4PGQA

Structure of human dna polymerase beta complexed with g in the template base paired with incoming non-hydrolyzable ttp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
324
Chain Sequence
b'ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 112
structure length 324
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgqA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgqA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgqA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgqA03
3T5LA 4LZGA 8ICFA 5KFPA 4TUPA 3C5FA 3QEAZ 4DSIA 7ICSA 1JXEA 5KFTA 4DFJA 4DSEA 5KFXA 4YVZA 4QZ9A 4MFFA 2NRKA 4ATBA 3AU6A 4UD5A 1HUZA 5BOLA 4NLKA 5KFLA 1MIWA 2NRTA 4QWAA 4UB3A 3SV3A 5DG7A 1TK8A 5KTQA 5J2KA 8ICJA 2BCQA 9ICHA 4X4QA 1BPZA 4M0AA 1L3VA 9ICQA 1Q79A 1BPEA 3RR7A 4KLTA 1D9FA 5HRLA 5IILA 1NJWA 9ICSA 4M9NA 2NRZA 5J0RA 2IA6A 4AT8A 4I27A 1NK5A 1CEZA 2AU0A 4K4GA 3H4BA 2AGQA 4F4ZA 4QZDA 2ZH2A 5J2IA 1NJXA 3H39A 1K1QA 3ZD8A 1QSSA 2I9GA 7ICQA 3QE9Y 7ICEA 1DOQA 3MBYA 1NJYA 2J6TA 3ZDCA 4EBCA 4DFKA 8ICCA 4DSJA 1QSLA 5HMLA 4MFAA 3H7IA 1PZNA 4FS2A 3PX4A 4GC7A 2VA3A 3RJHA 2O5AA 9ICJA 3UQ0A 5DLFA 1ZQLA 4KLFA 5KG3A 4RWOA 4PHEA 8ICBA 4F2SA 5EWEA 1NJZA 3M9NB 1BNOA 4ECXA 2C28A 3TAPA 4EP7A 5L1JA 3EYZA 4QWCA 1S10A 3EW9A 4FS1A 3V6JA 4IQUA 4BWMA 4F4XA 4G3IA 2FPKA 2JZBA 1A76A 4I2HA 4M9GA 1S97A 4ECZA 9ICRA 4UB1A 2PFNA 5JUMA 5L1IA 1NK6A 4DL4A 4KMUA 3KTQA 4F50A 4Q43A 1UA0A 4DSKA 1Y88A 4DWIA 4PH5A 4M47A 4FH3A 1ZJMA 4R8UA 1AROP 7ICPA 3C1ZA 1NKBA 5IIKA 4RQ1A 1NK0A 8ICSA 2WTFA 3PW0A 4IRKA 5HHHA 1NK8A 4I2AA 2ZUCA 2MUTA 5KFAA 1KDHA 3C2KA 4YP3A 3M8RA 5CR0A 2FMPA 4IRDA 4NY8A 2W9MA 1ZQSA 4QZCA 4UB5A 4FHXA 4DLGA 4P4MA 4YMMA 4XRHA 3GIMA 4E0DA 4I2EA 4KLLA 1BPBA 8ICLA 1UT5A 5KFYA 4UQGA 4Q8EA 2PI5A 5J2EA 8ICZA 2Y1IA 4YD1A 5KT7A 2R8HA 1ZQTA 3Q8SB 2AJQA 1DK3A 1BPDA 5KFVA 1S0NA 2ZTCA 3PVXA 1TAUA 5J0QA 4RUAA 1T8EA 3ZDBA 5HRGA 2PFQA 7ICHA 2AGPA 3ZD9A 4S3NA 4O3NA 3MR3A 4O3OA 4DF4A 3C5GA 4XQ7A 1ZQMA 3PNCA 4J9MA 4B9SA 1IM4A 5L9XA 4BDPA 4X5VA 4IG8A 3AQMA 1BVSA 1S0OA 7ICNA 4MF2A 4QW8A 4IQTA 4TUSA 4ECTA 4NKTA 1TVAA 2HHWA 3HX0A 8ICTA 4DL5A 4X0AA 3ISBA 2ZTDA 1ZQKA 3GV5B 3PV8A 1BPYA 4EBDA 4X4OA 1ZQPA 2LYHA 2HHXA 1ZQZA 2AGOA 5HP4A 3C23A 4AT7A 4J9RA 4P4OA 4O3PA 3BQ1A 3Q8QB 3AQKA 4AT9A 5HRFA 5DLGA 4F4YA 7ICUA 9ICFA 4KLQA 2DR7A 4DSFA 2PBEA 4X4UA 5DB6A 4F5PA 5KG2A 1ZQEA 5L1LA 1MSWD 3H4DA 5J0OA 2B21A 4YMNA 1XS9D 5J2DA 5KFQA 4FBTA 2XO7A 9ICMA 4RWNA 5HRIA 3V7JA 4MFCA 2ID1A 4Q45A 3JPNA 3TFSA 2R8GA 4J9PA 4O9MA 7ICOA 1TFYA 1ZQWA 5HRBA 3RRGA 2W8LA 3Q8KA 2ASJA 2BCRA 3GFKB 4I2FA 5DB7A 4UAYA 5J29A 3PO5A 4WBZA 2UVVA 3UPSA 3AQLA 3OJUA 3UPQA 1D9DA 2FLNA 4I2BA 4UAWA 4RQ4A 3BQTA 4B9VA 7ICVA 1RXWA 4J9KA 4C8OA 3JPTA 4RPXA 4UAZA 4ECVA 3AQNA 2BKEA 5DGAA 5D4BA 2FMQA 4FHPA 2HHTA 3V6HA 8ICKA 2DR5A 4WCWA 5IIOA 4RQ5A 1RZTA 4J9OA 8ICRA 3WFSC 3BDPA 3HW8A 4KLSA 4AT8B 2BHNA 4RQ0A 4C8NA 4QZHA 2JEJA 3T5JA 1KSPA 7ICGA 2HVIA 2P66A 1R8AA 3H38A 4QWBA 2V9WA 4M2YA 2P6UA 1NK4A 2DPIA 3MABA 3HP6A 2HW3A 2Q0ZX 4RUCA 4DOBA 4YN4A 5CHGA 4UBCA 3HWTA 2RDJA 3SV4A 4KLMA 9ICIA 3OV7A 2VANA 3PR5B 3V72A 4I2IA 4O3SA 1F5AA 4UB2A 1MIYA 4WC7A 2ZH6A 4CCHA 4F8RA 2BQUA 1XC9A 4J9NA 5DB9A 5HRKA 3RBDA 4EBKA 1MC8A 4LVSA 2M2UA 1NK9A 4O5EA 3MR5A 3M9OB 4HYKA 2C2EA 2JZBB 1LV5A 8ICXA 2BE3A 3BJYA 4P4PA 1V4AA 4K4IA 5J2BA 3PX0A 3UXNA 4WBYA 2DPJA 2FLPA 3UXOA 3JPSA 8ICVA 8ICMA 3H8SA 4RZRA 4RT3A 4KN4A 3IHQB 4DLEA 4ECUA 2UVRA 8ICOA 2I1QA 1UEUA 5J2AA 2ZHAA 1BNPA 1ZQOA 1QSYA 9ICTA 1Z00A 2A1JA 3UQ2A 2C2RA 2ZH1A 4KLGA 3C1YA 2W9CA 1XSLA 5KG1A 3GV8B 3KHHA 2KTQA 2GWSA 5KFFA 3WFPA 3LWMA 3UXPA 3OUYA 1ZQJA 7ICTA 3THVA 3TQ1A 9ICOA 2FPMA 4PHPA 4IR9A 1FA0A 4YR3A 4YD2A 4DFMA 4FH5A 3SZ2A 9ICXA 1ZJNA 2IHNA 1SZPA 4C8MA 5J0PA 4TURA 3JPOA 1U4BA 1Q78A 4X4RA 5EWFA 1UA1A 3H8WA 4ECYA 5HREA 4ED8A 3H8JA 4PGYA 2C22A 1UEVA 5KFHA 2JEFA 4LZDA 3JZ0A 3GIKA 4X4PA 2BDPA 1DK2A 4DS4A 2DR8A 4B9UA 1KFTA 4YFKA 4F2RA 3MDAA 4DFPA 3MR6A 5J0TA 2R8KA 8ICWA 3SYZA 4JV1A 5KFOA 2BGWA 3MFIA 4NXZA 4BXOA 2KFZA 3FYHA 4EBJA 2ZUBA 1U45A 3RAQA 1JX4A 1CUKA 4RPYA 1TV9A 4JV0A 4X4SA 5KFEA 4ED0A 4Z6DA 1SKRA 2MAXA 4KTQA 4YR0A 4R66A 5HMMA 3GDXA 1H38A 5KFSA 4Z6EA 3MGHA 1TKDA 5DQGA 2ZHBA 8ICEA 1N56A 3EWAA 3GQCA 4RU9A 2W9BA 1ZQYA 8ICGA 5HRDA 5KG6A 2XY5A 1U49A 4KLDA 4WC4A 8ICYA 3NTUA 4MEXA 3MFHA 1S76D 4DL6A 1ZQIA 2UVWA 4PHAA 3RR8A 5DDYA 4DOAA 4PPXA 4J9QA 1TK0A 3M9MB 7ICFA 2ASLA 1MIVA 5KT5A 2BR0A 3MR2A 1S0VA 4AT9B 1TFWA 4YR2A 4O5KA 3ORYA 5DBCA 9ICEA 1R89A 3EZ5A 8ICHA 3RBEA 1NOMA 1BGXT 4ELUA 5BOMA 1S77D 1WCNA 3JPQA 2ZUDA 2KP7A 5CWRA 9ICAA 1R8CA 1NKCA 2PXIA 3PY8A 5DEDA 2HHSA 2F1HA 3JYYA 4GXIA 4X4TA 5J2JA 2VA2A 4NM1A 3Q8RB 7ICKA 1WCLA 3Q8MA 5J0WA 2IHMA 4RPZA 2W8KA 4O0IA 1ZQCA 4GXKA 3ETLA 2R8IA 4NLZA 1C7YA 4KLHA 5EWGA 4ECSA 1ZQFA 4I29A 2BPFA 5KFJA 1ZYQA 5KFBA 3E2EA 4RQ3A 3NYBA 4C8LA 4O3RA 3LQCB 1A77A 1HUOA 1XO1A 9ICUA 2M2WA 5J2CA 5KFZA 4Q8FA 3G6XA 5J2HA 4RQ2A 2XGPA 3IM1A 4QZ8A 3N97B 1KFDA 1QTMA 2R8JA 1U9LA 2NRXA 8ICQA 1D8YA 5KFNA 5DBBA 2Q66A 4M9JA 4JV2A 4WC1A 4F5NA 4DOCA 5DQIA 4FHVA 4IQVA 1SL1A 4NM2A 9ICNA 3L9DA 2KZMA 4ED7A 2NRVA 3RJJA 3JPPA 4KLJA 7ICMA 4ATBB 5DBAA 5KG7A 1JXLA 3WFRE 1U48A 3B0YA 4DQRA 2M2VA 3V7LA 3Q8PB 3PW5A 5KT3A 8ICPA 9ICBA 2ISPA 3WFOA 4FHWA 1OU5A 1VFGA 2XCAA 3OJSA 3OVBA 2O1PA 3LK9A 5J0UA 3ZDEA 5C5JA 1KNYA 1T3NA 4QWEA 3TARA 4ELTA 5IIJA 1ZETA 1UT8A 1SKSA 1SL0A 4M9LA 1YLQA 1TAQA 3JPRA 4DL2A 4B9LA 4YXJA 4X4VA 5HR9A 1ZQVA 2FMSA 4F5RA 2ZH9A 2F1IA 2ALZA 1BPXA 3RTVA 1NZPA 5HRHA 3PO4A 2DRAA 2ISOA 4RQ8A 4E7XA 4F5QA 2M2TA 5KFWA 4XQ8A 4F5OA 3RH4A 3HT3A 8ICUA 1S9FA 3EPIA 1T7PA 4QZBA 1N48A 4QZAA 4KLIA 4FHYA 4R65A 4KN7A 1KLNA 2ZH7A 3M8SA 4I2JA 4RQ7A 1ZQUA 2A1JB 4MF8A 1JQRA 2AQ0A 4QZFA 2P6RA 3RB0A 2NRWA 5KFRA 4YQWA 4EBEA 4YG2A 1JIHA 4JWMA 5KG4A 2XC9A 1TFRA 2HHUA 3OUYB 3QZ7A 4R63A 4F92B 3V7KA 5HHIA 1QLNA 3MGIA 3ZDAA 2BCVA 4YCXA 1WOTA 2FLLA 3ISCA 5HC9A 1NK7A 3OVSA 5BPCA 1X9MA 2OWOA 1B43A 3H3AA 2RFFA 5KFDA 5EOZA 2DR9A 4NKUA 4PGQA 4PGXA 2ATLA 4YMOA 2PFPA 2PFOA 4DQPA 1B22A 1R8BA 2KZZA 2XGQA 4M6WA 4R8UB 1ZQRA 5KFGA 3TFRA 4Z6CA 1X9SA 1PX5A 1JMSA 3Q8LA 2BQRA 2V4RA 4FO6A 3RRHA 5IIMA 4DF8A 1SL2A 4BXOB 2MUTB 4F4KA 5DGBA 4O5CA 1L5UA 5DKWA 1DGSA 3C18A 1JN3A 3TI0A 9ICWA 2XY7A 3ISDA 4DQSA 3RH6A 2BCSA 4F4WA 3PX6A 4PHDA 3RJEA 2F1JA 4RNNA 2W9BB 4GC6A 1HJPA 5KG5A 3GIIA 7ICJA 8ICAA 3EPGA 4RNOA 4DQQA 1NKEA 4EZ9A 2W9AA 3G6YA 5TZVA 2C2DA 1L3SA 1RYRA 3C66A 2BPGA 5KT4A 3RB4A 4B9NA 3OSNA 3H40A 3PW4A 1TK5A 4DSLA 1KEJA 5KFCA 4TQSA 3C2MA 4F3OA 3T5KA 4M04A 4B9TA 3HPOA 2ZJAA 4Z6FA 1SKWA 3PR4A 4FBUA 4I28A 1JAJA 8ICIA 3HIYA 4ED1A 4K4HA 3NGDA 1NO5A 3PW2A 5DQHA 4QZIA 4LT6A 5KFMA 1S0MA 2KN7A 1Z3EB 2IBKA 1X2IA 4M9HA 3WFQE 5J0XA 3MDCA 9ICPA 4M5DA 1U47A 1ZQBA 3LWLA 3BQ2A 4QZEA 3OHBA 2KZ3A 4AT7B 4UBBA 2UVUA 3C2LA 2HHVA 3RB6A 5D46A 5J0SA 2XCPA 2ZH5A 4IR1A 4TQRA 4MEYA 4XA5A 4F93B 3H37A 3RB3A 4ED6A 4XUSA 3RJGA 4WC2A 4ECRA 4RNMA 4Q44A 4DL3A 1LB2B 2VA8A 4JWNA 2ZTEA 4QWDA 7ICRA 3K4GA 4I2CA 1L3UA 2ZJ5A 3K75D 5CP2A 3OHAA 4DS5A 1RXVA 4DO9A 4GXJA 1ZQQA 5J2FA 3QEBZ 4TUQA 1L3TA 2BPCA 2PI4A 4EYHB 4UD4A 4NLGA 3KHGA 5KFUA 4P2HA 1XWLA 2DRBA 4UB4A 4WC0A 4YXMA 5KG0A 4DQIA 1MQ3A 2ZJ8A 2BQ3A 4ECWA 3TAQA 2ZH3A 4EEYA 2BCUA 4X4NA 3GIJA 4JUZA 7ICIA 5CB1A 1RPLA 3KHRA 5CJ7A 9ICGA 9ICVA 4ELVA 3C21A 2HHPA 5KFKA 5J0YA 2HVHA 9ICKA 2DFLA 4E8FA 1XU4A 4ED3A 3RAXA 4KITB 5DG8A 3GILA 3PW7A 9ICLA 4ECQA 1K1SA 1UETA 4I2GA 3HJ1A 5KT2A 7ICLA 4R64A 3KHLA 1IXRA 1MQ2A 1XSNA 4NLNA 4RWPA 3T5HA 1V9PA 4QZGA 4BGDA 4J9SA 1ZQAA 4WC6A 3PMLA 2AQ4A 4B9MA 4KLOA 5DECA 3LDAA 1ZQNA 3RJKA 5HNKA 3OSPA 3RJIA 5DDMA 1KTQA 1X9WA 3PMNA 4IRCA 5DB8A 3AUOA 5CA7A 3G6VA 2HHQA 4O3QA 1EXNA 1D8LA 3ZDDA 1KFSA 4RWQA 4WC5A 2ASDA 5F2VO 3OGUA 3B0XA 2IMWP 4QW9A 4E80A 3GV7B 2H5XA 4F91B 4J9LA 3TANA 1KRPA 4RT2A 5IIIA 3QZ8A 2V4QA 8ICNA 3HJ4A 4RQ6A 2J6UA 2JEIA 4JK1A 2XY6A 3AU2A 5L1KA 2JEGA 1ZQDA 4EZ6A 9ICCA 1XSPA 3N4MB 2RDIA 5KFIA 4ED2A 3T3FA 1RYSA 4DEZA 5F9NA 5J2GA 4EYIB 3V6KA 1T4GA 3RH5A 2J6SA 1COOA 4I2DA 2Y1JA 5IINA 1ZQHA 4IQWA 2DVIA 5DG9A 3SI8A 2M9NA 1ZQGA 4KLUA 5D49A 2ZH4A 3BQ0A 4C8KA 1ZQXA 2ZH8A 4M6WB 1Z00B 4KLEA 4WC3A 4ZH4A 5KT6A 2KFNA 3OVAA 2W9CB 5F9LA 2FPLA 3FDSA 4GLXA 3RJFA 4BWJA 4X0BA 1VJ7A 4DL7A
chains in the Genus database with same CATH superfamily
3D2SA 5ALIA 3K7DA 3C5FA 4TUPA 1JXEA 2NRKA 3AU6A 1HUZA 4QWAA 2KOBA 4UB3A 8ICJA 9ICHA 1BPEA 5IILA 1NJWA 1CEZA 4OAIZ 3JCFA 2AGQA 2G5IB 4F4ZA 2HBMA 5J2IA 3H39A 7ICQA 4MHVA 5HR7A 1DOQA 2J6TA 3ZDCA 4DFKA 3AM9A 3H7IA 2VA3A 2LYAA 5DLFA 4KLFA 5ALOA 5EWEA 1BNOA 2C28A 5ALKA 3EW9A 4IQUA 1B4FA 4C0ZA 2P35A 2ZIUB 5EE1A 4UB1A 2IOFA 4F50A 4Q43A 1IV8A 1N5XA 3NVOA 8ICSA 1B0XA 3PW0A 4NXTA 5HHHA 1NK8A 1KDHA 3C2KA 3M8RA 2W9MA 4FHXA 2Z7JA 1BPBA 4UQGA 4Q8EA 2W55A 1ZQTA 3Q8SB 2AJQA 5ALUA 1T8EA 5HRGA 1SWVA 2AGPA 3ZD9A 3MR3A 4DF4A 2QARA 3H0MB 4J9MA 1BVSA 1S0OA 5ALVA 4NXVA 4QW8A 4IQTA 2JHDA 4ECTA 1TVAA 3HX0A 8ICTA 4DL5A 2KICA 3PV8A 1ZQPA 3C23A 4AT7A 4ZOHC 4OAHA 5D61A 1O03A 3KD3A 5HRFA 4KLQA 4F5PA 5L1LA 2QB1A 3H4DA 4RWNA 5HRIA 2K8BB 4Q45A 2R8GA 5HRBA 2W8LA 2BCRA 3GFKB 2GH1A 4UAYA 3PO5A 3OJUA 2LI6A 4B9VA 4C8OA 4UAZA 5D4BA 1NI3A 2HHTA 4FHPA 5IIOA 4RQ5A 4J9OA 3LVWA 2JV3A 3BDPA 4KLSA 2CN1A 2E1FA 4LEVA 4AT8B 3IV6A 4RQ0A 3ALRA 2JEJA 4CGZA 2HVIA 3H38A 4QWBA 2DPIA 3NKUA 4YN4A 4UBCA 3HWTA 3V72A 2EDUA 4CE6A 2BQUA 4J9NA 5DB9A 5ALYA 4UB8U 4O5EA 4HYKA 3M9OB 3ICXA 1LV5A 2BE3A 1M6YA 4K9AA 4P4PA 1V4AA 2NO4A 2YMMA 3UXOA 1L6NA 4DLEA 4F71A 2I1QA 1ZRNA 2K4IA 5AKGA 4Y2VA 1BNPA 1Z00A 3UQ2A 4GIBA 3SAFA 2ZH1A 1A0PA 1XSLA 5KG1A 3OUYA 2RLTA 2RQ5A 3NRWA 3TQ1A 3WK9A 2W11A 3VC8A 4DFMA 9ICXA 4TURA 1UA1A 3C29A 4ECYA 4P0QB 4OJLA 3H8JA 4PGYA 5KL8B 2C22A 1UEVA 5KFHA 4X4PA 2DR8A 3MDAA 5CEHA 2R8KA 2MSNA 2BGWA 4P0PA 2ZUBA 1U45A 1JX4A 2G5HB 3H0LB 1SKRA 2MAXA 4YR0A 3MGVA 3GDXA 1XO0A 3AL0B 2W43A 4Z6EA 4O67A 5KG6A 1U49A 4WC4A 8ICYA 3NVWA 1S76D 5AI4A 1TK0A 3M9MB 7ICFA 1MIVA 5KT5A 1S0VA 1F5SA 2EZXA 4YR2A 4O5KA 3K1RB 3ORYA 5DBCA 2HBLA 2NYVA 2KP7A 2ZUDA 1R8CA 2AHOB 1NKCA 3JYYA 2QB0A 1RYUA 4GXIA 5J8YA 2H3IA 2MRLA 2E8OA 3TADC 4NLZA 3ETLA 1C7YA 2EWRA 5ALJA 4I29A 1F0MA 4RQ3A 3LQCB 4Q8FA 3G6XA 3IM1A 3N97B 2Q66A 4DFDA 2E3TA 4DOCA 5DQIA 4FHVA 4IQVA 1SL1A 1LKYA 4ED7A 7ICMA 5DBAA 1U48A 4DQRA 2CRXA 2ZIWA 1NZBA 1VFGA 3SR6A 3OJSA 4CNQA 2O1PA 5AIAA 1SV0A 4RQNA 4UASA 2K4EA 2IHOA 1T3NA 4UD5A 1ZETA 2NV3A 1TAQA 5ALWA 1XNSA 2YB1A 5HR9A 2JXJA 2ALZA 2DRAA 1S9FA 3EPIA 1Q3VA 1O08A 4QZAA 1WYGA 1FEZA 2K89A 3MCRA 2EANA 3N7SC 3M8SA 1JRPA 2A1JB 2XICA 2NRWA 3IG8A 3V7KA 4KB6A 2FLLA 2KHQA 3H3AA 2B0CA 2HOIA 5KFDA 4QNLA 4IL6U 5ALXA 4PGQA 4PGXA 2ATLA 1B22A 2PFOA 1R8BA 5E79U 4M6WA 4R8UB 1N63A 5ALGA 4K8VA 3Q8LA 2O6KA 2V4RA 1KKXA 4DF8A 4BXOB 2MUTB 3F2DA 4F4KA 3SD7A 4DQSA 5AKJA 2HOQA 4PHDA 4RNNA 2W9BB 4GC6A 5KG5A 8ICAA 1S5LU 4RNOA 1QH9A 1L3SA 2C2DA 5ALEA 2BPGA 5KT4A 3RB4A 4DSLA 1X42A 1IG6A 4AYBF 3HPOA 4I28A 1D8BA 3PR4A 4FBUA 1RM6C 4ED1A 3NGDA 3PW2A 5DQHA 5GTIU 1X2IA 4UARA 5AKHA 1ZQBA 3QUQA 3BQ2A 2YN4A 4NXUA 4UBBA 2ZH5A 3WK5A 4MEYA 3H37A 1N60A 4WC2A 1N2XA 4RNMA 4DL3A 2ZTEA 1L3UA 2DQNB 4DS5A 4DO9A 3M6KA 2BPCA 3QNMA 4P2HA 4OAGA 4UB4A 4C7YA 4YXMA 1PK3A 4X4NA 3GIJA 1X40A 3F53A 2XIDA 4ELVA 5KFKA 2HVHA 5JU5A 2HOFA 4K9BA 2YMPA 3HJ1A 5KT2A 4R64A 1IXRA 4NLNA 1XSNA 4WC6A 1PVRA 1ZQNA 3RJKA 3D2NA 3OSPA 5DDMA 1KTQA 1X9WA 3PMNA 1RQLA 2G08A 1EXNA 3ZDDA 5F2VO 3OGUA 4O6AA 4F91B 4RT2A 2V4QA 2BBHA 3NUQA 3N4MB 2WHEA 2GLEA 4DEZA 5J2GA 3RH5A 4IQWA 4I2DA 2Y1JA 1ZQHA 5KAFU 1ZQGA 3N28A 3BQ0A 5CFTA 1ZQXA 4KLEA 3D2QA 5F9LA 5JTGA 2RRDA 4X0BA 3T5LA 3GZFA 3QEAZ 4MFFA 4ATBA 4OJPA 5BOLA 3J81j 5KFLA 4OJOA 3SV3A 1TK8A 3AQEA 5TISU 2W3RA 4M0AA 1L8OA 1L3VA 1SXEA 1C20A 4KLTA 3KOOA 4M9NA 2NRZA 5AKIA 2ZH2A 2I9GA 7ICEA 3CP8A 1L7PA 3PSIA 3HJEA 4EBCA 4DSJA 1QSLA 3I28A 2O5AA 4MFAA 4GC7A 4O3MA 5KG3A 4PHEA 8ICBA 4EX7A 1Q3UA 3TAPA 4EP7A 1COKA 1YT3A 2YX8A 2DKZA 3V6JA 4BWMA 2FPKA 4AP9A 1A76A 4I2HA 5D62A 1S97A 4ECZA 5JUMA 1NK6A 4KMUA 4PH5A 1ZJMA 4O68A 1AROP 7ICPA 1NK0A 2ES6A 3CRXA 4IRKA 5AKEA 5CR0A 2FMPA 4NY8A 2HN2A 4DLGA 4KLLA 1OW5A 2EQYA 4LJXA 3UMCA 3SEIA 2Y1IA 4YD1A 2R8HA 2KHVA 5EE3A 1TAUA 5J0QA 4RUAA 3ZDBA 1FFUA 2PFQA 3QXGA 1ZXIA 5KL1B 2WFAA 4XQ7A 4CF5A 3C5GA 5C0YA 4U6PA 3PSTA 1IM4A 5L9XA 4X5VA 4IG8A 3AQMA 2YB4A 4NKTA 2B51A 3GV5B 3H0RB 4CDGA 2GOLA 2EH9A 4EBDA 2HHXA 1HIWA 1ZQZA 2AGOA 1FIQA 4Y2XA 5HP4A 3KKAC 2KE7A 4O3PA 3BQ1A 3QX7A 3AQKA 4DSFA 2PBEA 2QLTA 1ZQEA 2ZIVB 5KG2A 1MSWD 4Y2PA 5J0OA 2B21A 4YMNA 4FBTA 2Y9TA 4MFCA 3JPNA 3CNHA 3RRGA 4NJ8A 3UPQA 4UAWA 7ICVA 2WB1F 3A0HU 3JPTA 4ECVA 2BKEA 2FMQA 2DR5A 8ICKA 1RZTA 3WKBA 4EGWA 5AI6A 1Q8KA 4PL1A 7ICGA 2V9WA 2P6UA 5AKYA 2HW3A 1SXDA 2G07A 2VANA 2ZH6A 4I2IA 4USAA 4UB2A 1XC9A 5T14A 5HRKA 4HAIA 3MR5A 2EAOA 8ICXA 1J2MA 3BJYA 2OXOA 3PX0A 3UXNA 2DPJA 2FLPA 1V85A 8ICVA 4ECUA 4KN4A 3IHQB 8ICOA 2HN1A 5H2FU 5J2AA 4DCCA 1QSYA 9ICTA 5JRTA 4KLGA 3KHHA 5B5EU 7ICTA 3THVA 1WG8A 9ICOA 1QQ7A 2Y0SF 1OUQA 4YR3A 3SZ2A 2IHNA 5EE9A 1Q78A 4FZMA 3JPOA 3JZ0A 3GIKA 1DK2A 1YZ6A 4B9UA 4DFPA 8ICWA 5KFOA 5AKXA 3MFIA 3WK8A 3RAQA 2B6GA 1CUKA 2BDUA 3QU5A 4JV0A 1S8OA 4WQLA 4KTQA 5HMMA 3UMGA 5KFSA 1JUDA 8ICEA 3UMBA 1N56A 3EWAA 3GQCA 4RU9A 1ZQYA 8ICGA 2KJ9A 2JH1A 2VKQA 3NTUA 3MFHA 4DL6A 3KBBA 3RR8A 1VDVA 2ASLA 3MR2A 1TFWA 3N7PD 2KMDA 4Y2QA 3QU7A 1R89A 3EZ5A 8ICHA 4ELUA 5BOMA 4MKPA 2KD1A 2PXIA 2F1HA 2Q4TA 2VA2A 3BQ7A 4NM1A 2KV2A 1WCLA 3Q8MA 5J0WA 1P7DA 3QUCA 4O0IA 4GXKA 4KLHA 1ZQFA 2BPFA 3NYBA 5ALNA 4C8LA 1X6JA 3FAHA 5KFZA 4UW9A 3HKZF 4AYBC 2EZYA 3MC1A 2XGPA 4QZ8A 8ICQA 1D8YA 5KFNA 2G0AA 4F5NA 9ICNA 3L9DA 5AI5A 2M0NA 2KJ5A 1JXLA 3PW5A 5KT3A 2ISPA 4FHWA 3OVBA 3LK9A 4NL9C 1SL0A 1MN8A 3JPRA 4X4VA 1ZQVA 3CK6A 2FMSA 2ZH9A 2F1IA 3SAGA 1BPXA 4QIWF 5KFWA 4XQ8A 8ICUA 3HT3A 4QZBA 4KLIA 4FZLA 2HDOA 4KN7A 1KLNA 1KBUA 2JGAA 4UAUA 1JQRA 2KSOA 4EBEA 4YQWA 4EELA 3RFAA 3OUYB 3QZ7A 5HHIA 1QLNA 5AM1A 5K4LA 3M7DA 1X9MA 2OWOA 1B43A 5EE0A 2DR9A 4NKUA 2PFPA 4DQPA 3TFRA 5JTIA 1X9SA 2BQRA 1SL2A 3PSPA 2EZZA 2W03A 5DGBA 1DGJA 1L5UA 3C18A 1DGSA 4K96A 9ICWA 4F4WA 2ESEA 2HI0A 3RJEA 7ICJA 5AK3A 4DQQA 1A6SA 1JI7A 2JH7A 5AKZA 1FFVA 1KW4A 1ZD3A 2WF9A 3OSNA 3H40A 3LVVA 4F3OA 4K98A 4B9TA 2ZJAA 3BZCA 3RF9A 3ED5A 1RG6A 1NO5A 5KFMA 2IBKA 4M9HA 2OCEA 2KK0A 1X66A 9ICPA 1U47A 1TAMA 1UHUA 3C2LA 5D46A 4IR1A 4F93B 1DRGA 4ED6A 4XUSA 2PKEA 4ECRA 4CRXA 1LB2B 4JWNA 4I2CA 2WF7A 1ZQQA 1TE2A 4GXJA 5J2FA 4I0UA 5J8YC 4OJ6A 3M1YA 2PI4A 1XWLA 2DRBA 3N7RC 3WKCA 1IIPA 5AICA 1MQ3A 2ZJ8A 2BQ3A 5KAIU 2NO5A 1ED1A 4JUZA 3KHRA 9ICVA 3C21A 5J0YA 1VJ5A 4WOYA 1XU4A 4ED3A 4Y2JA 3PW7A 1URJA 4ECQA 4IC9A 4RWPA 3T5HA 1V9PA 4QZGA 2Y9UA 1ZQAA 3F5EA 3LDAA 4IRCA 5DB8A 4FE3A 5ALLA 1JROA 3WKDA 4O3QA 2H3ZA 1SV0C 1KFSA 3AQFA 2ASDA 3B0XA 3GV7B 1X6IA 1KRPA 4BX9C 5IIIA 8ICNA 2ZG6A 1XSPA 1HEKA 3T3FA 4KMOB 2J6SA 1COOA 2DVIA 5IINA 5DG9A 3SI8A 4KLUA 3ER9B 4C8KA 2FE9A 2KJ8A 4M6WB 4WC3A 3OVAA 4U7CA 2W9CB 4BWJA 4DL7A 2AXTU 8ICFA 5KFTA 4DFJA 4YVZA 4QZ9A 1PK1A 4UATA 3SQIA 3NS1A 1MIWA 4WCWA 2KG5A 1BPZA 9ICQA 1D9FA 3WKEA 3TACB 5J0RA 4I27A 1NK5A 2AU0A 4K4GA 2DBYA 1NJXA 1K1QA 1NJYA 2F2AB 4FS2A 3PX4A 3RJHA 9ICJA 1ZQLA 2WB1C 4RWOA 4F2SA 4ECXA 5B3PA 5L1JA 3EYZA 4QWCA 5AKKA 1S10A 2GAFD 3WK7A 4FS1A 5F3XB 4F4XA 2JZBA 5AM5A 3IG5A 4Y2TA 2G06A 1UA0A 4DSKA 1Y88A 4FH3A 1UQVA 4M47A 4R8UA 1KL9A 4OD0A 5G5GA 5AM3A 2KEYA 3NVZA 4I2AA 2ZUCA 2MUTA 4QZCA 4E0DA 5KFYA 5FP0A 2PI5A 8ICZA 3AN1A 4K97A 2ZTCA 2HMXA 1KQQA 7ICHA 4O3NA 1ZQMA 4B9SA 4BDPA 1SGGA 1N5WA 4TUSA 2Y0SC 1V38A 3ISBA 2ZTDA 4PZNA 2BBJA 1BPYA 1L7NA 2QKQA 4X4OA 2LYHA 4A8EA 1F44A 4FFDA 3Q8QB 2F3NA 4AT9A 5DLGA 4F4YA 2ZIXA 2LBOA 9ICFA 2DR7A 4X4UA 2HCFA 2D6FC 1XS9D 5KFQA 9ICMA 2YMLA 2ID1A 5HR6A 3TFSA 3LYSA 7ICOA 4J9PA 4XJEA 1ZQWA 2H3FA 4I2FA 5DB7A 5ALZA 5J29A 4WBZA 2UVVA 2FLNA 4I2BA 4RQ4A 3BQTA 1GPJA 1RXWA 4RPXA 1K5OA 3AQNA 4ICAA 5DGAA 2G09A 3V6HA 3OTQA 2F44A 3EUB2 3HW8A 2RP5A 2F8KA 4LEZA 5AKLA 4C8NA 3ONNA 2YQEA 3NASA 5B66U 3T5JA 1KSPA 1R8AA 1GO3F 3MABA 2MU2A 2Q0ZX 4RUCA 3SV4A 5CHGA 9ICIA 3PR5B 3QUBA 4O3SA 1F5AA 4CCHA 3DEEA 3HKZC 4F8RA 2DL0A 3BS7A 3F5AA 4EBKA 4LVSA 2M2UA 5AK5A 1NK9A 3HILA 4LEYA 2C2EA 5J2BA 3JPSA 8ICMA 2LKYA 3H8SA 4RZRA 4RT3A 2UVRA 3AEVA 2VJ5A 2ZHAA 2E8MA 2C2RA 5AM2A 4BJQA 2KTQA 2GWSA 3LWMA 3UXPA 1LVHA 1ZQJA 1ZJNA 3F2BA 4C8MA 5J0PA 1U4BA 4QIWC 5HREA 2FJ6A 3SAHA 2BDPA 1KFTA 4YFKA 3E58A 5J0TA 3SYZA 4JV1A 4JLXA 3FYHA 4EBJA 4X4SA 4RPYA 1TV9A 3ETRA 5KFEA 4R66A 1DXSA 1H38A 3MGHA 2ZHBA 5DQGA 3WKAA 2H3VA 4BUGA 1ZQIA 2UVWA 4PHAA 5DDYA 4DOAA 4PPXA 4J9QA 2BR0A 2JR5A 9ICEA 3OPXA 3GU3A 2ZXIA 3JPQA 5CWRA 2GO7A 4KM5A 4X4TA 7ICKA 3DV9A 4ACOA 5ALFA 1SIJA 4RPZA 4EX6A 5EWGA 4ECSA 5KFJA 5KFBA 1HUOA 2KVSA 1WUDA 1ZD2P 2DGZA 3U26A 2I5HA 3BS5B 2HSZA 2NRXA 3PSFA 4JV2A 4WC1A 2WF5A 4NM2A 1CRXA 3RJJA 3JPPA 4KLJA 3KKAA 3NVYA 2DF4B 1ZD5A 2M2VA 3V7LA 3Q8PB 8ICPA 4OAFA 3ZDEA 1KNYA 4ELTA 5IIJA 1Z4OA 1SKSA 5AI8A 4YXJA 4F5RA 4PJ0U 5HRHA 1FO4A 2VJ4A 1PUZA 3PO4A 2ISOA 4RQ8A 4F5QA 2M2TA 5A0LA 5D63A 1T7PA 4FHYA 4EEBA 2YMQA 4I2JA 4RQ7A 1ZQUA 5ALSA 4Y2YA 3S6JA 5KFRA 3FM9A 4YG2A 4JWMA 5KG4A 2XC9A 4R63A 3ZDAA 5ALHA 4YCXA 2BCVA 1WOTA 3ISCA 5HC9A 4PZOA 1NK7A 3OVSA 5BPCA 3QU2A 2WF6A 5EOZA 4WJ3B 3QYPA 3BZKA 2KZZA 1ZQRA 5KFGA 1ZQ1C 4Z6CA 1PX5A 1JMSA 4FO6A 2XVTA 3TKAA 5CRXA 4NLBA 4O5CA 1JN3A 2XY7A 3RH6A 2BCSA 3PX6A 4G9BA 1HJPA 3EPGA 4PL2A 1NKEA 1KN5A 3G6YA 5TZVA 3C66A 1RYRA 2QARB 3M6ZA 5KFCA 4TQSA 3C2MA 3F2CA 1L7MA 3HIYA 8ICIA 4K4HA 4LT6A 1ZOLA 2KN7A 1Z3EB 3MDCA 4QZEA 4AT7B 2UVUA 5J0SA 2XCPA 3E0FA 3R9KA 3RB3A 3RJGA 1N61A 2VIXA 4QWDA 7ICRA 2ZJ5A 5CP2A 3IRUA 1RXVA 2FDRA 2ZIUA 3QEBZ 2EAPA 4UB6U 4EYHB 4UD4A 4NLGA 4FZNA 4ECWA 3TAQA 2D8CA 4EEYA 2CPRA 1L8LA 1RPLA 5CJ7A 9ICGA 2HHPA 5AK4A 2LMRA 3L5KA 4KITB 5DG8A 9ICLA 4F72A 1UETA 4EENA 1MQ2A 4BGDA 3PMLA 3L3FX 4B9MA 3WU2U 4KLOA 5DECA 2WAQF 4NWIA 3RJIA 3AUOA 3PZPA 5CA7A 4RWQA 1J2NA 4E80A 4GFJA 2KSOB 2H5XA 4C4SA 2ZXHA 3TANA 4WQKA 3QZ8A 2J6UA 2JEIA 2KVCA 4JK1A 5L1KA 2JEGA 1ZQDA 9ICCA 2ODGA 4ED2A 4EYIB 2XI9A 2LM1A 2ZH4A 2L5YA 3SENA 2ZH8A 1Z00B 1VLBA 1PVPA 2KFNA 2A3VA 4GLXA 2FPLA 3FDSA 1VJ7A 2HHWA 4LZGA 3DDHA 4NL9A 5KFPA 4DSIA 7ICSA 4DSEA 5GTHU 5KFXA 2W54A 1Z1VA 2YY6A 4NLKA 2NRTA 3IN5A 4X0AA 5DG7A 4X4QA 5KTQA 5J2KA 2BCQA 2A1AA 1Q79A 5HRLA 3RR7A 4Y2SA 9ICSA 2KKVA 2HBKA 2IA6A 4AT8A 1WWVA 3H4BA 4P0PB 4QZDA 3ZD8A 1QSSA 3QE9Y 2MA1A 3MBYA 8ICCA 3ERCC 2PMZF 5HMLA 1PZNA 3T79A 2B4VA 3UQ0A 5AI0A 1NJZA 3M9NB 4K99A 1V97A 2OEHA 1ZRMA 1SV4A 4G3IA 1N62A 4M9GA 9ICRA 2QB0B 2PFNA 5L1IA 2W04A 4DL4A 3KTQA 2E1EA 2FCLA 4DWIA 1RQNA 3KZXA 3C1ZA 1NKBA 5IIKA 4RQ1A 5G5HA 2OHFA 2WTFA 1WWUA 3SMVA 4WH5A 5KFAA 4YP3A 4IRDA 2R18A 1ZQSA 4UB5A 4I2EA 4P4MA 4YMMA 1AQ6A 4XRHA 3GIMA 8ICLA 1UT5A 1L7OA 1T94A 5J2EA 1X9XA 4P0QA 5KT7A 2EAMA 1DK3A 1BPDA 5KFVA 1S0NA 2F76X 3PVXA 1LKYB 4S3NA 4LEWA 4O3OA 2K4HA 5CHEA 2AH5A 3IP4B 5AK6A 5KNIA 3PNCA 3ER8C 2ZIWB 7ICNA 4J03A 4MF2A 2DWQA 4US8A 1JALA 1ZQKA 4J9RA 4P4OA 3TADA 3KFUF 1CI4A 1YZ7A 2DKXA 7ICUA 1OXJA 5DB6A 5ALPA 5AIBA 4EV6A 5J2DA 1MA7A 2XO7A 5ALQA 3V7JA 4O9MA 1TFYA 2ASJA 3Q8KA 3FC4A 3ZI4A 3UPSA 4CF3A 4CF4A 3AQLA 1PK1B 1D9DA 4OO1J 4J9KA 4IS7A 8ICRA 3KZIU 2N1RA 4US9A 3PHZA 2BHNA 4NXXA 1PVQA 5CFUA 4JMUA 5ALRA 4QZHA 2IOFK 2P66A 4C7ZA 4M2YA 1NK4A 1UCVA 3HP6A 3QU4A 1UPHA 4DOBA 2RDJA 4KLMA 2W7PA 3OV7A 1MIYA 4WC7A 3NWIA 3RBDA 1MC8A 5ALTA 2JZBB 3QU9A 4K4IA 4WBYA 2E8NA 1UEUA 3L4PA 2HBJA 1ZQOA 2A1JA 2F8LA 3C1YA 2W9CA 3GV8B 5KFFA 3WFPA 3K1ZA 2OYYA 2FPMA 4PHPA 4IR9A 1FA0A 4FH5A 4YD2A 1SZPA 4X4RA 1SWWA 5CFSA 5EWFA 3H8WA 3H8MA 4ED8A 4JB3A 2D3DA 2JEFA 2JRZA 4LZDA 3UM9A 4DS4A 2H3QA 4F2RA 3MR6A 2KFZA 4BXOA 4NXZA 4OJ5A 3NRZA 2OM6A 3WK6A 4ED0A 4Z6DA 1TKDA 3I1YA 2W9BA 5HRDA 2XY5A 4KLDA 5ALMA 4MEXA 1Q46A 4NV0A 2KIWA 4JLZA 4KX5A 4AT9B 3NVVA 2ZIXB 1Z1BA 3RBEA 1NOMA 1BGXT 1S77D 1WCNA 9ICAA 3O0FA 3PY8A 5DEDA 5ALDA 2HHSA 1SZHA 5J2JA 3Q8RB 3CW2C 2IHMA 2W8KA 1ZQCA 2R8IA 1ZYQA 3E2EA 2W7OA 2K4PA 4O3RA 4OCZA 1A77A 2FI1A 1XO1A 9ICUA 2M2WA 5B3QA 5J2CA 4HX0A 5J2HA 1NNLA 4RQ2A 1KFDA 1QTMA 2R8JA 1U9LA 5DBBA 4M9JA 2BZFA 5AI9A 2KZMA 2NRVA 3WFRE 4ATBB 2B56A 5KG7A 2K8CB 3B0YA 9ICBA 4QJFB 3WFOA 1OU5A 3C28A 2XCAA 2F77X 1ECWA 5J0UA 5C5JA 4QWEA 3TARA 4M9LA 1UT8A 1YLQA 4DL2A 4B9LA 4FO1A 5L1MA 3WFSC 3EF2A 1NZPA 3RTVA 4E7XA 2E5SA 4F5OA 3RH4A 3VCBA 1N48A 2JMGA 4R65A 4C80A 2ZH7A 2IOHA 3HRDD 4MF8A 2AQ0A 4QZFA 2P6RA 3RB0A 1RDFA 1JIHA 1TFRA 2HHUA 2WF8A 4F92B 3MGIA 3A0BU 4KX3A 2RFFA 4NLCA 2WAQC 4YMOA 2LYBA 3WK4A 2XGQA 5AM4A 2GA9D 3RRHA 5IIMA 2LM4A 5DKWA 2DUYA 3TI0A 3ISDA 2KNJA 4Y2UA 2F1JA 3CYMA 3GIIA 4EZ9A 2W9AA 1QQ5A 4B9NA 3PW4A 1TK5A 1KEJA 3T5KA 4M04A 4Z6FA 1SKWA 1JAJA 4QZIA 1S0MA 3WFQE 5J0XA 4M5DA 3LWLA 3OWGA 3OHBA 2KZ3A 2HHVA 4B6JA 3RB6A 4TQRA 4XA5A 3D6JA 5AM0A 4Q44A 2VA8A 2K8AA 2RHFA 3K4GA 3K75D 3OHAA 2IUBA 1QCKA 4TUQA 1L3TA 2LHTA 4RQMA 1T3QA 2PMZC 5KFUA 3KHGA 4WC0A 5KG0A 4DQIA 4C4RA 2ZH3A 2BCUA 5CB1A 2A19A 2K60A 1J97A 2KKPA 9ICKA 2DFLA 4E8FA 3RAXA 3GILA 3I76A 1K1SA 4Y2RA 1Z4NA 4I2GA 2CXYA 2E8PA 7ICLA 3KHLA 3B9JA 2OH2A 2I6XA 4J9SA 2YTUA 4EEDA 3QUTA 2AQ4A 3IDWA 5HNKA 3G6VA 2HHQA 1Z19A 1D8LA 4WC5A 2IMWP 4QW9A 5AHXA 4J9LA 2KIVA 4UAVA 3HJ4A 4O69A 4RQ6A 1QQ6A 4N7RA 2XY6A 3AU2A 4C4TA 4EZ6A 4NXWA 2RDIA 5KFIA 1RYSA 1SB3C 4EEKA 5F9NA 3V6KA 7ICIA 1T4GA 2ZIVA 2M9NA 5D49A 2LPEA 4ZH4A 3BS5A 2W3SA 3AMZA 5KT6A 1ZD4A 3RJFA
chains in the Genus database with same CATH topology
3T5LA 4LZGA 8ICFA 5KFPA 4TUPA 3C5FA 3QEAZ 4DSIA 7ICSA 1JXEA 5KFTA 4DFJA 4DSEA 5KFXA 4YVZA 4QZ9A 4MFFA 2NRKA 4ATBA 3AU6A 4UD5A 1HUZA 5BOLA 4NLKA 5KFLA 1MIWA 2NRTA 4QWAA 4UB3A 3SV3A 5DG7A 1TK8A 5KTQA 5J2KA 8ICJA 2BCQA 9ICHA 4X4QA 1BPZA 4M0AA 1L3VA 9ICQA 1Q79A 1BPEA 3RR7A 4KLTA 1D9FA 5HRLA 5IILA 1NJWA 9ICSA 4M9NA 2NRZA 5J0RA 2IA6A 4AT8A 4I27A 1NK5A 1CEZA 2AU0A 4K4GA 3H4BA 2AGQA 4F4ZA 4QZDA 2ZH2A 5J2IA 1NJXA 3H39A 1K1QA 3ZD8A 1QSSA 2I9GA 7ICQA 3QE9Y 7ICEA 1DOQA 3MBYA 1NJYA 2J6TA 3ZDCA 4EBCA 4DFKA 8ICCA 4DSJA 1QSLA 5HMLA 4MFAA 3H7IA 1PZNA 4FS2A 3PX4A 4GC7A 2VA3A 3RJHA 2O5AA 9ICJA 3UQ0A 5DLFA 1ZQLA 4KLFA 5KG3A 4RWOA 4PHEA 8ICBA 4F2SA 5EWEA 1NJZA 3M9NB 1BNOA 4ECXA 2C28A 3TAPA 4EP7A 5L1JA 3EYZA 4QWCA 1S10A 3EW9A 4FS1A 3V6JA 4IQUA 4BWMA 4F4XA 4G3IA 2FPKA 2JZBA 1A76A 4I2HA 4M9GA 1S97A 4ECZA 9ICRA 4UB1A 2PFNA 5JUMA 5L1IA 1NK6A 4DL4A 4KMUA 3KTQA 4F50A 4Q43A 1UA0A 4DSKA 1Y88A 4DWIA 4PH5A 4M47A 4FH3A 1ZJMA 4R8UA 1AROP 7ICPA 3C1ZA 1NKBA 5IIKA 4RQ1A 1NK0A 8ICSA 2WTFA 3PW0A 4IRKA 5HHHA 1NK8A 4I2AA 2ZUCA 2MUTA 5KFAA 1KDHA 3C2KA 4YP3A 3M8RA 5CR0A 2FMPA 4IRDA 4NY8A 2W9MA 1ZQSA 4QZCA 4UB5A 4FHXA 4DLGA 4P4MA 4YMMA 4XRHA 3GIMA 4E0DA 4I2EA 4KLLA 1BPBA 8ICLA 1UT5A 5KFYA 4UQGA 4Q8EA 2PI5A 5J2EA 8ICZA 2Y1IA 4YD1A 5KT7A 2R8HA 1ZQTA 3Q8SB 2AJQA 1DK3A 1BPDA 5KFVA 1S0NA 2ZTCA 3PVXA 1TAUA 5J0QA 4RUAA 1T8EA 3ZDBA 5HRGA 2PFQA 7ICHA 2AGPA 3ZD9A 4S3NA 4O3NA 3MR3A 4O3OA 4DF4A 3C5GA 4XQ7A 1ZQMA 3PNCA 4J9MA 4B9SA 1IM4A 5L9XA 4BDPA 4X5VA 4IG8A 3AQMA 1BVSA 1S0OA 7ICNA 4MF2A 4QW8A 4IQTA 4TUSA 4ECTA 4NKTA 1TVAA 2HHWA 3HX0A 8ICTA 4DL5A 4X0AA 3ISBA 2ZTDA 1ZQKA 3GV5B 3PV8A 1BPYA 4EBDA 4X4OA 1ZQPA 2LYHA 2HHXA 1ZQZA 2AGOA 5HP4A 3C23A 4AT7A 4J9RA 4P4OA 4O3PA 3BQ1A 3Q8QB 3AQKA 4AT9A 5HRFA 5DLGA 4F4YA 7ICUA 9ICFA 4KLQA 2DR7A 4DSFA 2PBEA 4X4UA 5DB6A 4F5PA 5KG2A 1ZQEA 5L1LA 1MSWD 3H4DA 5J0OA 2B21A 4YMNA 1XS9D 5J2DA 5KFQA 4FBTA 2XO7A 9ICMA 4RWNA 5HRIA 3V7JA 4MFCA 2ID1A 4Q45A 3JPNA 3TFSA 2R8GA 4J9PA 4O9MA 7ICOA 1TFYA 1ZQWA 5HRBA 3RRGA 2W8LA 3Q8KA 2ASJA 2BCRA 3GFKB 4I2FA 5DB7A 4UAYA 5J29A 3PO5A 4WBZA 2UVVA 3UPSA 3AQLA 3OJUA 3UPQA 1D9DA 2FLNA 4I2BA 4UAWA 4RQ4A 3BQTA 4B9VA 7ICVA 1RXWA 4J9KA 4C8OA 3JPTA 4RPXA 4UAZA 4ECVA 3AQNA 2BKEA 5DGAA 5D4BA 2FMQA 4FHPA 2HHTA 3V6HA 8ICKA 2DR5A 4WCWA 5IIOA 4RQ5A 1RZTA 4J9OA 8ICRA 3WFSC 3BDPA 3HW8A 4KLSA 4AT8B 2BHNA 4RQ0A 4C8NA 4QZHA 2JEJA 3T5JA 1KSPA 7ICGA 2HVIA 2P66A 1R8AA 3H38A 4QWBA 2V9WA 4M2YA 2P6UA 1NK4A 2DPIA 3MABA 3HP6A 2HW3A 2Q0ZX 4RUCA 4DOBA 4YN4A 5CHGA 4UBCA 3HWTA 2RDJA 3SV4A 4KLMA 9ICIA 3OV7A 2VANA 3PR5B 3V72A 4I2IA 4O3SA 1F5AA 4UB2A 1MIYA 4WC7A 2ZH6A 4CCHA 4F8RA 2BQUA 1XC9A 4J9NA 5DB9A 5HRKA 3RBDA 4EBKA 1MC8A 4LVSA 2M2UA 1NK9A 4O5EA 3MR5A 3M9OB 4HYKA 2C2EA 2JZBB 1LV5A 8ICXA 2BE3A 3BJYA 4P4PA 1V4AA 4K4IA 5J2BA 3PX0A 3UXNA 4WBYA 2DPJA 2FLPA 3UXOA 3JPSA 8ICVA 8ICMA 3H8SA 4RZRA 4RT3A 4KN4A 3IHQB 4DLEA 4ECUA 2UVRA 8ICOA 2I1QA 1UEUA 5J2AA 2ZHAA 1BNPA 1ZQOA 1QSYA 9ICTA 1Z00A 2A1JA 3UQ2A 2C2RA 2ZH1A 4KLGA 3C1YA 2W9CA 1XSLA 5KG1A 3GV8B 3KHHA 2KTQA 2GWSA 5KFFA 3WFPA 3LWMA 3UXPA 3OUYA 1ZQJA 7ICTA 3THVA 3TQ1A 9ICOA 2FPMA 4PHPA 4IR9A 1FA0A 4YR3A 4YD2A 4DFMA 4FH5A 3SZ2A 9ICXA 1ZJNA 2IHNA 1SZPA 4C8MA 5J0PA 4TURA 3JPOA 1U4BA 1Q78A 4X4RA 5EWFA 1UA1A 3H8WA 4ECYA 5HREA 4ED8A 3H8JA 4PGYA 2C22A 1UEVA 5KFHA 2JEFA 4LZDA 3JZ0A 3GIKA 4X4PA 2BDPA 1DK2A 4DS4A 2DR8A 4B9UA 1KFTA 4YFKA 4F2RA 3MDAA 4DFPA 3MR6A 5J0TA 2R8KA 8ICWA 3SYZA 4JV1A 5KFOA 2BGWA 3MFIA 4NXZA 4BXOA 2KFZA 3FYHA 4EBJA 2ZUBA 1U45A 3RAQA 1JX4A 1CUKA 4RPYA 1TV9A 4JV0A 4X4SA 5KFEA 4ED0A 4Z6DA 1SKRA 2MAXA 4KTQA 4YR0A 4R66A 5HMMA 3GDXA 1H38A 5KFSA 4Z6EA 3MGHA 1TKDA 5DQGA 2ZHBA 8ICEA 1N56A 3EWAA 3GQCA 4RU9A 2W9BA 1ZQYA 8ICGA 5HRDA 5KG6A 2XY5A 1U49A 4KLDA 4WC4A 8ICYA 3NTUA 4MEXA 3MFHA 1S76D 4DL6A 1ZQIA 2UVWA 4PHAA 3RR8A 5DDYA 4DOAA 4PPXA 4J9QA 1TK0A 3M9MB 7ICFA 2ASLA 1MIVA 5KT5A 2BR0A 3MR2A 1S0VA 4AT9B 1TFWA 4YR2A 4O5KA 3ORYA 5DBCA 9ICEA 1R89A 3EZ5A 8ICHA 3RBEA 1NOMA 1BGXT 4ELUA 5BOMA 1S77D 1WCNA 3JPQA 2ZUDA 2KP7A 5CWRA 9ICAA 1R8CA 1NKCA 2PXIA 3PY8A 5DEDA 2HHSA 2F1HA 3JYYA 4GXIA 4X4TA 5J2JA 2VA2A 4NM1A 3Q8RB 7ICKA 1WCLA 3Q8MA 5J0WA 2IHMA 4RPZA 2W8KA 4O0IA 1ZQCA 4GXKA 3ETLA 2R8IA 4NLZA 1C7YA 4KLHA 5EWGA 4ECSA 1ZQFA 4I29A 2BPFA 5KFJA 1ZYQA 5KFBA 3E2EA 4RQ3A 3NYBA 4C8LA 4O3RA 3LQCB 1A77A 1HUOA 1XO1A 9ICUA 2M2WA 5J2CA 5KFZA 4Q8FA 3G6XA 5J2HA 4RQ2A 2XGPA 3IM1A 4QZ8A 3N97B 1KFDA 1QTMA 2R8JA 1U9LA 2NRXA 8ICQA 1D8YA 5KFNA 5DBBA 2Q66A 4M9JA 4JV2A 4WC1A 4F5NA 4DOCA 5DQIA 4FHVA 4IQVA 1SL1A 4NM2A 9ICNA 3L9DA 2KZMA 4ED7A 2NRVA 3RJJA 3JPPA 4KLJA 7ICMA 4ATBB 5DBAA 5KG7A 1JXLA 3WFRE 1U48A 3B0YA 4DQRA 2M2VA 3V7LA 3Q8PB 3PW5A 5KT3A 8ICPA 9ICBA 2ISPA 3WFOA 4FHWA 1OU5A 1VFGA 2XCAA 3OJSA 3OVBA 2O1PA 3LK9A 5J0UA 3ZDEA 5C5JA 1KNYA 1T3NA 4QWEA 3TARA 4ELTA 5IIJA 1ZETA 1UT8A 1SKSA 1SL0A 4M9LA 1YLQA 1TAQA 3JPRA 4DL2A 4B9LA 4YXJA 4X4VA 5HR9A 1ZQVA 2FMSA 4F5RA 2ZH9A 2F1IA 2ALZA 1BPXA 3RTVA 1NZPA 5HRHA 3PO4A 2DRAA 2ISOA 4RQ8A 4E7XA 4F5QA 2M2TA 5KFWA 4XQ8A 4F5OA 3RH4A 3HT3A 8ICUA 1S9FA 3EPIA 1T7PA 4QZBA 1N48A 4QZAA 4KLIA 4FHYA 4R65A 4KN7A 1KLNA 2ZH7A 3M8SA 4I2JA 4RQ7A 1ZQUA 2A1JB 4MF8A 1JQRA 2AQ0A 4QZFA 2P6RA 3RB0A 2NRWA 5KFRA 4YQWA 4EBEA 4YG2A 1JIHA 4JWMA 5KG4A 2XC9A 1TFRA 2HHUA 3OUYB 3QZ7A 4R63A 4F92B 3V7KA 5HHIA 1QLNA 3MGIA 3ZDAA 2BCVA 4YCXA 1WOTA 2FLLA 3ISCA 5HC9A 1NK7A 3OVSA 5BPCA 1X9MA 2OWOA 1B43A 3H3AA 2RFFA 5KFDA 5EOZA 2DR9A 4NKUA 4PGQA 4PGXA 2ATLA 4YMOA 2PFPA 2PFOA 4DQPA 1B22A 1R8BA 2KZZA 2XGQA 4M6WA 4R8UB 1ZQRA 5KFGA 3TFRA 4Z6CA 1X9SA 1PX5A 1JMSA 3Q8LA 2BQRA 2V4RA 4FO6A 3RRHA 5IIMA 4DF8A 1SL2A 4BXOB 2MUTB 4F4KA 5DGBA 4O5CA 1L5UA 5DKWA 1DGSA 3C18A 1JN3A 3TI0A 9ICWA 2XY7A 3ISDA 4DQSA 3RH6A 2BCSA 4F4WA 3PX6A 4PHDA 3RJEA 2F1JA 4RNNA 2W9BB 4GC6A 1HJPA 5KG5A 3GIIA 7ICJA 8ICAA 3EPGA 4RNOA 4DQQA 1NKEA 4EZ9A 2W9AA 3G6YA 5TZVA 2C2DA 1L3SA 1RYRA 3C66A 2BPGA 5KT4A 3RB4A 4B9NA 3OSNA 3H40A 3PW4A 1TK5A 4DSLA 1KEJA 5KFCA 4TQSA 3C2MA 4F3OA 3T5KA 4M04A 4B9TA 3HPOA 2ZJAA 4Z6FA 1SKWA 3PR4A 4FBUA 4I28A 1JAJA 8ICIA 3HIYA 4ED1A 4K4HA 3NGDA 1NO5A 3PW2A 5DQHA 4QZIA 4LT6A 5KFMA 1S0MA 2KN7A 1Z3EB 2IBKA 1X2IA 4M9HA 3WFQE 5J0XA 3MDCA 9ICPA 4M5DA 1U47A 1ZQBA 3LWLA 3BQ2A 4QZEA 3OHBA 2KZ3A 4AT7B 4UBBA 2UVUA 3C2LA 2HHVA 3RB6A 5D46A 5J0SA 2XCPA 2ZH5A 4IR1A 4TQRA 4MEYA 4XA5A 4F93B 3H37A 3RB3A 4ED6A 4XUSA 3RJGA 4WC2A 4ECRA 4RNMA 4Q44A 4DL3A 1LB2B 2VA8A 4JWNA 2ZTEA 4QWDA 7ICRA 3K4GA 4I2CA 1L3UA 2ZJ5A 3K75D 5CP2A 3OHAA 4DS5A 1RXVA 4DO9A 4GXJA 1ZQQA 5J2FA 3QEBZ 4TUQA 1L3TA 2BPCA 2PI4A 4EYHB 4UD4A 4NLGA 3KHGA 5KFUA 4P2HA 1XWLA 2DRBA 4UB4A 4WC0A 4YXMA 5KG0A 4DQIA 1MQ3A 2ZJ8A 2BQ3A 4ECWA 3TAQA 2ZH3A 4EEYA 2BCUA 4X4NA 3GIJA 4JUZA 7ICIA 5CB1A 1RPLA 3KHRA 5CJ7A 9ICGA 9ICVA 4ELVA 3C21A 2HHPA 5KFKA 5J0YA 2HVHA 9ICKA 2DFLA 4E8FA 1XU4A 4ED3A 3RAXA 4KITB 5DG8A 3GILA 3PW7A 9ICLA 4ECQA 1K1SA 1UETA 4I2GA 3HJ1A 5KT2A 7ICLA 4R64A 3KHLA 1IXRA 1MQ2A 1XSNA 4NLNA 4RWPA 3T5HA 1V9PA 4QZGA 4BGDA 4J9SA 1ZQAA 4WC6A 3PMLA 2AQ4A 4B9MA 4KLOA 5DECA 3LDAA 1ZQNA 3RJKA 5HNKA 3OSPA 3RJIA 5DDMA 1KTQA 1X9WA 3PMNA 4IRCA 5DB8A 3AUOA 5CA7A 3G6VA 2HHQA 4O3QA 1EXNA 1D8LA 3ZDDA 1KFSA 4RWQA 4WC5A 2ASDA 5F2VO 3OGUA 3B0XA 2IMWP 4QW9A 4E80A 3GV7B 2H5XA 4F91B 4J9LA 3TANA 1KRPA 4RT2A 5IIIA 3QZ8A 2V4QA 8ICNA 3HJ4A 4RQ6A 2J6UA 2JEIA 4JK1A 2XY6A 3AU2A 5L1KA 2JEGA 1ZQDA 4EZ6A 9ICCA 1XSPA 3N4MB 2RDIA 5KFIA 4ED2A 3T3FA 1RYSA 4DEZA 5F9NA 5J2GA 4EYIB 3V6KA 1T4GA 3RH5A 2J6SA 1COOA 4I2DA 2Y1JA 5IINA 1ZQHA 4IQWA 2DVIA 5DG9A 3SI8A 2M9NA 1ZQGA 4KLUA 5D49A 2ZH4A 3BQ0A 4C8KA 1ZQXA 2ZH8A 4M6WB 1Z00B 4KLEA 4WC3A 4ZH4A 5KT6A 2KFNA 3OVAA 2W9CB 5F9LA 2FPLA 3FDSA 4GLXA 3RJFA 4BWJA 4X0BA 1VJ7A 4DL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T5L A;  4LZG A;  8ICF A;  5KFP A;  4TUP A;  3C5F A;  3QEA Z;  4DSI A;  7ICS A;  1JXE A;  5KFT A;  4DFJ A;  4DSE A;  5KFX A;  4YVZ A;  4QZ9 A;  4MFF A;  2NRK A;  4ATB A;  3AU6 A;  4UD5 A;  1HUZ A;  5BOL A;  4NLK A;  5KFL A;  1MIW A;  2NRT A;  4QWA A;  4UB3 A;  3SV3 A;  5DG7 A;  1TK8 A;  5KTQ A;  5J2K A;  8ICJ A;  2BCQ A;  9ICH A;  4X4Q A;  1BPZ A;  4M0A A;  1L3V A;  9ICQ A;  1Q79 A;  1BPE A;  3RR7 A;  4KLT A;  1D9F A;  5HRL A;  5IIL A;  1NJW A;  9ICS A;  4M9N A;  2NRZ A;  5J0R A;  2IA6 A;  4AT8 A;  4I27 A;  1NK5 A;  1CEZ A;  2AU0 A;  4K4G A;  3H4B A;  2AGQ A;  4F4Z A;  4QZD A;  2ZH2 A;  5J2I A;  1NJX A;  3H39 A;  1K1Q A;  3ZD8 A;  1QSS A;  2I9G A;  7ICQ A;  3QE9 Y;  7ICE A;  1DOQ A;  3MBY A;  1NJY A;  2J6T A;  3ZDC A;  4EBC A;  4DFK A;  8ICC A;  4DSJ A;  1QSL A;  5HML A;  4MFA A;  3H7I A;  1PZN A;  4FS2 A;  3PX4 A;  4GC7 A;  2VA3 A;  3RJH A;  2O5A A;  9ICJ A;  3UQ0 A;  5DLF A;  1ZQL A;  4KLF A;  5KG3 A;  4RWO A;  4PHE A;  8ICB A;  4F2S A;  5EWE A;  1NJZ A;  3M9N B;  1BNO A;  4ECX A;  2C28 A;  3TAP A;  4EP7 A;  5L1J A;  3EYZ A;  4QWC A;  1S10 A;  3EW9 A;  4FS1 A;  3V6J A;  4IQU A;  4BWM A;  4F4X A;  4G3I A;  2FPK A;  2JZB A;  1A76 A;  4I2H A;  4M9G A;  1S97 A;  4ECZ A;  9ICR A;  4UB1 A;  2PFN A;  5JUM A;  5L1I A;  1NK6 A;  4DL4 A;  4KMU A;  3KTQ A;  4F50 A;  4Q43 A;  1UA0 A;  4DSK A;  1Y88 A;  4DWI A;  4PH5 A;  4M47 A;  4FH3 A;  1ZJM A;  4R8U A;  1ARO P;  7ICP A;  3C1Z A;  1NKB A;  5IIK A;  4RQ1 A;  1NK0 A;  8ICS A;  2WTF A;  3PW0 A;  4IRK A;  5HHH A;  1NK8 A;  4I2A A;  2ZUC A;  2MUT A;  5KFA A;  1KDH A;  3C2K A;  4YP3 A;  3M8R A;  5CR0 A;  2FMP A;  4IRD A;  4NY8 A;  2W9M A;  1ZQS A;  4QZC A;  4UB5 A;  4FHX A;  4DLG A;  4P4M A;  4YMM A;  4XRH A;  3GIM A;  4E0D A;  4I2E A;  4KLL A;  1BPB A;  8ICL A;  1UT5 A;  5KFY A;  4UQG A;  4Q8E A;  2PI5 A;  5J2E A;  8ICZ A;  2Y1I A;  4YD1 A;  5KT7 A;  2R8H A;  1ZQT A;  3Q8S B;  2AJQ A;  1DK3 A;  1BPD A;  5KFV A;  1S0N A;  2ZTC A;  3PVX A;  1TAU A;  5J0Q A;  4RUA A;  1T8E A;  3ZDB A;  5HRG A;  2PFQ A;  7ICH A;  2AGP A;  3ZD9 A;  4S3N A;  4O3N A;  3MR3 A;  4O3O A;  4DF4 A;  3C5G A;  4XQ7 A;  1ZQM A;  3PNC A;  4J9M A;  4B9S A;  1IM4 A;  5L9X A;  4BDP A;  4X5V A;  4IG8 A;  3AQM A;  1BVS A;  1S0O A;  7ICN A;  4MF2 A;  4QW8 A;  4IQT A;  4TUS A;  4ECT A;  4NKT A;  1TVA A;  2HHW A;  3HX0 A;  8ICT A;  4DL5 A;  4X0A A;  3ISB A;  2ZTD A;  1ZQK A;  3GV5 B;  3PV8 A;  1BPY A;  4EBD A;  4X4O A;  1ZQP A;  2LYH A;  2HHX A;  1ZQZ A;  2AGO A;  5HP4 A;  3C23 A;  4AT7 A;  4J9R A;  4P4O A;  4O3P A;  3BQ1 A;  3Q8Q B;  3AQK A;  4AT9 A;  5HRF A;  5DLG A;  4F4Y A;  7ICU A;  9ICF A;  4KLQ A;  2DR7 A;  4DSF A;  2PBE A;  4X4U A;  5DB6 A;  4F5P A;  5KG2 A;  1ZQE A;  5L1L A;  1MSW D;  3H4D A;  5J0O A;  2B21 A;  4YMN A;  1XS9 D;  5J2D A;  5KFQ A;  4FBT A;  2XO7 A;  9ICM A;  4RWN A;  5HRI A;  3V7J A;  4MFC A;  2ID1 A;  4Q45 A;  3JPN A;  3TFS A;  2R8G A;  4J9P A;  4O9M A;  7ICO A;  1TFY A;  1ZQW A;  5HRB A;  3RRG A;  2W8L A;  3Q8K A;  2ASJ A;  2BCR A;  3GFK B;  4I2F A;  5DB7 A;  4UAY A;  5J29 A;  3PO5 A;  4WBZ A;  2UVV A;  3UPS A;  3AQL A;  3OJU A;  3UPQ A;  1D9D A;  2FLN A;  4I2B A;  4UAW A;  4RQ4 A;  3BQT A;  4B9V A;  7ICV A;  1RXW A;  4J9K A;  4C8O A;  3JPT A;  4RPX A;  4UAZ A;  4ECV A;  3AQN A;  2BKE A;  5DGA A;  5D4B A;  2FMQ A;  4FHP A;  2HHT A;  3V6H A;  8ICK A;  2DR5 A;  4WCW A;  5IIO A;  4RQ5 A;  1RZT A;  4J9O A;  8ICR A;  3WFS C;  3BDP A;  3HW8 A;  4KLS A;  4AT8 B;  2BHN A;  4RQ0 A;  4C8N A;  4QZH A;  2JEJ A;  3T5J A;  1KSP A;  7ICG A;  2HVI A;  2P66 A;  1R8A A;  3H38 A;  4QWB A;  2V9W A;  4M2Y A;  2P6U A;  1NK4 A;  2DPI A;  3MAB A;  3HP6 A;  2HW3 A;  2Q0Z X;  4RUC A;  4DOB A;  4YN4 A;  5CHG A;  4UBC A;  3HWT A;  2RDJ A;  3SV4 A;  4KLM A;  9ICI A;  3OV7 A;  2VAN A;  3PR5 B;  3V72 A;  4I2I A;  4O3S A;  1F5A A;  4UB2 A;  1MIY A;  4WC7 A;  2ZH6 A;  4CCH A;  4F8R A;  2BQU A;  1XC9 A;  4J9N A;  5DB9 A;  5HRK A;  3RBD A;  4EBK A;  1MC8 A;  4LVS A;  2M2U A;  1NK9 A;  4O5E A;  3MR5 A;  3M9O B;  4HYK A;  2C2E A;  2JZB B;  1LV5 A;  8ICX A;  2BE3 A;  3BJY A;  4P4P A;  1V4A A;  4K4I A;  5J2B A;  3PX0 A;  3UXN A;  4WBY A;  2DPJ A;  2FLP A;  3UXO A;  3JPS A;  8ICV A;  8ICM A;  3H8S A;  4RZR A;  4RT3 A;  4KN4 A;  3IHQ B;  4DLE A;  4ECU A;  2UVR A;  8ICO A;  2I1Q A;  1UEU A;  5J2A A;  2ZHA A;  1BNP A;  1ZQO A;  1QSY A;  9ICT A;  1Z00 A;  2A1J A;  3UQ2 A;  2C2R A;  2ZH1 A;  4KLG A;  3C1Y A;  2W9C A;  1XSL A;  5KG1 A;  3GV8 B;  3KHH A;  2KTQ A;  2GWS A;  5KFF A;  3WFP A;  3LWM A;  3UXP A;  3OUY A;  1ZQJ A;  7ICT A;  3THV A;  3TQ1 A;  9ICO A;  2FPM A;  4PHP A;  4IR9 A;  1FA0 A;  4YR3 A;  4YD2 A;  4DFM A;  4FH5 A;  3SZ2 A;  9ICX A;  1ZJN A;  2IHN A;  1SZP A;  4C8M A;  5J0P A;  4TUR A;  3JPO A;  1U4B A;  1Q78 A;  4X4R A;  5EWF A;  1UA1 A;  3H8W A;  4ECY A;  5HRE A;  4ED8 A;  3H8J A;  4PGY A;  2C22 A;  1UEV A;  5KFH A;  2JEF A;  4LZD A;  3JZ0 A;  3GIK A;  4X4P A;  2BDP A;  1DK2 A;  4DS4 A;  2DR8 A;  4B9U A;  1KFT A;  4YFK A;  4F2R A;  3MDA A;  4DFP A;  3MR6 A;  5J0T A;  2R8K A;  8ICW A;  3SYZ A;  4JV1 A;  5KFO A;  2BGW A;  3MFI A;  4NXZ A;  4BXO A;  2KFZ A;  3FYH A;  4EBJ A;  2ZUB A;  1U45 A;  3RAQ A;  1JX4 A;  1CUK A;  4RPY A;  1TV9 A;  4JV0 A;  4X4S A;  5KFE A;  4ED0 A;  4Z6D A;  1SKR A;  2MAX A;  4KTQ A;  4YR0 A;  4R66 A;  5HMM A;  3GDX A;  1H38 A;  5KFS A;  4Z6E A;  3MGH A;  1TKD A;  5DQG A;  2ZHB A;  8ICE A;  1N56 A;  3EWA A;  3GQC A;  4RU9 A;  2W9B A;  1ZQY A;  8ICG A;  5HRD A;  5KG6 A;  2XY5 A;  1U49 A;  4KLD A;  4WC4 A;  8ICY A;  3NTU A;  4MEX A;  3MFH A;  1S76 D;  4DL6 A;  1ZQI A;  2UVW A;  4PHA A;  3RR8 A;  5DDY A;  4DOA A;  4PPX A;  4J9Q A;  1TK0 A;  3M9M B;  7ICF A;  2ASL A;  1MIV A;  5KT5 A;  2BR0 A;  3MR2 A;  1S0V A;  4AT9 B;  1TFW A;  4YR2 A;  4O5K A;  3ORY A;  5DBC A;  9ICE A;  1R89 A;  3EZ5 A;  8ICH A;  3RBE A;  1NOM A;  1BGX T;  4ELU A;  5BOM A;  1S77 D;  1WCN A;  3JPQ A;  2ZUD A;  2KP7 A;  5CWR A;  9ICA A;  1R8C A;  1NKC A;  2PXI A;  3PY8 A;  5DED A;  2HHS A;  2F1H A;  3JYY A;  4GXI A;  4X4T A;  5J2J A;  2VA2 A;  4NM1 A;  3Q8R B;  7ICK A;  1WCL A;  3Q8M A;  5J0W A;  2IHM A;  4RPZ A;  2W8K A;  4O0I A;  1ZQC A;  4GXK A;  3ETL A;  2R8I A;  4NLZ A;  1C7Y A;  4KLH A;  5EWG A;  4ECS A;  1ZQF A;  4I29 A;  2BPF A;  5KFJ A;  1ZYQ A;  5KFB A;  3E2E A;  4RQ3 A;  3NYB A;  4C8L A;  4O3R A;  3LQC B;  1A77 A;  1HUO A;  1XO1 A;  9ICU A;  2M2W A;  5J2C A;  5KFZ A;  4Q8F A;  3G6X A;  5J2H A;  4RQ2 A;  2XGP A;  3IM1 A;  4QZ8 A;  3N97 B;  1KFD A;  1QTM A;  2R8J A;  1U9L A;  2NRX A;  8ICQ A;  1D8Y A;  5KFN A;  5DBB A;  2Q66 A;  4M9J A;  4JV2 A;  4WC1 A;  4F5N A;  4DOC A;  5DQI A;  4FHV A;  4IQV A;  1SL1 A;  4NM2 A;  9ICN A;  3L9D A;  2KZM A;  4ED7 A;  2NRV A;  3RJJ A;  3JPP A;  4KLJ A;  7ICM A;  4ATB B;  5DBA A;  5KG7 A;  1JXL A;  3WFR E;  1U48 A;  3B0Y A;  4DQR A;  2M2V A;  3V7L A;  3Q8P B;  3PW5 A;  5KT3 A;  8ICP A;  9ICB A;  2ISP A;  3WFO A;  4FHW A;  1OU5 A;  1VFG A;  2XCA A;  3OJS A;  3OVB A;  2O1P A;  3LK9 A;  5J0U A;  3ZDE A;  5C5J A;  1KNY A;  1T3N A;  4QWE A;  3TAR A;  4ELT A;  5IIJ A;  1ZET A;  1UT8 A;  1SKS A;  1SL0 A;  4M9L A;  1YLQ A;  1TAQ A;  3JPR A;  4DL2 A;  4B9L A;  4YXJ A;  4X4V A;  5HR9 A;  1ZQV A;  2FMS A;  4F5R A;  2ZH9 A;  2F1I A;  2ALZ A;  1BPX A;  3RTV A;  1NZP A;  5HRH A;  3PO4 A;  2DRA A;  2ISO A;  4RQ8 A;  4E7X A;  4F5Q A;  2M2T A;  5KFW A;  4XQ8 A;  4F5O A;  3RH4 A;  3HT3 A;  8ICU A;  1S9F A;  3EPI A;  1T7P A;  4QZB A;  1N48 A;  4QZA A;  4KLI A;  4FHY A;  4R65 A;  4KN7 A;  1KLN A;  2ZH7 A;  3M8S A;  4I2J A;  4RQ7 A;  1ZQU A;  2A1J B;  4MF8 A;  1JQR A;  2AQ0 A;  4QZF A;  2P6R A;  3RB0 A;  2NRW A;  5KFR A;  4YQW A;  4EBE A;  4YG2 A;  1JIH A;  4JWM A;  5KG4 A;  2XC9 A;  1TFR A;  2HHU A;  3OUY B;  3QZ7 A;  4R63 A;  4F92 B;  3V7K A;  5HHI A;  1QLN A;  3MGI A;  3ZDA A;  2BCV A;  4YCX A;  1WOT A;  2FLL A;  3ISC A;  5HC9 A;  1NK7 A;  3OVS A;  5BPC A;  1X9M A;  2OWO A;  1B43 A;  3H3A A;  2RFF A;  5KFD A;  5EOZ A;  2DR9 A;  4NKU A;  4PGQ A;  4PGX A;  2ATL A;  4YMO A;  2PFP A;  2PFO A;  4DQP A;  1B22 A;  1R8B A;  2KZZ A;  2XGQ A;  4M6W A;  4R8U B;  1ZQR A;  5KFG A;  3TFR A;  4Z6C A;  1X9S A;  1PX5 A;  1JMS A;  3Q8L A;  2BQR A;  2V4R A;  4FO6 A;  3RRH A;  5IIM A;  4DF8 A;  1SL2 A;  4BXO B;  2MUT B;  4F4K A;  5DGB A;  4O5C A;  1L5U A;  5DKW A;  1DGS A;  3C18 A;  1JN3 A;  3TI0 A;  9ICW A;  2XY7 A;  3ISD A;  4DQS A;  3RH6 A;  2BCS A;  4F4W A;  3PX6 A;  4PHD A;  3RJE A;  2F1J A;  4RNN A;  2W9B B;  4GC6 A;  1HJP A;  5KG5 A;  3GII A;  7ICJ A;  8ICA A;  3EPG A;  4RNO A;  4DQQ A;  1NKE A;  4EZ9 A;  2W9A A;  3G6Y A;  5TZV A;  2C2D A;  1L3S A;  1RYR A;  3C66 A;  2BPG A;  5KT4 A;  3RB4 A;  4B9N A;  3OSN A;  3H40 A;  3PW4 A;  1TK5 A;  4DSL A;  1KEJ A;  5KFC A;  4TQS A;  3C2M A;  4F3O A;  3T5K A;  4M04 A;  4B9T A;  3HPO A;  2ZJA A;  4Z6F A;  1SKW A;  3PR4 A;  4FBU A;  4I28 A;  1JAJ A;  8ICI A;  3HIY A;  4ED1 A;  4K4H A;  3NGD A;  1NO5 A;  3PW2 A;  5DQH A;  4QZI A;  4LT6 A;  5KFM A;  1S0M A;  2KN7 A;  1Z3E B;  2IBK A;  1X2I A;  4M9H A;  3WFQ E;  5J0X A;  3MDC A;  9ICP A;  4M5D A;  1U47 A;  1ZQB A;  3LWL A;  3BQ2 A;  4QZE A;  3OHB A;  2KZ3 A;  4AT7 B;  4UBB A;  2UVU A;  3C2L A;  2HHV A;  3RB6 A;  5D46 A;  5J0S A;  2XCP A;  2ZH5 A;  4IR1 A;  4TQR A;  4MEY A;  4XA5 A;  4F93 B;  3H37 A;  3RB3 A;  4ED6 A;  4XUS A;  3RJG A;  4WC2 A;  4ECR A;  4RNM A;  4Q44 A;  4DL3 A;  1LB2 B;  2VA8 A;  4JWN A;  2ZTE A;  4QWD A;  7ICR A;  3K4G A;  4I2C A;  1L3U A;  2ZJ5 A;  3K75 D;  5CP2 A;  3OHA A;  4DS5 A;  1RXV A;  4DO9 A;  4GXJ A;  1ZQQ A;  5J2F A;  3QEB Z;  4TUQ A;  1L3T A;  2BPC A;  2PI4 A;  4EYH B;  4UD4 A;  4NLG A;  3KHG A;  5KFU A;  4P2H A;  1XWL A;  2DRB A;  4UB4 A;  4WC0 A;  4YXM A;  5KG0 A;  4DQI A;  1MQ3 A;  2ZJ8 A;  2BQ3 A;  4ECW A;  3TAQ A;  2ZH3 A;  4EEY A;  2BCU A;  4X4N A;  3GIJ A;  4JUZ A;  7ICI A;  5CB1 A;  1RPL A;  3KHR A;  5CJ7 A;  9ICG A;  9ICV A;  4ELV A;  3C21 A;  2HHP A;  5KFK A;  5J0Y A;  2HVH A;  9ICK A;  2DFL A;  4E8F A;  1XU4 A;  4ED3 A;  3RAX A;  4KIT B;  5DG8 A;  3GIL A;  3PW7 A;  9ICL A;  4ECQ A;  1K1S A;  1UET A;  4I2G A;  3HJ1 A;  5KT2 A;  7ICL A;  4R64 A;  3KHL A;  1IXR A;  1MQ2 A;  1XSN A;  4NLN A;  4RWP A;  3T5H A;  1V9P A;  4QZG A;  4BGD A;  4J9S A;  1ZQA A;  4WC6 A;  3PML A;  2AQ4 A;  4B9M A;  4KLO A;  5DEC A;  3LDA A;  1ZQN A;  3RJK A;  5HNK A;  3OSP A;  3RJI A;  5DDM A;  1KTQ A;  1X9W A;  3PMN A;  4IRC A;  5DB8 A;  3AUO A;  5CA7 A;  3G6V A;  2HHQ A;  4O3Q A;  1EXN A;  1D8L A;  3ZDD A;  1KFS A;  4RWQ A;  4WC5 A;  2ASD A;  5F2V O;  3OGU A;  3B0X A;  2IMW P;  4QW9 A;  4E80 A;  3GV7 B;  2H5X A;  4F91 B;  4J9L A;  3TAN A;  1KRP A;  4RT2 A;  5III A;  3QZ8 A;  2V4Q A;  8ICN A;  3HJ4 A;  4RQ6 A;  2J6U A;  2JEI A;  4JK1 A;  2XY6 A;  3AU2 A;  5L1K A;  2JEG A;  1ZQD A;  4EZ6 A;  9ICC A;  1XSP A;  3N4M B;  2RDI A;  5KFI A;  4ED2 A;  3T3F A;  1RYS A;  4DEZ A;  5F9N A;  5J2G A;  4EYI B;  3V6K A;  1T4G A;  3RH5 A;  2J6S A;  1COO A;  4I2D A;  2Y1J A;  5IIN A;  1ZQH A;  4IQW A;  2DVI A;  5DG9 A;  3SI8 A;  2M9N A;  1ZQG A;  4KLU A;  5D49 A;  2ZH4 A;  3BQ0 A;  4C8K A;  1ZQX A;  2ZH8 A;  4M6W B;  1Z00 B;  4KLE A;  4WC3 A;  4ZH4 A;  5KT6 A;  2KFN A;  3OVA A;  2W9C B;  5F9L A;  2FPL A;  3FDS A;  4GLX A;  3RJF A;  4BWJ A;  4X0B A;  1VJ7 A;  4DL7 A; 
#chains in the Genus database with same CATH topology
 3D2S A;  5ALI A;  3K7D A;  3C5F A;  4TUP A;  1JXE A;  2NRK A;  3AU6 A;  1HUZ A;  4QWA A;  2KOB A;  4UB3 A;  8ICJ A;  9ICH A;  1BPE A;  5IIL A;  1NJW A;  1CEZ A;  4OAI Z;  3JCF A;  2AGQ A;  2G5I B;  4F4Z A;  2HBM A;  5J2I A;  3H39 A;  7ICQ A;  4MHV A;  5HR7 A;  1DOQ A;  2J6T A;  3ZDC A;  4DFK A;  3AM9 A;  3H7I A;  2VA3 A;  2LYA A;  5DLF A;  4KLF A;  5ALO A;  5EWE A;  1BNO A;  2C28 A;  5ALK A;  3EW9 A;  4IQU A;  1B4F A;  4C0Z A;  2P35 A;  2ZIU B;  5EE1 A;  4UB1 A;  2IOF A;  4F50 A;  4Q43 A;  1IV8 A;  1N5X A;  3NVO A;  8ICS A;  1B0X A;  3PW0 A;  4NXT A;  5HHH A;  1NK8 A;  1KDH A;  3C2K A;  3M8R A;  2W9M A;  4FHX A;  2Z7J A;  1BPB A;  4UQG A;  4Q8E A;  2W55 A;  1ZQT A;  3Q8S B;  2AJQ A;  5ALU A;  1T8E A;  5HRG A;  1SWV A;  2AGP A;  3ZD9 A;  3MR3 A;  4DF4 A;  2QAR A;  3H0M B;  4J9M A;  1BVS A;  1S0O A;  5ALV A;  4NXV A;  4QW8 A;  4IQT A;  2JHD A;  4ECT A;  1TVA A;  3HX0 A;  8ICT A;  4DL5 A;  2KIC A;  3PV8 A;  1ZQP A;  3C23 A;  4AT7 A;  4ZOH C;  4OAH A;  5D61 A;  1O03 A;  3KD3 A;  5HRF A;  4KLQ A;  4F5P A;  5L1L A;  2QB1 A;  3H4D A;  4RWN A;  5HRI A;  2K8B B;  4Q45 A;  2R8G A;  5HRB A;  2W8L A;  2BCR A;  3GFK B;  2GH1 A;  4UAY A;  3PO5 A;  3OJU A;  2LI6 A;  4B9V A;  4C8O A;  4UAZ A;  5D4B A;  1NI3 A;  2HHT A;  4FHP A;  5IIO A;  4RQ5 A;  4J9O A;  3LVW A;  2JV3 A;  3BDP A;  4KLS A;  2CN1 A;  2E1F A;  4LEV A;  4AT8 B;  3IV6 A;  4RQ0 A;  3ALR A;  2JEJ A;  4CGZ A;  2HVI A;  3H38 A;  4QWB A;  2DPI A;  3NKU A;  4YN4 A;  4UBC A;  3HWT A;  3V72 A;  2EDU A;  4CE6 A;  2BQU A;  4J9N A;  5DB9 A;  5ALY A;  4UB8 U;  4O5E A;  4HYK A;  3M9O B;  3ICX A;  1LV5 A;  2BE3 A;  1M6Y A;  4K9A A;  4P4P A;  1V4A A;  2NO4 A;  2YMM A;  3UXO A;  1L6N A;  4DLE A;  4F71 A;  2I1Q A;  1ZRN A;  2K4I A;  5AKG A;  4Y2V A;  1BNP A;  1Z00 A;  3UQ2 A;  4GIB A;  3SAF A;  2ZH1 A;  1A0P A;  1XSL A;  5KG1 A;  3OUY A;  2RLT A;  2RQ5 A;  3NRW A;  3TQ1 A;  3WK9 A;  2W11 A;  3VC8 A;  4DFM A;  9ICX A;  4TUR A;  1UA1 A;  3C29 A;  4ECY A;  4P0Q B;  4OJL A;  3H8J A;  4PGY A;  5KL8 B;  2C22 A;  1UEV A;  5KFH A;  4X4P A;  2DR8 A;  3MDA A;  5CEH A;  2R8K A;  2MSN A;  2BGW A;  4P0P A;  2ZUB A;  1U45 A;  1JX4 A;  2G5H B;  3H0L B;  1SKR A;  2MAX A;  4YR0 A;  3MGV A;  3GDX A;  1XO0 A;  3AL0 B;  2W43 A;  4Z6E A;  4O67 A;  5KG6 A;  1U49 A;  4WC4 A;  8ICY A;  3NVW A;  1S76 D;  5AI4 A;  1TK0 A;  3M9M B;  7ICF A;  1MIV A;  5KT5 A;  1S0V A;  1F5S A;  2EZX A;  4YR2 A;  4O5K A;  3K1R B;  3ORY A;  5DBC A;  2HBL A;  2NYV A;  2KP7 A;  2ZUD A;  1R8C A;  2AHO B;  1NKC A;  3JYY A;  2QB0 A;  1RYU A;  4GXI A;  5J8Y A;  2H3I A;  2MRL A;  2E8O A;  3TAD C;  4NLZ A;  3ETL A;  1C7Y A;  2EWR A;  5ALJ A;  4I29 A;  1F0M A;  4RQ3 A;  3LQC B;  4Q8F A;  3G6X A;  3IM1 A;  3N97 B;  2Q66 A;  4DFD A;  2E3T A;  4DOC A;  5DQI A;  4FHV A;  4IQV A;  1SL1 A;  1LKY A;  4ED7 A;  7ICM A;  5DBA A;  1U48 A;  4DQR A;  2CRX A;  2ZIW A;  1NZB A;  1VFG A;  3SR6 A;  3OJS A;  4CNQ A;  2O1P A;  5AIA A;  1SV0 A;  4RQN A;  4UAS A;  2K4E A;  2IHO A;  1T3N A;  4UD5 A;  1ZET A;  2NV3 A;  1TAQ A;  5ALW A;  1XNS A;  2YB1 A;  5HR9 A;  2JXJ A;  2ALZ A;  2DRA A;  1S9F A;  3EPI A;  1Q3V A;  1O08 A;  4QZA A;  1WYG A;  1FEZ A;  2K89 A;  3MCR A;  2EAN A;  3N7S C;  3M8S A;  1JRP A;  2A1J B;  2XIC A;  2NRW A;  3IG8 A;  3V7K A;  4KB6 A;  2FLL A;  2KHQ A;  3H3A A;  2B0C A;  2HOI A;  5KFD A;  4QNL A;  4IL6 U;  5ALX A;  4PGQ A;  4PGX A;  2ATL A;  1B22 A;  2PFO A;  1R8B A;  5E79 U;  4M6W A;  4R8U B;  1N63 A;  5ALG A;  4K8V A;  3Q8L A;  2O6K A;  2V4R A;  1KKX A;  4DF8 A;  4BXO B;  2MUT B;  3F2D A;  4F4K A;  3SD7 A;  4DQS A;  5AKJ A;  2HOQ A;  4PHD A;  4RNN A;  2W9B B;  4GC6 A;  5KG5 A;  8ICA A;  1S5L U;  4RNO A;  1QH9 A;  1L3S A;  2C2D A;  5ALE A;  2BPG A;  5KT4 A;  3RB4 A;  4DSL A;  1X42 A;  1IG6 A;  4AYB F;  3HPO A;  4I28 A;  1D8B A;  3PR4 A;  4FBU A;  1RM6 C;  4ED1 A;  3NGD A;  3PW2 A;  5DQH A;  5GTI U;  1X2I A;  4UAR A;  5AKH A;  1ZQB A;  3QUQ A;  3BQ2 A;  2YN4 A;  4NXU A;  4UBB A;  2ZH5 A;  3WK5 A;  4MEY A;  3H37 A;  1N60 A;  4WC2 A;  1N2X A;  4RNM A;  4DL3 A;  2ZTE A;  1L3U A;  2DQN B;  4DS5 A;  4DO9 A;  3M6K A;  2BPC A;  3QNM A;  4P2H A;  4OAG A;  4UB4 A;  4C7Y A;  4YXM A;  1PK3 A;  4X4N A;  3GIJ A;  1X40 A;  3F53 A;  2XID A;  4ELV A;  5KFK A;  2HVH A;  5JU5 A;  2HOF A;  4K9B A;  2YMP A;  3HJ1 A;  5KT2 A;  4R64 A;  1IXR A;  4NLN A;  1XSN A;  4WC6 A;  1PVR A;  1ZQN A;  3RJK A;  3D2N A;  3OSP A;  5DDM A;  1KTQ A;  1X9W A;  3PMN A;  1RQL A;  2G08 A;  1EXN A;  3ZDD A;  5F2V O;  3OGU A;  4O6A A;  4F91 B;  4RT2 A;  2V4Q A;  2BBH A;  3NUQ A;  3N4M B;  2WHE A;  2GLE A;  4DEZ A;  5J2G A;  3RH5 A;  4IQW A;  4I2D A;  2Y1J A;  1ZQH A;  5KAF U;  1ZQG A;  3N28 A;  3BQ0 A;  5CFT A;  1ZQX A;  4KLE A;  3D2Q A;  5F9L A;  5JTG A;  2RRD A;  4X0B A;  3T5L A;  3GZF A;  3QEA Z;  4MFF A;  4ATB A;  4OJP A;  5BOL A;  3J81 j;  5KFL A;  4OJO A;  3SV3 A;  1TK8 A;  3AQE A;  5TIS U;  2W3R A;  4M0A A;  1L8O A;  1L3V A;  1SXE A;  1C20 A;  4KLT A;  3KOO A;  4M9N A;  2NRZ A;  5AKI A;  2ZH2 A;  2I9G A;  7ICE A;  3CP8 A;  1L7P A;  3PSI A;  3HJE A;  4EBC A;  4DSJ A;  1QSL A;  3I28 A;  2O5A A;  4MFA A;  4GC7 A;  4O3M A;  5KG3 A;  4PHE A;  8ICB A;  4EX7 A;  1Q3U A;  3TAP A;  4EP7 A;  1COK A;  1YT3 A;  2YX8 A;  2DKZ A;  3V6J A;  4BWM A;  2FPK A;  4AP9 A;  1A76 A;  4I2H A;  5D62 A;  1S97 A;  4ECZ A;  5JUM A;  1NK6 A;  4KMU A;  4PH5 A;  1ZJM A;  4O68 A;  1ARO P;  7ICP A;  1NK0 A;  2ES6 A;  3CRX A;  4IRK A;  5AKE A;  5CR0 A;  2FMP A;  4NY8 A;  2HN2 A;  4DLG A;  4KLL A;  1OW5 A;  2EQY A;  4LJX A;  3UMC A;  3SEI A;  2Y1I A;  4YD1 A;  2R8H A;  2KHV A;  5EE3 A;  1TAU A;  5J0Q A;  4RUA A;  3ZDB A;  1FFU A;  2PFQ A;  3QXG A;  1ZXI A;  5KL1 B;  2WFA A;  4XQ7 A;  4CF5 A;  3C5G A;  5C0Y A;  4U6P A;  3PST A;  1IM4 A;  5L9X A;  4X5V A;  4IG8 A;  3AQM A;  2YB4 A;  4NKT A;  2B51 A;  3GV5 B;  3H0R B;  4CDG A;  2GOL A;  2EH9 A;  4EBD A;  2HHX A;  1HIW A;  1ZQZ A;  2AGO A;  1FIQ A;  4Y2X A;  5HP4 A;  3KKA C;  2KE7 A;  4O3P A;  3BQ1 A;  3QX7 A;  3AQK A;  4DSF A;  2PBE A;  2QLT A;  1ZQE A;  2ZIV B;  5KG2 A;  1MSW D;  4Y2P A;  5J0O A;  2B21 A;  4YMN A;  4FBT A;  2Y9T A;  4MFC A;  3JPN A;  3CNH A;  3RRG A;  4NJ8 A;  3UPQ A;  4UAW A;  7ICV A;  2WB1 F;  3A0H U;  3JPT A;  4ECV A;  2BKE A;  2FMQ A;  2DR5 A;  8ICK A;  1RZT A;  3WKB A;  4EGW A;  5AI6 A;  1Q8K A;  4PL1 A;  7ICG A;  2V9W A;  2P6U A;  5AKY A;  2HW3 A;  1SXD A;  2G07 A;  2VAN A;  2ZH6 A;  4I2I A;  4USA A;  4UB2 A;  1XC9 A;  5T14 A;  5HRK A;  4HAI A;  3MR5 A;  2EAO A;  8ICX A;  1J2M A;  3BJY A;  2OXO A;  3PX0 A;  3UXN A;  2DPJ A;  2FLP A;  1V85 A;  8ICV A;  4ECU A;  4KN4 A;  3IHQ B;  8ICO A;  2HN1 A;  5H2F U;  5J2A A;  4DCC A;  1QSY A;  9ICT A;  5JRT A;  4KLG A;  3KHH A;  5B5E U;  7ICT A;  3THV A;  1WG8 A;  9ICO A;  1QQ7 A;  2Y0S F;  1OUQ A;  4YR3 A;  3SZ2 A;  2IHN A;  5EE9 A;  1Q78 A;  4FZM A;  3JPO A;  3JZ0 A;  3GIK A;  1DK2 A;  1YZ6 A;  4B9U A;  4DFP A;  8ICW A;  5KFO A;  5AKX A;  3MFI A;  3WK8 A;  3RAQ A;  2B6G A;  1CUK A;  2BDU A;  3QU5 A;  4JV0 A;  1S8O A;  4WQL A;  4KTQ A;  5HMM A;  3UMG A;  5KFS A;  1JUD A;  8ICE A;  3UMB A;  1N56 A;  3EWA A;  3GQC A;  4RU9 A;  1ZQY A;  8ICG A;  2KJ9 A;  2JH1 A;  2VKQ A;  3NTU A;  3MFH A;  4DL6 A;  3KBB A;  3RR8 A;  1VDV A;  2ASL A;  3MR2 A;  1TFW A;  3N7P D;  2KMD A;  4Y2Q A;  3QU7 A;  1R89 A;  3EZ5 A;  8ICH A;  4ELU A;  5BOM A;  4MKP A;  2KD1 A;  2PXI A;  2F1H A;  2Q4T A;  2VA2 A;  3BQ7 A;  4NM1 A;  2KV2 A;  1WCL A;  3Q8M A;  5J0W A;  1P7D A;  3QUC A;  4O0I A;  4GXK A;  4KLH A;  1ZQF A;  2BPF A;  3NYB A;  5ALN A;  4C8L A;  1X6J A;  3FAH A;  5KFZ A;  4UW9 A;  3HKZ F;  4AYB C;  2EZY A;  3MC1 A;  2XGP A;  4QZ8 A;  8ICQ A;  1D8Y A;  5KFN A;  2G0A A;  4F5N A;  9ICN A;  3L9D A;  5AI5 A;  2M0N A;  2KJ5 A;  1JXL A;  3PW5 A;  5KT3 A;  2ISP A;  4FHW A;  3OVB A;  3LK9 A;  4NL9 C;  1SL0 A;  1MN8 A;  3JPR A;  4X4V A;  1ZQV A;  3CK6 A;  2FMS A;  2ZH9 A;  2F1I A;  3SAG A;  1BPX A;  4QIW F;  5KFW A;  4XQ8 A;  8ICU A;  3HT3 A;  4QZB A;  4KLI A;  4FZL A;  2HDO A;  4KN7 A;  1KLN A;  1KBU A;  2JGA A;  4UAU A;  1JQR A;  2KSO A;  4EBE A;  4YQW A;  4EEL A;  3RFA A;  3OUY B;  3QZ7 A;  5HHI A;  1QLN A;  5AM1 A;  5K4L A;  3M7D A;  1X9M A;  2OWO A;  1B43 A;  5EE0 A;  2DR9 A;  4NKU A;  2PFP A;  4DQP A;  3TFR A;  5JTI A;  1X9S A;  2BQR A;  1SL2 A;  3PSP A;  2EZZ A;  2W03 A;  5DGB A;  1DGJ A;  1L5U A;  3C18 A;  1DGS A;  4K96 A;  9ICW A;  4F4W A;  2ESE A;  2HI0 A;  3RJE A;  7ICJ A;  5AK3 A;  4DQQ A;  1A6S A;  1JI7 A;  2JH7 A;  5AKZ A;  1FFV A;  1KW4 A;  1ZD3 A;  2WF9 A;  3OSN A;  3H40 A;  3LVV A;  4F3O A;  4K98 A;  4B9T A;  2ZJA A;  3BZC A;  3RF9 A;  3ED5 A;  1RG6 A;  1NO5 A;  5KFM A;  2IBK A;  4M9H A;  2OCE A;  2KK0 A;  1X66 A;  9ICP A;  1U47 A;  1TAM A;  1UHU A;  3C2L A;  5D46 A;  4IR1 A;  4F93 B;  1DRG A;  4ED6 A;  4XUS A;  2PKE A;  4ECR A;  4CRX A;  1LB2 B;  4JWN A;  4I2C A;  2WF7 A;  1ZQQ A;  1TE2 A;  4GXJ A;  5J2F A;  4I0U A;  5J8Y C;  4OJ6 A;  3M1Y A;  2PI4 A;  1XWL A;  2DRB A;  3N7R C;  3WKC A;  1IIP A;  5AIC A;  1MQ3 A;  2ZJ8 A;  2BQ3 A;  5KAI U;  2NO5 A;  1ED1 A;  4JUZ A;  3KHR A;  9ICV A;  3C21 A;  5J0Y A;  1VJ5 A;  4WOY A;  1XU4 A;  4ED3 A;  4Y2J A;  3PW7 A;  1URJ A;  4ECQ A;  4IC9 A;  4RWP A;  3T5H A;  1V9P A;  4QZG A;  2Y9U A;  1ZQA A;  3F5E A;  3LDA A;  4IRC A;  5DB8 A;  4FE3 A;  5ALL A;  1JRO A;  3WKD A;  4O3Q A;  2H3Z A;  1SV0 C;  1KFS A;  3AQF A;  2ASD A;  3B0X A;  3GV7 B;  1X6I A;  1KRP A;  4BX9 C;  5III A;  8ICN A;  2ZG6 A;  1XSP A;  1HEK A;  3T3F A;  4KMO B;  2J6S A;  1COO A;  2DVI A;  5IIN A;  5DG9 A;  3SI8 A;  4KLU A;  3ER9 B;  4C8K A;  2FE9 A;  2KJ8 A;  4M6W B;  4WC3 A;  3OVA A;  4U7C A;  2W9C B;  4BWJ A;  4DL7 A;  2AXT U;  8ICF A;  5KFT A;  4DFJ A;  4YVZ A;  4QZ9 A;  1PK1 A;  4UAT A;  3SQI A;  3NS1 A;  1MIW A;  4WCW A;  2KG5 A;  1BPZ A;  9ICQ A;  1D9F A;  3WKE A;  3TAC B;  5J0R A;  4I27 A;  1NK5 A;  2AU0 A;  4K4G A;  2DBY A;  1NJX A;  1K1Q A;  1NJY A;  2F2A B;  4FS2 A;  3PX4 A;  3RJH A;  9ICJ A;  1ZQL A;  2WB1 C;  4RWO A;  4F2S A;  4ECX A;  5B3P A;  5L1J A;  3EYZ A;  4QWC A;  5AKK A;  1S10 A;  2GAF D;  3WK7 A;  4FS1 A;  5F3X B;  4F4X A;  2JZB A;  5AM5 A;  3IG5 A;  4Y2T A;  2G06 A;  1UA0 A;  4DSK A;  1Y88 A;  4FH3 A;  1UQV A;  4M47 A;  4R8U A;  1KL9 A;  4OD0 A;  5G5G A;  5AM3 A;  2KEY A;  3NVZ A;  4I2A A;  2ZUC A;  2MUT A;  4QZC A;  4E0D A;  5KFY A;  5FP0 A;  2PI5 A;  8ICZ A;  3AN1 A;  4K97 A;  2ZTC A;  2HMX A;  1KQQ A;  7ICH A;  4O3N A;  1ZQM A;  4B9S A;  4BDP A;  1SGG A;  1N5W A;  4TUS A;  2Y0S C;  1V38 A;  3ISB A;  2ZTD A;  4PZN A;  2BBJ A;  1BPY A;  1L7N A;  2QKQ A;  4X4O A;  2LYH A;  4A8E A;  1F44 A;  4FFD A;  3Q8Q B;  2F3N A;  4AT9 A;  5DLG A;  4F4Y A;  2ZIX A;  2LBO A;  9ICF A;  2DR7 A;  4X4U A;  2HCF A;  2D6F C;  1XS9 D;  5KFQ A;  9ICM A;  2YML A;  2ID1 A;  5HR6 A;  3TFS A;  3LYS A;  7ICO A;  4J9P A;  4XJE A;  1ZQW A;  2H3F A;  4I2F A;  5DB7 A;  5ALZ A;  5J29 A;  4WBZ A;  2UVV A;  2FLN A;  4I2B A;  4RQ4 A;  3BQT A;  1GPJ A;  1RXW A;  4RPX A;  1K5O A;  3AQN A;  4ICA A;  5DGA A;  2G09 A;  3V6H A;  3OTQ A;  2F44 A;  3EUB 2;  3HW8 A;  2RP5 A;  2F8K A;  4LEZ A;  5AKL A;  4C8N A;  3ONN A;  2YQE A;  3NAS A;  5B66 U;  3T5J A;  1KSP A;  1R8A A;  1GO3 F;  3MAB A;  2MU2 A;  2Q0Z X;  4RUC A;  3SV4 A;  5CHG A;  9ICI A;  3PR5 B;  3QUB A;  4O3S A;  1F5A A;  4CCH A;  3DEE A;  3HKZ C;  4F8R A;  2DL0 A;  3BS7 A;  3F5A A;  4EBK A;  4LVS A;  2M2U A;  5AK5 A;  1NK9 A;  3HIL A;  4LEY A;  2C2E A;  5J2B A;  3JPS A;  8ICM A;  2LKY A;  3H8S A;  4RZR A;  4RT3 A;  2UVR A;  3AEV A;  2VJ5 A;  2ZHA A;  2E8M A;  2C2R A;  5AM2 A;  4BJQ A;  2KTQ A;  2GWS A;  3LWM A;  3UXP A;  1LVH A;  1ZQJ A;  1ZJN A;  3F2B A;  4C8M A;  5J0P A;  1U4B A;  4QIW C;  5HRE A;  2FJ6 A;  3SAH A;  2BDP A;  1KFT A;  4YFK A;  3E58 A;  5J0T A;  3SYZ A;  4JV1 A;  4JLX A;  3FYH A;  4EBJ A;  4X4S A;  4RPY A;  1TV9 A;  3ETR A;  5KFE A;  4R66 A;  1DXS A;  1H38 A;  3MGH A;  2ZHB A;  5DQG A;  3WKA A;  2H3V A;  4BUG A;  1ZQI A;  2UVW A;  4PHA A;  5DDY A;  4DOA A;  4PPX A;  4J9Q A;  2BR0 A;  2JR5 A;  9ICE A;  3OPX A;  3GU3 A;  2ZXI A;  3JPQ A;  5CWR A;  2GO7 A;  4KM5 A;  4X4T A;  7ICK A;  3DV9 A;  4ACO A;  5ALF A;  1SIJ A;  4RPZ A;  4EX6 A;  5EWG A;  4ECS A;  5KFJ A;  5KFB A;  1HUO A;  2KVS A;  1WUD A;  1ZD2 P;  2DGZ A;  3U26 A;  2I5H A;  3BS5 B;  2HSZ A;  2NRX A;  3PSF A;  4JV2 A;  4WC1 A;  2WF5 A;  4NM2 A;  1CRX A;  3RJJ A;  3JPP A;  4KLJ A;  3KKA A;  3NVY A;  2DF4 B;  1ZD5 A;  2M2V A;  3V7L A;  3Q8P B;  8ICP A;  4OAF A;  3ZDE A;  1KNY A;  4ELT A;  5IIJ A;  1Z4O A;  1SKS A;  5AI8 A;  4YXJ A;  4F5R A;  4PJ0 U;  5HRH A;  1FO4 A;  2VJ4 A;  1PUZ A;  3PO4 A;  2ISO A;  4RQ8 A;  4F5Q A;  2M2T A;  5A0L A;  5D63 A;  1T7P A;  4FHY A;  4EEB A;  2YMQ A;  4I2J A;  4RQ7 A;  1ZQU A;  5ALS A;  4Y2Y A;  3S6J A;  5KFR A;  3FM9 A;  4YG2 A;  4JWM A;  5KG4 A;  2XC9 A;  4R63 A;  3ZDA A;  5ALH A;  4YCX A;  2BCV A;  1WOT A;  3ISC A;  5HC9 A;  4PZO A;  1NK7 A;  3OVS A;  5BPC A;  3QU2 A;  2WF6 A;  5EOZ A;  4WJ3 B;  3QYP A;  3BZK A;  2KZZ A;  1ZQR A;  5KFG A;  1ZQ1 C;  4Z6C A;  1PX5 A;  1JMS A;  4FO6 A;  2XVT A;  3TKA A;  5CRX A;  4NLB A;  4O5C A;  1JN3 A;  2XY7 A;  3RH6 A;  2BCS A;  3PX6 A;  4G9B A;  1HJP A;  3EPG A;  4PL2 A;  1NKE A;  1KN5 A;  3G6Y A;  5TZV A;  3C66 A;  1RYR A;  2QAR B;  3M6Z A;  5KFC A;  4TQS A;  3C2M A;  3F2C A;  1L7M A;  3HIY A;  8ICI A;  4K4H A;  4LT6 A;  1ZOL A;  2KN7 A;  1Z3E B;  3MDC A;  4QZE A;  4AT7 B;  2UVU A;  5J0S A;  2XCP A;  3E0F A;  3R9K A;  3RB3 A;  3RJG A;  1N61 A;  2VIX A;  4QWD A;  7ICR A;  2ZJ5 A;  5CP2 A;  3IRU A;  1RXV A;  2FDR A;  2ZIU A;  3QEB Z;  2EAP A;  4UB6 U;  4EYH B;  4UD4 A;  4NLG A;  4FZN A;  4ECW A;  3TAQ A;  2D8C A;  4EEY A;  2CPR A;  1L8L A;  1RPL A;  5CJ7 A;  9ICG A;  2HHP A;  5AK4 A;  2LMR A;  3L5K A;  4KIT B;  5DG8 A;  9ICL A;  4F72 A;  1UET A;  4EEN A;  1MQ2 A;  4BGD A;  3PML A;  3L3F X;  4B9M A;  3WU2 U;  4KLO A;  5DEC A;  2WAQ F;  4NWI A;  3RJI A;  3AUO A;  3PZP A;  5CA7 A;  4RWQ A;  1J2N A;  4E80 A;  4GFJ A;  2KSO B;  2H5X A;  4C4S A;  2ZXH A;  3TAN A;  4WQK A;  3QZ8 A;  2J6U A;  2JEI A;  2KVC A;  4JK1 A;  5L1K A;  2JEG A;  1ZQD A;  9ICC A;  2ODG A;  4ED2 A;  4EYI B;  2XI9 A;  2LM1 A;  2ZH4 A;  2L5Y A;  3SEN A;  2ZH8 A;  1Z00 B;  1VLB A;  1PVP A;  2KFN A;  2A3V A;  4GLX A;  2FPL A;  3FDS A;  1VJ7 A;  2HHW A;  4LZG A;  3DDH A;  4NL9 A;  5KFP A;  4DSI A;  7ICS A;  4DSE A;  5GTH U;  5KFX A;  2W54 A;  1Z1V A;  2YY6 A;  4NLK A;  2NRT A;  3IN5 A;  4X0A A;  5DG7 A;  4X4Q A;  5KTQ A;  5J2K A;  2BCQ A;  2A1A A;  1Q79 A;  5HRL A;  3RR7 A;  4Y2S A;  9ICS A;  2KKV A;  2HBK A;  2IA6 A;  4AT8 A;  1WWV A;  3H4B A;  4P0P B;  4QZD A;  3ZD8 A;  1QSS A;  3QE9 Y;  2MA1 A;  3MBY A;  8ICC A;  3ERC C;  2PMZ F;  5HML A;  1PZN A;  3T79 A;  2B4V A;  3UQ0 A;  5AI0 A;  1NJZ A;  3M9N B;  4K99 A;  1V97 A;  2OEH A;  1ZRM A;  1SV4 A;  4G3I A;  1N62 A;  4M9G A;  9ICR A;  2QB0 B;  2PFN A;  5L1I A;  2W04 A;  4DL4 A;  3KTQ A;  2E1E A;  2FCL A;  4DWI A;  1RQN A;  3KZX A;  3C1Z A;  1NKB A;  5IIK A;  4RQ1 A;  5G5H A;  2OHF A;  2WTF A;  1WWU A;  3SMV A;  4WH5 A;  5KFA A;  4YP3 A;  4IRD A;  2R18 A;  1ZQS A;  4UB5 A;  4I2E A;  4P4M A;  4YMM A;  1AQ6 A;  4XRH A;  3GIM A;  8ICL A;  1UT5 A;  1L7O A;  1T94 A;  5J2E A;  1X9X A;  4P0Q A;  5KT7 A;  2EAM A;  1DK3 A;  1BPD A;  5KFV A;  1S0N A;  2F76 X;  3PVX A;  1LKY B;  4S3N A;  4LEW A;  4O3O A;  2K4H A;  5CHE A;  2AH5 A;  3IP4 B;  5AK6 A;  5KNI A;  3PNC A;  3ER8 C;  2ZIW B;  7ICN A;  4J03 A;  4MF2 A;  2DWQ A;  4US8 A;  1JAL A;  1ZQK A;  4J9R A;  4P4O A;  3TAD A;  3KFU F;  1CI4 A;  1YZ7 A;  2DKX A;  7ICU A;  1OXJ A;  5DB6 A;  5ALP A;  5AIB A;  4EV6 A;  5J2D A;  1MA7 A;  2XO7 A;  5ALQ A;  3V7J A;  4O9M A;  1TFY A;  2ASJ A;  3Q8K A;  3FC4 A;  3ZI4 A;  3UPS A;  4CF3 A;  4CF4 A;  3AQL A;  1PK1 B;  1D9D A;  4OO1 J;  4J9K A;  4IS7 A;  8ICR A;  3KZI U;  2N1R A;  4US9 A;  3PHZ A;  2BHN A;  4NXX A;  1PVQ A;  5CFU A;  4JMU A;  5ALR A;  4QZH A;  2IOF K;  2P66 A;  4C7Z A;  4M2Y A;  1NK4 A;  1UCV A;  3HP6 A;  3QU4 A;  1UPH A;  4DOB A;  2RDJ A;  4KLM A;  2W7P A;  3OV7 A;  1MIY A;  4WC7 A;  3NWI A;  3RBD A;  1MC8 A;  5ALT A;  2JZB B;  3QU9 A;  4K4I A;  4WBY A;  2E8N A;  1UEU A;  3L4P A;  2HBJ A;  1ZQO A;  2A1J A;  2F8L A;  3C1Y A;  2W9C A;  3GV8 B;  5KFF A;  3WFP A;  3K1Z A;  2OYY A;  2FPM A;  4PHP A;  4IR9 A;  1FA0 A;  4FH5 A;  4YD2 A;  1SZP A;  4X4R A;  1SWW A;  5CFS A;  5EWF A;  3H8W A;  3H8M A;  4ED8 A;  4JB3 A;  2D3D A;  2JEF A;  2JRZ A;  4LZD A;  3UM9 A;  4DS4 A;  2H3Q A;  4F2R A;  3MR6 A;  2KFZ A;  4BXO A;  4NXZ A;  4OJ5 A;  3NRZ A;  2OM6 A;  3WK6 A;  4ED0 A;  4Z6D A;  1TKD A;  3I1Y A;  2W9B A;  5HRD A;  2XY5 A;  4KLD A;  5ALM A;  4MEX A;  1Q46 A;  4NV0 A;  2KIW A;  4JLZ A;  4KX5 A;  4AT9 B;  3NVV A;  2ZIX B;  1Z1B A;  3RBE A;  1NOM A;  1BGX T;  1S77 D;  1WCN A;  9ICA A;  3O0F A;  3PY8 A;  5DED A;  5ALD A;  2HHS A;  1SZH A;  5J2J A;  3Q8R B;  3CW2 C;  2IHM A;  2W8K A;  1ZQC A;  2R8I A;  1ZYQ A;  3E2E A;  2W7O A;  2K4P A;  4O3R A;  4OCZ A;  1A77 A;  2FI1 A;  1XO1 A;  9ICU A;  2M2W A;  5B3Q A;  5J2C A;  4HX0 A;  5J2H A;  1NNL A;  4RQ2 A;  1KFD A;  1QTM A;  2R8J A;  1U9L A;  5DBB A;  4M9J A;  2BZF A;  5AI9 A;  2KZM A;  2NRV A;  3WFR E;  4ATB B;  2B56 A;  5KG7 A;  2K8C B;  3B0Y A;  9ICB A;  4QJF B;  3WFO A;  1OU5 A;  3C28 A;  2XCA A;  2F77 X;  1ECW A;  5J0U A;  5C5J A;  4QWE A;  3TAR A;  4M9L A;  1UT8 A;  1YLQ A;  4DL2 A;  4B9L A;  4FO1 A;  5L1M A;  3WFS C;  3EF2 A;  1NZP A;  3RTV A;  4E7X A;  2E5S A;  4F5O A;  3RH4 A;  3VCB A;  1N48 A;  2JMG A;  4R65 A;  4C80 A;  2ZH7 A;  2IOH A;  3HRD D;  4MF8 A;  2AQ0 A;  4QZF A;  2P6R A;  3RB0 A;  1RDF A;  1JIH A;  1TFR A;  2HHU A;  2WF8 A;  4F92 B;  3MGI A;  3A0B U;  4KX3 A;  2RFF A;  4NLC A;  2WAQ C;  4YMO A;  2LYB A;  3WK4 A;  2XGQ A;  5AM4 A;  2GA9 D;  3RRH A;  5IIM A;  2LM4 A;  5DKW A;  2DUY A;  3TI0 A;  3ISD A;  2KNJ A;  4Y2U A;  2F1J A;  3CYM A;  3GII A;  4EZ9 A;  2W9A A;  1QQ5 A;  4B9N A;  3PW4 A;  1TK5 A;  1KEJ A;  3T5K A;  4M04 A;  4Z6F A;  1SKW A;  1JAJ A;  4QZI A;  1S0M A;  3WFQ E;  5J0X A;  4M5D A;  3LWL A;  3OWG A;  3OHB A;  2KZ3 A;  2HHV A;  4B6J A;  3RB6 A;  4TQR A;  4XA5 A;  3D6J A;  5AM0 A;  4Q44 A;  2VA8 A;  2K8A A;  2RHF A;  3K4G A;  3K75 D;  3OHA A;  2IUB A;  1QCK A;  4TUQ A;  1L3T A;  2LHT A;  4RQM A;  1T3Q A;  2PMZ C;  5KFU A;  3KHG A;  4WC0 A;  5KG0 A;  4DQI A;  4C4R A;  2ZH3 A;  2BCU A;  5CB1 A;  2A19 A;  2K60 A;  1J97 A;  2KKP A;  9ICK A;  2DFL A;  4E8F A;  3RAX A;  3GIL A;  3I76 A;  1K1S A;  4Y2R A;  1Z4N A;  4I2G A;  2CXY A;  2E8P A;  7ICL A;  3KHL A;  3B9J A;  2OH2 A;  2I6X A;  4J9S A;  2YTU A;  4EED A;  3QUT A;  2AQ4 A;  3IDW A;  5HNK A;  3G6V A;  2HHQ A;  1Z19 A;  1D8L A;  4WC5 A;  2IMW P;  4QW9 A;  5AHX A;  4J9L A;  2KIV A;  4UAV A;  3HJ4 A;  4O69 A;  4RQ6 A;  1QQ6 A;  4N7R A;  2XY6 A;  3AU2 A;  4C4T A;  4EZ6 A;  4NXW A;  2RDI A;  5KFI A;  1RYS A;  1SB3 C;  4EEK A;  5F9N A;  3V6K A;  7ICI A;  1T4G A;  2ZIV A;  2M9N A;  5D49 A;  2LPE A;  4ZH4 A;  3BS5 A;  2W3S A;  3AMZ A;  5KT6 A;  1ZD4 A;  3RJF A; 
#chains in the Genus database with same CATH homology
 3T5L A;  4LZG A;  8ICF A;  5KFP A;  4TUP A;  3C5F A;  3QEA Z;  4DSI A;  7ICS A;  1JXE A;  5KFT A;  4DFJ A;  4DSE A;  5KFX A;  4YVZ A;  4QZ9 A;  4MFF A;  2NRK A;  4ATB A;  3AU6 A;  4UD5 A;  1HUZ A;  5BOL A;  4NLK A;  5KFL A;  1MIW A;  2NRT A;  4QWA A;  4UB3 A;  3SV3 A;  5DG7 A;  1TK8 A;  5KTQ A;  5J2K A;  8ICJ A;  2BCQ A;  9ICH A;  4X4Q A;  1BPZ A;  4M0A A;  1L3V A;  9ICQ A;  1Q79 A;  1BPE A;  3RR7 A;  4KLT A;  1D9F A;  5HRL A;  5IIL A;  1NJW A;  9ICS A;  4M9N A;  2NRZ A;  5J0R A;  2IA6 A;  4AT8 A;  4I27 A;  1NK5 A;  1CEZ A;  2AU0 A;  4K4G A;  3H4B A;  2AGQ A;  4F4Z A;  4QZD A;  2ZH2 A;  5J2I A;  1NJX A;  3H39 A;  1K1Q A;  3ZD8 A;  1QSS A;  2I9G A;  7ICQ A;  3QE9 Y;  7ICE A;  1DOQ A;  3MBY A;  1NJY A;  2J6T A;  3ZDC A;  4EBC A;  4DFK A;  8ICC A;  4DSJ A;  1QSL A;  5HML A;  4MFA A;  3H7I A;  1PZN A;  4FS2 A;  3PX4 A;  4GC7 A;  2VA3 A;  3RJH A;  2O5A A;  9ICJ A;  3UQ0 A;  5DLF A;  1ZQL A;  4KLF A;  5KG3 A;  4RWO A;  4PHE A;  8ICB A;  4F2S A;  5EWE A;  1NJZ A;  3M9N B;  1BNO A;  4ECX A;  2C28 A;  3TAP A;  4EP7 A;  5L1J A;  3EYZ A;  4QWC A;  1S10 A;  3EW9 A;  4FS1 A;  3V6J A;  4IQU A;  4BWM A;  4F4X A;  4G3I A;  2FPK A;  2JZB A;  1A76 A;  4I2H A;  4M9G A;  1S97 A;  4ECZ A;  9ICR A;  4UB1 A;  2PFN A;  5JUM A;  5L1I A;  1NK6 A;  4DL4 A;  4KMU A;  3KTQ A;  4F50 A;  4Q43 A;  1UA0 A;  4DSK A;  1Y88 A;  4DWI A;  4PH5 A;  4M47 A;  4FH3 A;  1ZJM A;  4R8U A;  1ARO P;  7ICP A;  3C1Z A;  1NKB A;  5IIK A;  4RQ1 A;  1NK0 A;  8ICS A;  2WTF A;  3PW0 A;  4IRK A;  5HHH A;  1NK8 A;  4I2A A;  2ZUC A;  2MUT A;  5KFA A;  1KDH A;  3C2K A;  4YP3 A;  3M8R A;  5CR0 A;  2FMP A;  4IRD A;  4NY8 A;  2W9M A;  1ZQS A;  4QZC A;  4UB5 A;  4FHX A;  4DLG A;  4P4M A;  4YMM A;  4XRH A;  3GIM A;  4E0D A;  4I2E A;  4KLL A;  1BPB A;  8ICL A;  1UT5 A;  5KFY A;  4UQG A;  4Q8E A;  2PI5 A;  5J2E A;  8ICZ A;  2Y1I A;  4YD1 A;  5KT7 A;  2R8H A;  1ZQT A;  3Q8S B;  2AJQ A;  1DK3 A;  1BPD A;  5KFV A;  1S0N A;  2ZTC A;  3PVX A;  1TAU A;  5J0Q A;  4RUA A;  1T8E A;  3ZDB A;  5HRG A;  2PFQ A;  7ICH A;  2AGP A;  3ZD9 A;  4S3N A;  4O3N A;  3MR3 A;  4O3O A;  4DF4 A;  3C5G A;  4XQ7 A;  1ZQM A;  3PNC A;  4J9M A;  4B9S A;  1IM4 A;  5L9X A;  4BDP A;  4X5V A;  4IG8 A;  3AQM A;  1BVS A;  1S0O A;  7ICN A;  4MF2 A;  4QW8 A;  4IQT A;  4TUS A;  4ECT A;  4NKT A;  1TVA A;  2HHW A;  3HX0 A;  8ICT A;  4DL5 A;  4X0A A;  3ISB A;  2ZTD A;  1ZQK A;  3GV5 B;  3PV8 A;  1BPY A;  4EBD A;  4X4O A;  1ZQP A;  2LYH A;  2HHX A;  1ZQZ A;  2AGO A;  5HP4 A;  3C23 A;  4AT7 A;  4J9R A;  4P4O A;  4O3P A;  3BQ1 A;  3Q8Q B;  3AQK A;  4AT9 A;  5HRF A;  5DLG A;  4F4Y A;  7ICU A;  9ICF A;  4KLQ A;  2DR7 A;  4DSF A;  2PBE A;  4X4U A;  5DB6 A;  4F5P A;  5KG2 A;  1ZQE A;  5L1L A;  1MSW D;  3H4D A;  5J0O A;  2B21 A;  4YMN A;  1XS9 D;  5J2D A;  5KFQ A;  4FBT A;  2XO7 A;  9ICM A;  4RWN A;  5HRI A;  3V7J A;  4MFC A;  2ID1 A;  4Q45 A;  3JPN A;  3TFS A;  2R8G A;  4J9P A;  4O9M A;  7ICO A;  1TFY A;  1ZQW A;  5HRB A;  3RRG A;  2W8L A;  3Q8K A;  2ASJ A;  2BCR A;  3GFK B;  4I2F A;  5DB7 A;  4UAY A;  5J29 A;  3PO5 A;  4WBZ A;  2UVV A;  3UPS A;  3AQL A;  3OJU A;  3UPQ A;  1D9D A;  2FLN A;  4I2B A;  4UAW A;  4RQ4 A;  3BQT A;  4B9V A;  7ICV A;  1RXW A;  4J9K A;  4C8O A;  3JPT A;  4RPX A;  4UAZ A;  4ECV A;  3AQN A;  2BKE A;  5DGA A;  5D4B A;  2FMQ A;  4FHP A;  2HHT A;  3V6H A;  8ICK A;  2DR5 A;  4WCW A;  5IIO A;  4RQ5 A;  1RZT A;  4J9O A;  8ICR A;  3WFS C;  3BDP A;  3HW8 A;  4KLS A;  4AT8 B;  2BHN A;  4RQ0 A;  4C8N A;  4QZH A;  2JEJ A;  3T5J A;  1KSP A;  7ICG A;  2HVI A;  2P66 A;  1R8A A;  3H38 A;  4QWB A;  2V9W A;  4M2Y A;  2P6U A;  1NK4 A;  2DPI A;  3MAB A;  3HP6 A;  2HW3 A;  2Q0Z X;  4RUC A;  4DOB A;  4YN4 A;  5CHG A;  4UBC A;  3HWT A;  2RDJ A;  3SV4 A;  4KLM A;  9ICI A;  3OV7 A;  2VAN A;  3PR5 B;  3V72 A;  4I2I A;  4O3S A;  1F5A A;  4UB2 A;  1MIY A;  4WC7 A;  2ZH6 A;  4CCH A;  4F8R A;  2BQU A;  1XC9 A;  4J9N A;  5DB9 A;  5HRK A;  3RBD A;  4EBK A;  1MC8 A;  4LVS A;  2M2U A;  1NK9 A;  4O5E A;  3MR5 A;  3M9O B;  4HYK A;  2C2E A;  2JZB B;  1LV5 A;  8ICX A;  2BE3 A;  3BJY A;  4P4P A;  1V4A A;  4K4I A;  5J2B A;  3PX0 A;  3UXN A;  4WBY A;  2DPJ A;  2FLP A;  3UXO A;  3JPS A;  8ICV A;  8ICM A;  3H8S A;  4RZR A;  4RT3 A;  4KN4 A;  3IHQ B;  4DLE A;  4ECU A;  2UVR A;  8ICO A;  2I1Q A;  1UEU A;  5J2A A;  2ZHA A;  1BNP A;  1ZQO A;  1QSY A;  9ICT A;  1Z00 A;  2A1J A;  3UQ2 A;  2C2R A;  2ZH1 A;  4KLG A;  3C1Y A;  2W9C A;  1XSL A;  5KG1 A;  3GV8 B;  3KHH A;  2KTQ A;  2GWS A;  5KFF A;  3WFP A;  3LWM A;  3UXP A;  3OUY A;  1ZQJ A;  7ICT A;  3THV A;  3TQ1 A;  9ICO A;  2FPM A;  4PHP A;  4IR9 A;  1FA0 A;  4YR3 A;  4YD2 A;  4DFM A;  4FH5 A;  3SZ2 A;  9ICX A;  1ZJN A;  2IHN A;  1SZP A;  4C8M A;  5J0P A;  4TUR A;  3JPO A;  1U4B A;  1Q78 A;  4X4R A;  5EWF A;  1UA1 A;  3H8W A;  4ECY A;  5HRE A;  4ED8 A;  3H8J A;  4PGY A;  2C22 A;  1UEV A;  5KFH A;  2JEF A;  4LZD A;  3JZ0 A;  3GIK A;  4X4P A;  2BDP A;  1DK2 A;  4DS4 A;  2DR8 A;  4B9U A;  1KFT A;  4YFK A;  4F2R A;  3MDA A;  4DFP A;  3MR6 A;  5J0T A;  2R8K A;  8ICW A;  3SYZ A;  4JV1 A;  5KFO A;  2BGW A;  3MFI A;  4NXZ A;  4BXO A;  2KFZ A;  3FYH A;  4EBJ A;  2ZUB A;  1U45 A;  3RAQ A;  1JX4 A;  1CUK A;  4RPY A;  1TV9 A;  4JV0 A;  4X4S A;  5KFE A;  4ED0 A;  4Z6D A;  1SKR A;  2MAX A;  4KTQ A;  4YR0 A;  4R66 A;  5HMM A;  3GDX A;  1H38 A;  5KFS A;  4Z6E A;  3MGH A;  1TKD A;  5DQG A;  2ZHB A;  8ICE A;  1N56 A;  3EWA A;  3GQC A;  4RU9 A;  2W9B A;  1ZQY A;  8ICG A;  5HRD A;  5KG6 A;  2XY5 A;  1U49 A;  4KLD A;  4WC4 A;  8ICY A;  3NTU A;  4MEX A;  3MFH A;  1S76 D;  4DL6 A;  1ZQI A;  2UVW A;  4PHA A;  3RR8 A;  5DDY A;  4DOA A;  4PPX A;  4J9Q A;  1TK0 A;  3M9M B;  7ICF A;  2ASL A;  1MIV A;  5KT5 A;  2BR0 A;  3MR2 A;  1S0V A;  4AT9 B;  1TFW A;  4YR2 A;  4O5K A;  3ORY A;  5DBC A;  9ICE A;  1R89 A;  3EZ5 A;  8ICH A;  3RBE A;  1NOM A;  1BGX T;  4ELU A;  5BOM A;  1S77 D;  1WCN A;  3JPQ A;  2ZUD A;  2KP7 A;  5CWR A;  9ICA A;  1R8C A;  1NKC A;  2PXI A;  3PY8 A;  5DED A;  2HHS A;  2F1H A;  3JYY A;  4GXI A;  4X4T A;  5J2J A;  2VA2 A;  4NM1 A;  3Q8R B;  7ICK A;  1WCL A;  3Q8M A;  5J0W A;  2IHM A;  4RPZ A;  2W8K A;  4O0I A;  1ZQC A;  4GXK A;  3ETL A;  2R8I A;  4NLZ A;  1C7Y A;  4KLH A;  5EWG A;  4ECS A;  1ZQF A;  4I29 A;  2BPF A;  5KFJ A;  1ZYQ A;  5KFB A;  3E2E A;  4RQ3 A;  3NYB A;  4C8L A;  4O3R A;  3LQC B;  1A77 A;  1HUO A;  1XO1 A;  9ICU A;  2M2W A;  5J2C A;  5KFZ A;  4Q8F A;  3G6X A;  5J2H A;  4RQ2 A;  2XGP A;  3IM1 A;  4QZ8 A;  3N97 B;  1KFD A;  1QTM A;  2R8J A;  1U9L A;  2NRX A;  8ICQ A;  1D8Y A;  5KFN A;  5DBB A;  2Q66 A;  4M9J A;  4JV2 A;  4WC1 A;  4F5N A;  4DOC A;  5DQI A;  4FHV A;  4IQV A;  1SL1 A;  4NM2 A;  9ICN A;  3L9D A;  2KZM A;  4ED7 A;  2NRV A;  3RJJ A;  3JPP A;  4KLJ A;  7ICM A;  4ATB B;  5DBA A;  5KG7 A;  1JXL A;  3WFR E;  1U48 A;  3B0Y A;  4DQR A;  2M2V A;  3V7L A;  3Q8P B;  3PW5 A;  5KT3 A;  8ICP A;  9ICB A;  2ISP A;  3WFO A;  4FHW A;  1OU5 A;  1VFG A;  2XCA A;  3OJS A;  3OVB A;  2O1P A;  3LK9 A;  5J0U A;  3ZDE A;  5C5J A;  1KNY A;  1T3N A;  4QWE A;  3TAR A;  4ELT A;  5IIJ A;  1ZET A;  1UT8 A;  1SKS A;  1SL0 A;  4M9L A;  1YLQ A;  1TAQ A;  3JPR A;  4DL2 A;  4B9L A;  4YXJ A;  4X4V A;  5HR9 A;  1ZQV A;  2FMS A;  4F5R A;  2ZH9 A;  2F1I A;  2ALZ A;  1BPX A;  3RTV A;  1NZP A;  5HRH A;  3PO4 A;  2DRA A;  2ISO A;  4RQ8 A;  4E7X A;  4F5Q A;  2M2T A;  5KFW A;  4XQ8 A;  4F5O A;  3RH4 A;  3HT3 A;  8ICU A;  1S9F A;  3EPI A;  1T7P A;  4QZB A;  1N48 A;  4QZA A;  4KLI A;  4FHY A;  4R65 A;  4KN7 A;  1KLN A;  2ZH7 A;  3M8S A;  4I2J A;  4RQ7 A;  1ZQU A;  2A1J B;  4MF8 A;  1JQR A;  2AQ0 A;  4QZF A;  2P6R A;  3RB0 A;  2NRW A;  5KFR A;  4YQW A;  4EBE A;  4YG2 A;  1JIH A;  4JWM A;  5KG4 A;  2XC9 A;  1TFR A;  2HHU A;  3OUY B;  3QZ7 A;  4R63 A;  4F92 B;  3V7K A;  5HHI A;  1QLN A;  3MGI A;  3ZDA A;  2BCV A;  4YCX A;  1WOT A;  2FLL A;  3ISC A;  5HC9 A;  1NK7 A;  3OVS A;  5BPC A;  1X9M A;  2OWO A;  1B43 A;  3H3A A;  2RFF A;  5KFD A;  5EOZ A;  2DR9 A;  4NKU A;  4PGQ A;  4PGX A;  2ATL A;  4YMO A;  2PFP A;  2PFO A;  4DQP A;  1B22 A;  1R8B A;  2KZZ A;  2XGQ A;  4M6W A;  4R8U B;  1ZQR A;  5KFG A;  3TFR A;  4Z6C A;  1X9S A;  1PX5 A;  1JMS A;  3Q8L A;  2BQR A;  2V4R A;  4FO6 A;  3RRH A;  5IIM A;  4DF8 A;  1SL2 A;  4BXO B;  2MUT B;  4F4K A;  5DGB A;  4O5C A;  1L5U A;  5DKW A;  1DGS A;  3C18 A;  1JN3 A;  3TI0 A;  9ICW A;  2XY7 A;  3ISD A;  4DQS A;  3RH6 A;  2BCS A;  4F4W A;  3PX6 A;  4PHD A;  3RJE A;  2F1J A;  4RNN A;  2W9B B;  4GC6 A;  1HJP A;  5KG5 A;  3GII A;  7ICJ A;  8ICA A;  3EPG A;  4RNO A;  4DQQ A;  1NKE A;  4EZ9 A;  2W9A A;  3G6Y A;  5TZV A;  2C2D A;  1L3S A;  1RYR A;  3C66 A;  2BPG A;  5KT4 A;  3RB4 A;  4B9N A;  3OSN A;  3H40 A;  3PW4 A;  1TK5 A;  4DSL A;  1KEJ A;  5KFC A;  4TQS A;  3C2M A;  4F3O A;  3T5K A;  4M04 A;  4B9T A;  3HPO A;  2ZJA A;  4Z6F A;  1SKW A;  3PR4 A;  4FBU A;  4I28 A;  1JAJ A;  8ICI A;  3HIY A;  4ED1 A;  4K4H A;  3NGD A;  1NO5 A;  3PW2 A;  5DQH A;  4QZI A;  4LT6 A;  5KFM A;  1S0M A;  2KN7 A;  1Z3E B;  2IBK A;  1X2I A;  4M9H A;  3WFQ E;  5J0X A;  3MDC A;  9ICP A;  4M5D A;  1U47 A;  1ZQB A;  3LWL A;  3BQ2 A;  4QZE A;  3OHB A;  2KZ3 A;  4AT7 B;  4UBB A;  2UVU A;  3C2L A;  2HHV A;  3RB6 A;  5D46 A;  5J0S A;  2XCP A;  2ZH5 A;  4IR1 A;  4TQR A;  4MEY A;  4XA5 A;  4F93 B;  3H37 A;  3RB3 A;  4ED6 A;  4XUS A;  3RJG A;  4WC2 A;  4ECR A;  4RNM A;  4Q44 A;  4DL3 A;  1LB2 B;  2VA8 A;  4JWN A;  2ZTE A;  4QWD A;  7ICR A;  3K4G A;  4I2C A;  1L3U A;  2ZJ5 A;  3K75 D;  5CP2 A;  3OHA A;  4DS5 A;  1RXV A;  4DO9 A;  4GXJ A;  1ZQQ A;  5J2F A;  3QEB Z;  4TUQ A;  1L3T A;  2BPC A;  2PI4 A;  4EYH B;  4UD4 A;  4NLG A;  3KHG A;  5KFU A;  4P2H A;  1XWL A;  2DRB A;  4UB4 A;  4WC0 A;  4YXM A;  5KG0 A;  4DQI A;  1MQ3 A;  2ZJ8 A;  2BQ3 A;  4ECW A;  3TAQ A;  2ZH3 A;  4EEY A;  2BCU A;  4X4N A;  3GIJ A;  4JUZ A;  7ICI A;  5CB1 A;  1RPL A;  3KHR A;  5CJ7 A;  9ICG A;  9ICV A;  4ELV A;  3C21 A;  2HHP A;  5KFK A;  5J0Y A;  2HVH A;  9ICK A;  2DFL A;  4E8F A;  1XU4 A;  4ED3 A;  3RAX A;  4KIT B;  5DG8 A;  3GIL A;  3PW7 A;  9ICL A;  4ECQ A;  1K1S A;  1UET A;  4I2G A;  3HJ1 A;  5KT2 A;  7ICL A;  4R64 A;  3KHL A;  1IXR A;  1MQ2 A;  1XSN A;  4NLN A;  4RWP A;  3T5H A;  1V9P A;  4QZG A;  4BGD A;  4J9S A;  1ZQA A;  4WC6 A;  3PML A;  2AQ4 A;  4B9M A;  4KLO A;  5DEC A;  3LDA A;  1ZQN A;  3RJK A;  5HNK A;  3OSP A;  3RJI A;  5DDM A;  1KTQ A;  1X9W A;  3PMN A;  4IRC A;  5DB8 A;  3AUO A;  5CA7 A;  3G6V A;  2HHQ A;  4O3Q A;  1EXN A;  1D8L A;  3ZDD A;  1KFS A;  4RWQ A;  4WC5 A;  2ASD A;  5F2V O;  3OGU A;  3B0X A;  2IMW P;  4QW9 A;  4E80 A;  3GV7 B;  2H5X A;  4F91 B;  4J9L A;  3TAN A;  1KRP A;  4RT2 A;  5III A;  3QZ8 A;  2V4Q A;  8ICN A;  3HJ4 A;  4RQ6 A;  2J6U A;  2JEI A;  4JK1 A;  2XY6 A;  3AU2 A;  5L1K A;  2JEG A;  1ZQD A;  4EZ6 A;  9ICC A;  1XSP A;  3N4M B;  2RDI A;  5KFI A;  4ED2 A;  3T3F A;  1RYS A;  4DEZ A;  5F9N A;  5J2G A;  4EYI B;  3V6K A;  1T4G A;  3RH5 A;  2J6S A;  1COO A;  4I2D A;  2Y1J A;  5IIN A;  1ZQH A;  4IQW A;  2DVI A;  5DG9 A;  3SI8 A;  2M9N A;  1ZQG A;  4KLU A;  5D49 A;  2ZH4 A;  3BQ0 A;  4C8K A;  1ZQX A;  2ZH8 A;  4M6W B;  1Z00 B;  4KLE A;  4WC3 A;  4ZH4 A;  5KT6 A;  2KFN A;  3OVA A;  2W9C B;  5F9L A;  2FPL A;  3FDS A;  4GLX A;  3RJF A;  4BWJ A;  4X0B A;  1VJ7 A;  4DL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...