4PGQA

Structure of human dna polymerase beta complexed with g in the template base paired with incoming non-hydrolyzable ttp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
324
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 112
structure length 324
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgqA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgqA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgqA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgqA03
4AT7B 1BNOA 2FMSA 2Q0ZX 5KG5A 4RWNA 4EYHB 4ECZA 3OJUA 4I2JA 4B9MA 2BCUA 5J0OA 2BQ3A 1SKRA 2P6UA 4DO9A 4QZGA 4ECRA 5BPCA 4TQRA 4F5PA 1NJYA 3PX4A 2NRTA 4XQ8A 3OSNA 4KLMA 7ICEA 2M2UA 4DL5A 4JV1A 3QZ7A 3Q8QB 2RDIA 1H38A 4E0DA 4Q8FA 3JPTA 3WFQE 1WCNA 3QEBZ 8ICNA 5IINA 4KLTA 4F5RA 1NK4A 4AT9B 2IA6A 5DDYA 4QZ8A 3H4DA 4J9MA 1TV9A 1ZQDA 1C7YA 4C8OA 4IQVA 3C23A 3QZ8A 4R8UB 4DF8A 4ELVA 3JPOA 5KG6A 4F8RA 5KFCA 2UVVA 2J6SA 4Z6CA 4ECXA 4F2SA 4X4QA 5J29A 1NJZA 4ECVA 4BDPA 4I2DA 4DOAA 4FHXA 1UEVA 5DQIA 3G6YA 4ED6A 2OWOA 4YP3A 3RJHA 1TKDA 8ICEA 1TAUA 3TAPA 2WTFA 4WBYA 3V6JA 2M2TA 3HP6A 4P2HA 7ICUA 4X4UA 5CWRA 3LK9A 5DLFA 3T5JA 4RWOA 4RNOA 3MABA 7ICSA 1VJ7A 3UPSA 4YD2A 2XY7A 3KHRA 3RBDA 2DR5A 4X4PA 3MDCA 7ICNA 4FHYA 1NOMA 4ECSA 3K4GA 3GILA 5CHGA 3C66A 4X4NA 4MFAA 3TQ1A 5D46A 1R8AA 2V4RA 3L9DA 3AQNA 4KITB 4PGYA 1ZQPA 4J9LA 2FLLA 3MFHA 4YFKA 2AGQA 3N97B 5KG7A 4KLEA 5F9NA 9ICGA 4QWAA 4DLEA 9ICHA 1YLQA 2RDJA 2BCRA 2KZMA 1JIHA 2BGWA 4QZHA 2ZTEA 5IIMA 1QSYA 2VANA 1ZQCA 1ZJNA 3NYBA 3V6HA 9ICAA 4ECTA 1XSNA 1ZQMA 4M6WB 3KHHA 4YQWA 4UB2A 2BQRA 1JX4A 2ZUBA 1XC9A 3RJJA 3H8WA 4O5EA 5J0RA 4TURA 3UXOA 3HWTA 5CP2A 4P4PA 4F4YA 1ZQEA 1UA0A 1NJWA 2IHMA 3JPPA 8ICHA 3OUYB 2C2RA 8ICCA 4K4IA 4P4MA 3M8RA 1BPDA 1RYSA 4I2EA 4NY8A 1S0OA 7ICLA 9ICKA 5HHIA 4AT8B 2ZJ8A 4MFCA 3AQKA 4EP7A 2V4QA 4PPXA 5KFNA 4O3OA 5IIJA 4DL7A 4DFJA 4YCXA 1L3VA 4RT3A 4PHEA 4KLSA 4QZ9A 2ID1A 4FH3A 2BCSA 4UB1A 4TUQA 4M0AA 2UVWA 1KFSA 5KFUA 2I9GA 4I27A 5CA7A 2F1IA 4F5NA 4WC6A 4M5DA 4YMMA 4YMOA 4KLHA 3MR3A 5HRBA 1Q79A 3H8JA 5HRFA 2W9CA 5DG7A 4GXIA 1X9WA 2PFPA 3HW8A 5KT7A 5HREA 4FHVA 3JPRA 1BPEA 5KFEA 1B43A 3GIMA 3PW2A 5DB7A 4M47A 3UXPA 4O9MA 3TI0A 1QLNA 1NK7A 9ICUA 2ZH5A 3K75D 2BCVA 2ISPA 4RWPA 4EBDA 4RPZA 3UQ2A 3ZDEA 4KLDA 5BOMA 9ICFA 5KFOA 5KG0A 4BXOA 4ELTA 4PGQA 4IRCA 2HVHA 4DS4A 5KFGA 1DGSA 3FYHA 5KFSA 2ATLA 3RJEA 3ISBA 4WBZA 9ICOA 3ISCA 2ISOA 1D9FA 4BXOB 4RWQA 2FPKA 2V9WA 4M6WA 4F4ZA 8ICZA 1K1QA 2BR0A 3RJGA 5KFZA 3GIKA 4NLNA 4YXJA 3M8SA 4DQPA 9ICMA 2KZ3A 1ZQJA 1ZQVA 2C2DA 4RQ8A 4B9LA 3GQCA 7ICKA 4DSKA 5J2CA 5KFLA 8ICXA 5KT4A 2AGOA 4EBCA 4DL4A 5EWFA 1RXVA 5EOZA 1ZQTA 2ZH4A 4DOBA 5KT2A 1S0MA 4JV0A 3RTVA 4O3QA 3ZDBA 1U49A 4O3NA 3ETLA 5KFAA 4IR1A 5HNKA 2HHQA 1V4AA 4J9QA 3PX6A 5KG4A 3C2KA 3H3AA 3MR2A 3RB6A 3GDXA 3Q8SB 5IIIA 1SL0A 4I29A 4NKUA 1ZQBA 1NK0A 2ZUDA 2ZUCA 4C8MA 5IIKA 4I2AA 7ICHA 3PW5A 4YR3A 1T7PA 7ICTA 3KTQA 4FHPA 3TFSA 4GC6A 4ED2A 8ICOA 4TUPA 2W9AA 9ICRA 4PHPA 5KFKA 4RU9A 4YR0A 4QZBA 2ALZA 1NK8A 4DFKA 5DB8A 4LZGA 2IBKA 2JEFA 3ZDAA 1S76D 2HHSA 1R89A 1DK2A 8ICUA 9ICJA 5L9XA 2M9NA 9ICIA 5IIOA 3OJSA 3NGDA 1Q78A 2FLNA 4X4VA 1DOQA 1ZQLA 2HHTA 4QWBA 4E80A 2ZH2A 2VA8A 3H7IA 4J9NA 1NK9A 2ZH6A 4NM2A 1S0VA 1ZETA 7ICJA 4RQ4A 4J9SA 5DKWA 5J0YA 4ECUA 1XSLA 2PI4A 4C8KA 4O5KA 2C22A 4QZDA 3C1YA 4ECWA 3LDAA 5J2HA 4ECYA 1R8BA 3HPOA 3JZ0A 5J2FA 3PY8A 1COOA 8ICSA 4JWNA 4NXZA 3WFSC 4DL2A 5KFJA 9ICSA 4X4RA 1RZTA 5BOLA 4KLOA 2NRZA 4FO6A 4AT8A 4E8FA 2ZH3A 2JEIA 1U45A 4MEYA 4FS1A 3AU2A 1ZQUA 1RYRA 3LWLA 2A1JB 5HC9A 5DQHA 3H40A 4LZDA 3OVAA 4YD1A 4NM1A 1KRPA 1BPZA 7ICMA 5DLGA 1Z00B 4XRHA 4C8NA 3GIJA 2XY5A 2MUTB 4R63A 2IMWP 2ZH8A 5DECA 4UQGA 2R8HA 2O5AA 4X5VA 2HHXA 8ICKA 3H39A 2FMQA 3H4BA 4GXJA 2NRKA 5C5JA 4GC7A 1ZQNA 4QW8A 3MR5A 4UAYA 4PH5A 1MIYA 2O1PA 4YXMA 4WC0A 3PR4A 3ZD9A 4MF2A 3BQTA 1ZQXA 3PO5A 2BDPA 5HRDA 1Y88A 8ICIA 2BKEA 5J0WA 5DG9A 4M9JA 3MGHA 4RNNA 5J2IA 1HUOA 3PX0A 4RZRA 1BPYA 4PGXA 4ED0A 2I1QA 4RQ2A 3M9NB 1KLNA 2VA3A 2PI5A 4DSLA 4FHWA 2B21A 4DFPA 4P4OA 5J2JA 2PFNA 8ICJA 1HUZA 4X0AA 3OVBA 3M9MB 3C18A 5HRIA 1KFDA 4UD5A 3G6XA 2BQUA 2R8GA 2KZZA 3NTUA 7ICPA 4WC3A 4DSEA 4X4SA 4YMNA 3RB3A 4F4XA 3UQ0A 2AU0A 5KFHA 4UAWA 4MF8A 4F93B 3TFRA 1MQ2A 4DLGA 1MC8A 4HYKA 5J2DA 1SL2A 1JAJA 4ED1A 1EXNA 5DB6A 4O3SA 4WC7A 2Q66A 3EPIA 4J9RA 4M04A 1KNYA 2XGPA 2W8KA 7ICQA 9ICTA 1ZQGA 1A76A 1JXLA 4IRDA 4C8LA 2P66A 8ICMA 9ICBA 3T5LA 1NO5A 5HHHA 4RQ0A 1BPBA 4LT6A 5KFIA 4YR2A 3ZDDA 4I2GA 4IQTA 1U48A 5J2AA 2W8LA 4F92B 3EW9A 5TZVA 4KMUA 3GIIA 3QE9Y 2JEGA 1QSLA 2AJQA 4EBEA 5KG1A 4DQIA 1UT8A 4X4OA 4GXKA 4R8UA 4YN4A 3BDPA 4EEYA 4NLZA 4G3IA 3OHBA 1NKBA 2ZTDA 4Q43A 2MAXA 4M9LA 4B9TA 1MSWD 5HRGA 5J0PA 4Z6FA 3MBYA 1PZNA 5HRKA 2ZTCA 4WC4A 4DWIA 1CEZA 3PR5B 8ICWA 2BE3A 3UXNA 1NJXA 5KFQA 4Z6DA 3KHLA 1XS9D 1XU4A 4IQUA 3EWAA 1SL1A 1TK0A 4TUSA 2R8JA 4EBKA 2XC9A 5DB9A 4QZFA 2C28A 2XO7A 1TAQA 5J0QA 4XUSA 2AQ4A 1ZQIA 4DEZA 4DSJA 3ZD8A 2IHNA 8ICPA 3H8SA 1ZQSA 2ZH9A 4KLQA 1KTQA 8ICGA 8ICAA 2ZH1A 1UEUA 1JN3A 1QTMA 4NLKA 4FS2A 4NKTA 3OSPA 4K4HA 5JUMA 4R64A 3HJ4A 3PW7A 4QZCA 5DG8A 4RPXA 7ICIA 7ICVA 4KTQA 4X0BA 1T8EA 2FLPA 4WC2A 2W9CB 2ASJA 8ICRA 1ZQRA 3PNCA 4BWJA 1K1SA 1JXEA 4BWMA 2ZJ5A 4DL6A 4FBUA 1T3NA 2XCAA 3TANA 2HHWA 1SZPA 4XQ7A 2F1HA 3GV7B 4Z6EA 4ED8A 4E7XA 3AUOA 4EYIB 3C2MA 1NKEA 5HRLA 2FMPA 4M9NA 5KT3A 3AQMA 2W9BA 2P6RA 1R8CA 2ZHAA 1ZQQA 2JEJA 3OGUA 1DK3A 1JMSA 3V7JA 4ED3A 3RAXA 1D8LA 3HIYA 3Q8RB 5CR0A 1FA0A 2HHPA 1UA1A 1ZQZA 3LQCB 3B0YA 3RR7A 3JPQA 4XA5A 3MR6A 5D4BA 5DEDA 1S77D 1D9DA 5KFYA 3MDAA 5J0SA 4DF4A 3AQLA 4RUAA 5HMLA 3T5HA 1CUKA 4FH5A 3C5FA 1UETA 3MGIA 4QWEA 4IRKA 4TQSA 2NRWA 2FPLA 3C5GA 3C2LA 3RH6A 5J2KA 2M2WA 1N48A 4EZ9A 3MFIA 2KFZA 1QSSA 2DPIA 2J6TA 2DR9A 3PO4A 3T3FA 1PX5A 4DQQA 3SI8A 4B9VA 4RQ6A 3RH4A 1L3UA 3C1ZA 4I2CA 9ICVA 1RPLA 4QZIA 3EZ5A 2PBEA 4PHDA 3KHGA 1HJPA 3OVSA 2JZBA 4UBBA 4EZ6A 1OU5A 5L1KA 3WFPA 5HMMA 2BHNA 2AGPA 5KT5A 1WOTA 1Z00A 2BPGA 2C2EA 9ICWA 3HX0A 4RPYA 2DPJA 4F5QA 4I2IA 2JZBB 5J0XA 2KP7A 3SZ2A 3TAQA 4QWCA 4I2BA 4DQRA 1UT5A 2A1JA 5KFVA 4BGDA 5HP4A 4B9UA 3RR8A 4KLGA 4EBJA 8ICYA 4JK1A 4UB3A 1U4BA 8ICFA 9ICEA 1N56A 3JYYA 4X4TA 3Q8MA 5J0UA 1MIWA 1ZQYA 3ORYA 1NZPA 4ATBA 4M9GA 3GV5B 1JQRA 2PFOA 2RFFA 3V7LA 9ICLA 2R8KA 5KG2A 5KFBA 5DBAA 5DGAA 4DFMA 5IILA 4F50A 4UB5A 2Y1JA 4AT9A 2M2VA 4YVZA 3OUYA 1XO1A 4JUZA 1LV5A 3E2EA 1TFRA 3PMLA 1ZQAA 1X2IA 4DSIA 1BNPA 3RH5A 1SKWA 8ICTA 4MEXA 5HRHA 5KG3A 5KFDA 3FDSA 3H37A 3Q8LA 5HR9A 1IM4A 2PXIA 5CB1A 4DL3A 4YG2A 1S9FA 1TK8A 2BPFA 3RBEA 1LB2B 3RJKA 4KLJA 5J2BA 3HT3A 3N4MB 4F5OA 4NLGA 4O0IA 2ASDA 2PFQA 4IG8A 3SV3A 4IQWA 4R65A 2UVRA 4UD4A 4IR9A 1ZYQA 4F91B 2BCQA 3PW0A 9ICPA 2F1JA 1VFGA 5KTQA 1S10A 1TFWA 1NK6A 3RAQA 3H38A 3RB0A 4LVSA 4RUCA 4CCHA 3LWMA 3IHQB 3WFRE 4ZH4A 2FPMA 3PMNA 3AU6A 2VA2A 9ICQA 2KN7A 3EYZA 3IM1A 7ICGA 3Q8KA 5L1JA 3JPSA 4I2FA 4QW9A 1X9SA 7ICRA 3PVXA 2DRAA 8ICLA 1B22A 3C21A 5L1IA 4F3OA 2MUTA 1A77A 4Q45A 3G6VA 3BQ0A 4B9NA 1U9LA 3T5KA 2NRXA 1F5AA 4F4WA 4KN4A 2ZH7A 3RJFA 4UAZA 2DR8A 2HHUA 1KFTA 4JWMA 1ZJMA 1TFYA 4KLFA 3Q8PB 3RB4A 4S3NA 4QWDA 5KFRA 5F2VO 4PHAA 9ICXA 3PV8A 4DS5A 9ICCA 1MIVA 4M2YA 2ZJAA 2HVIA 5DBBA 1KSPA 2KTQA 4RQ1A 4O3PA 3BQ1A 5DQGA 1D8YA 5F9LA 4UBCA 4Q8EA 1S0NA 4Q44A 4ECQA 3RRHA 2HHVA 4KLIA 3SYZA 3QEAZ 1U47A 7ICFA 3EPGA 8ICBA 1BGXT 3JPNA 1TVAA 1Z3EB 3GFKB 4WCWA 4RNMA 5DBCA 4RQ3A 3UPQA 5KFPA 4R66A 4DOCA 5KFXA 4F4KA 1AROP 2AQ0A 7ICOA 2BPCA 1BVSA 4FBTA 1T4GA 1IXRA 2LYHA 4RQ7A 5EWEA 1MQ3A 4B9SA 2Y1IA 4WC5A 4O5CA 5D49A 4QZEA 4O3RA 5KFWA 2XY6A 4JV2A 3TARA 8ICQA 1V9PA 5KFMA 3PW4A 5J2EA 5DGBA 1S97A 2DFLA 4KLLA 3OHAA 1ZQHA 2W9MA 3V6KA 3ZDCA 5KFFA 1RXWA 2DR7A 2H5XA 3HJ1A 3OV7A 4J9OA 1ZQKA 2R8IA 4RQ5A 2XCPA 1KDHA 2KFNA 2W9BB 1L5UA 4DSFA 4ATBB 4KLUA 2DRBA 1XSPA 4DQSA 4QZAA 4RT2A 4MFFA 4AT7A 1TK5A 1NK5A 4J9KA 3BJYA 4KN7A 3GV8B 1KEJA 1L3TA 5L1LA 3V72A 3THVA 1ZQOA 5CJ7A 2NRVA 5EWGA 5J0TA 4UB4A 3V7KA 2J6UA 4K4GA 2HW3A 1ZQFA 3ISDA 3B0XA 2UVUA 3BQ2A 4ED7A 1NKCA 1SKSA 2GWSA 4I28A 4M9HA 8ICVA 1XWLA 2ASLA 1X9MA 4F2RA 2ZHBA 4GLXA 2DVIA 3RJIA 1ZQWA 5KT6A 5J2GA 2XGQA 1BPXA 3SV4A 1L3SA 3WFOA 3RRGA 4ELUA 4WC1A 9ICNA 4I2HA 4J9PA 5DDMA 3M9OB 1WCLA 5KFTA
chains in the Genus database with same CATH superfamily
2PMZF 4RWNA 2BCUA 4ECRA 5BPCA 4XQ8A 3OSNA 2KIWA 4JV1A 2A1AA 2RDIA 1VDVA 1CRXA 4Q8FA 1Z1VA 3WFQE 8ICNA 4F5RA 2IA6A 1TV9A 5ALNA 3QZ8A 4ELVA 3JPOA 5KG6A 2DUYA 5AI8A 4F8RA 5J29A 1NJZA 3SMVA 3AQFA 1N5WA 8ICEA 2WTFA 1JI7A 4X4UA 2Q4TA 1VJ7A 3UPSA 3RBDA 2YMMA 3MDCA 2EZYA 4ECSA 4OAFA 1B0XA 3GILA 4X4NA 2LKYA 2RP5A 5ALEA 3L9DA 4J9LA 2KHVA 9ICHA 5F9NA 4DLEA 4O68A 1YLQA 3BS5B 3AMZA 4EX6A 3V6HA 1ZQMA 4M6WB 1JX4A 1XC9A 4O5EA 4AP9A 4P4PA 3OUYB 3JPPA 8ICHA 1BPDA 7ICLA 3N7PD 1S0OA 4EP7A 4MFCA 3AQKA 3IV6A 3WK4A 4DL7A 4KLSA 3J81j 4M0AA 2UVWA 2I9GA 1KQQA 4YMMA 5G5GA 4WJ3B 2H3VA 4IL6U 2PFPA 4Y2XA 5KT7A 1JROA 1BPEA 5AKLA 1B43A 2B56A 5DB7A 3TI0A 9ICUA 1NK7A 3K75D 3UQ2A 5A0LA 3MCRA 1MA7A 1OUQA 4FZMA 3H0LB 3ISCA 4RWQA 2HBKA 2BR0A 3RJGA 3GIKA 2E1FA 3WKEA 3M8SA 1ZQJA 4RQ8A 2FJ6A 2RHFA 5J2CA 8ICXA 2QB1A 4EBCA 1RXVA 2ZH4A 2F2AB 4O3QA 2HMXA 2D6FC 4O3NA 2HN2A 3H3AA 3Q8SB 5IIIA 1ED1A 4C8MA 4I2AA 5ALUA 1T7PA 4FHPA 2QARB 4GC6A 4ED2A 4Y2SA 9ICRA 4YR0A 4QZBA 1S76D 5DB8A 1R89A 2IBKA 2JEFA 1DK2A 2M0NA 1SWVA 9ICJA 5L9XA 9ICIA 3NGDA 1Q78A 3QX7A 4X4VA 4E80A 1PVQA 1NK9A 5AHXA 1S0VA 3VCBA 4O5KA 3C1YA 5J2HA 2DQNB 1R8BA 4JWNA 3IDWA 3WFSC 4DL2A 5KFJA 3NKUA 1RZTA 4AT8A 2JEIA 1RYRA 5ALTA 5AM1A 3WKDA 1ZQ1C 4NM1A 2G5IB 4NLCA 5DLGA 7ICMA 3GIJA 4C8NA 4R63A 5AKZA 4UQGA 1SV0C 2HOQA 1JRPA 4X5VA 2HHXA 8ICKA 5C5JA 1ZQNA 4UAYA 4YXMA 4P0PA 1ZRMA 3BZKA 1Y88A 4JB3A 4Y2RA 4RNNA 4RZRA 4ED0A 3M9NB 4FHWA 5J2JA 2PFNA 2WHEA 1FEZA 8ICJA 3OVBA 3M9MB 5HRIA 1KFDA 4OJPA 7ICPA 4F71A 1OW5A 5AM0A 3UQ0A 4P0QB 3WU2U 5KFHA 3TFRA 4F93B 4DLGA 4U6PA 4HYKA 1SL2A 1IG6A 4WC7A 1EXNA 1S8OA 2JV3A 3D2QA 1A76A 3SAHA 4IRDA 4XJEA 2QARA 4RQ0A 1BPBA 4YR2A 1SV4A 2B6GA 2RRDA 5TZVA 2XVTA 3QYPA 3QE9Y 2AJQA 5KG1A 1UT8A 4X4OA 1V85A 4AYBC 2MAXA 1MSWD 4CDGA 1PZNA 4DWIA 8ICWA 2YB1A 3UXNA 1NJXA 4TUSA 3SEIA 1FO4A 2C28A 4KLQA 1KTQA 2HBMA 8ICAA 2KVCA 2HCFA 5ALHA 1LVHA 3QUCA 5C0YA 4RPXA 2K8BB 2EAOA 2ASJA 4FO1A 1JXEA 4FBUA 3TANA 2F1HA 3GV7B 1Q3VA 4Z6EA 4EYIB 2K8CB 1KBUA 5HRLA 4PZNA 1C20A 2W9BA 2P6RA 2JGAA 4US9A 4NV0A 2ZHAA 2JEJA 3QU2A 4ED3A 1FA0A 5CR0A 2BBHA 2K89A 1COKA 3RR7A 1DXSA 2KKPA 2KKVA 5ALMA 4KM5A 5J0SA 1SGGA 4DF4A 3T5HA 5HMLA 1CUKA 1O03A 4QWEA 4IRKA 3C2LA 3RH6A 2M2WA 1N48A 2KFZA 3DDHA 1ZD5A 2N1RA 2PBEA 1RPLA 3KHGA 3ERCC 4EELA 2BHNA 2AGPA 5KT5A 2BPGA 4LEYA 2C2EA 4RPYA 2DPJA 3GZFA 1TAMA 3AQEA 4BGDA 5HP4A 4KLGA 1ZOLA 4UB3A 4UB8U 5KL1B 2ZIUA 3LYSA 2DL0A 3BZCA 1K5OA 3OUYA 4LJXA 3ZI4A 4OJOA 2LMRA 2MU2A 5ALGA 5ALLA 1BNPA 5HRHA 4CF5A 5ALOA 4DL3A 1S9FA 1TK8A 3RJKA 1LB2B 2ASDA 4IG8A 2PMZC 4UD4A 4F91B 2F1JA 3HRDD 3SENA 1NK6A 3H38A 3RB0A 4RUCA 3PMNA 2FPMA 3AU6A 3UMBA 9ICQA 2ZIVA 3IM1A 7ICGA 5AIAA 2ZIUB 3JPSA 2GOLA 2D8CA 2DRAA 3PVXA 3QU4A 2MUTA 3ER8C 1PK1A 2LM1A 3T5KA 4F4WA 2MA1A 5ALSA 4Y2JA 2ZIWB 4QJFB 2DR8A 5B3PA 2EDUA 5ALYA 1O08A 3RB4A 5F2VO 4UB6U 4DS5A 2F8LA 5DBBA 1D8YA 5F9LA 4UBCA 4Q8EA 3MC1A 2HHVA 3T79A 3EPGA 4WCWA 3UPQA 7ICOA 1BVSA 1RG6A 1AQ6A 5D49A 1FIQA 1QQ7A 5J2EA 1S97A 2DFLA 3QU5A 4KLLA 3ZDCA 2DR7A 3NASA 2R8IA 4RQ5A 2XCPA 1KDHA 2W9BB 4DSFA 4ATBB 4DQSA 4US8A 4QZAA 4RT2A 4AT7A 1PUZA 4J9KA 2DGZA 1KEJA 5EWGA 1ZQFA 4ED7A 1NKCA 1XWLA 2DVIA 3RJIA 1ZQWA 2XGQA 1BPXA 2OYYA 3RRGA 3WK5A 5DDMA 1WCLA 4AT7B 1BNOA 1PVPA 3OJUA 2P6UA 5B66U 4QZGA 4DO9A 4KLMA 7ICEA 4F5PA 7ICVA 4DL5A 4E0DA 2XICA 2ZIWA 3NS1A 5IINA 4KLTA 4QZ8A 2KHQA 4J9MA 3FC4A 4R8UB 1ZD2P 4X4QA 4F2SA 4ECXA 2GLEA 5TISU 4DOAA 4USAA 3H0RB 1UEVA 2KG5A 5DQIA 2OWOA 4ED6A 2Y0SF 4YP3A 3RJHA 1TKDA 3TAPA 1X40A 4OJ5A 4WBYA 2LPEA 3HP6A 7ICUA 4EX7A 2AHOB 3LK9A 3T5JA 2EQYA 2G5HB 4RWOA 3TADC 7ICSA 3OTQA 2DR5A 2K4PA 1Q3UA 5JTGA 1UCVA 1NOMA 1NI3A 3K4GA 2BBJA 2V4RA 1PK1B 5ALIA 3AQNA 4K99A 1VLBA 4PGYA 1ZQPA 2FLLA 2CXYA 2E8NA 4YFKA 2I5HA 4KLEA 9ICGA 1L7PA 3TKAA 2ZTEA 3NYBA 1ZQCA 3SQIA 9ICAA 1WWVA 4EGWA 4UB2A 3H8WA 4OAIZ 5CP2A 2C2RA 4K4IA 1RYSA 4NY8A 1LKYB 9ICKA 2V4QA 4O3OA 5IIJA 3WKCA 4YCXA 4OJ6A 2ID1A 1X42A 1L8OA 4M5DA 4KLHA 2H3QA 1WWUA 1Q79A 5DG7A 4FHVA 1QLNA 2WAQC 2BCVA 4RWPA 1JQRA 4RPZA 5BOMA 9ICFA 5KFOA 4PGQA 4IRCA 2HVHA 1DGSA 3FYHA 2ATLA 4BXOB 2FPKA 4M6WA 2KZ3A 5ALDA 1WUDA 4DSKA 2W7PA 5KFLA 5KT4A 2AGOA 4K98A 1WG8A 5KT2A 1S0MA 3ER9B 2DKZA 3RTVA 1DGJA 1GO3F 1U49A 1A6SA 3FM9A 2DF4B 1V4AA 4J9QA 5KG4A 3L4PA 3MR2A 3RB6A 3BS7A 2W43A 4C80A 2ZUDA 2ZUCA 5IIKA 3PW5A 4YR3A 2JH1A 1PVRA 8ICOA 2W9AA 4KX3A 5KFKA 2OXOA 4XQ7A 4DFKA 3TADA 3K7DA 4DCCA 4UARA 1Q8KA 2HHTA 2K8AA 4NLBA 4K9AA 2VA8A 2ZH6A 4J9NA 4NM2A 4O67A 4KX5A 5AK6A 4J9SA 5DKWA 3F5EA 5J0YA 4ECUA 4C8KA 3LDAA 3ETRA 4ECYA 5J2FA 1ZXIA 2ZH3A 2G06A 4E8FA 4MEYA 1ZQUA 2EAPA 5HC9A 5DQHA 4LZDA 4YD1A 1BPZA 3A0HU 1Z00B 2IMWP 2MUTB 4UASA 2ZH8A 4K9BA 1MN8A 2FMQA 3MR5A 4PH5A 3SD7A 2WFAA 3QNMA 3PR4A 3ZD9A 5AKGA 3BQTA 1ZQXA 3PO5A 2BDPA 2XIDA 5HRDA 5J0WA 1HUOA 4UAUA 3PX0A 4RQ2A 2VA3A 4DFPA 1LKYA 4UD5A 3G6XA 3HKZC 2KZZA 2KICA 3N28A 2AU0A 4UAWA 4MF8A 1RYUA 2IOHA 4ED1A 4O3SA 5AKIA 4M04A 2NO4A 1ZQGA 4C8LA 3PSTA 5KFIA 3ZDDA 5J2AA 3GIIA 4EBEA 2I6XA 5ALVA 3IG5A 2ZXHA 3BDPA 4G3IA 3OHBA 1NKBA 2ZTDA 4JMUA 3MBYA 1CEZA 2DWQA 4Z6DA 5KFQA 3KHLA 4IQUA 3EWAA 3NVYA 1SL1A 5D61A 2R8JA 5B5EU 1TE2A 1V97A 5DB9A 4QZFA 4OD0A 5J0QA 4XUSA 5JRTA 4DEZA 2IHNA 8ICPA 4RQNA 2ZH1A 1UEUA 1JN3A 1QTMA 4FS2A 4NKTA 3OSPA 2DKXA 2KNJA 5JUMA 4R64A 1N61A 4QZCA 7ICIA 2FLPA 1ZRNA 2W9CB 8ICRA 4BWJA 4BWMA 1SZPA 4J03A 4ED8A 2HDOA 5ALJA 4I0UA 1ZQQA 2NV3A 3M6KA 1D8LA 5L1MA 2LBOA 3Q8RB 3WKBA 1ZQZA 3LQCB 4WOYA 4XA5A 2JR5A 5KFYA 5HR6A 2K4HA 4FH5A 1UETA 2FPLA 1S5LU 5J2KA 3MFIA 3PO4A 1PX5A 4B9VA 1L6NA 9ICVA 2ZIXA 3EUB2 4CE6A 1OU5A 5HMMA 3L3FX 2GAFD 1Z00A 3ALRA 9ICWA 4GIBA 3HX0A 3PSIA 1UPHA 3SZ2A 1JUDA 4DQRA 1UT5A 2A1JA 1U4BA 4JLXA 2YQEA 8ICFA 5AK5A 9ICEA 2FE9A 3ORYA 1NZPA 4M9GA 2PFOA 3V7LA 2R8KA 2IOFA 5KG2A 2KK0A 1SZHA 1XO1A 4JUZA 1ZQAA 1IV8A 3SAGA 5KFDA 3FDSA 3Q8LA 1IM4A 4MHVA 2BPFA 4FZNA 4IS7A 4B6JA 5J2BA 3HT3A 4O0IA 5GTIU 3SV3A 1RDFA 2WF8A 1TFWA 3RAQA 3F2CA 3LWMA 3IHQB 3WFRE 4ZH4A 2VA2A 2KN7A 3BS5A 4FE3A 3EYZA 2H3IA 4QW9A 3AM9A 4PL2A 3WK8A 8ICLA 4NXUA 4QIWF 3G6VA 2LM4A 1U9LA 3AEVA 1X66A 2FI1A 3CYMA 1F5AA 3N7SC 2ZH7A 3RJFA 2HHUA 2JXJA 5CFTA 4JWMA 1ZJMA 4C4RA 3PV8A 2YMPA 1OXJA 9ICCA 1MIVA 1KSPA 2KTQA 4RQ1A 2CPRA 5DQGA 4Q44A 4ECQA 2E8OA 1U47A 3JPNA 3GFKB 4RNMA 5DBCA 4RQ3A 1NZBA 4Y2YA 1XNSA 3D2NA 4F4KA 2BPCA 2HBLA 1VJ5A 1T4GA 2LYHA 4RQ7A 4O5CA 5AKKA 4O3RA 2XY6A 8ICQA 2HBJA 1RXWA 4LEVA 3WK9A 4EENA 4J9OA 3HJEA 4KLUA 1XSPA 3KKAA 1TK5A 3GV8B 3RF9A 5AM2A 4LEWA 5CJ7A 2HW3A 2QB0B 4UAVA 3ISDA 2UVUA 4I28A 3BQ2A 1SKSA 2ZHBA 2ASLA 4GLXA 2OM6A 2IOFK 5J2GA 2OCEA 3NRWA 4ELUA 5AKJA 2KJ9A 2IHOA 3M9OB 5CEHA 2YX8A 5KFTA 2Q0ZX 3GU3A 4ECZA 4B9MA 4I2JA 4EEBA 1SKRA 2HN1A 1NJYA 4TQRA 2M2UA 2NRTA 2EWRA 3I76A 3Q8QB 1H38A 4HX0A 3H8MA 1WCNA 1NK4A 4AT9B 1QCKA 5ALWA 5DDYA 2DBYA 3H4DA 4C8OA 3C23A 4DF8A 4NL9A 3U26A 5KFCA 4FHXA 2ZXIA 1X9XA 1N62A 2M2TA 4P2HA 3CRXA 4RNOA 4YD2A 2RQ5A 2WF6A 3KHRA 5CHGA 3C66A 3TQ1A 1R8AA 3MFHA 2AGQA 4K97A 4NXXA 4CGZA 4QWAA 2RDJA 2KZMA 1JIHA 2BGWA 1ZJNA 4ECTA 2KD1A 3KHHA 2BQRA 4C0ZA 2ZUBA 1ZQEA 3UXOA 4Y2UA 1F5SA 1UA0A 1NJWA 5AI0A 8ICCA 3M8RA 2G09A 2D3DA 4AT8B 2ZJ8A 5KFNA 4DFJA 1L3VA 4RT3A 4QZ9A 4FH3A 2ZIXB 4TUQA 3IG8A 4I27A 4F5NA 4YMOA 2G08A 3MR3A 3H8JA 3KOOA 1UQVA 2NYVA 3HW8A 5HREA 3JPRA 5KFEA 3GIMA 3UXPA 4CF3A 4EBDA 5HR9A 3ZDEA 5ALXA 4BXOA 5KG0A 3BQ7A 2YN4A 5KFSA 4DS4A 4EEDA 3ISBA 2ISOA 1KL9A 3IP4B 1SV0A 4K8VA 2V9WA 1K1QA 5KFZA 1FFUA 5EE9A 4B9LA 7ICKA 3PHZA 5AKEA 4QNLA 2JRZA 1ZQTA 1ECWA 1RQLA 1WYGA 3ETLA 1QQ5A 4IR1A 5HNKA 2HHQA 1V38A 3C2KA 1N60A 1SL0A 4I29A 2JMGA 2GH1A 3KFUF 3KTQA 4TUPA 2W7OA 4PHPA 1HEKA 4O3MA 4RU9A 2ALZA 2EAMA 1Z19A 4LZGA 3CW2C 1D8BA 2HHSA 1QH9A 8ICUA 2M9NA 5IIOA 3OJSA 3O0FA 2FLNA 1DOQA 1ZQLA 4A8EA 4QWBA 2ZH2A 3NVOA 4Y2VA 3H7IA 1ZETA 1XSLA 2PI4A 3RFAA 3M1YA 3E58A 3ED5A 2BZFA 3PY8A 8ICSA 4KLOA 2NRZA 4K96A 4NL9C 1U45A 4FS1A 4OCZA 3LWLA 4ZOHC 4WH5A 3OVAA 5ALPA 2ES6A 4RQMA 1N63A 2VJ4A 2YMLA 4XRHA 2XY5A 5DECA 2R8HA 2KV2A 2O5AA 4GXJA 2NRKA 2A19A 4QW8A 1B4FA 2E5SA 4EV6A 3I28A 4OO1J 2F77X 2BKEA 2CRXA 5J2IA 1X6JA 4PGXA 2I1QA 4DSLA 4BX9C 5AICA 2F76X 5KL8B 4EEKA 4X0AA 3NTUA 2B51A 4X4SA 1RM6C 4YMNA 4F4XA 3NWIA 4C7YA 5E79U 5DB6A 4NJ8A 3EPIA 2WB1F 9ICTA 1JXLA 2P66A 1J2NA 3T5LA 5AI6A 4I2GA 4IQTA 1U48A 2JH7A 2W8LA 5AIBA 2JEGA 1QSLA 3SAFA 4GXKA 4R8UA 4NLZA 4Q43A 4M9LA 4CRXA 5J0PA 4Z6FA 2VJ5A 2ZTCA 4CNQA 1YZ7A 2ODGA 2BE3A 1XU4A 1KN5A 1F0MA 3AN1A 1TK0A 4EBKA 2XC9A 2XO7A 1TAQA 1ZQIA 3LVWA 2OHFA 2AQ4A 3NVVA 3ZD8A 4DSJA 3H8SA 1ZQSA 2ZH9A 8ICGA 5CHEA 4K4HA 3HJ4A 3PW7A 5DG8A 4X0BA 4KTQA 2PKEA 4WC2A 1SIJA 4DL6A 2XCAA 2KOBA 3AUOA 3C2MA 1NKEA 3PZPA 2FMPA 4M9NA 5KT3A 1ZD3A 3OGUA 4P0QA 1L7MA 3RAXA 3HIYA 2QB0A 2HHPA 3DEEA 5ALFA 4RUAA 2E3TA 3C5FA 3MGIA 4TQSA 2NRWA 3C5GA 4EZ9A 1QSSA 2DPIA 3DV9A 2DR9A 4UW9A 3F5AA 3T3FA 2KEYA 4DQQA 3SI8A 3C1ZA 2AXTU 1F44A 4PHDA 4UBBA 5L1KA 5CFUA 2FDRA 1WOTA 2JZBB 5J0XA 3UMGA 4QWCA 4I2BA 5KFVA 4EBJA 8ICYA 4JK1A 3JYYA 2F3NA 4X4TA 3Q8MA 2E1EA 1ZQYA 1MIWA 2VKQA 4ATBA 3GV5B 5EE3A 3OWGA 9ICLA 2W03A 5DGAA 4BJQA 2H3ZA 4AT9A 5AKHA 3E2EA 1TFRA 3PMLA 2OEHA 4DSIA 3RH5A 1SKWA 4OAHA 4MEXA 5KG3A 3H37A 5CB1A 5FP0A 1RQNA 2KJ8A 3RBEA 4IQWA 4R65A 2UVRA 4IR9A 1VFGA 9ICPA 5KTQA 1S10A 4LVSA 4CCHA 4NXTA 4AYBF 5L1JA 3C21A 4B9NA 1A77A 1PK3A 5JU5A 1Q46A 4UAZA 5J8YA 3Q8PB 5KFRA 4C7ZA 9ICXA 5JTIA 3C29A 4M2YA 3KKAC 3N7RC 1S0NA 4KLIA 3SYZA 3QEAZ 7ICFA 1BGXT 1TVAA 5AK3A 5B3QA 5KFXA 1P7DA 3UM9A 1IXRA 1MQ3A 2WAQF 2W54A 1T94A 4QZEA 5J8YC 2L5YA 5KFWA 5KFMA 3KD3A 2GO7A 2EH9A 3OHAA 2W9MA 3V6KA 3IRUA 5G5HA 5AK4A 5KFFA 3HJ1A 3VC8A 3OV7A 1ZQKA 2KFNA 4Y2TA 4C4TA 3S6JA 3M7DA 3CK6A 1NK5A 2KSOB 4KN7A 1L3TA 3R9KA 3V72A 3THVA 1ZQOA 2NRVA 1L7OA 5J0TA 4UB4A 2J6UA 4P0PB 4M9HA 2GWSA 3CP8A 4KMOB 1X9MA 4DFDA 4F2RA 2W3SA 4PL1A 3SR6A 4BUGA 4I2HA 2A3VA 4J9PA 3RB3A 2EZZA 2FMSA 5KG5A 4EYHB 5J0OA 2BQ3A 3PX4A 4F72A 3QZ7A 1GPJA 3JPTA 4Y2PA 3QEBZ 4NXVA 4N7RA 1ZQDA 5EE0A 1C7YA 4IQVA 2QLTA 5T14A 3LVVA 2J6SA 4Z6CA 2UVVA 3WK7A 4ECVA 4Y2QA 4C4SA 4I2DA 4BDPA 3G6YA 4IC9A 1TAUA 3V6JA 5AM5A 3I1YA 5CWRA 5DLFA 3MABA 2XY7A 2F44A 4X4PA 5HR7A 7ICNA 4FHYA 4MFAA 2QKQA 5D46A 3F2DA 4OJLA 3WK6A 4KITB 3N97B 5AM4A 5KG7A 2BCRA 2KJ5A 4QZHA 3L5KA 5IIMA 1QSYA 2HOFA 1CI4A 2VANA 2BDUA 3UMCA 1JALA 1XSNA 4O69A 4YQWA 3HILA 3RJJA 5J0RA 4TURA 3HWTA 4F4YA 2W04A 2IHMA 3HKZF 4P4MA 4I2EA 2EZXA 5HHIA 2B4VA 3QU9A 4PPXA 4PHEA 2BCSA 4UB1A 1KFSA 5EE1A 5KFUA 5CA7A 2F1IA 4WC6A 5HRBA 5HRFA 2W9CA 2ESEA 4HAIA 4GXIA 5KAFU 1X9WA 1QQ6A 3OPXA 4U7CA 3PW2A 4M47A 4O9MA 2ZH5A 2ISPA 4KLDA 3K1ZA 4ELTA 2HSZA 2R18A 4WBZA 5KFGA 5D62A 3RJEA 9ICOA 4PJ0U 1D9FA 8ICZA 2HI0A 4F4ZA 4NLNA 5CFSA 4YXJA 4DQPA 9ICMA 1ZQVA 2C2DA 3GQCA 4DL4A 5EWFA 5EOZA 2KSOA 4DOBA 4JV0A 4O6AA 3ZDBA 2WB1C 5KFAA 3PX6A 3GDXA 2K4IA 1N2XA 4NKUA 2KE7A 1ZQBA 1NK0A 4PZOA 7ICHA 2Y9UA 2WF5A 7ICTA 3TFSA 4ACOA 1L8LA 3MGVA 1NK8A 3ZDAA 1YT3A 1T3QA 1KKXA 5F3XB 4RQ4A 7ICJA 2E8MA 2C22A 1J97A 4QZDA 4ECWA 3HPOA 3JZ0A 1COOA 3PSPA 1A0PA 2EANA 4NXZA 5AM3A 9ICSA 4X4RA 5BOLA 2K4EA 3E0FA 4FO6A 2Y0SC 3AU2A 4CF4A 2A1JB 3H40A 3QU7A 2AH5A 2W3RA 1KRPA 3H39A 3H4BA 4GC7A 1MIYA 2O1PA 4WC0A 4MF2A 5K4LA 8ICIA 5DG9A 4M9JA 3MGHA 1BPYA 1KLNA 2PI5A 2B21A 3JCFA 4P4OA 5AKYA 3D6JA 1HUZA 3C18A 4JLZA 5H2FU 3FAHA 2BQUA 2R8GA 5D63A 4WC3A 4DSEA 5GTHU 1L7NA 3B9JA 1MQ2A 1MC8A 5J2DA 1JAJA 2Q66A 4J9RA 1IIPA 1KNYA 2XGPA 2W8KA 7ICQA 2YY6A 9ICBA 8ICMA 5CRXA 1NO5A 5HHHA 4LT6A 2MSNA 4F92B 3EW9A 4KB6A 4KMUA 2KVSA 5AI5A 4DQIA 1Z4OA 1ZD4A 1XO0A 1M6YA 2YTUA 5ALQA 4YN4A 1Z1BA 4EEYA 3AL0B 4B9TA 5HRGA 4QIWC 3F2BA 5HRKA 4WC4A 3PR5B 1XS9D 2IUBA 1Z4NA 2LHTA 5AKXA 2KIVA 2LYAA 2Z7JA 3ONNA 4NLKA 2G0AA 3M6ZA 2LYBA 2W55A 1T8EA 2ZIVB 3KZIU 1ZQRA 3PNCA 1K1SA 2ZJ5A 2HHWA 5KNIA 1T3NA 3KBBA 4E7XA 3CNHA 2O6KA 3AQMA 1R8CA 4NWIA 2K60A 1DK3A 1JMSA 3V7JA 2W11A 3ICXA 1UA1A 3B0YA 3IN5A 3JPQA 3MR6A 5D4BA 5DEDA 1S77D 1D9DA 3MDAA 3AQLA 3NRZA 1UHUA 2J6TA 4RQ6A 3RH4A 1L3UA 2F8KA 4I2CA 4QZIA 3EZ5A 1HJPA 3OVSA 2JZBA 4EZ6A 3WFPA 3F53A 2WF7A 4WQLA 3EF2A 1KW4A 1J2MA 4F5QA 4I2IA 2KP7A 3TAQA 5AI4A 2Y9TA 4B9UA 3RR8A 2H3FA 1SWWA 3QXGA 1N56A 5J0UA 2RFFA 5KFBA 5DBAA 4DFMA 5IILA 4F50A 4UB5A 2Y1JA 1SB3C 4YVZA 5ALRA 1URJA 2M2VA 1LV5A 1X2IA 8ICTA 2PXIA 4YG2A 4KLJA 4NLGA 3N4MB 4F5OA 4OAGA 1DRGA 2PFQA 3PSFA 4LEZA 4WQKA 1ZYQA 2BCQA 3PW0A 2G07A 4MKPA 2YMQA 5AI9A 1N5XA 2JHDA 3Q8KA 4I2FA 7ICRA 1X9SA 3A0BU 4NXWA 1B22A 5L1IA 4F3OA 2MRLA 3BQ0A 3QUQA 2RLTA 4Q45A 2E8PA 2NRXA 4KN4A 2FCLA 2CN1A 2LI6A 4FFDA 1KFTA 3K1RB 1TFYA 2NO5A 3QUBA 4KLFA 4S3NA 1SXDA 4QWDA 4UATA 4GFJA 4PHAA 2P35A 2ZJAA 5ALZA 3D2SA 2HVIA 4O3PA 3BQ1A 3RRHA 4ICAA 8ICBA 3WKAA 3QUTA 1Z3EB 3H0MB 2OH2A 5KFPA 4R66A 4DOCA 1HIWA 1AROP 2AQ0A 2WF9A 4FZLA 4FBTA 3C28A 4B9SA 4WC5A 5KAIU 5EWEA 2KMDA 2Y1IA 2VIXA 4JV2A 3TARA 3NVWA 3PW4A 1V9PA 5DGBA 1ZQHA 2XI9A 2H5XA 1NNLA 2ZG6A 1L5UA 2DRBA 4MFFA 3TACB 3BJYA 3KZXA 1SXEA 5L1LA 3V7KA 4K4GA 4G9BA 2HOIA 2B0CA 3B0XA 8ICVA 1YZ6A 5ALKA 3NUQA 5KT6A 2GA9D 3WFOA 3SV4A 1L3SA 2YB4A 4WC1A 1X6IA 1FFVA 3NVZA 9ICNA
chains in the Genus database with same CATH topology
4AT7B 1BNOA 2FMSA 2Q0ZX 5KG5A 4RWNA 4EYHB 4ECZA 3OJUA 4I2JA 4B9MA 2BCUA 5J0OA 2BQ3A 1SKRA 2P6UA 4DO9A 4QZGA 4ECRA 5BPCA 4TQRA 4F5PA 1NJYA 3PX4A 2NRTA 4XQ8A 3OSNA 4KLMA 7ICEA 2M2UA 4DL5A 4JV1A 3QZ7A 3Q8QB 2RDIA 1H38A 4E0DA 4Q8FA 3JPTA 3WFQE 1WCNA 3QEBZ 8ICNA 5IINA 4KLTA 4F5RA 1NK4A 4AT9B 2IA6A 5DDYA 4QZ8A 3H4DA 4J9MA 1TV9A 1ZQDA 1C7YA 4C8OA 4IQVA 3C23A 3QZ8A 4R8UB 4DF8A 4ELVA 3JPOA 5KG6A 4F8RA 5KFCA 2UVVA 2J6SA 4Z6CA 4ECXA 4F2SA 4X4QA 5J29A 1NJZA 4ECVA 4BDPA 4I2DA 4DOAA 4FHXA 1UEVA 5DQIA 3G6YA 4ED6A 2OWOA 4YP3A 3RJHA 1TKDA 8ICEA 1TAUA 3TAPA 2WTFA 4WBYA 3V6JA 2M2TA 3HP6A 4P2HA 7ICUA 4X4UA 5CWRA 3LK9A 5DLFA 3T5JA 4RWOA 4RNOA 3MABA 7ICSA 1VJ7A 3UPSA 4YD2A 2XY7A 3KHRA 3RBDA 2DR5A 4X4PA 3MDCA 7ICNA 4FHYA 1NOMA 4ECSA 3K4GA 3GILA 5CHGA 3C66A 4X4NA 4MFAA 3TQ1A 5D46A 1R8AA 2V4RA 3L9DA 3AQNA 4KITB 4PGYA 1ZQPA 4J9LA 2FLLA 3MFHA 4YFKA 2AGQA 3N97B 5KG7A 4KLEA 5F9NA 9ICGA 4QWAA 4DLEA 9ICHA 1YLQA 2RDJA 2BCRA 2KZMA 1JIHA 2BGWA 4QZHA 2ZTEA 5IIMA 1QSYA 2VANA 1ZQCA 1ZJNA 3NYBA 3V6HA 9ICAA 4ECTA 1XSNA 1ZQMA 4M6WB 3KHHA 4YQWA 4UB2A 2BQRA 1JX4A 2ZUBA 1XC9A 3RJJA 3H8WA 4O5EA 5J0RA 4TURA 3UXOA 3HWTA 5CP2A 4P4PA 4F4YA 1ZQEA 1UA0A 1NJWA 2IHMA 3JPPA 8ICHA 3OUYB 2C2RA 8ICCA 4K4IA 4P4MA 3M8RA 1BPDA 1RYSA 4I2EA 4NY8A 1S0OA 7ICLA 9ICKA 5HHIA 4AT8B 2ZJ8A 4MFCA 3AQKA 4EP7A 2V4QA 4PPXA 5KFNA 4O3OA 5IIJA 4DL7A 4DFJA 4YCXA 1L3VA 4RT3A 4PHEA 4KLSA 4QZ9A 2ID1A 4FH3A 2BCSA 4UB1A 4TUQA 4M0AA 2UVWA 1KFSA 5KFUA 2I9GA 4I27A 5CA7A 2F1IA 4F5NA 4WC6A 4M5DA 4YMMA 4YMOA 4KLHA 3MR3A 5HRBA 1Q79A 3H8JA 5HRFA 2W9CA 5DG7A 4GXIA 1X9WA 2PFPA 3HW8A 5KT7A 5HREA 4FHVA 3JPRA 1BPEA 5KFEA 1B43A 3GIMA 3PW2A 5DB7A 4M47A 3UXPA 4O9MA 3TI0A 1QLNA 1NK7A 9ICUA 2ZH5A 3K75D 2BCVA 2ISPA 4RWPA 4EBDA 4RPZA 3UQ2A 3ZDEA 4KLDA 5BOMA 9ICFA 5KFOA 5KG0A 4BXOA 4ELTA 4PGQA 4IRCA 2HVHA 4DS4A 5KFGA 1DGSA 3FYHA 5KFSA 2ATLA 3RJEA 3ISBA 4WBZA 9ICOA 3ISCA 2ISOA 1D9FA 4BXOB 4RWQA 2FPKA 2V9WA 4M6WA 4F4ZA 8ICZA 1K1QA 2BR0A 3RJGA 5KFZA 3GIKA 4NLNA 4YXJA 3M8SA 4DQPA 9ICMA 2KZ3A 1ZQJA 1ZQVA 2C2DA 4RQ8A 4B9LA 3GQCA 7ICKA 4DSKA 5J2CA 5KFLA 8ICXA 5KT4A 2AGOA 4EBCA 4DL4A 5EWFA 1RXVA 5EOZA 1ZQTA 2ZH4A 4DOBA 5KT2A 1S0MA 4JV0A 3RTVA 4O3QA 3ZDBA 1U49A 4O3NA 3ETLA 5KFAA 4IR1A 5HNKA 2HHQA 1V4AA 4J9QA 3PX6A 5KG4A 3C2KA 3H3AA 3MR2A 3RB6A 3GDXA 3Q8SB 5IIIA 1SL0A 4I29A 4NKUA 1ZQBA 1NK0A 2ZUDA 2ZUCA 4C8MA 5IIKA 4I2AA 7ICHA 3PW5A 4YR3A 1T7PA 7ICTA 3KTQA 4FHPA 3TFSA 4GC6A 4ED2A 8ICOA 4TUPA 2W9AA 9ICRA 4PHPA 5KFKA 4RU9A 4YR0A 4QZBA 2ALZA 1NK8A 4DFKA 5DB8A 4LZGA 2IBKA 2JEFA 3ZDAA 1S76D 2HHSA 1R89A 1DK2A 8ICUA 9ICJA 5L9XA 2M9NA 9ICIA 5IIOA 3OJSA 3NGDA 1Q78A 2FLNA 4X4VA 1DOQA 1ZQLA 2HHTA 4QWBA 4E80A 2ZH2A 2VA8A 3H7IA 4J9NA 1NK9A 2ZH6A 4NM2A 1S0VA 1ZETA 7ICJA 4RQ4A 4J9SA 5DKWA 5J0YA 4ECUA 1XSLA 2PI4A 4C8KA 4O5KA 2C22A 4QZDA 3C1YA 4ECWA 3LDAA 5J2HA 4ECYA 1R8BA 3HPOA 3JZ0A 5J2FA 3PY8A 1COOA 8ICSA 4JWNA 4NXZA 3WFSC 4DL2A 5KFJA 9ICSA 4X4RA 1RZTA 5BOLA 4KLOA 2NRZA 4FO6A 4AT8A 4E8FA 2ZH3A 2JEIA 1U45A 4MEYA 4FS1A 3AU2A 1ZQUA 1RYRA 3LWLA 2A1JB 5HC9A 5DQHA 3H40A 4LZDA 3OVAA 4YD1A 4NM1A 1KRPA 1BPZA 7ICMA 5DLGA 1Z00B 4XRHA 4C8NA 3GIJA 2XY5A 2MUTB 4R63A 2IMWP 2ZH8A 5DECA 4UQGA 2R8HA 2O5AA 4X5VA 2HHXA 8ICKA 3H39A 2FMQA 3H4BA 4GXJA 2NRKA 5C5JA 4GC7A 1ZQNA 4QW8A 3MR5A 4UAYA 4PH5A 1MIYA 2O1PA 4YXMA 4WC0A 3PR4A 3ZD9A 4MF2A 3BQTA 1ZQXA 3PO5A 2BDPA 5HRDA 1Y88A 8ICIA 2BKEA 5J0WA 5DG9A 4M9JA 3MGHA 4RNNA 5J2IA 1HUOA 3PX0A 4RZRA 1BPYA 4PGXA 4ED0A 2I1QA 4RQ2A 3M9NB 1KLNA 2VA3A 2PI5A 4DSLA 4FHWA 2B21A 4DFPA 4P4OA 5J2JA 2PFNA 8ICJA 1HUZA 4X0AA 3OVBA 3M9MB 3C18A 5HRIA 1KFDA 4UD5A 3G6XA 2BQUA 2R8GA 2KZZA 3NTUA 7ICPA 4WC3A 4DSEA 4X4SA 4YMNA 3RB3A 4F4XA 3UQ0A 2AU0A 5KFHA 4UAWA 4MF8A 4F93B 3TFRA 1MQ2A 4DLGA 1MC8A 4HYKA 5J2DA 1SL2A 1JAJA 4ED1A 1EXNA 5DB6A 4O3SA 4WC7A 2Q66A 3EPIA 4J9RA 4M04A 1KNYA 2XGPA 2W8KA 7ICQA 9ICTA 1ZQGA 1A76A 1JXLA 4IRDA 4C8LA 2P66A 8ICMA 9ICBA 3T5LA 1NO5A 5HHHA 4RQ0A 1BPBA 4LT6A 5KFIA 4YR2A 3ZDDA 4I2GA 4IQTA 1U48A 5J2AA 2W8LA 4F92B 3EW9A 5TZVA 4KMUA 3GIIA 3QE9Y 2JEGA 1QSLA 2AJQA 4EBEA 5KG1A 4DQIA 1UT8A 4X4OA 4GXKA 4R8UA 4YN4A 3BDPA 4EEYA 4NLZA 4G3IA 3OHBA 1NKBA 2ZTDA 4Q43A 2MAXA 4M9LA 4B9TA 1MSWD 5HRGA 5J0PA 4Z6FA 3MBYA 1PZNA 5HRKA 2ZTCA 4WC4A 4DWIA 1CEZA 3PR5B 8ICWA 2BE3A 3UXNA 1NJXA 5KFQA 4Z6DA 3KHLA 1XS9D 1XU4A 4IQUA 3EWAA 1SL1A 1TK0A 4TUSA 2R8JA 4EBKA 2XC9A 5DB9A 4QZFA 2C28A 2XO7A 1TAQA 5J0QA 4XUSA 2AQ4A 1ZQIA 4DEZA 4DSJA 3ZD8A 2IHNA 8ICPA 3H8SA 1ZQSA 2ZH9A 4KLQA 1KTQA 8ICGA 8ICAA 2ZH1A 1UEUA 1JN3A 1QTMA 4NLKA 4FS2A 4NKTA 3OSPA 4K4HA 5JUMA 4R64A 3HJ4A 3PW7A 4QZCA 5DG8A 4RPXA 7ICIA 7ICVA 4KTQA 4X0BA 1T8EA 2FLPA 4WC2A 2W9CB 2ASJA 8ICRA 1ZQRA 3PNCA 4BWJA 1K1SA 1JXEA 4BWMA 2ZJ5A 4DL6A 4FBUA 1T3NA 2XCAA 3TANA 2HHWA 1SZPA 4XQ7A 2F1HA 3GV7B 4Z6EA 4ED8A 4E7XA 3AUOA 4EYIB 3C2MA 1NKEA 5HRLA 2FMPA 4M9NA 5KT3A 3AQMA 2W9BA 2P6RA 1R8CA 2ZHAA 1ZQQA 2JEJA 3OGUA 1DK3A 1JMSA 3V7JA 4ED3A 3RAXA 1D8LA 3HIYA 3Q8RB 5CR0A 1FA0A 2HHPA 1UA1A 1ZQZA 3LQCB 3B0YA 3RR7A 3JPQA 4XA5A 3MR6A 5D4BA 5DEDA 1S77D 1D9DA 5KFYA 3MDAA 5J0SA 4DF4A 3AQLA 4RUAA 5HMLA 3T5HA 1CUKA 4FH5A 3C5FA 1UETA 3MGIA 4QWEA 4IRKA 4TQSA 2NRWA 2FPLA 3C5GA 3C2LA 3RH6A 5J2KA 2M2WA 1N48A 4EZ9A 3MFIA 2KFZA 1QSSA 2DPIA 2J6TA 2DR9A 3PO4A 3T3FA 1PX5A 4DQQA 3SI8A 4B9VA 4RQ6A 3RH4A 1L3UA 3C1ZA 4I2CA 9ICVA 1RPLA 4QZIA 3EZ5A 2PBEA 4PHDA 3KHGA 1HJPA 3OVSA 2JZBA 4UBBA 4EZ6A 1OU5A 5L1KA 3WFPA 5HMMA 2BHNA 2AGPA 5KT5A 1WOTA 1Z00A 2BPGA 2C2EA 9ICWA 3HX0A 4RPYA 2DPJA 4F5QA 4I2IA 2JZBB 5J0XA 2KP7A 3SZ2A 3TAQA 4QWCA 4I2BA 4DQRA 1UT5A 2A1JA 5KFVA 4BGDA 5HP4A 4B9UA 3RR8A 4KLGA 4EBJA 8ICYA 4JK1A 4UB3A 1U4BA 8ICFA 9ICEA 1N56A 3JYYA 4X4TA 3Q8MA 5J0UA 1MIWA 1ZQYA 3ORYA 1NZPA 4ATBA 4M9GA 3GV5B 1JQRA 2PFOA 2RFFA 3V7LA 9ICLA 2R8KA 5KG2A 5KFBA 5DBAA 5DGAA 4DFMA 5IILA 4F50A 4UB5A 2Y1JA 4AT9A 2M2VA 4YVZA 3OUYA 1XO1A 4JUZA 1LV5A 3E2EA 1TFRA 3PMLA 1ZQAA 1X2IA 4DSIA 1BNPA 3RH5A 1SKWA 8ICTA 4MEXA 5HRHA 5KG3A 5KFDA 3FDSA 3H37A 3Q8LA 5HR9A 1IM4A 2PXIA 5CB1A 4DL3A 4YG2A 1S9FA 1TK8A 2BPFA 3RBEA 1LB2B 3RJKA 4KLJA 5J2BA 3HT3A 3N4MB 4F5OA 4NLGA 4O0IA 2ASDA 2PFQA 4IG8A 3SV3A 4IQWA 4R65A 2UVRA 4UD4A 4IR9A 1ZYQA 4F91B 2BCQA 3PW0A 9ICPA 2F1JA 1VFGA 5KTQA 1S10A 1TFWA 1NK6A 3RAQA 3H38A 3RB0A 4LVSA 4RUCA 4CCHA 3LWMA 3IHQB 3WFRE 4ZH4A 2FPMA 3PMNA 3AU6A 2VA2A 9ICQA 2KN7A 3EYZA 3IM1A 7ICGA 3Q8KA 5L1JA 3JPSA 4I2FA 4QW9A 1X9SA 7ICRA 3PVXA 2DRAA 8ICLA 1B22A 3C21A 5L1IA 4F3OA 2MUTA 1A77A 4Q45A 3G6VA 3BQ0A 4B9NA 1U9LA 3T5KA 2NRXA 1F5AA 4F4WA 4KN4A 2ZH7A 3RJFA 4UAZA 2DR8A 2HHUA 1KFTA 4JWMA 1ZJMA 1TFYA 4KLFA 3Q8PB 3RB4A 4S3NA 4QWDA 5KFRA 5F2VO 4PHAA 9ICXA 3PV8A 4DS5A 9ICCA 1MIVA 4M2YA 2ZJAA 2HVIA 5DBBA 1KSPA 2KTQA 4RQ1A 4O3PA 3BQ1A 5DQGA 1D8YA 5F9LA 4UBCA 4Q8EA 1S0NA 4Q44A 4ECQA 3RRHA 2HHVA 4KLIA 3SYZA 3QEAZ 1U47A 7ICFA 3EPGA 8ICBA 1BGXT 3JPNA 1TVAA 1Z3EB 3GFKB 4WCWA 4RNMA 5DBCA 4RQ3A 3UPQA 5KFPA 4R66A 4DOCA 5KFXA 4F4KA 1AROP 2AQ0A 7ICOA 2BPCA 1BVSA 4FBTA 1T4GA 1IXRA 2LYHA 4RQ7A 5EWEA 1MQ3A 4B9SA 2Y1IA 4WC5A 4O5CA 5D49A 4QZEA 4O3RA 5KFWA 2XY6A 4JV2A 3TARA 8ICQA 1V9PA 5KFMA 3PW4A 5J2EA 5DGBA 1S97A 2DFLA 4KLLA 3OHAA 1ZQHA 2W9MA 3V6KA 3ZDCA 5KFFA 1RXWA 2DR7A 2H5XA 3HJ1A 3OV7A 4J9OA 1ZQKA 2R8IA 4RQ5A 2XCPA 1KDHA 2KFNA 2W9BB 1L5UA 4DSFA 4ATBB 4KLUA 2DRBA 1XSPA 4DQSA 4QZAA 4RT2A 4MFFA 4AT7A 1TK5A 1NK5A 4J9KA 3BJYA 4KN7A 3GV8B 1KEJA 1L3TA 5L1LA 3V72A 3THVA 1ZQOA 5CJ7A 2NRVA 5EWGA 5J0TA 4UB4A 3V7KA 2J6UA 4K4GA 2HW3A 1ZQFA 3ISDA 3B0XA 2UVUA 3BQ2A 4ED7A 1NKCA 1SKSA 2GWSA 4I28A 4M9HA 8ICVA 1XWLA 2ASLA 1X9MA 4F2RA 2ZHBA 4GLXA 2DVIA 3RJIA 1ZQWA 5KT6A 5J2GA 2XGQA 1BPXA 3SV4A 1L3SA 3WFOA 3RRGA 4ELUA 4WC1A 9ICNA 4I2HA 4J9PA 5DDMA 3M9OB 1WCLA 5KFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AT7 B;  1BNO A;  2FMS A;  2Q0Z X;  5KG5 A;  4RWN A;  4EYH B;  4ECZ A;  3OJU A;  4I2J A;  4B9M A;  2BCU A;  5J0O A;  2BQ3 A;  1SKR A;  2P6U A;  4DO9 A;  4QZG A;  4ECR A;  5BPC A;  4TQR A;  4F5P A;  1NJY A;  3PX4 A;  2NRT A;  4XQ8 A;  3OSN A;  4KLM A;  7ICE A;  2M2U A;  4DL5 A;  4JV1 A;  3QZ7 A;  3Q8Q B;  2RDI A;  1H38 A;  4E0D A;  4Q8F A;  3JPT A;  3WFQ E;  1WCN A;  3QEB Z;  8ICN A;  5IIN A;  4KLT A;  4F5R A;  1NK4 A;  4AT9 B;  2IA6 A;  5DDY A;  4QZ8 A;  3H4D A;  4J9M A;  1TV9 A;  1ZQD A;  1C7Y A;  4C8O A;  4IQV A;  3C23 A;  3QZ8 A;  4R8U B;  4DF8 A;  4ELV A;  3JPO A;  5KG6 A;  4F8R A;  5KFC A;  2UVV A;  2J6S A;  4Z6C A;  4ECX A;  4F2S A;  4X4Q A;  5J29 A;  1NJZ A;  4ECV A;  4BDP A;  4I2D A;  4DOA A;  4FHX A;  1UEV A;  5DQI A;  3G6Y A;  4ED6 A;  2OWO A;  4YP3 A;  3RJH A;  1TKD A;  8ICE A;  1TAU A;  3TAP A;  2WTF A;  4WBY A;  3V6J A;  2M2T A;  3HP6 A;  4P2H A;  7ICU A;  4X4U A;  5CWR A;  3LK9 A;  5DLF A;  3T5J A;  4RWO A;  4RNO A;  3MAB A;  7ICS A;  1VJ7 A;  3UPS A;  4YD2 A;  2XY7 A;  3KHR A;  3RBD A;  2DR5 A;  4X4P A;  3MDC A;  7ICN A;  4FHY A;  1NOM A;  4ECS A;  3K4G A;  3GIL A;  5CHG A;  3C66 A;  4X4N A;  4MFA A;  3TQ1 A;  5D46 A;  1R8A A;  2V4R A;  3L9D A;  3AQN A;  4KIT B;  4PGY A;  1ZQP A;  4J9L A;  2FLL A;  3MFH A;  4YFK A;  2AGQ A;  3N97 B;  5KG7 A;  4KLE A;  5F9N A;  9ICG A;  4QWA A;  4DLE A;  9ICH A;  1YLQ A;  2RDJ A;  2BCR A;  2KZM A;  1JIH A;  2BGW A;  4QZH A;  2ZTE A;  5IIM A;  1QSY A;  2VAN A;  1ZQC A;  1ZJN A;  3NYB A;  3V6H A;  9ICA A;  4ECT A;  1XSN A;  1ZQM A;  4M6W B;  3KHH A;  4YQW A;  4UB2 A;  2BQR A;  1JX4 A;  2ZUB A;  1XC9 A;  3RJJ A;  3H8W A;  4O5E A;  5J0R A;  4TUR A;  3UXO A;  3HWT A;  5CP2 A;  4P4P A;  4F4Y A;  1ZQE A;  1UA0 A;  1NJW A;  2IHM A;  3JPP A;  8ICH A;  3OUY B;  2C2R A;  8ICC A;  4K4I A;  4P4M A;  3M8R A;  1BPD A;  1RYS A;  4I2E A;  4NY8 A;  1S0O A;  7ICL A;  9ICK A;  5HHI A;  4AT8 B;  2ZJ8 A;  4MFC A;  3AQK A;  4EP7 A;  2V4Q A;  4PPX A;  5KFN A;  4O3O A;  5IIJ A;  4DL7 A;  4DFJ A;  4YCX A;  1L3V A;  4RT3 A;  4PHE A;  4KLS A;  4QZ9 A;  2ID1 A;  4FH3 A;  2BCS A;  4UB1 A;  4TUQ A;  4M0A A;  2UVW A;  1KFS A;  5KFU A;  2I9G A;  4I27 A;  5CA7 A;  2F1I A;  4F5N A;  4WC6 A;  4M5D A;  4YMM A;  4YMO A;  4KLH A;  3MR3 A;  5HRB A;  1Q79 A;  3H8J A;  5HRF A;  2W9C A;  5DG7 A;  4GXI A;  1X9W A;  2PFP A;  3HW8 A;  5KT7 A;  5HRE A;  4FHV A;  3JPR A;  1BPE A;  5KFE A;  1B43 A;  3GIM A;  3PW2 A;  5DB7 A;  4M47 A;  3UXP A;  4O9M A;  3TI0 A;  1QLN A;  1NK7 A;  9ICU A;  2ZH5 A;  3K75 D;  2BCV A;  2ISP A;  4RWP A;  4EBD A;  4RPZ A;  3UQ2 A;  3ZDE A;  4KLD A;  5BOM A;  9ICF A;  5KFO A;  5KG0 A;  4BXO A;  4ELT A;  4PGQ A;  4IRC A;  2HVH A;  4DS4 A;  5KFG A;  1DGS A;  3FYH A;  5KFS A;  2ATL A;  3RJE A;  3ISB A;  4WBZ A;  9ICO A;  3ISC A;  2ISO A;  1D9F A;  4BXO B;  4RWQ A;  2FPK A;  2V9W A;  4M6W A;  4F4Z A;  8ICZ A;  1K1Q A;  2BR0 A;  3RJG A;  5KFZ A;  3GIK A;  4NLN A;  4YXJ A;  3M8S A;  4DQP A;  9ICM A;  2KZ3 A;  1ZQJ A;  1ZQV A;  2C2D A;  4RQ8 A;  4B9L A;  3GQC A;  7ICK A;  4DSK A;  5J2C A;  5KFL A;  8ICX A;  5KT4 A;  2AGO A;  4EBC A;  4DL4 A;  5EWF A;  1RXV A;  5EOZ A;  1ZQT A;  2ZH4 A;  4DOB A;  5KT2 A;  1S0M A;  4JV0 A;  3RTV A;  4O3Q A;  3ZDB A;  1U49 A;  4O3N A;  3ETL A;  5KFA A;  4IR1 A;  5HNK A;  2HHQ A;  1V4A A;  4J9Q A;  3PX6 A;  5KG4 A;  3C2K A;  3H3A A;  3MR2 A;  3RB6 A;  3GDX A;  3Q8S B;  5III A;  1SL0 A;  4I29 A;  4NKU A;  1ZQB A;  1NK0 A;  2ZUD A;  2ZUC A;  4C8M A;  5IIK A;  4I2A A;  7ICH A;  3PW5 A;  4YR3 A;  1T7P A;  7ICT A;  3KTQ A;  4FHP A;  3TFS A;  4GC6 A;  4ED2 A;  8ICO A;  4TUP A;  2W9A A;  9ICR A;  4PHP A;  5KFK A;  4RU9 A;  4YR0 A;  4QZB A;  2ALZ A;  1NK8 A;  4DFK A;  5DB8 A;  4LZG A;  2IBK A;  2JEF A;  3ZDA A;  1S76 D;  2HHS A;  1R89 A;  1DK2 A;  8ICU A;  9ICJ A;  5L9X A;  2M9N A;  9ICI A;  5IIO A;  3OJS A;  3NGD A;  1Q78 A;  2FLN A;  4X4V A;  1DOQ A;  1ZQL A;  2HHT A;  4QWB A;  4E80 A;  2ZH2 A;  2VA8 A;  3H7I A;  4J9N A;  1NK9 A;  2ZH6 A;  4NM2 A;  1S0V A;  1ZET A;  7ICJ A;  4RQ4 A;  4J9S A;  5DKW A;  5J0Y A;  4ECU A;  1XSL A;  2PI4 A;  4C8K A;  4O5K A;  2C22 A;  4QZD A;  3C1Y A;  4ECW A;  3LDA A;  5J2H A;  4ECY A;  1R8B A;  3HPO A;  3JZ0 A;  5J2F A;  3PY8 A;  1COO A;  8ICS A;  4JWN A;  4NXZ A;  3WFS C;  4DL2 A;  5KFJ A;  9ICS A;  4X4R A;  1RZT A;  5BOL A;  4KLO A;  2NRZ A;  4FO6 A;  4AT8 A;  4E8F A;  2ZH3 A;  2JEI A;  1U45 A;  4MEY A;  4FS1 A;  3AU2 A;  1ZQU A;  1RYR A;  3LWL A;  2A1J B;  5HC9 A;  5DQH A;  3H40 A;  4LZD A;  3OVA A;  4YD1 A;  4NM1 A;  1KRP A;  1BPZ A;  7ICM A;  5DLG A;  1Z00 B;  4XRH A;  4C8N A;  3GIJ A;  2XY5 A;  2MUT B;  4R63 A;  2IMW P;  2ZH8 A;  5DEC A;  4UQG A;  2R8H A;  2O5A A;  4X5V A;  2HHX A;  8ICK A;  3H39 A;  2FMQ A;  3H4B A;  4GXJ A;  2NRK A;  5C5J A;  4GC7 A;  1ZQN A;  4QW8 A;  3MR5 A;  4UAY A;  4PH5 A;  1MIY A;  2O1P A;  4YXM A;  4WC0 A;  3PR4 A;  3ZD9 A;  4MF2 A;  3BQT A;  1ZQX A;  3PO5 A;  2BDP A;  5HRD A;  1Y88 A;  8ICI A;  2BKE A;  5J0W A;  5DG9 A;  4M9J A;  3MGH A;  4RNN A;  5J2I A;  1HUO A;  3PX0 A;  4RZR A;  1BPY A;  4PGX A;  4ED0 A;  2I1Q A;  4RQ2 A;  3M9N B;  1KLN A;  2VA3 A;  2PI5 A;  4DSL A;  4FHW A;  2B21 A;  4DFP A;  4P4O A;  5J2J A;  2PFN A;  8ICJ A;  1HUZ A;  4X0A A;  3OVB A;  3M9M B;  3C18 A;  5HRI A;  1KFD A;  4UD5 A;  3G6X A;  2BQU A;  2R8G A;  2KZZ A;  3NTU A;  7ICP A;  4WC3 A;  4DSE A;  4X4S A;  4YMN A;  3RB3 A;  4F4X A;  3UQ0 A;  2AU0 A;  5KFH A;  4UAW A;  4MF8 A;  4F93 B;  3TFR A;  1MQ2 A;  4DLG A;  1MC8 A;  4HYK A;  5J2D A;  1SL2 A;  1JAJ A;  4ED1 A;  1EXN A;  5DB6 A;  4O3S A;  4WC7 A;  2Q66 A;  3EPI A;  4J9R A;  4M04 A;  1KNY A;  2XGP A;  2W8K A;  7ICQ A;  9ICT A;  1ZQG A;  1A76 A;  1JXL A;  4IRD A;  4C8L A;  2P66 A;  8ICM A;  9ICB A;  3T5L A;  1NO5 A;  5HHH A;  4RQ0 A;  1BPB A;  4LT6 A;  5KFI A;  4YR2 A;  3ZDD A;  4I2G A;  4IQT A;  1U48 A;  5J2A A;  2W8L A;  4F92 B;  3EW9 A;  5TZV A;  4KMU A;  3GII A;  3QE9 Y;  2JEG A;  1QSL A;  2AJQ A;  4EBE A;  5KG1 A;  4DQI A;  1UT8 A;  4X4O A;  4GXK A;  4R8U A;  4YN4 A;  3BDP A;  4EEY A;  4NLZ A;  4G3I A;  3OHB A;  1NKB A;  2ZTD A;  4Q43 A;  2MAX A;  4M9L A;  4B9T A;  1MSW D;  5HRG A;  5J0P A;  4Z6F A;  3MBY A;  1PZN A;  5HRK A;  2ZTC A;  4WC4 A;  4DWI A;  1CEZ A;  3PR5 B;  8ICW A;  2BE3 A;  3UXN A;  1NJX A;  5KFQ A;  4Z6D A;  3KHL A;  1XS9 D;  1XU4 A;  4IQU A;  3EWA A;  1SL1 A;  1TK0 A;  4TUS A;  2R8J A;  4EBK A;  2XC9 A;  5DB9 A;  4QZF A;  2C28 A;  2XO7 A;  1TAQ A;  5J0Q A;  4XUS A;  2AQ4 A;  1ZQI A;  4DEZ A;  4DSJ A;  3ZD8 A;  2IHN A;  8ICP A;  3H8S A;  1ZQS A;  2ZH9 A;  4KLQ A;  1KTQ A;  8ICG A;  8ICA A;  2ZH1 A;  1UEU A;  1JN3 A;  1QTM A;  4NLK A;  4FS2 A;  4NKT A;  3OSP A;  4K4H A;  5JUM A;  4R64 A;  3HJ4 A;  3PW7 A;  4QZC A;  5DG8 A;  4RPX A;  7ICI A;  7ICV A;  4KTQ A;  4X0B A;  1T8E A;  2FLP A;  4WC2 A;  2W9C B;  2ASJ A;  8ICR A;  1ZQR A;  3PNC A;  4BWJ A;  1K1S A;  1JXE A;  4BWM A;  2ZJ5 A;  4DL6 A;  4FBU A;  1T3N A;  2XCA A;  3TAN A;  2HHW A;  1SZP A;  4XQ7 A;  2F1H A;  3GV7 B;  4Z6E A;  4ED8 A;  4E7X A;  3AUO A;  4EYI B;  3C2M A;  1NKE A;  5HRL A;  2FMP A;  4M9N A;  5KT3 A;  3AQM A;  2W9B A;  2P6R A;  1R8C A;  2ZHA A;  1ZQQ A;  2JEJ A;  3OGU A;  1DK3 A;  1JMS A;  3V7J A;  4ED3 A;  3RAX A;  1D8L A;  3HIY A;  3Q8R B;  5CR0 A;  1FA0 A;  2HHP A;  1UA1 A;  1ZQZ A;  3LQC B;  3B0Y A;  3RR7 A;  3JPQ A;  4XA5 A;  3MR6 A;  5D4B A;  5DED A;  1S77 D;  1D9D A;  5KFY A;  3MDA A;  5J0S A;  4DF4 A;  3AQL A;  4RUA A;  5HML A;  3T5H A;  1CUK A;  4FH5 A;  3C5F A;  1UET A;  3MGI A;  4QWE A;  4IRK A;  4TQS A;  2NRW A;  2FPL A;  3C5G A;  3C2L A;  3RH6 A;  5J2K A;  2M2W A;  1N48 A;  4EZ9 A;  3MFI A;  2KFZ A;  1QSS A;  2DPI A;  2J6T A;  2DR9 A;  3PO4 A;  3T3F A;  1PX5 A;  4DQQ A;  3SI8 A;  4B9V A;  4RQ6 A;  3RH4 A;  1L3U A;  3C1Z A;  4I2C A;  9ICV A;  1RPL A;  4QZI A;  3EZ5 A;  2PBE A;  4PHD A;  3KHG A;  1HJP A;  3OVS A;  2JZB A;  4UBB A;  4EZ6 A;  1OU5 A;  5L1K A;  3WFP A;  5HMM A;  2BHN A;  2AGP A;  5KT5 A;  1WOT A;  1Z00 A;  2BPG A;  2C2E A;  9ICW A;  3HX0 A;  4RPY A;  2DPJ A;  4F5Q A;  4I2I A;  2JZB B;  5J0X A;  2KP7 A;  3SZ2 A;  3TAQ A;  4QWC A;  4I2B A;  4DQR A;  1UT5 A;  2A1J A;  5KFV A;  4BGD A;  5HP4 A;  4B9U A;  3RR8 A;  4KLG A;  4EBJ A;  8ICY A;  4JK1 A;  4UB3 A;  1U4B A;  8ICF A;  9ICE A;  1N56 A;  3JYY A;  4X4T A;  3Q8M A;  5J0U A;  1MIW A;  1ZQY A;  3ORY A;  1NZP A;  4ATB A;  4M9G A;  3GV5 B;  1JQR A;  2PFO A;  2RFF A;  3V7L A;  9ICL A;  2R8K A;  5KG2 A;  5KFB A;  5DBA A;  5DGA A;  4DFM A;  5IIL A;  4F50 A;  4UB5 A;  2Y1J A;  4AT9 A;  2M2V A;  4YVZ A;  3OUY A;  1XO1 A;  4JUZ A;  1LV5 A;  3E2E A;  1TFR A;  3PML A;  1ZQA A;  1X2I A;  4DSI A;  1BNP A;  3RH5 A;  1SKW A;  8ICT A;  4MEX A;  5HRH A;  5KG3 A;  5KFD A;  3FDS A;  3H37 A;  3Q8L A;  5HR9 A;  1IM4 A;  2PXI A;  5CB1 A;  4DL3 A;  4YG2 A;  1S9F A;  1TK8 A;  2BPF A;  3RBE A;  1LB2 B;  3RJK A;  4KLJ A;  5J2B A;  3HT3 A;  3N4M B;  4F5O A;  4NLG A;  4O0I A;  2ASD A;  2PFQ A;  4IG8 A;  3SV3 A;  4IQW A;  4R65 A;  2UVR A;  4UD4 A;  4IR9 A;  1ZYQ A;  4F91 B;  2BCQ A;  3PW0 A;  9ICP A;  2F1J A;  1VFG A;  5KTQ A;  1S10 A;  1TFW A;  1NK6 A;  3RAQ A;  3H38 A;  3RB0 A;  4LVS A;  4RUC A;  4CCH A;  3LWM A;  3IHQ B;  3WFR E;  4ZH4 A;  2FPM A;  3PMN A;  3AU6 A;  2VA2 A;  9ICQ A;  2KN7 A;  3EYZ A;  3IM1 A;  7ICG A;  3Q8K A;  5L1J A;  3JPS A;  4I2F A;  4QW9 A;  1X9S A;  7ICR A;  3PVX A;  2DRA A;  8ICL A;  1B22 A;  3C21 A;  5L1I A;  4F3O A;  2MUT A;  1A77 A;  4Q45 A;  3G6V A;  3BQ0 A;  4B9N A;  1U9L A;  3T5K A;  2NRX A;  1F5A A;  4F4W A;  4KN4 A;  2ZH7 A;  3RJF A;  4UAZ A;  2DR8 A;  2HHU A;  1KFT A;  4JWM A;  1ZJM A;  1TFY A;  4KLF A;  3Q8P B;  3RB4 A;  4S3N A;  4QWD A;  5KFR A;  5F2V O;  4PHA A;  9ICX A;  3PV8 A;  4DS5 A;  9ICC A;  1MIV A;  4M2Y A;  2ZJA A;  2HVI A;  5DBB A;  1KSP A;  2KTQ A;  4RQ1 A;  4O3P A;  3BQ1 A;  5DQG A;  1D8Y A;  5F9L A;  4UBC A;  4Q8E A;  1S0N A;  4Q44 A;  4ECQ A;  3RRH A;  2HHV A;  4KLI A;  3SYZ A;  3QEA Z;  1U47 A;  7ICF A;  3EPG A;  8ICB A;  1BGX T;  3JPN A;  1TVA A;  1Z3E B;  3GFK B;  4WCW A;  4RNM A;  5DBC A;  4RQ3 A;  3UPQ A;  5KFP A;  4R66 A;  4DOC A;  5KFX A;  4F4K A;  1ARO P;  2AQ0 A;  7ICO A;  2BPC A;  1BVS A;  4FBT A;  1T4G A;  1IXR A;  2LYH A;  4RQ7 A;  5EWE A;  1MQ3 A;  4B9S A;  2Y1I A;  4WC5 A;  4O5C A;  5D49 A;  4QZE A;  4O3R A;  5KFW A;  2XY6 A;  4JV2 A;  3TAR A;  8ICQ A;  1V9P A;  5KFM A;  3PW4 A;  5J2E A;  5DGB A;  1S97 A;  2DFL A;  4KLL A;  3OHA A;  1ZQH A;  2W9M A;  3V6K A;  3ZDC A;  5KFF A;  1RXW A;  2DR7 A;  2H5X A;  3HJ1 A;  3OV7 A;  4J9O A;  1ZQK A;  2R8I A;  4RQ5 A;  2XCP A;  1KDH A;  2KFN A;  2W9B B;  1L5U A;  4DSF A;  4ATB B;  4KLU A;  2DRB A;  1XSP A;  4DQS A;  4QZA A;  4RT2 A;  4MFF A;  4AT7 A;  1TK5 A;  1NK5 A;  4J9K A;  3BJY A;  4KN7 A;  3GV8 B;  1KEJ A;  1L3T A;  5L1L A;  3V72 A;  3THV A;  1ZQO A;  5CJ7 A;  2NRV A;  5EWG A;  5J0T A;  4UB4 A;  3V7K A;  2J6U A;  4K4G A;  2HW3 A;  1ZQF A;  3ISD A;  3B0X A;  2UVU A;  3BQ2 A;  4ED7 A;  1NKC A;  1SKS A;  2GWS A;  4I28 A;  4M9H A;  8ICV A;  1XWL A;  2ASL A;  1X9M A;  4F2R A;  2ZHB A;  4GLX A;  2DVI A;  3RJI A;  1ZQW A;  5KT6 A;  5J2G A;  2XGQ A;  1BPX A;  3SV4 A;  1L3S A;  3WFO A;  3RRG A;  4ELU A;  4WC1 A;  9ICN A;  4I2H A;  4J9P A;  5DDM A;  3M9O B;  1WCL A;  5KFT A; 
#chains in the Genus database with same CATH topology
 2PMZ F;  4RWN A;  2BCU A;  4ECR A;  5BPC A;  4XQ8 A;  3OSN A;  2KIW A;  4JV1 A;  2A1A A;  2RDI A;  1VDV A;  1CRX A;  4Q8F A;  1Z1V A;  3WFQ E;  8ICN A;  4F5R A;  2IA6 A;  1TV9 A;  5ALN A;  3QZ8 A;  4ELV A;  3JPO A;  5KG6 A;  2DUY A;  5AI8 A;  4F8R A;  5J29 A;  1NJZ A;  3SMV A;  3AQF A;  1N5W A;  8ICE A;  2WTF A;  1JI7 A;  4X4U A;  2Q4T A;  1VJ7 A;  3UPS A;  3RBD A;  2YMM A;  3MDC A;  2EZY A;  4ECS A;  4OAF A;  1B0X A;  3GIL A;  4X4N A;  2LKY A;  2RP5 A;  5ALE A;  3L9D A;  4J9L A;  2KHV A;  9ICH A;  5F9N A;  4DLE A;  4O68 A;  1YLQ A;  3BS5 B;  3AMZ A;  4EX6 A;  3V6H A;  1ZQM A;  4M6W B;  1JX4 A;  1XC9 A;  4O5E A;  4AP9 A;  4P4P A;  3OUY B;  3JPP A;  8ICH A;  1BPD A;  7ICL A;  3N7P D;  1S0O A;  4EP7 A;  4MFC A;  3AQK A;  3IV6 A;  3WK4 A;  4DL7 A;  4KLS A;  3J81 j;  4M0A A;  2UVW A;  2I9G A;  1KQQ A;  4YMM A;  5G5G A;  4WJ3 B;  2H3V A;  4IL6 U;  2PFP A;  4Y2X A;  5KT7 A;  1JRO A;  1BPE A;  5AKL A;  1B43 A;  2B56 A;  5DB7 A;  3TI0 A;  9ICU A;  1NK7 A;  3K75 D;  3UQ2 A;  5A0L A;  3MCR A;  1MA7 A;  1OUQ A;  4FZM A;  3H0L B;  3ISC A;  4RWQ A;  2HBK A;  2BR0 A;  3RJG A;  3GIK A;  2E1F A;  3WKE A;  3M8S A;  1ZQJ A;  4RQ8 A;  2FJ6 A;  2RHF A;  5J2C A;  8ICX A;  2QB1 A;  4EBC A;  1RXV A;  2ZH4 A;  2F2A B;  4O3Q A;  2HMX A;  2D6F C;  4O3N A;  2HN2 A;  3H3A A;  3Q8S B;  5III A;  1ED1 A;  4C8M A;  4I2A A;  5ALU A;  1T7P A;  4FHP A;  2QAR B;  4GC6 A;  4ED2 A;  4Y2S A;  9ICR A;  4YR0 A;  4QZB A;  1S76 D;  5DB8 A;  1R89 A;  2IBK A;  2JEF A;  1DK2 A;  2M0N A;  1SWV A;  9ICJ A;  5L9X A;  9ICI A;  3NGD A;  1Q78 A;  3QX7 A;  4X4V A;  4E80 A;  1PVQ A;  1NK9 A;  5AHX A;  1S0V A;  3VCB A;  4O5K A;  3C1Y A;  5J2H A;  2DQN B;  1R8B A;  4JWN A;  3IDW A;  3WFS C;  4DL2 A;  5KFJ A;  3NKU A;  1RZT A;  4AT8 A;  2JEI A;  1RYR A;  5ALT A;  5AM1 A;  3WKD A;  1ZQ1 C;  4NM1 A;  2G5I B;  4NLC A;  5DLG A;  7ICM A;  3GIJ A;  4C8N A;  4R63 A;  5AKZ A;  4UQG A;  1SV0 C;  2HOQ A;  1JRP A;  4X5V A;  2HHX A;  8ICK A;  5C5J A;  1ZQN A;  4UAY A;  4YXM A;  4P0P A;  1ZRM A;  3BZK A;  1Y88 A;  4JB3 A;  4Y2R A;  4RNN A;  4RZR A;  4ED0 A;  3M9N B;  4FHW A;  5J2J A;  2PFN A;  2WHE A;  1FEZ A;  8ICJ A;  3OVB A;  3M9M B;  5HRI A;  1KFD A;  4OJP A;  7ICP A;  4F71 A;  1OW5 A;  5AM0 A;  3UQ0 A;  4P0Q B;  3WU2 U;  5KFH A;  3TFR A;  4F93 B;  4DLG A;  4U6P A;  4HYK A;  1SL2 A;  1IG6 A;  4WC7 A;  1EXN A;  1S8O A;  2JV3 A;  3D2Q A;  1A76 A;  3SAH A;  4IRD A;  4XJE A;  2QAR A;  4RQ0 A;  1BPB A;  4YR2 A;  1SV4 A;  2B6G A;  2RRD A;  5TZV A;  2XVT A;  3QYP A;  3QE9 Y;  2AJQ A;  5KG1 A;  1UT8 A;  4X4O A;  1V85 A;  4AYB C;  2MAX A;  1MSW D;  4CDG A;  1PZN A;  4DWI A;  8ICW A;  2YB1 A;  3UXN A;  1NJX A;  4TUS A;  3SEI A;  1FO4 A;  2C28 A;  4KLQ A;  1KTQ A;  2HBM A;  8ICA A;  2KVC A;  2HCF A;  5ALH A;  1LVH A;  3QUC A;  5C0Y A;  4RPX A;  2K8B B;  2EAO A;  2ASJ A;  4FO1 A;  1JXE A;  4FBU A;  3TAN A;  2F1H A;  3GV7 B;  1Q3V A;  4Z6E A;  4EYI B;  2K8C B;  1KBU A;  5HRL A;  4PZN A;  1C20 A;  2W9B A;  2P6R A;  2JGA A;  4US9 A;  4NV0 A;  2ZHA A;  2JEJ A;  3QU2 A;  4ED3 A;  1FA0 A;  5CR0 A;  2BBH A;  2K89 A;  1COK A;  3RR7 A;  1DXS A;  2KKP A;  2KKV A;  5ALM A;  4KM5 A;  5J0S A;  1SGG A;  4DF4 A;  3T5H A;  5HML A;  1CUK A;  1O03 A;  4QWE A;  4IRK A;  3C2L A;  3RH6 A;  2M2W A;  1N48 A;  2KFZ A;  3DDH A;  1ZD5 A;  2N1R A;  2PBE A;  1RPL A;  3KHG A;  3ERC C;  4EEL A;  2BHN A;  2AGP A;  5KT5 A;  2BPG A;  4LEY A;  2C2E A;  4RPY A;  2DPJ A;  3GZF A;  1TAM A;  3AQE A;  4BGD A;  5HP4 A;  4KLG A;  1ZOL A;  4UB3 A;  4UB8 U;  5KL1 B;  2ZIU A;  3LYS A;  2DL0 A;  3BZC A;  1K5O A;  3OUY A;  4LJX A;  3ZI4 A;  4OJO A;  2LMR A;  2MU2 A;  5ALG A;  5ALL A;  1BNP A;  5HRH A;  4CF5 A;  5ALO A;  4DL3 A;  1S9F A;  1TK8 A;  3RJK A;  1LB2 B;  2ASD A;  4IG8 A;  2PMZ C;  4UD4 A;  4F91 B;  2F1J A;  3HRD D;  3SEN A;  1NK6 A;  3H38 A;  3RB0 A;  4RUC A;  3PMN A;  2FPM A;  3AU6 A;  3UMB A;  9ICQ A;  2ZIV A;  3IM1 A;  7ICG A;  5AIA A;  2ZIU B;  3JPS A;  2GOL A;  2D8C A;  2DRA A;  3PVX A;  3QU4 A;  2MUT A;  3ER8 C;  1PK1 A;  2LM1 A;  3T5K A;  4F4W A;  2MA1 A;  5ALS A;  4Y2J A;  2ZIW B;  4QJF B;  2DR8 A;  5B3P A;  2EDU A;  5ALY A;  1O08 A;  3RB4 A;  5F2V O;  4UB6 U;  4DS5 A;  2F8L A;  5DBB A;  1D8Y A;  5F9L A;  4UBC A;  4Q8E A;  3MC1 A;  2HHV A;  3T79 A;  3EPG A;  4WCW A;  3UPQ A;  7ICO A;  1BVS A;  1RG6 A;  1AQ6 A;  5D49 A;  1FIQ A;  1QQ7 A;  5J2E A;  1S97 A;  2DFL A;  3QU5 A;  4KLL A;  3ZDC A;  2DR7 A;  3NAS A;  2R8I A;  4RQ5 A;  2XCP A;  1KDH A;  2W9B B;  4DSF A;  4ATB B;  4DQS A;  4US8 A;  4QZA A;  4RT2 A;  4AT7 A;  1PUZ A;  4J9K A;  2DGZ A;  1KEJ A;  5EWG A;  1ZQF A;  4ED7 A;  1NKC A;  1XWL A;  2DVI A;  3RJI A;  1ZQW A;  2XGQ A;  1BPX A;  2OYY A;  3RRG A;  3WK5 A;  5DDM A;  1WCL A;  4AT7 B;  1BNO A;  1PVP A;  3OJU A;  2P6U A;  5B66 U;  4QZG A;  4DO9 A;  4KLM A;  7ICE A;  4F5P A;  7ICV A;  4DL5 A;  4E0D A;  2XIC A;  2ZIW A;  3NS1 A;  5IIN A;  4KLT A;  4QZ8 A;  2KHQ A;  4J9M A;  3FC4 A;  4R8U B;  1ZD2 P;  4X4Q A;  4F2S A;  4ECX A;  2GLE A;  5TIS U;  4DOA A;  4USA A;  3H0R B;  1UEV A;  2KG5 A;  5DQI A;  2OWO A;  4ED6 A;  2Y0S F;  4YP3 A;  3RJH A;  1TKD A;  3TAP A;  1X40 A;  4OJ5 A;  4WBY A;  2LPE A;  3HP6 A;  7ICU A;  4EX7 A;  2AHO B;  3LK9 A;  3T5J A;  2EQY A;  2G5H B;  4RWO A;  3TAD C;  7ICS A;  3OTQ A;  2DR5 A;  2K4P A;  1Q3U A;  5JTG A;  1UCV A;  1NOM A;  1NI3 A;  3K4G A;  2BBJ A;  2V4R A;  1PK1 B;  5ALI A;  3AQN A;  4K99 A;  1VLB A;  4PGY A;  1ZQP A;  2FLL A;  2CXY A;  2E8N A;  4YFK A;  2I5H A;  4KLE A;  9ICG A;  1L7P A;  3TKA A;  2ZTE A;  3NYB A;  1ZQC A;  3SQI A;  9ICA A;  1WWV A;  4EGW A;  4UB2 A;  3H8W A;  4OAI Z;  5CP2 A;  2C2R A;  4K4I A;  1RYS A;  4NY8 A;  1LKY B;  9ICK A;  2V4Q A;  4O3O A;  5IIJ A;  3WKC A;  4YCX A;  4OJ6 A;  2ID1 A;  1X42 A;  1L8O A;  4M5D A;  4KLH A;  2H3Q A;  1WWU A;  1Q79 A;  5DG7 A;  4FHV A;  1QLN A;  2WAQ C;  2BCV A;  4RWP A;  1JQR A;  4RPZ A;  5BOM A;  9ICF A;  5KFO A;  4PGQ A;  4IRC A;  2HVH A;  1DGS A;  3FYH A;  2ATL A;  4BXO B;  2FPK A;  4M6W A;  2KZ3 A;  5ALD A;  1WUD A;  4DSK A;  2W7P A;  5KFL A;  5KT4 A;  2AGO A;  4K98 A;  1WG8 A;  5KT2 A;  1S0M A;  3ER9 B;  2DKZ A;  3RTV A;  1DGJ A;  1GO3 F;  1U49 A;  1A6S A;  3FM9 A;  2DF4 B;  1V4A A;  4J9Q A;  5KG4 A;  3L4P A;  3MR2 A;  3RB6 A;  3BS7 A;  2W43 A;  4C80 A;  2ZUD A;  2ZUC A;  5IIK A;  3PW5 A;  4YR3 A;  2JH1 A;  1PVR A;  8ICO A;  2W9A A;  4KX3 A;  5KFK A;  2OXO A;  4XQ7 A;  4DFK A;  3TAD A;  3K7D A;  4DCC A;  4UAR A;  1Q8K A;  2HHT A;  2K8A A;  4NLB A;  4K9A A;  2VA8 A;  2ZH6 A;  4J9N A;  4NM2 A;  4O67 A;  4KX5 A;  5AK6 A;  4J9S A;  5DKW A;  3F5E A;  5J0Y A;  4ECU A;  4C8K A;  3LDA A;  3ETR A;  4ECY A;  5J2F A;  1ZXI A;  2ZH3 A;  2G06 A;  4E8F A;  4MEY A;  1ZQU A;  2EAP A;  5HC9 A;  5DQH A;  4LZD A;  4YD1 A;  1BPZ A;  3A0H U;  1Z00 B;  2IMW P;  2MUT B;  4UAS A;  2ZH8 A;  4K9B A;  1MN8 A;  2FMQ A;  3MR5 A;  4PH5 A;  3SD7 A;  2WFA A;  3QNM A;  3PR4 A;  3ZD9 A;  5AKG A;  3BQT A;  1ZQX A;  3PO5 A;  2BDP A;  2XID A;  5HRD A;  5J0W A;  1HUO A;  4UAU A;  3PX0 A;  4RQ2 A;  2VA3 A;  4DFP A;  1LKY A;  4UD5 A;  3G6X A;  3HKZ C;  2KZZ A;  2KIC A;  3N28 A;  2AU0 A;  4UAW A;  4MF8 A;  1RYU A;  2IOH A;  4ED1 A;  4O3S A;  5AKI A;  4M04 A;  2NO4 A;  1ZQG A;  4C8L A;  3PST A;  5KFI A;  3ZDD A;  5J2A A;  3GII A;  4EBE A;  2I6X A;  5ALV A;  3IG5 A;  2ZXH A;  3BDP A;  4G3I A;  3OHB A;  1NKB A;  2ZTD A;  4JMU A;  3MBY A;  1CEZ A;  2DWQ A;  4Z6D A;  5KFQ A;  3KHL A;  4IQU A;  3EWA A;  3NVY A;  1SL1 A;  5D61 A;  2R8J A;  5B5E U;  1TE2 A;  1V97 A;  5DB9 A;  4QZF A;  4OD0 A;  5J0Q A;  4XUS A;  5JRT A;  4DEZ A;  2IHN A;  8ICP A;  4RQN A;  2ZH1 A;  1UEU A;  1JN3 A;  1QTM A;  4FS2 A;  4NKT A;  3OSP A;  2DKX A;  2KNJ A;  5JUM A;  4R64 A;  1N61 A;  4QZC A;  7ICI A;  2FLP A;  1ZRN A;  2W9C B;  8ICR A;  4BWJ A;  4BWM A;  1SZP A;  4J03 A;  4ED8 A;  2HDO A;  5ALJ A;  4I0U A;  1ZQQ A;  2NV3 A;  3M6K A;  1D8L A;  5L1M A;  2LBO A;  3Q8R B;  3WKB A;  1ZQZ A;  3LQC B;  4WOY A;  4XA5 A;  2JR5 A;  5KFY A;  5HR6 A;  2K4H A;  4FH5 A;  1UET A;  2FPL A;  1S5L U;  5J2K A;  3MFI A;  3PO4 A;  1PX5 A;  4B9V A;  1L6N A;  9ICV A;  2ZIX A;  3EUB 2;  4CE6 A;  1OU5 A;  5HMM A;  3L3F X;  2GAF D;  1Z00 A;  3ALR A;  9ICW A;  4GIB A;  3HX0 A;  3PSI A;  1UPH A;  3SZ2 A;  1JUD A;  4DQR A;  1UT5 A;  2A1J A;  1U4B A;  4JLX A;  2YQE A;  8ICF A;  5AK5 A;  9ICE A;  2FE9 A;  3ORY A;  1NZP A;  4M9G A;  2PFO A;  3V7L A;  2R8K A;  2IOF A;  5KG2 A;  2KK0 A;  1SZH A;  1XO1 A;  4JUZ A;  1ZQA A;  1IV8 A;  3SAG A;  5KFD A;  3FDS A;  3Q8L A;  1IM4 A;  4MHV A;  2BPF A;  4FZN A;  4IS7 A;  4B6J A;  5J2B A;  3HT3 A;  4O0I A;  5GTI U;  3SV3 A;  1RDF A;  2WF8 A;  1TFW A;  3RAQ A;  3F2C A;  3LWM A;  3IHQ B;  3WFR E;  4ZH4 A;  2VA2 A;  2KN7 A;  3BS5 A;  4FE3 A;  3EYZ A;  2H3I A;  4QW9 A;  3AM9 A;  4PL2 A;  3WK8 A;  8ICL A;  4NXU A;  4QIW F;  3G6V A;  2LM4 A;  1U9L A;  3AEV A;  1X66 A;  2FI1 A;  3CYM A;  1F5A A;  3N7S C;  2ZH7 A;  3RJF A;  2HHU A;  2JXJ A;  5CFT A;  4JWM A;  1ZJM A;  4C4R A;  3PV8 A;  2YMP A;  1OXJ A;  9ICC A;  1MIV A;  1KSP A;  2KTQ A;  4RQ1 A;  2CPR A;  5DQG A;  4Q44 A;  4ECQ A;  2E8O A;  1U47 A;  3JPN A;  3GFK B;  4RNM A;  5DBC A;  4RQ3 A;  1NZB A;  4Y2Y A;  1XNS A;  3D2N A;  4F4K A;  2BPC A;  2HBL A;  1VJ5 A;  1T4G A;  2LYH A;  4RQ7 A;  4O5C A;  5AKK A;  4O3R A;  2XY6 A;  8ICQ A;  2HBJ A;  1RXW A;  4LEV A;  3WK9 A;  4EEN A;  4J9O A;  3HJE A;  4KLU A;  1XSP A;  3KKA A;  1TK5 A;  3GV8 B;  3RF9 A;  5AM2 A;  4LEW A;  5CJ7 A;  2HW3 A;  2QB0 B;  4UAV A;  3ISD A;  2UVU A;  4I28 A;  3BQ2 A;  1SKS A;  2ZHB A;  2ASL A;  4GLX A;  2OM6 A;  2IOF K;  5J2G A;  2OCE A;  3NRW A;  4ELU A;  5AKJ A;  2KJ9 A;  2IHO A;  3M9O B;  5CEH A;  2YX8 A;  5KFT A;  2Q0Z X;  3GU3 A;  4ECZ A;  4B9M A;  4I2J A;  4EEB A;  1SKR A;  2HN1 A;  1NJY A;  4TQR A;  2M2U A;  2NRT A;  2EWR A;  3I76 A;  3Q8Q B;  1H38 A;  4HX0 A;  3H8M A;  1WCN A;  1NK4 A;  4AT9 B;  1QCK A;  5ALW A;  5DDY A;  2DBY A;  3H4D A;  4C8O A;  3C23 A;  4DF8 A;  4NL9 A;  3U26 A;  5KFC A;  4FHX A;  2ZXI A;  1X9X A;  1N62 A;  2M2T A;  4P2H A;  3CRX A;  4RNO A;  4YD2 A;  2RQ5 A;  2WF6 A;  3KHR A;  5CHG A;  3C66 A;  3TQ1 A;  1R8A A;  3MFH A;  2AGQ A;  4K97 A;  4NXX A;  4CGZ A;  4QWA A;  2RDJ A;  2KZM A;  1JIH A;  2BGW A;  1ZJN A;  4ECT A;  2KD1 A;  3KHH A;  2BQR A;  4C0Z A;  2ZUB A;  1ZQE A;  3UXO A;  4Y2U A;  1F5S A;  1UA0 A;  1NJW A;  5AI0 A;  8ICC A;  3M8R A;  2G09 A;  2D3D A;  4AT8 B;  2ZJ8 A;  5KFN A;  4DFJ A;  1L3V A;  4RT3 A;  4QZ9 A;  4FH3 A;  2ZIX B;  4TUQ A;  3IG8 A;  4I27 A;  4F5N A;  4YMO A;  2G08 A;  3MR3 A;  3H8J A;  3KOO A;  1UQV A;  2NYV A;  3HW8 A;  5HRE A;  3JPR A;  5KFE A;  3GIM A;  3UXP A;  4CF3 A;  4EBD A;  5HR9 A;  3ZDE A;  5ALX A;  4BXO A;  5KG0 A;  3BQ7 A;  2YN4 A;  5KFS A;  4DS4 A;  4EED A;  3ISB A;  2ISO A;  1KL9 A;  3IP4 B;  1SV0 A;  4K8V A;  2V9W A;  1K1Q A;  5KFZ A;  1FFU A;  5EE9 A;  4B9L A;  7ICK A;  3PHZ A;  5AKE A;  4QNL A;  2JRZ A;  1ZQT A;  1ECW A;  1RQL A;  1WYG A;  3ETL A;  1QQ5 A;  4IR1 A;  5HNK A;  2HHQ A;  1V38 A;  3C2K A;  1N60 A;  1SL0 A;  4I29 A;  2JMG A;  2GH1 A;  3KFU F;  3KTQ A;  4TUP A;  2W7O A;  4PHP A;  1HEK A;  4O3M A;  4RU9 A;  2ALZ A;  2EAM A;  1Z19 A;  4LZG A;  3CW2 C;  1D8B A;  2HHS A;  1QH9 A;  8ICU A;  2M9N A;  5IIO A;  3OJS A;  3O0F A;  2FLN A;  1DOQ A;  1ZQL A;  4A8E A;  4QWB A;  2ZH2 A;  3NVO A;  4Y2V A;  3H7I A;  1ZET A;  1XSL A;  2PI4 A;  3RFA A;  3M1Y A;  3E58 A;  3ED5 A;  2BZF A;  3PY8 A;  8ICS A;  4KLO A;  2NRZ A;  4K96 A;  4NL9 C;  1U45 A;  4FS1 A;  4OCZ A;  3LWL A;  4ZOH C;  4WH5 A;  3OVA A;  5ALP A;  2ES6 A;  4RQM A;  1N63 A;  2VJ4 A;  2YML A;  4XRH A;  2XY5 A;  5DEC A;  2R8H A;  2KV2 A;  2O5A A;  4GXJ A;  2NRK A;  2A19 A;  4QW8 A;  1B4F A;  2E5S A;  4EV6 A;  3I28 A;  4OO1 J;  2F77 X;  2BKE A;  2CRX A;  5J2I A;  1X6J A;  4PGX A;  2I1Q A;  4DSL A;  4BX9 C;  5AIC A;  2F76 X;  5KL8 B;  4EEK A;  4X0A A;  3NTU A;  2B51 A;  4X4S A;  1RM6 C;  4YMN A;  4F4X A;  3NWI A;  4C7Y A;  5E79 U;  5DB6 A;  4NJ8 A;  3EPI A;  2WB1 F;  9ICT A;  1JXL A;  2P66 A;  1J2N A;  3T5L A;  5AI6 A;  4I2G A;  4IQT A;  1U48 A;  2JH7 A;  2W8L A;  5AIB A;  2JEG A;  1QSL A;  3SAF A;  4GXK A;  4R8U A;  4NLZ A;  4Q43 A;  4M9L A;  4CRX A;  5J0P A;  4Z6F A;  2VJ5 A;  2ZTC A;  4CNQ A;  1YZ7 A;  2ODG A;  2BE3 A;  1XU4 A;  1KN5 A;  1F0M A;  3AN1 A;  1TK0 A;  4EBK A;  2XC9 A;  2XO7 A;  1TAQ A;  1ZQI A;  3LVW A;  2OHF A;  2AQ4 A;  3NVV A;  3ZD8 A;  4DSJ A;  3H8S A;  1ZQS A;  2ZH9 A;  8ICG A;  5CHE A;  4K4H A;  3HJ4 A;  3PW7 A;  5DG8 A;  4X0B A;  4KTQ A;  2PKE A;  4WC2 A;  1SIJ A;  4DL6 A;  2XCA A;  2KOB A;  3AUO A;  3C2M A;  1NKE A;  3PZP A;  2FMP A;  4M9N A;  5KT3 A;  1ZD3 A;  3OGU A;  4P0Q A;  1L7M A;  3RAX A;  3HIY A;  2QB0 A;  2HHP A;  3DEE A;  5ALF A;  4RUA A;  2E3T A;  3C5F A;  3MGI A;  4TQS A;  2NRW A;  3C5G A;  4EZ9 A;  1QSS A;  2DPI A;  3DV9 A;  2DR9 A;  4UW9 A;  3F5A A;  3T3F A;  2KEY A;  4DQQ A;  3SI8 A;  3C1Z A;  2AXT U;  1F44 A;  4PHD A;  4UBB A;  5L1K A;  5CFU A;  2FDR A;  1WOT A;  2JZB B;  5J0X A;  3UMG A;  4QWC A;  4I2B A;  5KFV A;  4EBJ A;  8ICY A;  4JK1 A;  3JYY A;  2F3N A;  4X4T A;  3Q8M A;  2E1E A;  1ZQY A;  1MIW A;  2VKQ A;  4ATB A;  3GV5 B;  5EE3 A;  3OWG A;  9ICL A;  2W03 A;  5DGA A;  4BJQ A;  2H3Z A;  4AT9 A;  5AKH A;  3E2E A;  1TFR A;  3PML A;  2OEH A;  4DSI A;  3RH5 A;  1SKW A;  4OAH A;  4MEX A;  5KG3 A;  3H37 A;  5CB1 A;  5FP0 A;  1RQN A;  2KJ8 A;  3RBE A;  4IQW A;  4R65 A;  2UVR A;  4IR9 A;  1VFG A;  9ICP A;  5KTQ A;  1S10 A;  4LVS A;  4CCH A;  4NXT A;  4AYB F;  5L1J A;  3C21 A;  4B9N A;  1A77 A;  1PK3 A;  5JU5 A;  1Q46 A;  4UAZ A;  5J8Y A;  3Q8P B;  5KFR A;  4C7Z A;  9ICX A;  5JTI A;  3C29 A;  4M2Y A;  3KKA C;  3N7R C;  1S0N A;  4KLI A;  3SYZ A;  3QEA Z;  7ICF A;  1BGX T;  1TVA A;  5AK3 A;  5B3Q A;  5KFX A;  1P7D A;  3UM9 A;  1IXR A;  1MQ3 A;  2WAQ F;  2W54 A;  1T94 A;  4QZE A;  5J8Y C;  2L5Y A;  5KFW A;  5KFM A;  3KD3 A;  2GO7 A;  2EH9 A;  3OHA A;  2W9M A;  3V6K A;  3IRU A;  5G5H A;  5AK4 A;  5KFF A;  3HJ1 A;  3VC8 A;  3OV7 A;  1ZQK A;  2KFN A;  4Y2T A;  4C4T A;  3S6J A;  3M7D A;  3CK6 A;  1NK5 A;  2KSO B;  4KN7 A;  1L3T A;  3R9K A;  3V72 A;  3THV A;  1ZQO A;  2NRV A;  1L7O A;  5J0T A;  4UB4 A;  2J6U A;  4P0P B;  4M9H A;  2GWS A;  3CP8 A;  4KMO B;  1X9M A;  4DFD A;  4F2R A;  2W3S A;  4PL1 A;  3SR6 A;  4BUG A;  4I2H A;  2A3V A;  4J9P A;  3RB3 A;  2EZZ A;  2FMS A;  5KG5 A;  4EYH B;  5J0O A;  2BQ3 A;  3PX4 A;  4F72 A;  3QZ7 A;  1GPJ A;  3JPT A;  4Y2P A;  3QEB Z;  4NXV A;  4N7R A;  1ZQD A;  5EE0 A;  1C7Y A;  4IQV A;  2QLT A;  5T14 A;  3LVV A;  2J6S A;  4Z6C A;  2UVV A;  3WK7 A;  4ECV A;  4Y2Q A;  4C4S A;  4I2D A;  4BDP A;  3G6Y A;  4IC9 A;  1TAU A;  3V6J A;  5AM5 A;  3I1Y A;  5CWR A;  5DLF A;  3MAB A;  2XY7 A;  2F44 A;  4X4P A;  5HR7 A;  7ICN A;  4FHY A;  4MFA A;  2QKQ A;  5D46 A;  3F2D A;  4OJL A;  3WK6 A;  4KIT B;  3N97 B;  5AM4 A;  5KG7 A;  2BCR A;  2KJ5 A;  4QZH A;  3L5K A;  5IIM A;  1QSY A;  2HOF A;  1CI4 A;  2VAN A;  2BDU A;  3UMC A;  1JAL A;  1XSN A;  4O69 A;  4YQW A;  3HIL A;  3RJJ A;  5J0R A;  4TUR A;  3HWT A;  4F4Y A;  2W04 A;  2IHM A;  3HKZ F;  4P4M A;  4I2E A;  2EZX A;  5HHI A;  2B4V A;  3QU9 A;  4PPX A;  4PHE A;  2BCS A;  4UB1 A;  1KFS A;  5EE1 A;  5KFU A;  5CA7 A;  2F1I A;  4WC6 A;  5HRB A;  5HRF A;  2W9C A;  2ESE A;  4HAI A;  4GXI A;  5KAF U;  1X9W A;  1QQ6 A;  3OPX A;  4U7C A;  3PW2 A;  4M47 A;  4O9M A;  2ZH5 A;  2ISP A;  4KLD A;  3K1Z A;  4ELT A;  2HSZ A;  2R18 A;  4WBZ A;  5KFG A;  5D62 A;  3RJE A;  9ICO A;  4PJ0 U;  1D9F A;  8ICZ A;  2HI0 A;  4F4Z A;  4NLN A;  5CFS A;  4YXJ A;  4DQP A;  9ICM A;  1ZQV A;  2C2D A;  3GQC A;  4DL4 A;  5EWF A;  5EOZ A;  2KSO A;  4DOB A;  4JV0 A;  4O6A A;  3ZDB A;  2WB1 C;  5KFA A;  3PX6 A;  3GDX A;  2K4I A;  1N2X A;  4NKU A;  2KE7 A;  1ZQB A;  1NK0 A;  4PZO A;  7ICH A;  2Y9U A;  2WF5 A;  7ICT A;  3TFS A;  4ACO A;  1L8L A;  3MGV A;  1NK8 A;  3ZDA A;  1YT3 A;  1T3Q A;  1KKX A;  5F3X B;  4RQ4 A;  7ICJ A;  2E8M A;  2C22 A;  1J97 A;  4QZD A;  4ECW A;  3HPO A;  3JZ0 A;  1COO A;  3PSP A;  1A0P A;  2EAN A;  4NXZ A;  5AM3 A;  9ICS A;  4X4R A;  5BOL A;  2K4E A;  3E0F A;  4FO6 A;  2Y0S C;  3AU2 A;  4CF4 A;  2A1J B;  3H40 A;  3QU7 A;  2AH5 A;  2W3R A;  1KRP A;  3H39 A;  3H4B A;  4GC7 A;  1MIY A;  2O1P A;  4WC0 A;  4MF2 A;  5K4L A;  8ICI A;  5DG9 A;  4M9J A;  3MGH A;  1BPY A;  1KLN A;  2PI5 A;  2B21 A;  3JCF A;  4P4O A;  5AKY A;  3D6J A;  1HUZ A;  3C18 A;  4JLZ A;  5H2F U;  3FAH A;  2BQU A;  2R8G A;  5D63 A;  4WC3 A;  4DSE A;  5GTH U;  1L7N A;  3B9J A;  1MQ2 A;  1MC8 A;  5J2D A;  1JAJ A;  2Q66 A;  4J9R A;  1IIP A;  1KNY A;  2XGP A;  2W8K A;  7ICQ A;  2YY6 A;  9ICB A;  8ICM A;  5CRX A;  1NO5 A;  5HHH A;  4LT6 A;  2MSN A;  4F92 B;  3EW9 A;  4KB6 A;  4KMU A;  2KVS A;  5AI5 A;  4DQI A;  1Z4O A;  1ZD4 A;  1XO0 A;  1M6Y A;  2YTU A;  5ALQ A;  4YN4 A;  1Z1B A;  4EEY A;  3AL0 B;  4B9T A;  5HRG A;  4QIW C;  3F2B A;  5HRK A;  4WC4 A;  3PR5 B;  1XS9 D;  2IUB A;  1Z4N A;  2LHT A;  5AKX A;  2KIV A;  2LYA A;  2Z7J A;  3ONN A;  4NLK A;  2G0A A;  3M6Z A;  2LYB A;  2W55 A;  1T8E A;  2ZIV B;  3KZI U;  1ZQR A;  3PNC A;  1K1S A;  2ZJ5 A;  2HHW A;  5KNI A;  1T3N A;  3KBB A;  4E7X A;  3CNH A;  2O6K A;  3AQM A;  1R8C A;  4NWI A;  2K60 A;  1DK3 A;  1JMS A;  3V7J A;  2W11 A;  3ICX A;  1UA1 A;  3B0Y A;  3IN5 A;  3JPQ A;  3MR6 A;  5D4B A;  5DED A;  1S77 D;  1D9D A;  3MDA A;  3AQL A;  3NRZ A;  1UHU A;  2J6T A;  4RQ6 A;  3RH4 A;  1L3U A;  2F8K A;  4I2C A;  4QZI A;  3EZ5 A;  1HJP A;  3OVS A;  2JZB A;  4EZ6 A;  3WFP A;  3F53 A;  2WF7 A;  4WQL A;  3EF2 A;  1KW4 A;  1J2M A;  4F5Q A;  4I2I A;  2KP7 A;  3TAQ A;  5AI4 A;  2Y9T A;  4B9U A;  3RR8 A;  2H3F A;  1SWW A;  3QXG A;  1N56 A;  5J0U A;  2RFF A;  5KFB A;  5DBA A;  4DFM A;  5IIL A;  4F50 A;  4UB5 A;  2Y1J A;  1SB3 C;  4YVZ A;  5ALR A;  1URJ A;  2M2V A;  1LV5 A;  1X2I A;  8ICT A;  2PXI A;  4YG2 A;  4KLJ A;  4NLG A;  3N4M B;  4F5O A;  4OAG A;  1DRG A;  2PFQ A;  3PSF A;  4LEZ A;  4WQK A;  1ZYQ A;  2BCQ A;  3PW0 A;  2G07 A;  4MKP A;  2YMQ A;  5AI9 A;  1N5X A;  2JHD A;  3Q8K A;  4I2F A;  7ICR A;  1X9S A;  3A0B U;  4NXW A;  1B22 A;  5L1I A;  4F3O A;  2MRL A;  3BQ0 A;  3QUQ A;  2RLT A;  4Q45 A;  2E8P A;  2NRX A;  4KN4 A;  2FCL A;  2CN1 A;  2LI6 A;  4FFD A;  1KFT A;  3K1R B;  1TFY A;  2NO5 A;  3QUB A;  4KLF A;  4S3N A;  1SXD A;  4QWD A;  4UAT A;  4GFJ A;  4PHA A;  2P35 A;  2ZJA A;  5ALZ A;  3D2S A;  2HVI A;  4O3P A;  3BQ1 A;  3RRH A;  4ICA A;  8ICB A;  3WKA A;  3QUT A;  1Z3E B;  3H0M B;  2OH2 A;  5KFP A;  4R66 A;  4DOC A;  1HIW A;  1ARO P;  2AQ0 A;  2WF9 A;  4FZL A;  4FBT A;  3C28 A;  4B9S A;  4WC5 A;  5KAI U;  5EWE A;  2KMD A;  2Y1I A;  2VIX A;  4JV2 A;  3TAR A;  3NVW A;  3PW4 A;  1V9P A;  5DGB A;  1ZQH A;  2XI9 A;  2H5X A;  1NNL A;  2ZG6 A;  1L5U A;  2DRB A;  4MFF A;  3TAC B;  3BJY A;  3KZX A;  1SXE A;  5L1L A;  3V7K A;  4K4G A;  4G9B A;  2HOI A;  2B0C A;  3B0X A;  8ICV A;  1YZ6 A;  5ALK A;  3NUQ A;  5KT6 A;  2GA9 D;  3WFO A;  3SV4 A;  1L3S A;  2YB4 A;  4WC1 A;  1X6I A;  1FFV A;  3NVZ A;  9ICN A; 
#chains in the Genus database with same CATH homology
 4AT7 B;  1BNO A;  2FMS A;  2Q0Z X;  5KG5 A;  4RWN A;  4EYH B;  4ECZ A;  3OJU A;  4I2J A;  4B9M A;  2BCU A;  5J0O A;  2BQ3 A;  1SKR A;  2P6U A;  4DO9 A;  4QZG A;  4ECR A;  5BPC A;  4TQR A;  4F5P A;  1NJY A;  3PX4 A;  2NRT A;  4XQ8 A;  3OSN A;  4KLM A;  7ICE A;  2M2U A;  4DL5 A;  4JV1 A;  3QZ7 A;  3Q8Q B;  2RDI A;  1H38 A;  4E0D A;  4Q8F A;  3JPT A;  3WFQ E;  1WCN A;  3QEB Z;  8ICN A;  5IIN A;  4KLT A;  4F5R A;  1NK4 A;  4AT9 B;  2IA6 A;  5DDY A;  4QZ8 A;  3H4D A;  4J9M A;  1TV9 A;  1ZQD A;  1C7Y A;  4C8O A;  4IQV A;  3C23 A;  3QZ8 A;  4R8U B;  4DF8 A;  4ELV A;  3JPO A;  5KG6 A;  4F8R A;  5KFC A;  2UVV A;  2J6S A;  4Z6C A;  4ECX A;  4F2S A;  4X4Q A;  5J29 A;  1NJZ A;  4ECV A;  4BDP A;  4I2D A;  4DOA A;  4FHX A;  1UEV A;  5DQI A;  3G6Y A;  4ED6 A;  2OWO A;  4YP3 A;  3RJH A;  1TKD A;  8ICE A;  1TAU A;  3TAP A;  2WTF A;  4WBY A;  3V6J A;  2M2T A;  3HP6 A;  4P2H A;  7ICU A;  4X4U A;  5CWR A;  3LK9 A;  5DLF A;  3T5J A;  4RWO A;  4RNO A;  3MAB A;  7ICS A;  1VJ7 A;  3UPS A;  4YD2 A;  2XY7 A;  3KHR A;  3RBD A;  2DR5 A;  4X4P A;  3MDC A;  7ICN A;  4FHY A;  1NOM A;  4ECS A;  3K4G A;  3GIL A;  5CHG A;  3C66 A;  4X4N A;  4MFA A;  3TQ1 A;  5D46 A;  1R8A A;  2V4R A;  3L9D A;  3AQN A;  4KIT B;  4PGY A;  1ZQP A;  4J9L A;  2FLL A;  3MFH A;  4YFK A;  2AGQ A;  3N97 B;  5KG7 A;  4KLE A;  5F9N A;  9ICG A;  4QWA A;  4DLE A;  9ICH A;  1YLQ A;  2RDJ A;  2BCR A;  2KZM A;  1JIH A;  2BGW A;  4QZH A;  2ZTE A;  5IIM A;  1QSY A;  2VAN A;  1ZQC A;  1ZJN A;  3NYB A;  3V6H A;  9ICA A;  4ECT A;  1XSN A;  1ZQM A;  4M6W B;  3KHH A;  4YQW A;  4UB2 A;  2BQR A;  1JX4 A;  2ZUB A;  1XC9 A;  3RJJ A;  3H8W A;  4O5E A;  5J0R A;  4TUR A;  3UXO A;  3HWT A;  5CP2 A;  4P4P A;  4F4Y A;  1ZQE A;  1UA0 A;  1NJW A;  2IHM A;  3JPP A;  8ICH A;  3OUY B;  2C2R A;  8ICC A;  4K4I A;  4P4M A;  3M8R A;  1BPD A;  1RYS A;  4I2E A;  4NY8 A;  1S0O A;  7ICL A;  9ICK A;  5HHI A;  4AT8 B;  2ZJ8 A;  4MFC A;  3AQK A;  4EP7 A;  2V4Q A;  4PPX A;  5KFN A;  4O3O A;  5IIJ A;  4DL7 A;  4DFJ A;  4YCX A;  1L3V A;  4RT3 A;  4PHE A;  4KLS A;  4QZ9 A;  2ID1 A;  4FH3 A;  2BCS A;  4UB1 A;  4TUQ A;  4M0A A;  2UVW A;  1KFS A;  5KFU A;  2I9G A;  4I27 A;  5CA7 A;  2F1I A;  4F5N A;  4WC6 A;  4M5D A;  4YMM A;  4YMO A;  4KLH A;  3MR3 A;  5HRB A;  1Q79 A;  3H8J A;  5HRF A;  2W9C A;  5DG7 A;  4GXI A;  1X9W A;  2PFP A;  3HW8 A;  5KT7 A;  5HRE A;  4FHV A;  3JPR A;  1BPE A;  5KFE A;  1B43 A;  3GIM A;  3PW2 A;  5DB7 A;  4M47 A;  3UXP A;  4O9M A;  3TI0 A;  1QLN A;  1NK7 A;  9ICU A;  2ZH5 A;  3K75 D;  2BCV A;  2ISP A;  4RWP A;  4EBD A;  4RPZ A;  3UQ2 A;  3ZDE A;  4KLD A;  5BOM A;  9ICF A;  5KFO A;  5KG0 A;  4BXO A;  4ELT A;  4PGQ A;  4IRC A;  2HVH A;  4DS4 A;  5KFG A;  1DGS A;  3FYH A;  5KFS A;  2ATL A;  3RJE A;  3ISB A;  4WBZ A;  9ICO A;  3ISC A;  2ISO A;  1D9F A;  4BXO B;  4RWQ A;  2FPK A;  2V9W A;  4M6W A;  4F4Z A;  8ICZ A;  1K1Q A;  2BR0 A;  3RJG A;  5KFZ A;  3GIK A;  4NLN A;  4YXJ A;  3M8S A;  4DQP A;  9ICM A;  2KZ3 A;  1ZQJ A;  1ZQV A;  2C2D A;  4RQ8 A;  4B9L A;  3GQC A;  7ICK A;  4DSK A;  5J2C A;  5KFL A;  8ICX A;  5KT4 A;  2AGO A;  4EBC A;  4DL4 A;  5EWF A;  1RXV A;  5EOZ A;  1ZQT A;  2ZH4 A;  4DOB A;  5KT2 A;  1S0M A;  4JV0 A;  3RTV A;  4O3Q A;  3ZDB A;  1U49 A;  4O3N A;  3ETL A;  5KFA A;  4IR1 A;  5HNK A;  2HHQ A;  1V4A A;  4J9Q A;  3PX6 A;  5KG4 A;  3C2K A;  3H3A A;  3MR2 A;  3RB6 A;  3GDX A;  3Q8S B;  5III A;  1SL0 A;  4I29 A;  4NKU A;  1ZQB A;  1NK0 A;  2ZUD A;  2ZUC A;  4C8M A;  5IIK A;  4I2A A;  7ICH A;  3PW5 A;  4YR3 A;  1T7P A;  7ICT A;  3KTQ A;  4FHP A;  3TFS A;  4GC6 A;  4ED2 A;  8ICO A;  4TUP A;  2W9A A;  9ICR A;  4PHP A;  5KFK A;  4RU9 A;  4YR0 A;  4QZB A;  2ALZ A;  1NK8 A;  4DFK A;  5DB8 A;  4LZG A;  2IBK A;  2JEF A;  3ZDA A;  1S76 D;  2HHS A;  1R89 A;  1DK2 A;  8ICU A;  9ICJ A;  5L9X A;  2M9N A;  9ICI A;  5IIO A;  3OJS A;  3NGD A;  1Q78 A;  2FLN A;  4X4V A;  1DOQ A;  1ZQL A;  2HHT A;  4QWB A;  4E80 A;  2ZH2 A;  2VA8 A;  3H7I A;  4J9N A;  1NK9 A;  2ZH6 A;  4NM2 A;  1S0V A;  1ZET A;  7ICJ A;  4RQ4 A;  4J9S A;  5DKW A;  5J0Y A;  4ECU A;  1XSL A;  2PI4 A;  4C8K A;  4O5K A;  2C22 A;  4QZD A;  3C1Y A;  4ECW A;  3LDA A;  5J2H A;  4ECY A;  1R8B A;  3HPO A;  3JZ0 A;  5J2F A;  3PY8 A;  1COO A;  8ICS A;  4JWN A;  4NXZ A;  3WFS C;  4DL2 A;  5KFJ A;  9ICS A;  4X4R A;  1RZT A;  5BOL A;  4KLO A;  2NRZ A;  4FO6 A;  4AT8 A;  4E8F A;  2ZH3 A;  2JEI A;  1U45 A;  4MEY A;  4FS1 A;  3AU2 A;  1ZQU A;  1RYR A;  3LWL A;  2A1J B;  5HC9 A;  5DQH A;  3H40 A;  4LZD A;  3OVA A;  4YD1 A;  4NM1 A;  1KRP A;  1BPZ A;  7ICM A;  5DLG A;  1Z00 B;  4XRH A;  4C8N A;  3GIJ A;  2XY5 A;  2MUT B;  4R63 A;  2IMW P;  2ZH8 A;  5DEC A;  4UQG A;  2R8H A;  2O5A A;  4X5V A;  2HHX A;  8ICK A;  3H39 A;  2FMQ A;  3H4B A;  4GXJ A;  2NRK A;  5C5J A;  4GC7 A;  1ZQN A;  4QW8 A;  3MR5 A;  4UAY A;  4PH5 A;  1MIY A;  2O1P A;  4YXM A;  4WC0 A;  3PR4 A;  3ZD9 A;  4MF2 A;  3BQT A;  1ZQX A;  3PO5 A;  2BDP A;  5HRD A;  1Y88 A;  8ICI A;  2BKE A;  5J0W A;  5DG9 A;  4M9J A;  3MGH A;  4RNN A;  5J2I A;  1HUO A;  3PX0 A;  4RZR A;  1BPY A;  4PGX A;  4ED0 A;  2I1Q A;  4RQ2 A;  3M9N B;  1KLN A;  2VA3 A;  2PI5 A;  4DSL A;  4FHW A;  2B21 A;  4DFP A;  4P4O A;  5J2J A;  2PFN A;  8ICJ A;  1HUZ A;  4X0A A;  3OVB A;  3M9M B;  3C18 A;  5HRI A;  1KFD A;  4UD5 A;  3G6X A;  2BQU A;  2R8G A;  2KZZ A;  3NTU A;  7ICP A;  4WC3 A;  4DSE A;  4X4S A;  4YMN A;  3RB3 A;  4F4X A;  3UQ0 A;  2AU0 A;  5KFH A;  4UAW A;  4MF8 A;  4F93 B;  3TFR A;  1MQ2 A;  4DLG A;  1MC8 A;  4HYK A;  5J2D A;  1SL2 A;  1JAJ A;  4ED1 A;  1EXN A;  5DB6 A;  4O3S A;  4WC7 A;  2Q66 A;  3EPI A;  4J9R A;  4M04 A;  1KNY A;  2XGP A;  2W8K A;  7ICQ A;  9ICT A;  1ZQG A;  1A76 A;  1JXL A;  4IRD A;  4C8L A;  2P66 A;  8ICM A;  9ICB A;  3T5L A;  1NO5 A;  5HHH A;  4RQ0 A;  1BPB A;  4LT6 A;  5KFI A;  4YR2 A;  3ZDD A;  4I2G A;  4IQT A;  1U48 A;  5J2A A;  2W8L A;  4F92 B;  3EW9 A;  5TZV A;  4KMU A;  3GII A;  3QE9 Y;  2JEG A;  1QSL A;  2AJQ A;  4EBE A;  5KG1 A;  4DQI A;  1UT8 A;  4X4O A;  4GXK A;  4R8U A;  4YN4 A;  3BDP A;  4EEY A;  4NLZ A;  4G3I A;  3OHB A;  1NKB A;  2ZTD A;  4Q43 A;  2MAX A;  4M9L A;  4B9T A;  1MSW D;  5HRG A;  5J0P A;  4Z6F A;  3MBY A;  1PZN A;  5HRK A;  2ZTC A;  4WC4 A;  4DWI A;  1CEZ A;  3PR5 B;  8ICW A;  2BE3 A;  3UXN A;  1NJX A;  5KFQ A;  4Z6D A;  3KHL A;  1XS9 D;  1XU4 A;  4IQU A;  3EWA A;  1SL1 A;  1TK0 A;  4TUS A;  2R8J A;  4EBK A;  2XC9 A;  5DB9 A;  4QZF A;  2C28 A;  2XO7 A;  1TAQ A;  5J0Q A;  4XUS A;  2AQ4 A;  1ZQI A;  4DEZ A;  4DSJ A;  3ZD8 A;  2IHN A;  8ICP A;  3H8S A;  1ZQS A;  2ZH9 A;  4KLQ A;  1KTQ A;  8ICG A;  8ICA A;  2ZH1 A;  1UEU A;  1JN3 A;  1QTM A;  4NLK A;  4FS2 A;  4NKT A;  3OSP A;  4K4H A;  5JUM A;  4R64 A;  3HJ4 A;  3PW7 A;  4QZC A;  5DG8 A;  4RPX A;  7ICI A;  7ICV A;  4KTQ A;  4X0B A;  1T8E A;  2FLP A;  4WC2 A;  2W9C B;  2ASJ A;  8ICR A;  1ZQR A;  3PNC A;  4BWJ A;  1K1S A;  1JXE A;  4BWM A;  2ZJ5 A;  4DL6 A;  4FBU A;  1T3N A;  2XCA A;  3TAN A;  2HHW A;  1SZP A;  4XQ7 A;  2F1H A;  3GV7 B;  4Z6E A;  4ED8 A;  4E7X A;  3AUO A;  4EYI B;  3C2M A;  1NKE A;  5HRL A;  2FMP A;  4M9N A;  5KT3 A;  3AQM A;  2W9B A;  2P6R A;  1R8C A;  2ZHA A;  1ZQQ A;  2JEJ A;  3OGU A;  1DK3 A;  1JMS A;  3V7J A;  4ED3 A;  3RAX A;  1D8L A;  3HIY A;  3Q8R B;  5CR0 A;  1FA0 A;  2HHP A;  1UA1 A;  1ZQZ A;  3LQC B;  3B0Y A;  3RR7 A;  3JPQ A;  4XA5 A;  3MR6 A;  5D4B A;  5DED A;  1S77 D;  1D9D A;  5KFY A;  3MDA A;  5J0S A;  4DF4 A;  3AQL A;  4RUA A;  5HML A;  3T5H A;  1CUK A;  4FH5 A;  3C5F A;  1UET A;  3MGI A;  4QWE A;  4IRK A;  4TQS A;  2NRW A;  2FPL A;  3C5G A;  3C2L A;  3RH6 A;  5J2K A;  2M2W A;  1N48 A;  4EZ9 A;  3MFI A;  2KFZ A;  1QSS A;  2DPI A;  2J6T A;  2DR9 A;  3PO4 A;  3T3F A;  1PX5 A;  4DQQ A;  3SI8 A;  4B9V A;  4RQ6 A;  3RH4 A;  1L3U A;  3C1Z A;  4I2C A;  9ICV A;  1RPL A;  4QZI A;  3EZ5 A;  2PBE A;  4PHD A;  3KHG A;  1HJP A;  3OVS A;  2JZB A;  4UBB A;  4EZ6 A;  1OU5 A;  5L1K A;  3WFP A;  5HMM A;  2BHN A;  2AGP A;  5KT5 A;  1WOT A;  1Z00 A;  2BPG A;  2C2E A;  9ICW A;  3HX0 A;  4RPY A;  2DPJ A;  4F5Q A;  4I2I A;  2JZB B;  5J0X A;  2KP7 A;  3SZ2 A;  3TAQ A;  4QWC A;  4I2B A;  4DQR A;  1UT5 A;  2A1J A;  5KFV A;  4BGD A;  5HP4 A;  4B9U A;  3RR8 A;  4KLG A;  4EBJ A;  8ICY A;  4JK1 A;  4UB3 A;  1U4B A;  8ICF A;  9ICE A;  1N56 A;  3JYY A;  4X4T A;  3Q8M A;  5J0U A;  1MIW A;  1ZQY A;  3ORY A;  1NZP A;  4ATB A;  4M9G A;  3GV5 B;  1JQR A;  2PFO A;  2RFF A;  3V7L A;  9ICL A;  2R8K A;  5KG2 A;  5KFB A;  5DBA A;  5DGA A;  4DFM A;  5IIL A;  4F50 A;  4UB5 A;  2Y1J A;  4AT9 A;  2M2V A;  4YVZ A;  3OUY A;  1XO1 A;  4JUZ A;  1LV5 A;  3E2E A;  1TFR A;  3PML A;  1ZQA A;  1X2I A;  4DSI A;  1BNP A;  3RH5 A;  1SKW A;  8ICT A;  4MEX A;  5HRH A;  5KG3 A;  5KFD A;  3FDS A;  3H37 A;  3Q8L A;  5HR9 A;  1IM4 A;  2PXI A;  5CB1 A;  4DL3 A;  4YG2 A;  1S9F A;  1TK8 A;  2BPF A;  3RBE A;  1LB2 B;  3RJK A;  4KLJ A;  5J2B A;  3HT3 A;  3N4M B;  4F5O A;  4NLG A;  4O0I A;  2ASD A;  2PFQ A;  4IG8 A;  3SV3 A;  4IQW A;  4R65 A;  2UVR A;  4UD4 A;  4IR9 A;  1ZYQ A;  4F91 B;  2BCQ A;  3PW0 A;  9ICP A;  2F1J A;  1VFG A;  5KTQ A;  1S10 A;  1TFW A;  1NK6 A;  3RAQ A;  3H38 A;  3RB0 A;  4LVS A;  4RUC A;  4CCH A;  3LWM A;  3IHQ B;  3WFR E;  4ZH4 A;  2FPM A;  3PMN A;  3AU6 A;  2VA2 A;  9ICQ A;  2KN7 A;  3EYZ A;  3IM1 A;  7ICG A;  3Q8K A;  5L1J A;  3JPS A;  4I2F A;  4QW9 A;  1X9S A;  7ICR A;  3PVX A;  2DRA A;  8ICL A;  1B22 A;  3C21 A;  5L1I A;  4F3O A;  2MUT A;  1A77 A;  4Q45 A;  3G6V A;  3BQ0 A;  4B9N A;  1U9L A;  3T5K A;  2NRX A;  1F5A A;  4F4W A;  4KN4 A;  2ZH7 A;  3RJF A;  4UAZ A;  2DR8 A;  2HHU A;  1KFT A;  4JWM A;  1ZJM A;  1TFY A;  4KLF A;  3Q8P B;  3RB4 A;  4S3N A;  4QWD A;  5KFR A;  5F2V O;  4PHA A;  9ICX A;  3PV8 A;  4DS5 A;  9ICC A;  1MIV A;  4M2Y A;  2ZJA A;  2HVI A;  5DBB A;  1KSP A;  2KTQ A;  4RQ1 A;  4O3P A;  3BQ1 A;  5DQG A;  1D8Y A;  5F9L A;  4UBC A;  4Q8E A;  1S0N A;  4Q44 A;  4ECQ A;  3RRH A;  2HHV A;  4KLI A;  3SYZ A;  3QEA Z;  1U47 A;  7ICF A;  3EPG A;  8ICB A;  1BGX T;  3JPN A;  1TVA A;  1Z3E B;  3GFK B;  4WCW A;  4RNM A;  5DBC A;  4RQ3 A;  3UPQ A;  5KFP A;  4R66 A;  4DOC A;  5KFX A;  4F4K A;  1ARO P;  2AQ0 A;  7ICO A;  2BPC A;  1BVS A;  4FBT A;  1T4G A;  1IXR A;  2LYH A;  4RQ7 A;  5EWE A;  1MQ3 A;  4B9S A;  2Y1I A;  4WC5 A;  4O5C A;  5D49 A;  4QZE A;  4O3R A;  5KFW A;  2XY6 A;  4JV2 A;  3TAR A;  8ICQ A;  1V9P A;  5KFM A;  3PW4 A;  5J2E A;  5DGB A;  1S97 A;  2DFL A;  4KLL A;  3OHA A;  1ZQH A;  2W9M A;  3V6K A;  3ZDC A;  5KFF A;  1RXW A;  2DR7 A;  2H5X A;  3HJ1 A;  3OV7 A;  4J9O A;  1ZQK A;  2R8I A;  4RQ5 A;  2XCP A;  1KDH A;  2KFN A;  2W9B B;  1L5U A;  4DSF A;  4ATB B;  4KLU A;  2DRB A;  1XSP A;  4DQS A;  4QZA A;  4RT2 A;  4MFF A;  4AT7 A;  1TK5 A;  1NK5 A;  4J9K A;  3BJY A;  4KN7 A;  3GV8 B;  1KEJ A;  1L3T A;  5L1L A;  3V72 A;  3THV A;  1ZQO A;  5CJ7 A;  2NRV A;  5EWG A;  5J0T A;  4UB4 A;  3V7K A;  2J6U A;  4K4G A;  2HW3 A;  1ZQF A;  3ISD A;  3B0X A;  2UVU A;  3BQ2 A;  4ED7 A;  1NKC A;  1SKS A;  2GWS A;  4I28 A;  4M9H A;  8ICV A;  1XWL A;  2ASL A;  1X9M A;  4F2R A;  2ZHB A;  4GLX A;  2DVI A;  3RJI A;  1ZQW A;  5KT6 A;  5J2G A;  2XGQ A;  1BPX A;  3SV4 A;  1L3S A;  3WFO A;  3RRG A;  4ELU A;  4WC1 A;  9ICN A;  4I2H A;  4J9P A;  5DDM A;  3M9O B;  1WCL A;  5KFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...