1NOMA 5B5EU 2ATLA 3BDPA 2YY6A 1UPHA 4ED6A 4CCHA 1A77A 4EZ6A 4M6WB 4I2JA 1T4GA 2OHFA 3BQ7A 5KFPA 1BGXT 2RDJA 3KFUF 3C5GA 2AXTU 1SV0C 4F4WA 2DUYA 1WUDA 3IHQB 4Y2PA 2ZJ8A 5J2KA 1NK8A 4DSEA 2IBKA 5ALSA 2KFNA 3K1ZA 2KVCA 3N7PD 2DQNB 1J2NA 4ECUA 4E8FA 4F5OA 4UB2A 5KG1A 3WKCA 4UB5A 2WFAA 4C4RA 4KB6A 1KDHA 4F5PA 1SKSA 4ICAA 8ICKA 2HDOA 4UAUA 3ALRA 3PMNA 2ZTCA 4P0QB 1S0NA 4DS5A 4DL2A 3RJKA 5F9NA 1PZNA 4PZNA 1KN5A 8ICCA 3GV5B 4EYHB 5IINA 3OHBA 1SGGA 1A76A 7ICNA 1WCLA 2HHSA 2GAFD 1SL0A 1O03A 1RPLA 4J9PA 3RH6A 4G3IA 1BNPA 2Y0SC 2KZ3A 3PW0A 8ICEA 1NZPA 4X0BA 4EEBA 1ZQBA 5F2VO 3WFSC 9ICLA 9ICRA 2I1QA 3H39A 4NXZA 1HJPA 4ELUA 4KLUA 8ICAA 3JYYA 4WCWA 1N48A 3UQ2A 4P4OA 4X4TA 3L5KA 5AM4A 4KLQA 3NVOA 3JZ0A 1Z4NA 2VA2A 1HUOA 4EYIB 5CA7A 4ECVA 2LI6A 4BJQA 2R8KA 3M1YA 4C7ZA 4FO6A 3LYSA 1LVHA 1WCNA 2YTUA 3RB3A 4P2HA 2N1RA 4WBYA 3OUYA 2P6RA 2JZBB 3K4GA 3HW8A 3H3AA 5AIAA 5BOMA 2JH1A 3A0BU 4EENA 5DB8A 4BXOA 2RLTA 4DEZA 3ZDDA 4EP7A 3OSNA 5KFLA 5L1JA 2KE7A 1H38A 2JR5A 4XJEA 1UA1A 2LKYA 1SWVA 4RQMA 4DL6A 1TFWA 3FM9A 4BX9C 5J0QA 4YR3A 3M6KA 1XSPA 3IV6A 1ZQUA 4AYBF 1Q3UA 4F2SA 4FBUA 1U49A 2YB4A 2HN1A 2UVRA 4C8OA 1XO1A 3K1RB 5EOZA 1WYGA 4YR2A 2BBJA 2M2TA 4I2CA 2DRBA 4ED1A 1IIPA 4Q8EA 2JZBA 1B22A 4UD5A 9ICFA 3IRUA 1NJYA 4UB1A 4F2RA 4JWNA 2HHXA 4ZH4A 4EX6A 3THVA 1ZQKA 2KN7A 4JB3A 4O3MA 2P66A 3KKAA 2CRXA 3PX6A 5KFMA 2JMGA 4WC4A 4IRKA 1RDFA 4FHXA 1NI3A 4M47A 4MFCA 5EE0A 3NRWA 1BPBA 4X4QA 3HIYA 5KFXA 1NO5A 2HI0A 3SAHA 4UB4A 2ZIVA 5KFYA 1FFUA 5CHGA 1TVAA 5KFVA 2JV3A 2PI5A 2M2UA 1FFVA 2C2RA 3RTVA 2AQ4A 3R9KA 7ICIA 1N5XA 4CF5A 4PGQA 2DPIA 1ZQQA 1NK9A 3PW2A 1X6IA 4X4VA 4Q44A 3ZI4A 4S3NA 2WF6A 4F93B 3PW7A 3ISCA 8ICNA 4O3QA 4JMUA 1R8CA 2MUTB 2VA3A 1ZQGA 3RBEA 4JUZA 4O0IA 1NZBA 2M2VA 1AQ6A 3IG8A 5DQIA 3N7SC 2MSNA 5ALXA 1ZQIA 4ECQA 1KNYA 2KFZA 3PV8A 2HOIA 3ONNA 4WQKA 4USAA 1ZRNA 3HP6A 5HHIA 8ICMA 3TANA 2IHMA 1N61A 2J6SA 4NXWA 4EBKA 4ECRA 4QIWC 4DCCA 5HRGA 4K8VA 1LKYA 1ZQNA 4X4RA 2WAQC 2DL0A 3PVXA 4OO1J 3VCBA 1MIYA 3M9OB 4RPXA 4EZ9A 1QQ6A 4PZOA 1SZHA 1YZ6A 4G9BA 3QE9Y 4IRCA 3L4PA 2GOLA 3AM9A 4XUSA 1JMSA 4GC7A 3C1ZA 5IILA 1K1QA 2DKZA 1OUQA 1T3QA 1AROP 2F1HA 3FDSA 5KL1B 3JPRA 4RT3A 5FP0A 3DDHA 4F5QA 3BS5A 2AJQA 8ICQA 4Q43A 4RNOA 4EGWA 4B9UA 3HRDD 4KLLA 3JPQA 4O3RA 1PVRA 2KNJA 4NL9A 5ALWA 1NKCA 2K60A 3TKAA 3OVBA 9ICIA 5KFRA 2MU2A 2ASLA 2BKEA 2QARB 2Z7JA 5KT2A 3EUB2 4RNNA 1SV4A 5KNIA 5ALMA 5DG7A 5HMMA 4KLJA 1NNLA 4Z6FA 4CDGA 3J81j 3I76A 2EQYA 3GV7B 4ECXA 3N28A 3AEVA 5D4BA 5KFQA 1JRPA 4PGXA 5AKIA 3H0LB 4IQTA 4TURA 1N5WA 2C22A 1JALA 3EF2A 2ID1A 3ETLA 4OAFA 1TK0A 1RXVA 3TADC 3VC8A 4K9AA 2Q4TA 3ZDBA 4AP9A 4Z6CA 4MKPA 4QWCA 2JHDA 4PPXA 3ZD9A 3WKDA 2K8AA 4I2IA 4DO9A 7ICGA 4NKTA 3V6JA 3MR2A 1L5UA 2EZZA 2AGPA 2XI9A 2W3RA 2OYYA 4QIWF 8ICSA 1BNOA 3ICXA 3T5HA 3CNHA 3WK6A 1ZQ1C 2KOBA 1LB2B 2JXJA 2ZXHA 3MDCA 4DFKA 8ICBA 3UMGA 2F77X 4Z6DA 2HHVA 4C80A 4F3OA 2QLTA 1IM4A 2BR0A 5J0XA 3MCRA 1NJWA 4M04A 3QZ7A 1KW4A 3QU4A 1FA0A 4F72A 2W8KA 4ECSA 2ZH2A 1U4BA 2LM1A 4DFJA 4OJLA 2ZHBA 2F76X 4Y2SA 4UAWA 4DFPA 5KT4A 2G5HB 3SQIA 3SV3A 2I9GA 1JXEA 3G6XA 4I0UA 4J03A 2BGWA 4CF4A 5ALDA 1L3UA 4XA5A 4FBTA 5HHHA 4C0ZA 3SMVA 2WB1C 4K9BA 4NLCA 4ED8A 4M2YA 3KZXA 1R8BA 2PI4A 4Y2QA 4TQSA 4NWIA 3OPXA 4QZGA 4J9KA 3ED5A 2BQRA 3RRGA 1SXEA 5EE3A 1IXRA 2ZTDA 1HIWA 1X40A 4QZIA 4IR9A 4GXIA 3V6KA 3JPOA 5ALIA 2JH7A 1RQNA 3Q8QB 4I27A 4NLKA 1MC8A 1NJZA 5AKKA 7ICUA 3PSTA 3UPSA 1L7MA 1PVQA 3UXOA 3C2MA 2ALZA 2PFOA 3ZDCA 2P35A 3T5KA 4M9JA 3HPOA 2P6UA 2ODGA 4KLOA 2E8MA 2VA8A 4RPZA 4B9SA 2EAMA 3TACB 3RJEA 1ECWA 1ZJMA 2YB1A 2HW3A 3NVZA 5CP2A 2GWSA 1L8OA 4F50A 3DEEA 3BQTA 3RR8A 3KHHA 4IR1A 5J0RA 4QZCA 4ECYA 2DKXA 5KFKA 1B4FA 4KX3A 3QU5A 2H3FA 5K4LA 4DFMA 4X4SA 4HX0A 4NLNA 4WC7A 1KFSA 4DQIA 4RQ3A 4HAIA 1S77D 1SZPA 8ICVA 5J0YA 3H40A 5HC9A 9ICAA 4O6AA 1XWLA 4DLEA 2KIWA 2PXIA 3QZ8A 2QB0A 5J2IA 4M9NA 4DSJA 2KSOB 4PHPA 4YVZA 2W03A 2J6UA 2VIXA 3MR5A 3NTUA 1XC9A 5JU5A 3NVVA 5KG2A 2UVVA 2E8PA 3BQ1A 3GDXA 2WB1F 5BOLA 2BPFA 3AQKA 7ICKA 1RQLA 2IHOA 1TV9A 2K89A 1TAUA 1Z1BA 1ZQZA 1XS9D 3SD7A 5GTHU 1ZQXA 4FE3A 4OJOA 5J0TA 1ZQWA 5AM5A 1UEUA 5KFHA 4FH3A 3RBDA 1F0MA 3RAQA 1KBUA 2KTQA 4OCZA 2EDUA 1RYSA 1XU4A 3RJJA 3T5LA 4UB6U 5HNKA 1IV8A 3C5FA 3PZPA 3B0YA 3RAXA 1VJ5A 4I28A 2VANA 5KFZA 3JCFA 2BCVA 3OTQA 1NK4A 3QEAZ 2W55A 4YCXA 9ICQA 4WBZA 4DSKA 4TUSA 2IOHA 2EAOA 5ALHA 4KLMA 5KFSA 3IM1A 2JEIA 4QWBA 1QCKA 2FPKA 5DEDA 1FEZA 4YQWA 2DFLA 2WHEA 1VFGA 4C8MA 3BQ0A 2PBEA 9ICMA 7ICFA 2NRZA 1ZJNA 2IOFA 4U7CA 1MSWD 1WG8A 1TKDA 2KIVA 3WK7A 5CHEA 1SL1A 3M9MB 2RDIA 3Q8PB 3RB0A 4PL1A 4WQLA 5KG3A 4EX7A 4C4SA 4AYBC 3E0FA 4GXKA 5HRKA 2B4VA 3ZD8A 2EZYA 3OVSA 1URJA 3ETRA 5D46A 5AICA 1YLQA 4NY8A 3NUQA 1Z3EB 3BZKA 2NO5A 2YMQA 2NRWA 4NXXA 5CFUA 9ICPA 2F8LA 1B43A 4I2BA 1A0PA 4IS7A 5AKXA 3OUYB 3KOOA 4FZNA 2NRVA 2FMQA 5HMLA 4FZMA 4Q8FA 3ERCC 5DDMA 4BXOB 2ZHAA 5AK6A 1Y88A 5DKWA 4YD1A 3CYMA 4RQNA 2KEYA 3F2DA 1LV5A 4YR0A 4B9LA 1FIQA 5TZVA 4UQGA 3AUOA 1HUZA 4O67A 3IDWA 4B9MA 2BBHA 1D9DA 2KJ9A 5KAFU 4JWMA 4F4XA 1DK2A 2B0CA 7ICLA 1F5AA 2ZXIA 3PX0A 4M5DA 4Z6EA 3AU6A 2LM4A 2WF7A 2GH1A 9ICVA 3C1YA 3C21A 5EWEA 3NYBA 2FLNA 3SV4A 3NVWA 4DOAA 4IL6U 3PSPA 5CEHA 5AM2A 2OH2A 3QUBA 1D8BA 2XY5A 4JLXA 2K8BB 5DBBA 4DQRA 3L9DA 5AI0A 2XY7A 5AKEA 2BCQA 2KJ8A 5L1LA 4YMOA 4UAYA 2J6TA 2W9AA 8ICWA 3MDAA 4QNLA 2W9MA 1SV0A 3M8RA 5TISU 3D6JA 4R65A 4ECZA 2ZIVB 3SAGA 4DF8A 1MQ2A 1UETA 1COKA 4IG8A 1ZQSA 9ICHA 2ZIXA 1ZQMA 2CN1A 4IQWA 3EYZA 4DQQA 4ELVA 5EWFA 3RRHA 3ZDEA 2KV2A 1Z1VA 5DBAA 5EE1A 1PK1A 4BDPA 4RQ0A 5EWGA 3SEIA 3MFIA 5EE9A 1U48A 3C2KA 2LYAA 5KG5A 4K97A 4F5NA 8ICLA 1RYRA 2HHUA 4NM2A 1V85A 3RF9A 4R8UB 2UVWA 1JAJA 5AHXA 4UBBA 2KKVA 4GLXA 3KD3A 2BZFA 2G5IB 1FO4A 2VJ4A 4TUQA 1JI7A 2HVHA 9ICUA 1S0VA 2ASJA 3UPQA 5KFUA 1JQRA 5AKGA 2AHOB 4DOBA 4DSLA 2H3IA 1LKYB 1DRGA 1T7PA 4FHYA 1ZYQA 3G6VA 1COOA 2FE9A 4ACOA 1ZQAA 2CXYA 2Y9TA 4Y2UA 4R63A 2G0AA 4R8UA 3OJSA 8ICYA 5H2FU 4F4YA 5DQHA 2WTFA 4DL7A 3RH5A 3HJ1A 3TAPA 1UA0A 1NKBA 5HREA 1L3SA 5AM1A 3T3FA 4QJFB 2K4PA 3BS5B 4I2GA 1CEZA 4WC1A 1Z00B 2NRXA 4U6PA 2DF4B 1K5OA 3GU3A 4MF2A 3TAQA 2ZUDA 4FS1A 3PX4A 4EV6A 2FPMA 8ICPA 1CRXA 5KG0A 4RQ1A 2HBKA 2W7PA 3RJIA 2K4IA 1RYUA 1XSNA 3NKUA 2BCRA 3QUTA 2ZH7A 1ZQFA 1PK3A 4EEKA 4QWDA 1Z4OA 4YMNA 3F2CA 1SWWA 3UMCA 4FZLA 1TE2A 4OJ5A 1ZQDA 2BQUA 1P7DA 2G08A 3SYZA 1ZD5A 4J9SA 1ZQYA 2ZIWA 1S0MA 1C7YA 3H0RB 3PW5A 4K96A 5J8YC 2Y1JA 4KTQA 1KFDA 4WC0A 4AT8A 2H3VA 2DWQA 1UHUA 3PSFA 4M9GA 1Z00A 1KEJA 2WF8A 2KJ5A 2ZH9A 2YMMA 5G5HA 1JROA 5HRLA 3RB4A 1SB3C 1KQQA 2XCPA 1KRPA 2QB1A 5DB6A 1ZQHA 5B66U 2H5XA 2C2EA 3ER8C 1UT5A 1SKWA 3AQNA 3PHZA 3FC4A 3BQ2A 3KHLA 4Y2XA 1X9XA 3WKBA 1F44A 4DSIA 3H8MA 3QXGA 1EXNA 4CF3A 4NV0A 1ZQPA 3NRZA 4OAIZ 5HR6A 1R89A 3RFAA 2GA9D 4EBJA 4YN4A 8ICXA 4JK1A 4RWQA 4KLSA 4KLTA 4WC2A 2ESEA 2NYVA 4DLGA 9ICTA 1S5LU 4QW8A 5KAIU 4DL4A 5J2HA 5A0LA 1HEKA 3TARA 3NASA 4TQRA 3WKEA 2XICA 1MIVA 5D61A 4UB8U 1ZQTA 2DR9A 3F2BA 4B9TA 3C18A 3IP4B 1RM6C 1V9PA 2ZG6A 4TUPA 4GIBA 4YMMA 3SR6A 2RQ5A 3GIKA 4XQ8A 2L5YA 3SAFA 4UW9A 5HRIA 4YD2A 1V97A 2FJ6A 1X9WA 4I29A 5HRFA 3H8SA 3MC1A 9ICGA 4CRXA 4P0PB 2HBJA 4IQUA 5D63A 2HHQA 3AQLA 7ICJA 4P4PA 3QNMA 4BWJA 4DOCA 2F1JA 1S0OA 5D62A 4UARA 1X66A 1IG6A 1UT8A 4F91B 3C66A 2R8JA 4NLGA 2PMZC 1ZQCA 4A8EA 3TFRA 3Q8MA 9ICXA 1XO0A 5L1MA 3PW4A 3BZCA 1V38A 2DGZA 4X0AA 1ZQLA 4I2HA 3WK8A 1X42A 1ED1A 5ALJA 3RJFA 1J2MA 5C0YA 3WK5A 8ICOA 2DBYA 2G09A 5KFNA 8ICIA 5J2EA 4ED7A 4P0PA 2ZIUA 4UD4A 3G6YA 2RRDA 3QU9A 2F3NA 4LEWA 2DR7A 3SENA 4J9MA 4NM1A 4B9VA 4PH5A 2K4EA 2QB0B 2EAPA 4ECWA 3IN5A 1KL9A 4QWAA 2K4HA 7ICHA 4K99A 3QU2A 1Q79A 1N63A 3RH4A 1S8OA 3TI0A 1L7NA 5DGBA 1CUKA 3AMZA 3GZFA 3ISDA 4J9OA 1QSSA 4CGZA 3F5EA 1U47A 3QUCA 7ICVA 2E8NA 4K4GA 4DQPA 5G5GA 3TADA 4NXUA 1T3NA 2O1PA 2V9WA 2V4RA 8ICJA 3KHGA 2GO7A 2OEHA 1Q78A 2HOFA 1U9LA 2OXOA 2XCAA 2ES6A 2YN4A 5KT3A 5DBCA 3WK4A 4WH5A 2QKQA 4F4ZA 2ZTEA 1QQ5A 4NJ8A 1X2IA 2DRAA 2HCFA 3KBBA 5JRTA 5AIBA 4RU9A 3T79A 2OCEA 5ALLA 5J0OA 3HKZF 4DWIA 2MA1A 4NXTA 2HOQA 1C20A 7ICPA 4EBEA 5J2DA 1N56A 2PMZF 2KK0A 3C29A 4KLFA 1TAQA 2KP7A 2Y1IA 2W9BB 2HBLA 1L8LA 1GO3F 4IQVA 1NK0A 4PL2A 3WFQE 2D6FC 4RWOA 4ED3A 3KHRA 3D2QA 4RQ7A 4PJ0U 1VLBA 3I28A 4UB3A 2IOFK 1X9MA 5JUMA 1ZOLA 4NLZA 4AT9A 5B3PA 4X4NA 1D9FA 3H0MB 9ICWA 2R8IA 4KM5A 2FMSA 2JEGA 3EPIA 2BDPA 4NXVA 4WC6A 3QEBZ 3PO4A 1X6JA 1D8YA 2LHTA 3JPTA 4DL3A 2A1JA 5J2GA 4KLHA 4US9A 3MGHA 5AKJA 2D8CA 4EELA 5KFIA 3UXPA 2C2DA 2W9BA 3PMLA 3JPSA 1VJ7A 4DS4A 2GLEA 2UVUA 1TK8A 3HJ4A 4LZGA 4YP3A 2AQ0A 4CE6A 3ZDAA 5DLGA 2R8HA 2W43A 1A6SA 5DG8A 5B3QA 3EWAA 4RQ4A
chains in the Genus database with same CATH topology
3AU2A 4R65A 3C1ZA 4GC7A 5IILA 3K75D 4ECZA 1K1QA 4DF8A 4E0DA 1MQ2A 5J0SA 1UETA 4IG8A 2M9NA 4X4OA 3MR3A 4B9NA 4KLIA 1ZQSA 1AROP 2JEFA 9ICHA 2ZH3A 2F1HA 3FDSA 3JPRA 4NKUA 4RT3A 3V7LA 1ZQMA 4QZHA 1QSYA 1MIYA 4F5QA 2AJQA 1RZTA 8ICQA 4Q43A 4RNOA 4B9UA 3N97B 4IQWA 4KLLA 4PHDA 9ICEA 3JPQA 3EYZA 5F9LA 4DQQA 1S10A 5IIKA 4ELVA 2IMWP 3ISBA 4O3RA 5EWFA 2Q66A 4F92B 4XQ7A 3KTQA 3RRHA 1NKCA 3ZDEA 3OVBA 5J0WA 4QZFA 5DBAA 5J29A 9ICIA 3UQ0A 1JMSA 3B0XA 5KFRA 5KT6A 4BDPA 4RQ0A 5EWGA 2XGPA 3LWLA 2ASLA 2BKEA 2HHPA 3H37A 3MFIA 1V4AA 5DECA 5KT2A 4O5EA 4DL5A 1U48A 3C2KA 1JIHA 4RNNA 4DQSA 1KSPA 2R8GA 2HHTA 5J2JA 5DG7A 5KG5A 5HMMA 2ZJAA 4RUCA 4F5NA 4KLJA 4C8LA 5J2BA 3PR4A 1RYRA 4BGDA 5IIOA 2W9CA 8ICLA 5HR9A 4Z6FA 4RT2A 2HHUA 4I2FA 3GV7B 4NM2A 3RR7A 1ZQOA 4ATBA 4FHWA 4ECXA 4R8UB 4M9LA 4MEYA 5D4BA 2UVWA 5DQGA 9ICKA 5KFQA 2B21A 5CJ7A 1JAJA 4AT9B 3RJHA 4O5CA 3WFPA 4PGXA 3OJUA 3GIIA 4UBBA 4PHAA 4GLXA 3E2EA 3TQ1A 4IQTA 1UEVA 4TURA 2AGOA 3MFHA 2C22A 1NK5A 2ID1A 9ICBA 3ETLA 7ICRA 5L9XA 3SZ2A 1TK0A 2DPJA 2ISOA 4EEYA 4TUQA 1RXVA 5KG7A 2HVHA 4RWNA 9ICUA 2A1JB 5KFBA 5J2FA 4M6WA 3ZDBA 4LVSA 1S0VA 1BPEA 4O3SA 2ASJA 4Z6CA 5J0UA 3UPQA 1TFYA 4QWCA 5KFUA 1JQRA 3HT3A 2ZUCA 5IIIA 4PPXA 4RQ8A 3ZD9A 2LYHA 4DOBA 5KG4A 4R66A 3SI8A 4DSLA 1L3TA 4I2IA 3EZ5A 4DO9A 4I2DA 7ICGA 4NKTA 1QSLA 1T7PA 2BCSA 3V6JA 4FHYA 1ZYQA 3MR2A 1L5UA 8ICZA 3G6VA 1COOA 2AGPA 3H4BA 7ICMA 1ZQAA 9ICNA 2ZH5A 8ICSA 4J9LA 2BHNA 1BNOA 2ZH1A 4J9QA 1R8AA 3OV7A 4BWMA 4R63A 5D49A 1ZQRA 3T5HA 3LDAA 1ZQVA 4DF4A 2DR8A 4R8UA 3OJSA 3V7KA 8ICYA 1KTQA 5DG9A 4F4YA 1MQ3A 1LB2B 5DQHA 2PFPA 2ASDA 2M2WA 2WTFA 3MDCA 3LWMA 3ORYA 4DL7A 3RH5A 4EBCA 4RQ5A 1BVSA 4DFKA 3Q8KA 3HJ1A 3TAPA 1UA0A 1NKBA 5HREA 3GILA 8ICBA 1RXWA 1JX4A 4Z6DA 2XY6A 1L3SA 3JPNA 4F3OA 2HHVA 3T3FA 2BQ3A 3OSPA 1IM4A 4O5KA 3C23A 2BR0A 5J0XA 1NJWA 4M04A 3QZ7A 4I2GA 5KT5A 1ZQJA 1CEZA 2O5AA 1SL2A 1FA0A 4WC1A 2W8KA 4ECSA 2ZH2A 4RQ2A 1U4BA 3V72A 4MFFA 1Z00B 2NRXA 4RNMA 3GQCA 4DFJA 4MF2A 3TAQA 2ZUDA 4QZEA 4FS1A 3PX4A 1T8EA 2FPMA 2FLPA 3AQMA 8ICPA 2ZHBA 2XO7A 5KG0A 4RQ1A 1BPDA 4UAWA 2PFQA 4DFPA 3RJIA 3HWTA 5KT4A 1XSNA 2I9GA 5J2AA 5J2CA 3SV3A 9ICCA 2BCRA 2ZH7A 1JXEA 1ZQFA 2HHWA 3G6XA 4QWDA 4YMNA 2BGWA 2FLLA 4FHVA 8ICTA 4IRDA 2AU0A 4P4MA 1L3UA 4YXMA 1NJXA 2Q0ZX 4XA5A 4FBTA 1ZQDA 5HHHA 2BQUA 7ICTA 2W9CB 2ZJ5A 4O3NA 4RWPA 3SYZA 3C2LA 4J9SA 1JN3A 1ZQYA 4FH5A 4JV1A 4ATBB 4ED8A 2ISPA 4M2YA 4WC5A 4R64A 2ZH6A 4RPYA 3H4DA 3GIJA 3NGDA 1R8BA 3EW9A 3PO5A 2PI4A 4QZBA 1S0MA 1WOTA 4TQSA 1C7YA 4RQ6A 4QZGA 4J9KA 4KN7A 1NOMA 3PW5A 2ATLA 2Y1JA 2BE3A 9ICJA 3BDPA 5KFWA 8ICUA 5HC9A 4KTQA 1BPYA 7ICOA 1KFDA 4IRCA 3WFRE 4WC0A 4AT8A 2BQRA 4ED6A 4CCHA 3RRGA 4RUAA 8ICFA 1A77A 1TK5A 1IXRA 4EZ6A 2ZTDA 3JPPA 4M6WB 4F5RA 4M9GA 4I2JA 4IR9A 5C5JA 5J0PA 1Z00A 1KEJA 4QZIA 4GXIA 3V6KA 1T4GA 4ELTA 4ED0A 5KFGA 2ZH9A 3JPOA 3WFOA 3H38A 5KFPA 5HRLA 7ICQA 3RB4A 3Q8QB 4I27A 2RFFA 4NLKA 1BGXT 1MC8A 2RDJA 3C5GA 1NJZA 4GC6A 7ICUA 2XCPA 5KTQA 3UPSA 3UXOA 4F4WA 2FPLA 4MF8A 3C2MA 1KRPA 3LK9A 2ALZA 3IHQB 2ZH8A 2PFOA 3ZDCA 3T5KA 2ZUBA 5CWRA 4M9JA 2ZJ8A 5J2KA 3HPOA 5DB6A 1NK8A 2FMPA 4I2AA 2P6UA 1ZQHA 3MR6A 4DSEA 2XC9A 4KLOA 4E80A 2H5XA 2VA8A 4RPZA 4B9SA 2IBKA 3RJEA 4C8NA 2C2EA 2KFNA 1ZJMA 1UT5A 1SKWA 3AQNA 3OVAA 2HW3A 5CP2A 2GWSA 4ECUA 4E8FA 3BQ2A 4F50A 4F5OA 3KHLA 4UB2A 3V6HA 5KG1A 4UB5A 3H8WA 4YXJA 4KLDA 3OHAA 4DSIA 3BQTA 4O3PA 5KFFA 4O3OA 5J0RA 3KHHA 3RR8A 4IR1A 2DVIA 4QZCA 4ECYA 1EXNA 1KDHA 4F5PA 5KFKA 1ZQPA 1SKSA 4YG2A 3UXNA 1R89A 8ICKA 4DFMA 4AT7B 4FS2A 3PMNA 4EBJA 4YN4A 8ICXA 4X4SA 2ZTCA 4NLNA 4WC7A 4JK1A 5KFCA 1S0NA 1KFSA 4DS5A 4RWQA 4UAZA 4DQIA 4KLSA 4KLTA 4WC2A 4DLGA 9ICTA 4RQ3A 2W8LA 4QW8A 1SZPA 5F9NA 1PZNA 4DL2A 5J0YA 3H40A 4DL4A 4O9MA 1S77D 8ICVA 9ICAA 8ICCA 3GV5B 1XWLA 4EYHB 3H8JA 3OHBA 5J2HA 4DLEA 5IINA 4FHPA 1A76A 4Q45A 2PXIA 7ICNA 1WCLA 5KT7A 3QZ8A 5KFAA 2HHSA 5J2IA 3TARA 1SL0A 4M9NA 4E7XA 1RPLA 1TFRA 4TQRA 4DSJA 4RQ4A 4J9PA 4PHPA 8ICRA 1MIVA 3H7IA 4YVZA 3RH6A 4G3IA 1BNPA 1ZQTA 2DR9A 2KZ3A 1S76D 3PW0A 5DGAA 2J6UA 4B9TA 3C18A 4QZAA 3MR5A 8ICEA 3NTUA 1V9PA 1NZPA 4X0BA 4TUPA 4JV0A 5KFJA 1ZQBA 4YMMA 5F2VO 3WFSC 3GIMA 9ICLA 3GIKA 1XC9A 2IA6A 4XQ8A 9ICRA 2I1QA 5KG2A 2UVVA 3H39A 4NXZA 1HJPA 4ELUA 5HRIA 4YD2A 1X9WA 4I29A 4KLUA 3BQ1A 2KZZA 8ICAA 3JYYA 3GDXA 5HRFA 4WCWA 3H8SA 3PNCA 1N48A 3UQ2A 4P4OA 9ICGA 4X4TA 5BOLA 1NK6A 2BPFA 4KLQA 7ICEA 4IQUA 4MFAA 1OU5A 2HHQA 3AQKA 4AT8B 2BCUA 3JZ0A 7ICKA 7ICJA 3AQLA 4P4PA 2VA2A 1HUOA 4AT7A 4EYIB 3GFKB 9ICOA 5CA7A 4BWJA 4M9HA 4ECVA 1TV9A 4DOCA 1KFTA 2F1JA 1S0OA 1TAUA 1QTMA 1ZQZA 1XS9D 2R8KA 1ZQXA 5J0TA 4YFKA 1BPXA 1ZQWA 5L1KA 4FO6A 1UEUA 1UT8A 4F91B 5KFHA 3RBDA 3C66A 4FH3A 1WCNA 4QZDA 4M0AA 3RAQA 3RB3A 4P2HA 4XRHA 1L3VA 2R8JA 4NLGA 1PX5A 4WBYA 3OUYA 1ZQCA 2P6RA 4KLGA 2JZBB 3TFRA 2KTQA 1RYSA 1XU4A 3K4GA 5KG6A 3HW8A 3RJJA 3H3AA 3T5LA 2XGQA 3Q8MA 5BOMA 5HNKA 1ZQEA 4F4KA 1DGSA 9ICXA 2ZH4A 5DB8A 3C5FA 4BXOA 3PW4A 1MIWA 3B0YA 3RAXA 4DEZA 4JV2A 4X0AA 1ZQLA 3ZDDA 4I28A 2VANA 4I2HA 3OSNA 5KFLA 5KFZA 5L1JA 2BCVA 3LQCB 5KFEA 4EP7A 1H38A 3RJFA 1NK4A 3OGUA 3QEAZ 1UA1A 8ICOA 4YCXA 9ICQA 4DL6A 4WBZA 1TFWA 4DSKA 5KFNA 4TUSA 8ICIA 5J0QA 5J2EA 4ED7A 4KLMA 4YR3A 1X9SA 1XSPA 1XSLA 2IHNA 3G6YA 4UD4A 4LT6A 3RJKA 1ZQUA 5KFSA 4F2SA 2DR5A 2DR7A 3IM1A 4FBUA 2JEIA 2MUTA 4QWBA 1U49A 4RZRA 2FPKA 3MGIA 2UVRA 4C8OA 5DEDA 4YQWA 2DFLA 4J9MA 2KZMA 3PY8A 1XO1A 1VFGA 5EOZA 4NM1A 4B9VA 4C8MA 4PH5A 3BQ0A 2PBEA 4YR2A 9ICMA 7ICFA 2NRZA 3Q8LA 3RJGA 4ECWA 1ZJNA 2M2TA 4QWAA 4ECTA 3Q8SB 4I2CA 1MSWD 7ICHA 4KMUA 2HVIA 2DRBA 1Q79A 4ED1A 5L1IA 3RH4A 1ZETA 4Q8EA 2JZBA 3TI0A 1B22A 2F1IA 5DGBA 1CUKA 3ISDA 4J9OA 1QSSA 1NJYA 1TKDA 4UB1A 9ICFA 4UD5A 1U47A 4F2RA 4JWNA 3FYHA 7ICVA 4J9RA 1SL1A 3M9MB 2HHXA 4K4GA 4ZH4A 4DQPA 8ICHA 2RDIA 3Q8PB 2NRKA 3THVA 1ZQKA 3RB0A 1T3NA 2KN7A 5KG3A 1DK3A 2O1PA 2P66A 2V9WA 1KLNA 2V4RA 8ICJA 3KHGA 3PX6A 5KFMA 4GXKA 5HRKA 1Q78A 5KFTA 4WC4A 1U9LA 4IRKA 3ZD8A 4X5VA 2XCAA 4FHXA 3OVSA 4QWEA 4QZ9A 5KT3A 4M47A 4MFCA 2V4QA 5D46A 3RB6A 2BPGA 1BPBA 5DBCA 4X4QA 3TFSA 1YLQA 3HIYA 4NY8A 3PR5B 4X4PA 1Z3EB 5KFXA 1NO5A 4LZDA 4F4ZA 2NRWA 2AGQA 4UB4A 2JEJA 2ZTEA 5KFOA 1X2IA 5KFYA 2DRAA 1S97A 9ICPA 1B43A 3M8SA 1NK7A 4RU9A 4UBCA 5CHGA 1TVAA 5KFVA 4I2BA 4I2EA 3M9NB 2PI5A 2M2UA 3OUYB 5J0OA 4DWIA 3Q8RB 3MBYA 2C2RA 3RTVA 1U45A 9ICSA 2AQ4A 2NRVA 5DB9A 5HMLA 5HP4A 2FMQA 7ICIA 4Q8FA 3V7JA 5DDMA 4PGQA 2DPIA 4BXOB 7ICPA 2ZHAA 4EBEA 1Y88A 5J2DA 1N56A 1ZQQA 5DKWA 1NK9A 4GXJA 4YD1A 2BPCA 3PW2A 4KLFA 5IIMA 1D8LA 1TAQA 2KP7A 2Y1IA 4X4VA 2NRTA 4Q44A 2W9BB 5DDYA 3HX0A 4YR0A 4J9NA 1LV5A 4B9LA 4S3NA 4F8RA 2MAXA 5TZVA 4IQVA 1NK0A 3WFQE 4UQGA 3AUOA 1HUZA 4F93B 5CB1A 4RWOA 3PW7A 3ISCA 4ED3A 4O3QA 3KHRA 4RQ7A 1D9DA 4B9MA 1QLNA 8ICNA 1R8CA 4JWMA 2MUTB 4KITB 4UB3A 4F4XA 1S9FA 1X9MA 2VA3A 1DK2A 1ZQGA 5JUMA 3RBEA 4MEXA 5DLFA 7ICLA 1K1SA 4JUZA 4O0IA 4NLZA 1F5AA 4AT9A 3PX0A 4K4HA 4Z6EA 1DOQA 3AU6A 1D9FA 2M2VA 5HRDA 4M5DA 9ICWA 4X4NA 4K4IA 2R8IA 8ICGA 5DQIA 4X4UA 1JXLA 2FMSA 4DSFA 3C1YA 3C21A 9ICVA 1ZQIA 3EPIA 5EWEA 4ECQA 2JEGA 1KNYA 3NYBA 2FLNA 2BDPA 2KFZA 4WC6A 3PV8A 1SKRA 3SV4A 4HYKA 3QEBZ 3PO4A 3GV8B 4DOAA 1D8YA 3JPTA 4DL3A 2PFNA 2A1JA 5J2GA 4KLHA 3T5JA 3HP6A 3MGHA 5HHIA 1NKEA 4QW9A 8ICMA 5KFIA 4KLEA 3TANA 3MABA 3UXPA 2IHMA 2J6SA 5HRBA 4EBKA 5DB7A 4ECRA 2XY5A 5HRHA 5HRGA 5DBBA 4DQRA 1ZQNA 4PGYA 2C2DA 2W9BA 3PMLA 3L9DA 4X4RA 2XY7A 3JPSA 1VJ7A 5KFDA 3EPGA 4DS4A 3PVXA 2C28A 5IIJA 4C8KA 2UVUA 3M9OB 4RPXA 4EZ9A 1TK8A 4KN4A 2BCQA 7ICSA 4EBDA 5L1LA 4ED2A 4WC3A 3HJ4A 4YMOA 4LZGA 3QE9Y 4UAYA 5BPCA 4YP3A 2W9AA 3N4MB 2AQ0A 3MDAA 2J6TA 5DLGA 3BJYA 2R8HA 1BPZA 3ZDAA 8ICWA 2W9MA 5CR0A 3M8RA 4QZ8A 5DG8A 4PHEA 2OWOA 3EWAA 4XUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU2 A;  4R65 A;  3C1Z A;  4GC7 A;  5IIL A;  3K75 D;  4ECZ A;  1K1Q A;  4DF8 A;  4E0D A;  1MQ2 A;  5J0S A;  1UET A;  4IG8 A;  2M9N A;  4X4O A;  3MR3 A;  4B9N A;  4KLI A;  1ZQS A;  1ARO P;  2JEF A;  9ICH A;  2ZH3 A;  2F1H A;  3FDS A;  3JPR A;  4NKU A;  4RT3 A;  3V7L A;  1ZQM A;  4QZH A;  1QSY A;  1MIY A;  4F5Q A;  2AJQ A;  1RZT A;  8ICQ A;  4Q43 A;  4RNO A;  4B9U A;  3N97 B;  4IQW A;  4KLL A;  4PHD A;  9ICE A;  3JPQ A;  3EYZ A;  5F9L A;  4DQQ A;  1S10 A;  5IIK A;  4ELV A;  2IMW P;  3ISB A;  4O3R A;  5EWF A;  2Q66 A;  4F92 B;  4XQ7 A;  3KTQ A;  3RRH A;  1NKC A;  3ZDE A;  3OVB A;  5J0W A;  4QZF A;  5DBA A;  5J29 A;  9ICI A;  3UQ0 A;  1JMS A;  3B0X A;  5KFR A;  5KT6 A;  4BDP A;  4RQ0 A;  5EWG A;  2XGP A;  3LWL A;  2ASL A;  2BKE A;  2HHP A;  3H37 A;  3MFI A;  1V4A A;  5DEC A;  5KT2 A;  4O5E A;  4DL5 A;  1U48 A;  3C2K A;  1JIH A;  4RNN A;  4DQS A;  1KSP A;  2R8G A;  2HHT A;  5J2J A;  5DG7 A;  5KG5 A;  5HMM A;  2ZJA A;  4RUC A;  4F5N A;  4KLJ A;  4C8L A;  5J2B A;  3PR4 A;  1RYR A;  4BGD A;  5IIO A;  2W9C A;  8ICL A;  5HR9 A;  4Z6F A;  4RT2 A;  2HHU A;  4I2F A;  3GV7 B;  4NM2 A;  3RR7 A;  1ZQO A;  4ATB A;  4FHW A;  4ECX A;  4R8U B;  4M9L A;  4MEY A;  5D4B A;  2UVW A;  5DQG A;  9ICK A;  5KFQ A;  2B21 A;  5CJ7 A;  1JAJ A;  4AT9 B;  3RJH A;  4O5C A;  3WFP A;  4PGX A;  3OJU A;  3GII A;  4UBB A;  4PHA A;  4GLX A;  3E2E A;  3TQ1 A;  4IQT A;  1UEV A;  4TUR A;  2AGO A;  3MFH A;  2C22 A;  1NK5 A;  2ID1 A;  9ICB A;  3ETL A;  7ICR A;  5L9X A;  3SZ2 A;  1TK0 A;  2DPJ A;  2ISO A;  4EEY A;  4TUQ A;  1RXV A;  5KG7 A;  2HVH A;  4RWN A;  9ICU A;  2A1J B;  5KFB A;  5J2F A;  4M6W A;  3ZDB A;  4LVS A;  1S0V A;  1BPE A;  4O3S A;  2ASJ A;  4Z6C A;  5J0U A;  3UPQ A;  1TFY A;  4QWC A;  5KFU A;  1JQR A;  3HT3 A;  2ZUC A;  5III A;  4PPX A;  4RQ8 A;  3ZD9 A;  2LYH A;  4DOB A;  5KG4 A;  4R66 A;  3SI8 A;  4DSL A;  1L3T A;  4I2I A;  3EZ5 A;  4DO9 A;  4I2D A;  7ICG A;  4NKT A;  1QSL A;  1T7P A;  2BCS A;  3V6J A;  4FHY A;  1ZYQ A;  3MR2 A;  1L5U A;  8ICZ A;  3G6V A;  1COO A;  2AGP A;  3H4B A;  7ICM A;  1ZQA A;  9ICN A;  2ZH5 A;  8ICS A;  4J9L A;  2BHN A;  1BNO A;  2ZH1 A;  4J9Q A;  1R8A A;  3OV7 A;  4BWM A;  4R63 A;  5D49 A;  1ZQR A;  3T5H A;  3LDA A;  1ZQV A;  4DF4 A;  2DR8 A;  4R8U A;  3OJS A;  3V7K A;  8ICY A;  1KTQ A;  5DG9 A;  4F4Y A;  1MQ3 A;  1LB2 B;  5DQH A;  2PFP A;  2ASD A;  2M2W A;  2WTF A;  3MDC A;  3LWM A;  3ORY A;  4DL7 A;  3RH5 A;  4EBC A;  4RQ5 A;  1BVS A;  4DFK A;  3Q8K A;  3HJ1 A;  3TAP A;  1UA0 A;  1NKB A;  5HRE A;  3GIL A;  8ICB A;  1RXW A;  1JX4 A;  4Z6D A;  2XY6 A;  1L3S A;  3JPN A;  4F3O A;  2HHV A;  3T3F A;  2BQ3 A;  3OSP A;  1IM4 A;  4O5K A;  3C23 A;  2BR0 A;  5J0X A;  1NJW A;  4M04 A;  3QZ7 A;  4I2G A;  5KT5 A;  1ZQJ A;  1CEZ A;  2O5A A;  1SL2 A;  1FA0 A;  4WC1 A;  2W8K A;  4ECS A;  2ZH2 A;  4RQ2 A;  1U4B A;  3V72 A;  4MFF A;  1Z00 B;  2NRX A;  4RNM A;  3GQC A;  4DFJ A;  4MF2 A;  3TAQ A;  2ZUD A;  4QZE A;  4FS1 A;  3PX4 A;  1T8E A;  2FPM A;  2FLP A;  3AQM A;  8ICP A;  2ZHB A;  2XO7 A;  5KG0 A;  4RQ1 A;  1BPD A;  4UAW A;  2PFQ A;  4DFP A;  3RJI A;  3HWT A;  5KT4 A;  1XSN A;  2I9G A;  5J2A A;  5J2C A;  3SV3 A;  9ICC A;  2BCR A;  2ZH7 A;  1JXE A;  1ZQF A;  2HHW A;  3G6X A;  4QWD A;  4YMN A;  2BGW A;  2FLL A;  4FHV A;  8ICT A;  4IRD A;  2AU0 A;  4P4M A;  1L3U A;  4YXM A;  1NJX A;  2Q0Z X;  4XA5 A;  4FBT A;  1ZQD A;  5HHH A;  2BQU A;  7ICT A;  2W9C B;  2ZJ5 A;  4O3N A;  4RWP A;  3SYZ A;  3C2L A;  4J9S A;  1JN3 A;  1ZQY A;  4FH5 A;  4JV1 A;  4ATB B;  4ED8 A;  2ISP A;  4M2Y A;  4WC5 A;  4R64 A;  2ZH6 A;  4RPY A;  3H4D A;  3GIJ A;  3NGD A;  1R8B A;  3EW9 A;  3PO5 A;  2PI4 A;  4QZB A;  1S0M A;  1WOT A;  4TQS A;  1C7Y A;  4RQ6 A;  4QZG A;  4J9K A;  4KN7 A;  1NOM A;  3PW5 A;  2ATL A;  2Y1J A;  2BE3 A;  9ICJ A;  3BDP A;  5KFW A;  8ICU A;  5HC9 A;  4KTQ A;  1BPY A;  7ICO A;  1KFD A;  4IRC A;  3WFR E;  4WC0 A;  4AT8 A;  2BQR A;  4ED6 A;  4CCH A;  3RRG A;  4RUA A;  8ICF A;  1A77 A;  1TK5 A;  1IXR A;  4EZ6 A;  2ZTD A;  3JPP A;  4M6W B;  4F5R A;  4M9G A;  4I2J A;  4IR9 A;  5C5J A;  5J0P A;  1Z00 A;  1KEJ A;  4QZI A;  4GXI A;  3V6K A;  1T4G A;  4ELT A;  4ED0 A;  5KFG A;  2ZH9 A;  3JPO A;  3WFO A;  3H38 A;  5KFP A;  5HRL A;  7ICQ A;  3RB4 A;  3Q8Q B;  4I27 A;  2RFF A;  4NLK A;  1BGX T;  1MC8 A;  2RDJ A;  3C5G A;  1NJZ A;  4GC6 A;  7ICU A;  2XCP A;  5KTQ A;  3UPS A;  3UXO A;  4F4W A;  2FPL A;  4MF8 A;  3C2M A;  1KRP A;  3LK9 A;  2ALZ A;  3IHQ B;  2ZH8 A;  2PFO A;  3ZDC A;  3T5K A;  2ZUB A;  5CWR A;  4M9J A;  2ZJ8 A;  5J2K A;  3HPO A;  5DB6 A;  1NK8 A;  2FMP A;  4I2A A;  2P6U A;  1ZQH A;  3MR6 A;  4DSE A;  2XC9 A;  4KLO A;  4E80 A;  2H5X A;  2VA8 A;  4RPZ A;  4B9S A;  2IBK A;  3RJE A;  4C8N A;  2C2E A;  2KFN A;  1ZJM A;  1UT5 A;  1SKW A;  3AQN A;  3OVA A;  2HW3 A;  5CP2 A;  2GWS A;  4ECU A;  4E8F A;  3BQ2 A;  4F50 A;  4F5O A;  3KHL A;  4UB2 A;  3V6H A;  5KG1 A;  4UB5 A;  3H8W A;  4YXJ A;  4KLD A;  3OHA A;  4DSI A;  3BQT A;  4O3P A;  5KFF A;  4O3O A;  5J0R A;  3KHH A;  3RR8 A;  4IR1 A;  2DVI A;  4QZC A;  4ECY A;  1EXN A;  1KDH A;  4F5P A;  5KFK A;  1ZQP A;  1SKS A;  4YG2 A;  3UXN A;  1R89 A;  8ICK A;  4DFM A;  4AT7 B;  4FS2 A;  3PMN A;  4EBJ A;  4YN4 A;  8ICX A;  4X4S A;  2ZTC A;  4NLN A;  4WC7 A;  4JK1 A;  5KFC A;  1S0N A;  1KFS A;  4DS5 A;  4RWQ A;  4UAZ A;  4DQI A;  4KLS A;  4KLT A;  4WC2 A;  4DLG A;  9ICT A;  4RQ3 A;  2W8L A;  4QW8 A;  1SZP A;  5F9N A;  1PZN A;  4DL2 A;  5J0Y A;  3H40 A;  4DL4 A;  4O9M A;  1S77 D;  8ICV A;  9ICA A;  8ICC A;  3GV5 B;  1XWL A;  4EYH B;  3H8J A;  3OHB A;  5J2H A;  4DLE A;  5IIN A;  4FHP A;  1A76 A;  4Q45 A;  2PXI A;  7ICN A;  1WCL A;  5KT7 A;  3QZ8 A;  5KFA A;  2HHS A;  5J2I A;  3TAR A;  1SL0 A;  4M9N A;  4E7X A;  1RPL A;  1TFR A;  4TQR A;  4DSJ A;  4RQ4 A;  4J9P A;  4PHP A;  8ICR A;  1MIV A;  3H7I A;  4YVZ A;  3RH6 A;  4G3I A;  1BNP A;  1ZQT A;  2DR9 A;  2KZ3 A;  1S76 D;  3PW0 A;  5DGA A;  2J6U A;  4B9T A;  3C18 A;  4QZA A;  3MR5 A;  8ICE A;  3NTU A;  1V9P A;  1NZP A;  4X0B A;  4TUP A;  4JV0 A;  5KFJ A;  1ZQB A;  4YMM A;  5F2V O;  3WFS C;  3GIM A;  9ICL A;  3GIK A;  1XC9 A;  2IA6 A;  4XQ8 A;  9ICR A;  2I1Q A;  5KG2 A;  2UVV A;  3H39 A;  4NXZ A;  1HJP A;  4ELU A;  5HRI A;  4YD2 A;  1X9W A;  4I29 A;  4KLU A;  3BQ1 A;  2KZZ A;  8ICA A;  3JYY A;  3GDX A;  5HRF A;  4WCW A;  3H8S A;  3PNC A;  1N48 A;  3UQ2 A;  4P4O A;  9ICG A;  4X4T A;  5BOL A;  1NK6 A;  2BPF A;  4KLQ A;  7ICE A;  4IQU A;  4MFA A;  1OU5 A;  2HHQ A;  3AQK A;  4AT8 B;  2BCU A;  3JZ0 A;  7ICK A;  7ICJ A;  3AQL A;  4P4P A;  2VA2 A;  1HUO A;  4AT7 A;  4EYI B;  3GFK B;  9ICO A;  5CA7 A;  4BWJ A;  4M9H A;  4ECV A;  1TV9 A;  4DOC A;  1KFT A;  2F1J A;  1S0O A;  1TAU A;  1QTM A;  1ZQZ A;  1XS9 D;  2R8K A;  1ZQX A;  5J0T A;  4YFK A;  1BPX A;  1ZQW A;  5L1K A;  4FO6 A;  1UEU A;  1UT8 A;  4F91 B;  5KFH A;  3RBD A;  3C66 A;  4FH3 A;  1WCN A;  4QZD A;  4M0A A;  3RAQ A;  3RB3 A;  4P2H A;  4XRH A;  1L3V A;  2R8J A;  4NLG A;  1PX5 A;  4WBY A;  3OUY A;  1ZQC A;  2P6R A;  4KLG A;  2JZB B;  3TFR A;  2KTQ A;  1RYS A;  1XU4 A;  3K4G A;  5KG6 A;  3HW8 A;  3RJJ A;  3H3A A;  3T5L A;  2XGQ A;  3Q8M A;  5BOM A;  5HNK A;  1ZQE A;  4F4K A;  1DGS A;  9ICX A;  2ZH4 A;  5DB8 A;  3C5F A;  4BXO A;  3PW4 A;  1MIW A;  3B0Y A;  3RAX A;  4DEZ A;  4JV2 A;  4X0A A;  1ZQL A;  3ZDD A;  4I28 A;  2VAN A;  4I2H A;  3OSN A;  5KFL A;  5KFZ A;  5L1J A;  2BCV A;  3LQC B;  5KFE A;  4EP7 A;  1H38 A;  3RJF A;  1NK4 A;  3OGU A;  3QEA Z;  1UA1 A;  8ICO A;  4YCX A;  9ICQ A;  4DL6 A;  4WBZ A;  1TFW A;  4DSK A;  5KFN A;  4TUS A;  8ICI A;  5J0Q A;  5J2E A;  4ED7 A;  4KLM A;  4YR3 A;  1X9S A;  1XSP A;  1XSL A;  2IHN A;  3G6Y A;  4UD4 A;  4LT6 A;  3RJK A;  1ZQU A;  5KFS A;  4F2S A;  2DR5 A;  2DR7 A;  3IM1 A;  4FBU A;  2JEI A;  2MUT A;  4QWB A;  1U49 A;  4RZR A;  2FPK A;  3MGI A;  2UVR A;  4C8O A;  5DED A;  4YQW A;  2DFL A;  4J9M A;  2KZM A;  3PY8 A;  1XO1 A;  1VFG A;  5EOZ A;  4NM1 A;  4B9V A;  4C8M A;  4PH5 A;  3BQ0 A;  2PBE A;  4YR2 A;  9ICM A;  7ICF A;  2NRZ A;  3Q8L A;  3RJG A;  4ECW A;  1ZJN A;  2M2T A;  4QWA A;  4ECT A;  3Q8S B;  4I2C A;  1MSW D;  7ICH A;  4KMU A;  2HVI A;  2DRB A;  1Q79 A;  4ED1 A;  5L1I A;  3RH4 A;  1ZET A;  4Q8E A;  2JZB A;  3TI0 A;  1B22 A;  2F1I A;  5DGB A;  1CUK A;  3ISD A;  4J9O A;  1QSS A;  1NJY A;  1TKD A;  4UB1 A;  9ICF A;  4UD5 A;  1U47 A;  4F2R A;  4JWN A;  3FYH A;  7ICV A;  4J9R A;  1SL1 A;  3M9M B;  2HHX A;  4K4G A;  4ZH4 A;  4DQP A;  8ICH A;  2RDI A;  3Q8P B;  2NRK A;  3THV A;  1ZQK A;  3RB0 A;  1T3N A;  2KN7 A;  5KG3 A;  1DK3 A;  2O1P A;  2P66 A;  2V9W A;  1KLN A;  2V4R A;  8ICJ A;  3KHG A;  3PX6 A;  5KFM A;  4GXK A;  5HRK A;  1Q78 A;  5KFT A;  4WC4 A;  1U9L A;  4IRK A;  3ZD8 A;  4X5V A;  2XCA A;  4FHX A;  3OVS A;  4QWE A;  4QZ9 A;  5KT3 A;  4M47 A;  4MFC A;  2V4Q A;  5D46 A;  3RB6 A;  2BPG A;  1BPB A;  5DBC A;  4X4Q A;  3TFS A;  1YLQ A;  3HIY A;  4NY8 A;  3PR5 B;  4X4P A;  1Z3E B;  5KFX A;  1NO5 A;  4LZD A;  4F4Z A;  2NRW A;  2AGQ A;  4UB4 A;  2JEJ A;  2ZTE A;  5KFO A;  1X2I A;  5KFY A;  2DRA A;  1S97 A;  9ICP A;  1B43 A;  3M8S A;  1NK7 A;  4RU9 A;  4UBC A;  5CHG A;  1TVA A;  5KFV A;  4I2B A;  4I2E A;  3M9N B;  2PI5 A;  2M2U A;  3OUY B;  5J0O A;  4DWI A;  3Q8R B;  3MBY A;  2C2R A;  3RTV A;  1U45 A;  9ICS A;  2AQ4 A;  2NRV A;  5DB9 A;  5HML A;  5HP4 A;  2FMQ A;  7ICI A;  4Q8F A;  3V7J A;  5DDM A;  4PGQ A;  2DPI A;  4BXO B;  7ICP A;  2ZHA A;  4EBE A;  1Y88 A;  5J2D A;  1N56 A;  1ZQQ A;  5DKW A;  1NK9 A;  4GXJ A;  4YD1 A;  2BPC A;  3PW2 A;  4KLF A;  5IIM A;  1D8L A;  1TAQ A;  2KP7 A;  2Y1I A;  4X4V A;  2NRT A;  4Q44 A;  2W9B B;  5DDY A;  3HX0 A;  4YR0 A;  4J9N A;  1LV5 A;  4B9L A;  4S3N A;  4F8R A;  2MAX A;  5TZV A;  4IQV A;  1NK0 A;  3WFQ E;  4UQG A;  3AUO A;  1HUZ A;  4F93 B;  5CB1 A;  4RWO A;  3PW7 A;  3ISC A;  4ED3 A;  4O3Q A;  3KHR A;  4RQ7 A;  1D9D A;  4B9M A;  1QLN A;  8ICN A;  1R8C A;  4JWM A;  2MUT B;  4KIT B;  4UB3 A;  4F4X A;  1S9F A;  1X9M A;  2VA3 A;  1DK2 A;  1ZQG A;  5JUM A;  3RBE A;  4MEX A;  5DLF A;  7ICL A;  1K1S A;  4JUZ A;  4O0I A;  4NLZ A;  1F5A A;  4AT9 A;  3PX0 A;  4K4H A;  4Z6E A;  1DOQ A;  3AU6 A;  1D9F A;  2M2V A;  5HRD A;  4M5D A;  9ICW A;  4X4N A;  4K4I A;  2R8I A;  8ICG A;  5DQI A;  4X4U A;  1JXL A;  2FMS A;  4DSF A;  3C1Y A;  3C21 A;  9ICV A;  1ZQI A;  3EPI A;  5EWE A;  4ECQ A;  2JEG A;  1KNY A;  3NYB A;  2FLN A;  2BDP A;  2KFZ A;  4WC6 A;  3PV8 A;  1SKR A;  3SV4 A;  4HYK A;  3QEB Z;  3PO4 A;  3GV8 B;  4DOA A;  1D8Y A;  3JPT A;  4DL3 A;  2PFN A;  2A1J A;  5J2G A;  4KLH A;  3T5J A;  3HP6 A;  3MGH A;  5HHI A;  1NKE A;  4QW9 A;  8ICM A;  5KFI A;  4KLE A;  3TAN A;  3MAB A;  3UXP A;  2IHM A;  2J6S A;  5HRB A;  4EBK A;  5DB7 A;  4ECR A;  2XY5 A;  5HRH A;  5HRG A;  5DBB A;  4DQR A;  1ZQN A;  4PGY A;  2C2D A;  2W9B A;  3PML A;  3L9D A;  4X4R A;  2XY7 A;  3JPS A;  1VJ7 A;  5KFD A;  3EPG A;  4DS4 A;  3PVX A;  2C28 A;  5IIJ A;  4C8K A;  2UVU A;  3M9O B;  4RPX A;  4EZ9 A;  1TK8 A;  4KN4 A;  2BCQ A;  7ICS A;  4EBD A;  5L1L A;  4ED2 A;  4WC3 A;  3HJ4 A;  4YMO A;  4LZG A;  3QE9 Y;  4UAY A;  5BPC A;  4YP3 A;  2W9A A;  3N4M B;  2AQ0 A;  3MDA A;  2J6T A;  5DLG A;  3BJY A;  2R8H A;  1BPZ A;  3ZDA A;  8ICW A;  2W9M A;  5CR0 A;  3M8R A;  4QZ8 A;  5DG8 A;  4PHE A;  2OWO A;  3EWA A;  4XUS A; 
#chains in the Genus database with same CATH topology
 4E0D A;  4C4T A;  4LJX A;  5J0S A;  3U26 A;  3MR3 A;  4B9N A;  5ALN A;  4KLI A;  3V7L A;  1KKX A;  4B6J A;  1Q8K A;  5AK3 A;  2I5H A;  3N97 B;  1Z19 A;  3MGV A;  9ICE A;  5F9L A;  4F92 B;  5J0W A;  5J29 A;  2YMP A;  5KT6 A;  2HHP A;  1V4A A;  4DL5 A;  1JIH A;  4DQS A;  1KSP A;  5ALQ A;  2R8G A;  2HHT A;  5J2J A;  3A0H U;  8ICT A;  4C8L A;  5J2B A;  3PR4 A;  2W9C A;  5HR9 A;  4RT2 A;  1ZQO A;  4ATB A;  4M9L A;  4MEY A;  5DQG A;  2B21 A;  3M7D A;  1O08 A;  3WU2 U;  3OJU A;  3GII A;  3TQ1 A;  2D3D A;  1UEV A;  2AGO A;  2I6X A;  9ICB A;  7ICR A;  5L9X A;  2HMX A;  3SZ2 A;  2ISO A;  4EEY A;  2YML A;  5ALT A;  5KG7 A;  4RWN A;  1SXD A;  5KFB A;  5J2F A;  4M6W A;  4LVS A;  1BPE A;  4O3S A;  5J0U A;  1TFY A;  3KKA C;  3E58 A;  3HT3 A;  2ZUC A;  2KG5 A;  2LYH A;  4R66 A;  5AKL A;  1L3T A;  4I2D A;  4FFD A;  3AN1 A;  7ICM A;  9ICN A;  4J9L A;  5ALK A;  2ZH1 A;  1R8A A;  3OV7 A;  3QUQ A;  4BWM A;  5D49 A;  2WF9 A;  1B0X A;  4UAT A;  1ZQR A;  3LDA A;  1ZQV A;  4DF4 A;  2KD1 A;  3V7K A;  1KTQ A;  2ASD A;  3ORY A;  1CI4 A;  5ALF A;  2H3Z A;  3GIL A;  2ZIX B;  2XY6 A;  2BQ3 A;  3F53 A;  3ER9 B;  3C23 A;  2O5A A;  2JRZ A;  1SL2 A;  3FAH A;  4RQ2 A;  3V72 A;  4RNM A;  4P0Q A;  2FLP A;  2XO7 A;  5GTI U;  1BPD A;  2PFQ A;  2LBO A;  3HWT A;  3CK6 A;  1PK1 B;  2KKP A;  4OAH A;  5AKY A;  2FLL A;  4FHV A;  1F5S A;  4IRD A;  4P4M A;  4YXM A;  5AI4 A;  2A19 A;  2Q0Z X;  7ICT A;  4BUG A;  4RWP A;  1RG6 A;  4JV1 A;  3D2S A;  2ISP A;  1GPJ A;  2W54 A;  5AI5 A;  2ZH6 A;  1OW5 A;  3NGD A;  1WOT A;  4QZB A;  2F8K A;  4OJ6 A;  3LVW A;  2KMD A;  2BE3 A;  9ICJ A;  5KFW A;  8ICU A;  1BPY A;  7ICO A;  3WFR E;  8ICF A;  4RUA A;  1TK5 A;  4F5R A;  3JPP A;  5C5J A;  5J0P A;  1N2X A;  4ELT A;  4ED0 A;  5KFG A;  3WFO A;  3H38 A;  2KVS A;  3F5A A;  7ICQ A;  2RFF A;  1YT3 A;  4GC6 A;  5AM0 A;  5ALR A;  5KTQ A;  1OXJ A;  2FPL A;  4MF8 A;  2E8O A;  2H3Q A;  3PSI A;  3LK9 A;  2ZH8 A;  4LEY A;  1Q46 A;  2ZUB A;  5CWR A;  2E1E A;  4KX5 A;  2W04 A;  2FMP A;  4I2A A;  3KZI U;  1PUZ A;  3MR6 A;  2XC9 A;  4E80 A;  4C8N A;  3OVA A;  2Y0S F;  2W3S A;  3V6H A;  1VDV A;  3H8W A;  4YXJ A;  4KLD A;  3OHA A;  5KFF A;  4O3P A;  4O3O A;  2DVI A;  2EH9 A;  4NL9 C;  4YG2 A;  3UXN A;  2M0N A;  3NS1 A;  4AT7 B;  4FS2 A;  3NVY A;  1WWU A;  1ZRM A;  2YQE A;  5KFC A;  5KL8 B;  4UAZ A;  2A1A A;  2W8L A;  4O9M A;  2HSZ A;  4FHP A;  3H8J A;  4Q45 A;  5KT7 A;  5KFA A;  4E7X A;  5JTG A;  1TFR A;  1DGJ A;  8ICR A;  3H7I A;  2LPE A;  1S76 D;  2EWR A;  5DGA A;  4US8 A;  4QZA A;  2ZIW B;  5AI6 A;  4JV0 A;  5KFJ A;  3GIM A;  2IA6 A;  1MN8 A;  2KZZ A;  3S6J A;  2A3V A;  3PNC A;  2FDR A;  1NK6 A;  5T14 A;  1QQ7 A;  7ICE A;  1SIJ A;  2O6K A;  4MFA A;  1OU5 A;  4AT8 B;  2BCU A;  1XNS A;  2VJ5 A;  4AT7 A;  3GFK B;  9ICO A;  4M9H A;  1KFT A;  1ZD3 A;  1QTM A;  3K7D A;  3NWI A;  2PKE A;  4YFK A;  1BPX A;  5L1K A;  3C28 A;  4QZD A;  4M0A A;  2G07 A;  1PX5 A;  4XRH A;  1L3V A;  1DXS A;  4KLG A;  5KG6 A;  1T94 A;  2XGQ A;  1ZQE A;  4N7R A;  2CPR A;  1DGS A;  2ZH4 A;  5AK5 A;  5ALO A;  1MIW A;  5F3X B;  4JV2 A;  5HR7 A;  3LQC B;  5KFE A;  1L7P A;  4UAV A;  3OGU A;  3AL0 B;  1X9S A;  1J97 A;  1XSL A;  2E3T A;  2IHN A;  4O69 A;  4LT6 A;  3UM9 A;  4JLZ A;  4OAG A;  2DR5 A;  3HJE A;  2MUT A;  4RZR A;  3MGI A;  5CFS A;  3AQF A;  1PVP A;  2KZM A;  3PY8 A;  2G06 A;  3M6Z A;  3Q8L A;  3RJG A;  4ECT A;  3Q8S B;  4KMU A;  2HVI A;  5L1I A;  1ZET A;  5CFT A;  2F1I A;  3I1Y A;  3B9J A;  3FYH A;  3QX7 A;  4C7Y A;  4J9R A;  8ICH A;  2RHF A;  1DK3 A;  1KLN A;  5JTI A;  4OJP A;  5E79 U;  5KFT A;  2EAN A;  4X5V A;  2VKQ A;  1ZD2 P;  2F44 A;  4QZ9 A;  4QWE A;  4Y2J A;  5AKH A;  2V4Q A;  3RB6 A;  2BPG A;  5AKZ A;  3TFS A;  4WJ3 B;  3PR5 B;  4X4P A;  4LZD A;  2LMR A;  2AGQ A;  2MRL A;  2JEJ A;  5KFO A;  1S97 A;  3M8S A;  1NK7 A;  4UBC A;  1MA7 A;  3AQE A;  4I2E A;  2NO4 A;  3M9N B;  2KIC A;  3Q8R B;  3MBY A;  1U45 A;  9ICS A;  5HP4 A;  5DB9 A;  3CW2 C;  4ZOH C;  5AI8 A;  3V7J A;  1Q3V A;  3L3F X;  4GXJ A;  2BPC A;  5IIM A;  5AK4 A;  1D8L A;  1ZXI A;  2NRT A;  1TAM A;  4WOY A;  4GFJ A;  5DDY A;  3HX0 A;  4J9N A;  2IUB A;  2QAR A;  4F8R A;  2MAX A;  2B56 A;  5CB1 A;  2ZIU B;  1QLN A;  2WAQ F;  4KIT B;  1S9F A;  4DFD A;  4MEX A;  5DLF A;  1K1S A;  4F71 A;  5ALP A;  4K4H A;  1DOQ A;  2E5S A;  5HRD A;  4K4I A;  3HKZ C;  4CNQ A;  8ICG A;  4X4U A;  1JXL A;  4DSF A;  1ZD4 A;  5CRX A;  4EED A;  2R18 A;  1QH9 A;  1UQV A;  1SKR A;  5ALE A;  4HYK A;  4Y2Y A;  3GV8 B;  3BS7 A;  4LEV A;  2JGA A;  2PFN A;  3T5J A;  5J8Y A;  2W7O A;  1NKE A;  4QW9 A;  4KLE A;  3MAB A;  5HRB A;  4LEZ A;  5DB7 A;  5HRH A;  2EZX A;  4PGY A;  5KFD A;  2OM6 A;  3EPG A;  2C28 A;  4C8K A;  5IIJ A;  4F4K A;  7ICS A;  4KN4 A;  1L6N A;  4WC3 A;  2RP5 A;  4EBD A;  4ED2 A;  4NLB A;  5BPC A;  3N4M B;  3WKA A;  3BJY A;  1BPZ A;  2HBM A;  5CR0 A;  5ALU A;  4QZ8 A;  4PHE A;  2OWO A;  1M6Y A;  3AU2 A;  3K75 D;  3UMB A;  2M9N A;  4X4O A;  2JEF A;  2ZH3 A;  4NKU A;  4QZH A;  1QSY A;  2F2A B;  2YX8 A;  1RZT A;  4IC9 A;  2E1F A;  4Y2T A;  4PHD A;  1S10 A;  4OD0 A;  5IIK A;  5AI9 A;  2IMW P;  3ISB A;  2Q66 A;  4XQ7 A;  3KTQ A;  3LVV A;  5ALZ A;  1UCV A;  4QZF A;  2KHQ A;  3QU7 A;  3UQ0 A;  3B0X A;  2XGP A;  3LWL A;  2FCL A;  3H37 A;  5DEC A;  4O5E A;  4RUC A;  2ZJA A;  4K98 A;  4BGD A;  5IIO A;  3OWG A;  5ALG A;  3CRX A;  4I2F A;  3RR7 A;  4FHW A;  9ICK A;  4AT9 B;  5CJ7 A;  3RJH A;  4O5C A;  3WFP A;  4PHA A;  3E2E A;  3D2N A;  2B6G A;  1JUD A;  3MFH A;  2K8C B;  1NK5 A;  3O0F A;  4KMO B;  2KHV A;  2DPJ A;  1N62 A;  2B51 A;  4FO1 A;  3IG5 A;  2A1J B;  1L7O A;  1WWV A;  3N7R C;  3CP8 A;  4UAS A;  5III A;  4RQ8 A;  5KG4 A;  3SI8 A;  2LYB A;  3EZ5 A;  3DV9 A;  1QSL A;  2BCS A;  8ICZ A;  3H4B A;  2ZH5 A;  2BHN A;  4J9Q A;  2Y9U A;  2FI1 A;  2BDU A;  2WF5 A;  2DR8 A;  3HIL A;  5DG9 A;  1MQ3 A;  1YZ7 A;  2PFP A;  2M2W A;  2NRK A;  1ZQJ A;  3LWM A;  4EBC A;  4RQ5 A;  1BVS A;  3Q8K A;  4Y2R A;  1N60 A;  1RXW A;  1JX4 A;  2XID A;  3JPN A;  2AH5 A;  4Y2V A;  3OSP A;  4O5K A;  4O68 A;  5KT5 A;  4MFF A;  3GQC A;  4QZE A;  1T8E A;  3AQM A;  2HN2 A;  2XVT A;  5ALV A;  3WK9 A;  5J2A A;  5J2C A;  9ICC A;  2HHW A;  2AU0 A;  2NV3 A;  2KSO A;  1NJX A;  2W9C B;  2ZJ5 A;  4O3N A;  3C2L A;  1JN3 A;  4FH5 A;  4ATB B;  2W11 A;  4WC5 A;  4R64 A;  4RPY A;  5ALY A;  3H4D A;  3GIJ A;  3QYP A;  3EW9 A;  5AM3 A;  3PO5 A;  4MHV A;  4RQ6 A;  4KN7 A;  1NOM A;  5B5E U;  2ATL A;  3BDP A;  2YY6 A;  1UPH A;  4ED6 A;  4CCH A;  1A77 A;  4EZ6 A;  4M6W B;  4I2J A;  1T4G A;  2OHF A;  3BQ7 A;  5KFP A;  1BGX T;  2RDJ A;  3KFU F;  3C5G A;  2AXT U;  1SV0 C;  4F4W A;  2DUY A;  1WUD A;  3IHQ B;  4Y2P A;  2ZJ8 A;  5J2K A;  1NK8 A;  4DSE A;  2IBK A;  5ALS A;  2KFN A;  3K1Z A;  2KVC A;  3N7P D;  2DQN B;  1J2N A;  4ECU A;  4E8F A;  4F5O A;  4UB2 A;  5KG1 A;  3WKC A;  4UB5 A;  2WFA A;  4C4R A;  4KB6 A;  1KDH A;  4F5P A;  1SKS A;  4ICA A;  8ICK A;  2HDO A;  4UAU A;  3ALR A;  3PMN A;  2ZTC A;  4P0Q B;  1S0N A;  4DS5 A;  4DL2 A;  3RJK A;  5F9N A;  1PZN A;  4PZN A;  1KN5 A;  8ICC A;  3GV5 B;  4EYH B;  5IIN A;  3OHB A;  1SGG A;  1A76 A;  7ICN A;  1WCL A;  2HHS A;  2GAF D;  1SL0 A;  1O03 A;  1RPL A;  4J9P A;  3RH6 A;  4G3I A;  1BNP A;  2Y0S C;  2KZ3 A;  3PW0 A;  8ICE A;  1NZP A;  4X0B A;  4EEB A;  1ZQB A;  5F2V O;  3WFS C;  9ICL A;  9ICR A;  2I1Q A;  3H39 A;  4NXZ A;  1HJP A;  4ELU A;  4KLU A;  8ICA A;  3JYY A;  4WCW A;  1N48 A;  3UQ2 A;  4P4O A;  4X4T A;  3L5K A;  5AM4 A;  4KLQ A;  3NVO A;  3JZ0 A;  1Z4N A;  2VA2 A;  1HUO A;  4EYI B;  5CA7 A;  4ECV A;  2LI6 A;  4BJQ A;  2R8K A;  3M1Y A;  4C7Z A;  4FO6 A;  3LYS A;  1LVH A;  1WCN A;  2YTU A;  3RB3 A;  4P2H A;  2N1R A;  4WBY A;  3OUY A;  2P6R A;  2JZB B;  3K4G A;  3HW8 A;  3H3A A;  5AIA A;  5BOM A;  2JH1 A;  3A0B U;  4EEN A;  5DB8 A;  4BXO A;  2RLT A;  4DEZ A;  3ZDD A;  4EP7 A;  3OSN A;  5KFL A;  5L1J A;  2KE7 A;  1H38 A;  2JR5 A;  4XJE A;  1UA1 A;  2LKY A;  1SWV A;  4RQM A;  4DL6 A;  1TFW A;  3FM9 A;  4BX9 C;  5J0Q A;  4YR3 A;  3M6K A;  1XSP A;  3IV6 A;  1ZQU A;  4AYB F;  1Q3U A;  4F2S A;  4FBU A;  1U49 A;  2YB4 A;  2HN1 A;  2UVR A;  4C8O A;  1XO1 A;  3K1R B;  5EOZ A;  1WYG A;  4YR2 A;  2BBJ A;  2M2T A;  4I2C A;  2DRB A;  4ED1 A;  1IIP A;  4Q8E A;  2JZB A;  1B22 A;  4UD5 A;  9ICF A;  3IRU A;  1NJY A;  4UB1 A;  4F2R A;  4JWN A;  2HHX A;  4ZH4 A;  4EX6 A;  3THV A;  1ZQK A;  2KN7 A;  4JB3 A;  4O3M A;  2P66 A;  3KKA A;  2CRX A;  3PX6 A;  5KFM A;  2JMG A;  4WC4 A;  4IRK A;  1RDF A;  4FHX A;  1NI3 A;  4M47 A;  4MFC A;  5EE0 A;  3NRW A;  1BPB A;  4X4Q A;  3HIY A;  5KFX A;  1NO5 A;  2HI0 A;  3SAH A;  4UB4 A;  2ZIV A;  5KFY A;  1FFU A;  5CHG A;  1TVA A;  5KFV A;  2JV3 A;  2PI5 A;  2M2U A;  1FFV A;  2C2R A;  3RTV A;  2AQ4 A;  3R9K A;  7ICI A;  1N5X A;  4CF5 A;  4PGQ A;  2DPI A;  1ZQQ A;  1NK9 A;  3PW2 A;  1X6I A;  4X4V A;  4Q44 A;  3ZI4 A;  4S3N A;  2WF6 A;  4F93 B;  3PW7 A;  3ISC A;  8ICN A;  4O3Q A;  4JMU A;  1R8C A;  2MUT B;  2VA3 A;  1ZQG A;  3RBE A;  4JUZ A;  4O0I A;  1NZB A;  2M2V A;  1AQ6 A;  3IG8 A;  5DQI A;  3N7S C;  2MSN A;  5ALX A;  1ZQI A;  4ECQ A;  1KNY A;  2KFZ A;  3PV8 A;  2HOI A;  3ONN A;  4WQK A;  4USA A;  1ZRN A;  3HP6 A;  5HHI A;  8ICM A;  3TAN A;  2IHM A;  1N61 A;  2J6S A;  4NXW A;  4EBK A;  4ECR A;  4QIW C;  4DCC A;  5HRG A;  4K8V A;  1LKY A;  1ZQN A;  4X4R A;  2WAQ C;  2DL0 A;  3PVX A;  4OO1 J;  3VCB A;  1MIY A;  3M9O B;  4RPX A;  4EZ9 A;  1QQ6 A;  4PZO A;  1SZH A;  1YZ6 A;  4G9B A;  3QE9 Y;  4IRC A;  3L4P A;  2GOL A;  3AM9 A;  4XUS A;  1JMS A;  4GC7 A;  3C1Z A;  5IIL A;  1K1Q A;  2DKZ A;  1OUQ A;  1T3Q A;  1ARO P;  2F1H A;  3FDS A;  5KL1 B;  3JPR A;  4RT3 A;  5FP0 A;  3DDH A;  4F5Q A;  3BS5 A;  2AJQ A;  8ICQ A;  4Q43 A;  4RNO A;  4EGW A;  4B9U A;  3HRD D;  4KLL A;  3JPQ A;  4O3R A;  1PVR A;  2KNJ A;  4NL9 A;  5ALW A;  1NKC A;  2K60 A;  3TKA A;  3OVB A;  9ICI A;  5KFR A;  2MU2 A;  2ASL A;  2BKE A;  2QAR B;  2Z7J A;  5KT2 A;  3EUB 2;  4RNN A;  1SV4 A;  5KNI A;  5ALM A;  5DG7 A;  5HMM A;  4KLJ A;  1NNL A;  4Z6F A;  4CDG A;  3J81 j;  3I76 A;  2EQY A;  3GV7 B;  4ECX A;  3N28 A;  3AEV A;  5D4B A;  5KFQ A;  1JRP A;  4PGX A;  5AKI A;  3H0L B;  4IQT A;  4TUR A;  1N5W A;  2C22 A;  1JAL A;  3EF2 A;  2ID1 A;  3ETL A;  4OAF A;  1TK0 A;  1RXV A;  3TAD C;  3VC8 A;  4K9A A;  2Q4T A;  3ZDB A;  4AP9 A;  4Z6C A;  4MKP A;  4QWC A;  2JHD A;  4PPX A;  3ZD9 A;  3WKD A;  2K8A A;  4I2I A;  4DO9 A;  7ICG A;  4NKT A;  3V6J A;  3MR2 A;  1L5U A;  2EZZ A;  2AGP A;  2XI9 A;  2W3R A;  2OYY A;  4QIW F;  8ICS A;  1BNO A;  3ICX A;  3T5H A;  3CNH A;  3WK6 A;  1ZQ1 C;  2KOB A;  1LB2 B;  2JXJ A;  2ZXH A;  3MDC A;  4DFK A;  8ICB A;  3UMG A;  2F77 X;  4Z6D A;  2HHV A;  4C80 A;  4F3O A;  2QLT A;  1IM4 A;  2BR0 A;  5J0X A;  3MCR A;  1NJW A;  4M04 A;  3QZ7 A;  1KW4 A;  3QU4 A;  1FA0 A;  4F72 A;  2W8K A;  4ECS A;  2ZH2 A;  1U4B A;  2LM1 A;  4DFJ A;  4OJL A;  2ZHB A;  2F76 X;  4Y2S A;  4UAW A;  4DFP A;  5KT4 A;  2G5H B;  3SQI A;  3SV3 A;  2I9G A;  1JXE A;  3G6X A;  4I0U A;  4J03 A;  2BGW A;  4CF4 A;  5ALD A;  1L3U A;  4XA5 A;  4FBT A;  5HHH A;  4C0Z A;  3SMV A;  2WB1 C;  4K9B A;  4NLC A;  4ED8 A;  4M2Y A;  3KZX A;  1R8B A;  2PI4 A;  4Y2Q A;  4TQS A;  4NWI A;  3OPX A;  4QZG A;  4J9K A;  3ED5 A;  2BQR A;  3RRG A;  1SXE A;  5EE3 A;  1IXR A;  2ZTD A;  1HIW A;  1X40 A;  4QZI A;  4IR9 A;  4GXI A;  3V6K A;  3JPO A;  5ALI A;  2JH7 A;  1RQN A;  3Q8Q B;  4I27 A;  4NLK A;  1MC8 A;  1NJZ A;  5AKK A;  7ICU A;  3PST A;  3UPS A;  1L7M A;  1PVQ A;  3UXO A;  3C2M A;  2ALZ A;  2PFO A;  3ZDC A;  2P35 A;  3T5K A;  4M9J A;  3HPO A;  2P6U A;  2ODG A;  4KLO A;  2E8M A;  2VA8 A;  4RPZ A;  4B9S A;  2EAM A;  3TAC B;  3RJE A;  1ECW A;  1ZJM A;  2YB1 A;  2HW3 A;  3NVZ A;  5CP2 A;  2GWS A;  1L8O A;  4F50 A;  3DEE A;  3BQT A;  3RR8 A;  3KHH A;  4IR1 A;  5J0R A;  4QZC A;  4ECY A;  2DKX A;  5KFK A;  1B4F A;  4KX3 A;  3QU5 A;  2H3F A;  5K4L A;  4DFM A;  4X4S A;  4HX0 A;  4NLN A;  4WC7 A;  1KFS A;  4DQI A;  4RQ3 A;  4HAI A;  1S77 D;  1SZP A;  8ICV A;  5J0Y A;  3H40 A;  5HC9 A;  9ICA A;  4O6A A;  1XWL A;  4DLE A;  2KIW A;  2PXI A;  3QZ8 A;  2QB0 A;  5J2I A;  4M9N A;  4DSJ A;  2KSO B;  4PHP A;  4YVZ A;  2W03 A;  2J6U A;  2VIX A;  3MR5 A;  3NTU A;  1XC9 A;  5JU5 A;  3NVV A;  5KG2 A;  2UVV A;  2E8P A;  3BQ1 A;  3GDX A;  2WB1 F;  5BOL A;  2BPF A;  3AQK A;  7ICK A;  1RQL A;  2IHO A;  1TV9 A;  2K89 A;  1TAU A;  1Z1B A;  1ZQZ A;  1XS9 D;  3SD7 A;  5GTH U;  1ZQX A;  4FE3 A;  4OJO A;  5J0T A;  1ZQW A;  5AM5 A;  1UEU A;  5KFH A;  4FH3 A;  3RBD A;  1F0M A;  3RAQ A;  1KBU A;  2KTQ A;  4OCZ A;  2EDU A;  1RYS A;  1XU4 A;  3RJJ A;  3T5L A;  4UB6 U;  5HNK A;  1IV8 A;  3C5F A;  3PZP A;  3B0Y A;  3RAX A;  1VJ5 A;  4I28 A;  2VAN A;  5KFZ A;  3JCF A;  2BCV A;  3OTQ A;  1NK4 A;  3QEA Z;  2W55 A;  4YCX A;  9ICQ A;  4WBZ A;  4DSK A;  4TUS A;  2IOH A;  2EAO A;  5ALH A;  4KLM A;  5KFS A;  3IM1 A;  2JEI A;  4QWB A;  1QCK A;  2FPK A;  5DED A;  1FEZ A;  4YQW A;  2DFL A;  2WHE A;  1VFG A;  4C8M A;  3BQ0 A;  2PBE A;  9ICM A;  7ICF A;  2NRZ A;  1ZJN A;  2IOF A;  4U7C A;  1MSW D;  1WG8 A;  1TKD A;  2KIV A;  3WK7 A;  5CHE A;  1SL1 A;  3M9M B;  2RDI A;  3Q8P B;  3RB0 A;  4PL1 A;  4WQL A;  5KG3 A;  4EX7 A;  4C4S A;  4AYB C;  3E0F A;  4GXK A;  5HRK A;  2B4V A;  3ZD8 A;  2EZY A;  3OVS A;  1URJ A;  3ETR A;  5D46 A;  5AIC A;  1YLQ A;  4NY8 A;  3NUQ A;  1Z3E B;  3BZK A;  2NO5 A;  2YMQ A;  2NRW A;  4NXX A;  5CFU A;  9ICP A;  2F8L A;  1B43 A;  4I2B A;  1A0P A;  4IS7 A;  5AKX A;  3OUY B;  3KOO A;  4FZN A;  2NRV A;  2FMQ A;  5HML A;  4FZM A;  4Q8F A;  3ERC C;  5DDM A;  4BXO B;  2ZHA A;  5AK6 A;  1Y88 A;  5DKW A;  4YD1 A;  3CYM A;  4RQN A;  2KEY A;  3F2D A;  1LV5 A;  4YR0 A;  4B9L A;  1FIQ A;  5TZV A;  4UQG A;  3AUO A;  1HUZ A;  4O67 A;  3IDW A;  4B9M A;  2BBH A;  1D9D A;  2KJ9 A;  5KAF U;  4JWM A;  4F4X A;  1DK2 A;  2B0C A;  7ICL A;  1F5A A;  2ZXI A;  3PX0 A;  4M5D A;  4Z6E A;  3AU6 A;  2LM4 A;  2WF7 A;  2GH1 A;  9ICV A;  3C1Y A;  3C21 A;  5EWE A;  3NYB A;  2FLN A;  3SV4 A;  3NVW A;  4DOA A;  4IL6 U;  3PSP A;  5CEH A;  5AM2 A;  2OH2 A;  3QUB A;  1D8B A;  2XY5 A;  4JLX A;  2K8B B;  5DBB A;  4DQR A;  3L9D A;  5AI0 A;  2XY7 A;  5AKE A;  2BCQ A;  2KJ8 A;  5L1L A;  4YMO A;  4UAY A;  2J6T A;  2W9A A;  8ICW A;  3MDA A;  4QNL A;  2W9M A;  1SV0 A;  3M8R A;  5TIS U;  3D6J A;  4R65 A;  4ECZ A;  2ZIV B;  3SAG A;  4DF8 A;  1MQ2 A;  1UET A;  1COK A;  4IG8 A;  1ZQS A;  9ICH A;  2ZIX A;  1ZQM A;  2CN1 A;  4IQW A;  3EYZ A;  4DQQ A;  4ELV A;  5EWF A;  3RRH A;  3ZDE A;  2KV2 A;  1Z1V A;  5DBA A;  5EE1 A;  1PK1 A;  4BDP A;  4RQ0 A;  5EWG A;  3SEI A;  3MFI A;  5EE9 A;  1U48 A;  3C2K A;  2LYA A;  5KG5 A;  4K97 A;  4F5N A;  8ICL A;  1RYR A;  2HHU A;  4NM2 A;  1V85 A;  3RF9 A;  4R8U B;  2UVW A;  1JAJ A;  5AHX A;  4UBB A;  2KKV A;  4GLX A;  3KD3 A;  2BZF A;  2G5I B;  1FO4 A;  2VJ4 A;  4TUQ A;  1JI7 A;  2HVH A;  9ICU A;  1S0V A;  2ASJ A;  3UPQ A;  5KFU A;  1JQR A;  5AKG A;  2AHO B;  4DOB A;  4DSL A;  2H3I A;  1LKY B;  1DRG A;  1T7P A;  4FHY A;  1ZYQ A;  3G6V A;  1COO A;  2FE9 A;  4ACO A;  1ZQA A;  2CXY A;  2Y9T A;  4Y2U A;  4R63 A;  2G0A A;  4R8U A;  3OJS A;  8ICY A;  5H2F U;  4F4Y A;  5DQH A;  2WTF A;  4DL7 A;  3RH5 A;  3HJ1 A;  3TAP A;  1UA0 A;  1NKB A;  5HRE A;  1L3S A;  5AM1 A;  3T3F A;  4QJF B;  2K4P A;  3BS5 B;  4I2G A;  1CEZ A;  4WC1 A;  1Z00 B;  2NRX A;  4U6P A;  2DF4 B;  1K5O A;  3GU3 A;  4MF2 A;  3TAQ A;  2ZUD A;  4FS1 A;  3PX4 A;  4EV6 A;  2FPM A;  8ICP A;  1CRX A;  5KG0 A;  4RQ1 A;  2HBK A;  2W7P A;  3RJI A;  2K4I A;  1RYU A;  1XSN A;  3NKU A;  2BCR A;  3QUT A;  2ZH7 A;  1ZQF A;  1PK3 A;  4EEK A;  4QWD A;  1Z4O A;  4YMN A;  3F2C A;  1SWW A;  3UMC A;  4FZL A;  1TE2 A;  4OJ5 A;  1ZQD A;  2BQU A;  1P7D A;  2G08 A;  3SYZ A;  1ZD5 A;  4J9S A;  1ZQY A;  2ZIW A;  1S0M A;  1C7Y A;  3H0R B;  3PW5 A;  4K96 A;  5J8Y C;  2Y1J A;  4KTQ A;  1KFD A;  4WC0 A;  4AT8 A;  2H3V A;  2DWQ A;  1UHU A;  3PSF A;  4M9G A;  1Z00 A;  1KEJ A;  2WF8 A;  2KJ5 A;  2ZH9 A;  2YMM A;  5G5H A;  1JRO A;  5HRL A;  3RB4 A;  1SB3 C;  1KQQ A;  2XCP A;  1KRP A;  2QB1 A;  5DB6 A;  1ZQH A;  5B66 U;  2H5X A;  2C2E A;  3ER8 C;  1UT5 A;  1SKW A;  3AQN A;  3PHZ A;  3FC4 A;  3BQ2 A;  3KHL A;  4Y2X A;  1X9X A;  3WKB A;  1F44 A;  4DSI A;  3H8M A;  3QXG A;  1EXN A;  4CF3 A;  4NV0 A;  1ZQP A;  3NRZ A;  4OAI Z;  5HR6 A;  1R89 A;  3RFA A;  2GA9 D;  4EBJ A;  4YN4 A;  8ICX A;  4JK1 A;  4RWQ A;  4KLS A;  4KLT A;  4WC2 A;  2ESE A;  2NYV A;  4DLG A;  9ICT A;  1S5L U;  4QW8 A;  5KAI U;  4DL4 A;  5J2H A;  5A0L A;  1HEK A;  3TAR A;  3NAS A;  4TQR A;  3WKE A;  2XIC A;  1MIV A;  5D61 A;  4UB8 U;  1ZQT A;  2DR9 A;  3F2B A;  4B9T A;  3C18 A;  3IP4 B;  1RM6 C;  1V9P A;  2ZG6 A;  4TUP A;  4GIB A;  4YMM A;  3SR6 A;  2RQ5 A;  3GIK A;  4XQ8 A;  2L5Y A;  3SAF A;  4UW9 A;  5HRI A;  4YD2 A;  1V97 A;  2FJ6 A;  1X9W A;  4I29 A;  5HRF A;  3H8S A;  3MC1 A;  9ICG A;  4CRX A;  4P0P B;  2HBJ A;  4IQU A;  5D63 A;  2HHQ A;  3AQL A;  7ICJ A;  4P4P A;  3QNM A;  4BWJ A;  4DOC A;  2F1J A;  1S0O A;  5D62 A;  4UAR A;  1X66 A;  1IG6 A;  1UT8 A;  4F91 B;  3C66 A;  2R8J A;  4NLG A;  2PMZ C;  1ZQC A;  4A8E A;  3TFR A;  3Q8M A;  9ICX A;  1XO0 A;  5L1M A;  3PW4 A;  3BZC A;  1V38 A;  2DGZ A;  4X0A A;  1ZQL A;  4I2H A;  3WK8 A;  1X42 A;  1ED1 A;  5ALJ A;  3RJF A;  1J2M A;  5C0Y A;  3WK5 A;  8ICO A;  2DBY A;  2G09 A;  5KFN A;  8ICI A;  5J2E A;  4ED7 A;  4P0P A;  2ZIU A;  4UD4 A;  3G6Y A;  2RRD A;  3QU9 A;  2F3N A;  4LEW A;  2DR7 A;  3SEN A;  4J9M A;  4NM1 A;  4B9V A;  4PH5 A;  2K4E A;  2QB0 B;  2EAP A;  4ECW A;  3IN5 A;  1KL9 A;  4QWA A;  2K4H A;  7ICH A;  4K99 A;  3QU2 A;  1Q79 A;  1N63 A;  3RH4 A;  1S8O A;  3TI0 A;  1L7N A;  5DGB A;  1CUK A;  3AMZ A;  3GZF A;  3ISD A;  4J9O A;  1QSS A;  4CGZ A;  3F5E A;  1U47 A;  3QUC A;  7ICV A;  2E8N A;  4K4G A;  4DQP A;  5G5G A;  3TAD A;  4NXU A;  1T3N A;  2O1P A;  2V9W A;  2V4R A;  8ICJ A;  3KHG A;  2GO7 A;  2OEH A;  1Q78 A;  2HOF A;  1U9L A;  2OXO A;  2XCA A;  2ES6 A;  2YN4 A;  5KT3 A;  5DBC A;  3WK4 A;  4WH5 A;  2QKQ A;  4F4Z A;  2ZTE A;  1QQ5 A;  4NJ8 A;  1X2I A;  2DRA A;  2HCF A;  3KBB A;  5JRT A;  5AIB A;  4RU9 A;  3T79 A;  2OCE A;  5ALL A;  5J0O A;  3HKZ F;  4DWI A;  2MA1 A;  4NXT A;  2HOQ A;  1C20 A;  7ICP A;  4EBE A;  5J2D A;  1N56 A;  2PMZ F;  2KK0 A;  3C29 A;  4KLF A;  1TAQ A;  2KP7 A;  2Y1I A;  2W9B B;  2HBL A;  1L8L A;  1GO3 F;  4IQV A;  1NK0 A;  4PL2 A;  3WFQ E;  2D6F C;  4RWO A;  4ED3 A;  3KHR A;  3D2Q A;  4RQ7 A;  4PJ0 U;  1VLB A;  3I28 A;  4UB3 A;  2IOF K;  1X9M A;  5JUM A;  1ZOL A;  4NLZ A;  4AT9 A;  5B3P A;  4X4N A;  1D9F A;  3H0M B;  9ICW A;  2R8I A;  4KM5 A;  2FMS A;  2JEG A;  3EPI A;  2BDP A;  4NXV A;  4WC6 A;  3QEB Z;  3PO4 A;  1X6J A;  1D8Y A;  2LHT A;  3JPT A;  4DL3 A;  2A1J A;  5J2G A;  4KLH A;  4US9 A;  3MGH A;  5AKJ A;  2D8C A;  4EEL A;  5KFI A;  3UXP A;  2C2D A;  2W9B A;  3PML A;  3JPS A;  1VJ7 A;  4DS4 A;  2GLE A;  2UVU A;  1TK8 A;  3HJ4 A;  4LZG A;  4YP3 A;  2AQ0 A;  4CE6 A;  3ZDA A;  5DLG A;  2R8H A;  2W43 A;  1A6S A;  5DG8 A;  5B3Q A;  3EWA A;  4RQ4 A; 
#chains in the Genus database with same CATH homology
 3AU2 A;  4R65 A;  3C1Z A;  4GC7 A;  5IIL A;  3K75 D;  4ECZ A;  1K1Q A;  4DF8 A;  4E0D A;  1MQ2 A;  5J0S A;  1UET A;  4IG8 A;  2M9N A;  4X4O A;  3MR3 A;  4B9N A;  4KLI A;  1ZQS A;  1ARO P;  2JEF A;  9ICH A;  2ZH3 A;  2F1H A;  3FDS A;  3JPR A;  4NKU A;  4RT3 A;  3V7L A;  1ZQM A;  4QZH A;  1QSY A;  1MIY A;  4F5Q A;  2AJQ A;  1RZT A;  8ICQ A;  4Q43 A;  4RNO A;  4B9U A;  3N97 B;  4IQW A;  4KLL A;  4PHD A;  9ICE A;  3JPQ A;  3EYZ A;  5F9L A;  4DQQ A;  1S10 A;  5IIK A;  4ELV A;  2IMW P;  3ISB A;  4O3R A;  5EWF A;  2Q66 A;  4F92 B;  4XQ7 A;  3KTQ A;  3RRH A;  1NKC A;  3ZDE A;  3OVB A;  5J0W A;  4QZF A;  5DBA A;  5J29 A;  9ICI A;  3UQ0 A;  1JMS A;  3B0X A;  5KFR A;  5KT6 A;  4BDP A;  4RQ0 A;  5EWG A;  2XGP A;  3LWL A;  2ASL A;  2BKE A;  2HHP A;  3H37 A;  3MFI A;  1V4A A;  5DEC A;  5KT2 A;  4O5E A;  4DL5 A;  1U48 A;  3C2K A;  1JIH A;  4RNN A;  4DQS A;  1KSP A;  2R8G A;  2HHT A;  5J2J A;  5DG7 A;  5KG5 A;  5HMM A;  2ZJA A;  4RUC A;  4F5N A;  4KLJ A;  4C8L A;  5J2B A;  3PR4 A;  1RYR A;  4BGD A;  5IIO A;  2W9C A;  8ICL A;  5HR9 A;  4Z6F A;  4RT2 A;  2HHU A;  4I2F A;  3GV7 B;  4NM2 A;  3RR7 A;  1ZQO A;  4ATB A;  4FHW A;  4ECX A;  4R8U B;  4M9L A;  4MEY A;  5D4B A;  2UVW A;  5DQG A;  9ICK A;  5KFQ A;  2B21 A;  5CJ7 A;  1JAJ A;  4AT9 B;  3RJH A;  4O5C A;  3WFP A;  4PGX A;  3OJU A;  3GII A;  4UBB A;  4PHA A;  4GLX A;  3E2E A;  3TQ1 A;  4IQT A;  1UEV A;  4TUR A;  2AGO A;  3MFH A;  2C22 A;  1NK5 A;  2ID1 A;  9ICB A;  3ETL A;  7ICR A;  5L9X A;  3SZ2 A;  1TK0 A;  2DPJ A;  2ISO A;  4EEY A;  4TUQ A;  1RXV A;  5KG7 A;  2HVH A;  4RWN A;  9ICU A;  2A1J B;  5KFB A;  5J2F A;  4M6W A;  3ZDB A;  4LVS A;  1S0V A;  1BPE A;  4O3S A;  2ASJ A;  4Z6C A;  5J0U A;  3UPQ A;  1TFY A;  4QWC A;  5KFU A;  1JQR A;  3HT3 A;  2ZUC A;  5III A;  4PPX A;  4RQ8 A;  3ZD9 A;  2LYH A;  4DOB A;  5KG4 A;  4R66 A;  3SI8 A;  4DSL A;  1L3T A;  4I2I A;  3EZ5 A;  4DO9 A;  4I2D A;  7ICG A;  4NKT A;  1QSL A;  1T7P A;  2BCS A;  3V6J A;  4FHY A;  1ZYQ A;  3MR2 A;  1L5U A;  8ICZ A;  3G6V A;  1COO A;  2AGP A;  3H4B A;  7ICM A;  1ZQA A;  9ICN A;  2ZH5 A;  8ICS A;  4J9L A;  2BHN A;  1BNO A;  2ZH1 A;  4J9Q A;  1R8A A;  3OV7 A;  4BWM A;  4R63 A;  5D49 A;  1ZQR A;  3T5H A;  3LDA A;  1ZQV A;  4DF4 A;  2DR8 A;  4R8U A;  3OJS A;  3V7K A;  8ICY A;  1KTQ A;  5DG9 A;  4F4Y A;  1MQ3 A;  1LB2 B;  5DQH A;  2PFP A;  2ASD A;  2M2W A;  2WTF A;  3MDC A;  3LWM A;  3ORY A;  4DL7 A;  3RH5 A;  4EBC A;  4RQ5 A;  1BVS A;  4DFK A;  3Q8K A;  3HJ1 A;  3TAP A;  1UA0 A;  1NKB A;  5HRE A;  3GIL A;  8ICB A;  1RXW A;  1JX4 A;  4Z6D A;  2XY6 A;  1L3S A;  3JPN A;  4F3O A;  2HHV A;  3T3F A;  2BQ3 A;  3OSP A;  1IM4 A;  4O5K A;  3C23 A;  2BR0 A;  5J0X A;  1NJW A;  4M04 A;  3QZ7 A;  4I2G A;  5KT5 A;  1ZQJ A;  1CEZ A;  2O5A A;  1SL2 A;  1FA0 A;  4WC1 A;  2W8K A;  4ECS A;  2ZH2 A;  4RQ2 A;  1U4B A;  3V72 A;  4MFF A;  1Z00 B;  2NRX A;  4RNM A;  3GQC A;  4DFJ A;  4MF2 A;  3TAQ A;  2ZUD A;  4QZE A;  4FS1 A;  3PX4 A;  1T8E A;  2FPM A;  2FLP A;  3AQM A;  8ICP A;  2ZHB A;  2XO7 A;  5KG0 A;  4RQ1 A;  1BPD A;  4UAW A;  2PFQ A;  4DFP A;  3RJI A;  3HWT A;  5KT4 A;  1XSN A;  2I9G A;  5J2A A;  5J2C A;  3SV3 A;  9ICC A;  2BCR A;  2ZH7 A;  1JXE A;  1ZQF A;  2HHW A;  3G6X A;  4QWD A;  4YMN A;  2BGW A;  2FLL A;  4FHV A;  8ICT A;  4IRD A;  2AU0 A;  4P4M A;  1L3U A;  4YXM A;  1NJX A;  2Q0Z X;  4XA5 A;  4FBT A;  1ZQD A;  5HHH A;  2BQU A;  7ICT A;  2W9C B;  2ZJ5 A;  4O3N A;  4RWP A;  3SYZ A;  3C2L A;  4J9S A;  1JN3 A;  1ZQY A;  4FH5 A;  4JV1 A;  4ATB B;  4ED8 A;  2ISP A;  4M2Y A;  4WC5 A;  4R64 A;  2ZH6 A;  4RPY A;  3H4D A;  3GIJ A;  3NGD A;  1R8B A;  3EW9 A;  3PO5 A;  2PI4 A;  4QZB A;  1S0M A;  1WOT A;  4TQS A;  1C7Y A;  4RQ6 A;  4QZG A;  4J9K A;  4KN7 A;  1NOM A;  3PW5 A;  2ATL A;  2Y1J A;  2BE3 A;  9ICJ A;  3BDP A;  5KFW A;  8ICU A;  5HC9 A;  4KTQ A;  1BPY A;  7ICO A;  1KFD A;  4IRC A;  3WFR E;  4WC0 A;  4AT8 A;  2BQR A;  4ED6 A;  4CCH A;  3RRG A;  4RUA A;  8ICF A;  1A77 A;  1TK5 A;  1IXR A;  4EZ6 A;  2ZTD A;  3JPP A;  4M6W B;  4F5R A;  4M9G A;  4I2J A;  4IR9 A;  5C5J A;  5J0P A;  1Z00 A;  1KEJ A;  4QZI A;  4GXI A;  3V6K A;  1T4G A;  4ELT A;  4ED0 A;  5KFG A;  2ZH9 A;  3JPO A;  3WFO A;  3H38 A;  5KFP A;  5HRL A;  7ICQ A;  3RB4 A;  3Q8Q B;  4I27 A;  2RFF A;  4NLK A;  1BGX T;  1MC8 A;  2RDJ A;  3C5G A;  1NJZ A;  4GC6 A;  7ICU A;  2XCP A;  5KTQ A;  3UPS A;  3UXO A;  4F4W A;  2FPL A;  4MF8 A;  3C2M A;  1KRP A;  3LK9 A;  2ALZ A;  3IHQ B;  2ZH8 A;  2PFO A;  3ZDC A;  3T5K A;  2ZUB A;  5CWR A;  4M9J A;  2ZJ8 A;  5J2K A;  3HPO A;  5DB6 A;  1NK8 A;  2FMP A;  4I2A A;  2P6U A;  1ZQH A;  3MR6 A;  4DSE A;  2XC9 A;  4KLO A;  4E80 A;  2H5X A;  2VA8 A;  4RPZ A;  4B9S A;  2IBK A;  3RJE A;  4C8N A;  2C2E A;  2KFN A;  1ZJM A;  1UT5 A;  1SKW A;  3AQN A;  3OVA A;  2HW3 A;  5CP2 A;  2GWS A;  4ECU A;  4E8F A;  3BQ2 A;  4F50 A;  4F5O A;  3KHL A;  4UB2 A;  3V6H A;  5KG1 A;  4UB5 A;  3H8W A;  4YXJ A;  4KLD A;  3OHA A;  4DSI A;  3BQT A;  4O3P A;  5KFF A;  4O3O A;  5J0R A;  3KHH A;  3RR8 A;  4IR1 A;  2DVI A;  4QZC A;  4ECY A;  1EXN A;  1KDH A;  4F5P A;  5KFK A;  1ZQP A;  1SKS A;  4YG2 A;  3UXN A;  1R89 A;  8ICK A;  4DFM A;  4AT7 B;  4FS2 A;  3PMN A;  4EBJ A;  4YN4 A;  8ICX A;  4X4S A;  2ZTC A;  4NLN A;  4WC7 A;  4JK1 A;  5KFC A;  1S0N A;  1KFS A;  4DS5 A;  4RWQ A;  4UAZ A;  4DQI A;  4KLS A;  4KLT A;  4WC2 A;  4DLG A;  9ICT A;  4RQ3 A;  2W8L A;  4QW8 A;  1SZP A;  5F9N A;  1PZN A;  4DL2 A;  5J0Y A;  3H40 A;  4DL4 A;  4O9M A;  1S77 D;  8ICV A;  9ICA A;  8ICC A;  3GV5 B;  1XWL A;  4EYH B;  3H8J A;  3OHB A;  5J2H A;  4DLE A;  5IIN A;  4FHP A;  1A76 A;  4Q45 A;  2PXI A;  7ICN A;  1WCL A;  5KT7 A;  3QZ8 A;  5KFA A;  2HHS A;  5J2I A;  3TAR A;  1SL0 A;  4M9N A;  4E7X A;  1RPL A;  1TFR A;  4TQR A;  4DSJ A;  4RQ4 A;  4J9P A;  4PHP A;  8ICR A;  1MIV A;  3H7I A;  4YVZ A;  3RH6 A;  4G3I A;  1BNP A;  1ZQT A;  2DR9 A;  2KZ3 A;  1S76 D;  3PW0 A;  5DGA A;  2J6U A;  4B9T A;  3C18 A;  4QZA A;  3MR5 A;  8ICE A;  3NTU A;  1V9P A;  1NZP A;  4X0B A;  4TUP A;  4JV0 A;  5KFJ A;  1ZQB A;  4YMM A;  5F2V O;  3WFS C;  3GIM A;  9ICL A;  3GIK A;  1XC9 A;  2IA6 A;  4XQ8 A;  9ICR A;  2I1Q A;  5KG2 A;  2UVV A;  3H39 A;  4NXZ A;  1HJP A;  4ELU A;  5HRI A;  4YD2 A;  1X9W A;  4I29 A;  4KLU A;  3BQ1 A;  2KZZ A;  8ICA A;  3JYY A;  3GDX A;  5HRF A;  4WCW A;  3H8S A;  3PNC A;  1N48 A;  3UQ2 A;  4P4O A;  9ICG A;  4X4T A;  5BOL A;  1NK6 A;  2BPF A;  4KLQ A;  7ICE A;  4IQU A;  4MFA A;  1OU5 A;  2HHQ A;  3AQK A;  4AT8 B;  2BCU A;  3JZ0 A;  7ICK A;  7ICJ A;  3AQL A;  4P4P A;  2VA2 A;  1HUO A;  4AT7 A;  4EYI B;  3GFK B;  9ICO A;  5CA7 A;  4BWJ A;  4M9H A;  4ECV A;  1TV9 A;  4DOC A;  1KFT A;  2F1J A;  1S0O A;  1TAU A;  1QTM A;  1ZQZ A;  1XS9 D;  2R8K A;  1ZQX A;  5J0T A;  4YFK A;  1BPX A;  1ZQW A;  5L1K A;  4FO6 A;  1UEU A;  1UT8 A;  4F91 B;  5KFH A;  3RBD A;  3C66 A;  4FH3 A;  1WCN A;  4QZD A;  4M0A A;  3RAQ A;  3RB3 A;  4P2H A;  4XRH A;  1L3V A;  2R8J A;  4NLG A;  1PX5 A;  4WBY A;  3OUY A;  1ZQC A;  2P6R A;  4KLG A;  2JZB B;  3TFR A;  2KTQ A;  1RYS A;  1XU4 A;  3K4G A;  5KG6 A;  3HW8 A;  3RJJ A;  3H3A A;  3T5L A;  2XGQ A;  3Q8M A;  5BOM A;  5HNK A;  1ZQE A;  4F4K A;  1DGS A;  9ICX A;  2ZH4 A;  5DB8 A;  3C5F A;  4BXO A;  3PW4 A;  1MIW A;  3B0Y A;  3RAX A;  4DEZ A;  4JV2 A;  4X0A A;  1ZQL A;  3ZDD A;  4I28 A;  2VAN A;  4I2H A;  3OSN A;  5KFL A;  5KFZ A;  5L1J A;  2BCV A;  3LQC B;  5KFE A;  4EP7 A;  1H38 A;  3RJF A;  1NK4 A;  3OGU A;  3QEA Z;  1UA1 A;  8ICO A;  4YCX A;  9ICQ A;  4DL6 A;  4WBZ A;  1TFW A;  4DSK A;  5KFN A;  4TUS A;  8ICI A;  5J0Q A;  5J2E A;  4ED7 A;  4KLM A;  4YR3 A;  1X9S A;  1XSP A;  1XSL A;  2IHN A;  3G6Y A;  4UD4 A;  4LT6 A;  3RJK A;  1ZQU A;  5KFS A;  4F2S A;  2DR5 A;  2DR7 A;  3IM1 A;  4FBU A;  2JEI A;  2MUT A;  4QWB A;  1U49 A;  4RZR A;  2FPK A;  3MGI A;  2UVR A;  4C8O A;  5DED A;  4YQW A;  2DFL A;  4J9M A;  2KZM A;  3PY8 A;  1XO1 A;  1VFG A;  5EOZ A;  4NM1 A;  4B9V A;  4C8M A;  4PH5 A;  3BQ0 A;  2PBE A;  4YR2 A;  9ICM A;  7ICF A;  2NRZ A;  3Q8L A;  3RJG A;  4ECW A;  1ZJN A;  2M2T A;  4QWA A;  4ECT A;  3Q8S B;  4I2C A;  1MSW D;  7ICH A;  4KMU A;  2HVI A;  2DRB A;  1Q79 A;  4ED1 A;  5L1I A;  3RH4 A;  1ZET A;  4Q8E A;  2JZB A;  3TI0 A;  1B22 A;  2F1I A;  5DGB A;  1CUK A;  3ISD A;  4J9O A;  1QSS A;  1NJY A;  1TKD A;  4UB1 A;  9ICF A;  4UD5 A;  1U47 A;  4F2R A;  4JWN A;  3FYH A;  7ICV A;  4J9R A;  1SL1 A;  3M9M B;  2HHX A;  4K4G A;  4ZH4 A;  4DQP A;  8ICH A;  2RDI A;  3Q8P B;  2NRK A;  3THV A;  1ZQK A;  3RB0 A;  1T3N A;  2KN7 A;  5KG3 A;  1DK3 A;  2O1P A;  2P66 A;  2V9W A;  1KLN A;  2V4R A;  8ICJ A;  3KHG A;  3PX6 A;  5KFM A;  4GXK A;  5HRK A;  1Q78 A;  5KFT A;  4WC4 A;  1U9L A;  4IRK A;  3ZD8 A;  4X5V A;  2XCA A;  4FHX A;  3OVS A;  4QWE A;  4QZ9 A;  5KT3 A;  4M47 A;  4MFC A;  2V4Q A;  5D46 A;  3RB6 A;  2BPG A;  1BPB A;  5DBC A;  4X4Q A;  3TFS A;  1YLQ A;  3HIY A;  4NY8 A;  3PR5 B;  4X4P A;  1Z3E B;  5KFX A;  1NO5 A;  4LZD A;  4F4Z A;  2NRW A;  2AGQ A;  4UB4 A;  2JEJ A;  2ZTE A;  5KFO A;  1X2I A;  5KFY A;  2DRA A;  1S97 A;  9ICP A;  1B43 A;  3M8S A;  1NK7 A;  4RU9 A;  4UBC A;  5CHG A;  1TVA A;  5KFV A;  4I2B A;  4I2E A;  3M9N B;  2PI5 A;  2M2U A;  3OUY B;  5J0O A;  4DWI A;  3Q8R B;  3MBY A;  2C2R A;  3RTV A;  1U45 A;  9ICS A;  2AQ4 A;  2NRV A;  5DB9 A;  5HML A;  5HP4 A;  2FMQ A;  7ICI A;  4Q8F A;  3V7J A;  5DDM A;  4PGQ A;  2DPI A;  4BXO B;  7ICP A;  2ZHA A;  4EBE A;  1Y88 A;  5J2D A;  1N56 A;  1ZQQ A;  5DKW A;  1NK9 A;  4GXJ A;  4YD1 A;  2BPC A;  3PW2 A;  4KLF A;  5IIM A;  1D8L A;  1TAQ A;  2KP7 A;  2Y1I A;  4X4V A;  2NRT A;  4Q44 A;  2W9B B;  5DDY A;  3HX0 A;  4YR0 A;  4J9N A;  1LV5 A;  4B9L A;  4S3N A;  4F8R A;  2MAX A;  5TZV A;  4IQV A;  1NK0 A;  3WFQ E;  4UQG A;  3AUO A;  1HUZ A;  4F93 B;  5CB1 A;  4RWO A;  3PW7 A;  3ISC A;  4ED3 A;  4O3Q A;  3KHR A;  4RQ7 A;  1D9D A;  4B9M A;  1QLN A;  8ICN A;  1R8C A;  4JWM A;  2MUT B;  4KIT B;  4UB3 A;  4F4X A;  1S9F A;  1X9M A;  2VA3 A;  1DK2 A;  1ZQG A;  5JUM A;  3RBE A;  4MEX A;  5DLF A;  7ICL A;  1K1S A;  4JUZ A;  4O0I A;  4NLZ A;  1F5A A;  4AT9 A;  3PX0 A;  4K4H A;  4Z6E A;  1DOQ A;  3AU6 A;  1D9F A;  2M2V A;  5HRD A;  4M5D A;  9ICW A;  4X4N A;  4K4I A;  2R8I A;  8ICG A;  5DQI A;  4X4U A;  1JXL A;  2FMS A;  4DSF A;  3C1Y A;  3C21 A;  9ICV A;  1ZQI A;  3EPI A;  5EWE A;  4ECQ A;  2JEG A;  1KNY A;  3NYB A;  2FLN A;  2BDP A;  2KFZ A;  4WC6 A;  3PV8 A;  1SKR A;  3SV4 A;  4HYK A;  3QEB Z;  3PO4 A;  3GV8 B;  4DOA A;  1D8Y A;  3JPT A;  4DL3 A;  2PFN A;  2A1J A;  5J2G A;  4KLH A;  3T5J A;  3HP6 A;  3MGH A;  5HHI A;  1NKE A;  4QW9 A;  8ICM A;  5KFI A;  4KLE A;  3TAN A;  3MAB A;  3UXP A;  2IHM A;  2J6S A;  5HRB A;  4EBK A;  5DB7 A;  4ECR A;  2XY5 A;  5HRH A;  5HRG A;  5DBB A;  4DQR A;  1ZQN A;  4PGY A;  2C2D A;  2W9B A;  3PML A;  3L9D A;  4X4R A;  2XY7 A;  3JPS A;  1VJ7 A;  5KFD A;  3EPG A;  4DS4 A;  3PVX A;  2C28 A;  5IIJ A;  4C8K A;  2UVU A;  3M9O B;  4RPX A;  4EZ9 A;  1TK8 A;  4KN4 A;  2BCQ A;  7ICS A;  4EBD A;  5L1L A;  4ED2 A;  4WC3 A;  3HJ4 A;  4YMO A;  4LZG A;  3QE9 Y;  4UAY A;  5BPC A;  4YP3 A;  2W9A A;  3N4M B;  2AQ0 A;  3MDA A;  2J6T A;  5DLG A;  3BJY A;  2R8H A;  1BPZ A;  3ZDA A;  8ICW A;  2W9M A;  5CR0 A;  3M8R A;  4QZ8 A;  5DG8 A;  4PHE A;  2OWO A;  3EWA A;  4XUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...