4PH0A

Capsid protein from bovine leukemia virus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
206
structure length
201
Chain Sequence
PIISEGNRNRHRAWALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSLTAAIAAAEAANTLQGFNPQNGTLTQQSAQPNAGDLRSQYQNLWLQAWKNLPTPWSTIVQGPAESYVEFVNRLQISLADNLPDGVPKEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQACAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLV capsid
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
total genus 68
structure length 201
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4ph0A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ph0A02
3VRLC 2XGVA 5HGMA 1E6JP 1M9DC 1AFVA 2EIAA 2Y4ZA 3G1IA 4XFXA 3BP9A 4XFZA 3DS4A 1M9YC 4INBA 3G28A 3G26A 1EM9A 2V4XA 4U0DA 4E92A 5HGOA 5HGLA 4DGEC 4COPA 1QRJA 2X2DD 3DPHA 5I4TG 3MGEA 3H4EA 1G03A 2XV6A 3H47A 4COCA 3NTEA 1EOQA 2JYGA 2WLVB 1P7NA 2M8LA 1L6NA 4B4NA 4PH3A 1A43A 2GONA 3DS3A 5HGNA 3DTJA 4NX4C 2PWOA 4IPYA 1U7KA 3DS2A 2XGUA 2GOLB 2KODA 2XXMA 2ONTA 2LF4A 2XDEA 2JO0A 1M9XC 4LQWC 2BUOA 1D1DA 1AK4C 1M9FC 2M8PA 1M9EC 3DS1A 3G21A 2PWMA 3DS5A 2XT1A 4DGAC 1AUMA 3DS0A 4U0CA 3P05A 2PXRC 4XRQA 5DCKA 4M0IA 2JPRA 2WLVA 4U0AA 2X83A 3G1GA 5JPAA 2XGYA 4XROA 4U0EA 4XFYA 2L6EA 3G0VA 4PH1A 2JYLA 1A8OA 2KGFA 4WYMA 4J93A 4E91A 4HTWA 3LRYA 4PH2A 1GWPA 4QNBA 5HGKA 2X82A 4U0FA 4PH0A 2M8NA 1BAJA 3G29A 1M9CC 1EIAA 4U0BA
chains in the Genus database with same CATH superfamily
3G1IA 4XFXA 5BS2A 5KP6B 2DNWA 2VLQA 2GZEA 2LOLA 2KOPA 2LTEA 2FADA 1QRJA 1YHQP 4DG9A 3M1MA 2KG8A 3G71P 2VLOA 1VQ7P 2KOOA 4COCA 1VKUA 3CMAP 3CCMP 1KLPA 1L6NA 2FQ2A 2MD9A 2EG5A 3CPWO 1GXGA 1T8KA 4PH3A 2MY5A 2LIWA 2PWOA 4IPYA 2KG6A 3DS2A 2GOLB 2GYKA 3GZLA 2GZIA 1FR2A 1RO0A 1K8AQ 1HQBA 2XDEA 2OTJP 2JO0A 4QKOA 3G4SP 2BHVA 4LQWC 1M1KQ 2GZFA 2LKIA 1AK4C 2VLPA 1YJNP 4BPHA 2FQ1A 5KP7B 3DS1A 1M6NA 1UJZA 3DS5A 1JJ2O 2K5XA 1MZ8A 3DS0A 3P05A 4M0IA 2AFEA 2FAEA 2CGQA 2L6EA 2N6YA 3OW2O 2KOSA 4H2XC 3G6EP 2N6ZA 4QNBA 5HGKA 2X82A 3I55P 3B5IA 2X2BA 2JQ4A 1VQ8P 1AYIA 4U0BA 3VRLC 2PY8A 1Q82Q 1Q86Q 1E0HA 2K2QA 4H2WC 4MRTC 4INBA 3HYBA 2LMLA 3G28A 2CNRA 1VQ4P 4U0DA 1BXIA 5HGOA 5HGLA 3GJNA 3MGEA 2KR5A 1G03A 2VSQA 3H0DA 2XZ1C 3CC4P 2PEOA 3NTEA 4HKGA 1P7NA 2AVAA 2LIUA 3CCUP 1K73Q 3CD6P 2N5IA 1VQ9P 3CE7A 4BPFA 1YITP 2KODA 2K93A 1L0IA 1K30A 3CCQP 5F2NA 2ONTA 3CCVP 1M9XC 2M8PA 2N98A 2GZJA 2CWOA 3EJEA 3CCSP 1VQLP 4GR6A 3RG6C 2FHSC 2KGCA 5EW5E 1QVFO 4XRQA 5DCKA 2PNGA 2XZ0D 2P9XA 1W2BO 3CMEP 2PEJA 1QVGO 5JPAA 2XGYA 2K0YA 4U0EA 2Z45A 1A8OA 3B4QA 2KGFA 4WYMA 3CCJP 2MVVA 4HTWA 1VQ5P 5BS1A 1VQKP 1GWPA 2FQ0A 4U0FA 4PH0A 1CEIA 1M9CC 3Q20A 2ROQA 1M9DC 2Y4ZA 4PXHB 3CCRP 2FVAA 1YI2P 4XFZA 2KG9A 2JGPA 3DS4A 2WPTA 1EM9A 2GDXA 5KP8B 2ERHA 1X3OA 4E92A 4COPA 3I56P 3CC7P 2X2DD 3WBHA 1N8RQ 3DPHA 3H4EA 2XV6A 3CCEP 3H47A 1M90Q 1Z6MA 1F80D 1OR5A 2JAZA 3HZQA 1EOQA 2FACA 2JYGA 2QNWA 1AF8A 1M74A 2CQ8A 2PENA 1A43A 3E2DA 5HGNA 1YJWP 4R0MA 1Q81Q 1GPJA 2XGUA 1ZNVA 2XXMA 3LMOA 1RO2A 2K0XA 2K0DX 2PEKA 3EJBA 3CC2P 3RG2A 1D1DA 1NQ4A 3NY7B 1M9FC 2CG5B 2QEXP 1KD1Q 2LPKA 2PWMA 1VHNA 2KOQA 2GDWA 2PEMA 2L0QA 2XT1A 2FVEA 2GZGA 1AUMA 4U0CA 4IZ6A 2PEIA 2PXRC 3CCLP 2JPRA 2N5HA 3G1GA 3EJDA 4H2YC 2MVUA 4XFYA 3G0VA 2K92A 2AFDA 2JYLA 2Z46A 2MR8A 3CXCO 2EHTA 2M5RA 1YJ9P 4E91A 1HY8A 1UNKA 2VLNA 1YIJP 2PEQA 1BAJA 3G29A 5F2OA 2E1MA 2JU2A 2NO8A 2XGVA 5HGMA 1E6JP 2EFJA 1GXHA 1AFVA 2AF8A 2EIAA 2KGDA 5EJDA 2LL8A 3BP9A 2KWLA 1L0HA 1VQPP 1M9YC 3G26A 4BPGA 2V4XA 1DV5A 2L22A 4DGEC 2KORA 5I4TG 4CA3A 1IMPA 1RNIA 1S72P 2WLVB 2M8LA 2KGEA 3U43A 4B4NA 2GONA 3DS3A 1NJIQ 3DTJA 3GKLC 4NX4C 2JU1A 1U7KA 2DGYA 1Q7YQ 1VQNP 1K9MQ 2EHSA 1VQ6P 4GR2A 2MF4A 1IMQA 2LF4A 1IUQA 2JB0A 2N50A 2BUOA 2L4BA 4NEOA 1ACPA 1M9EC 3G21A 2JBGA 5CZDB 5HVCA 2KGAA 2OTLP 4DGAC 1EMVA 3GZMA 2QA4P 4F37A 1KQSO 2GDYA 2Z44A 2WLVA 4U0AA 2X83A 4UHPB 5HV8A 4XROA 1DNYA 2KW2A 2L9FA 4PH1A 2FVFA 4J93A 2K94A 3LRYA 4PH2A 2MR7A 1ZMBA 2OARA 7CEIA 2M8NA 4PWVB 1VQMP 1EIAA 1M6EX 5F2KA 1KC8Q 1VQOP
chains in the Genus database with same CATH topology
3VRLC 2XGVA 5HGMA 1E6JP 2EFJA 1M9DC 2PY8A 1AFVA 2EIAA 2Y4ZA 3G1IA 4XFXA 1Q82Q 1Q86Q 3BP9A 3CCRP 5BS2A 1YI2P 1VQPP 4XFZA 3DS4A 1M9YC 4INBA 3HYBA 3G28A 3G26A 1EM9A 2V4XA 1VQ4P 4U0DA 4E92A 5HGOA 5HGLA 4DGEC 4COPA 3I56P 1QRJA 3CC7P 2X2DD 1YHQP 3WBHA 1N8RQ 3DPHA 5I4TG 3MGEA 3H4EA 3M1MA 1G03A 3G71P 3H0DA 2XV6A 1VQ7P 3CCEP 1RNIA 3H47A 4COCA 1M90Q 1S72P 3CMAP 3CCMP 3CC4P 2PEOA 3HZQA 3NTEA 1EOQA 2JYGA 2WLVB 1P7NA 2M8LA 1M74A 1L6NA 2EG5A 3CPWO 4B4NA 2PENA 4PH3A 1A43A 3CCUP 2GONA 3DS3A 3E2DA 5HGNA 1YJWP 1Q81Q 3DTJA 1K73Q 1NJIQ 4NX4C 3CD6P 2PWOA 4IPYA 1VQ9P 1U7KA 3DS2A 1YITP 2DGYA 2XGUA 2GOLB 2KODA 1Q7YQ 1VQNP 1K9MQ 1K30A 3CCQP 5F2NA 2XXMA 2ONTA 1VQ6P 4GR2A 5F2OA 1RO0A 1RO2A 2LF4A 1K8AQ 2XDEA 3CCVP 2OTJP 2JO0A 1IUQA 2PEKA 3G4SP 3CC2P 1M9XC 2BHVA 4LQWC 2BUOA 1M1KQ 1D1DA 1AK4C 1YJNP 1M9FC 2M8PA 1M9EC 2QEXP 3DS1A 3G21A 1M6NA 1KD1Q 2CWOA 2PWMA 2PEMA 3DS5A 3CCSP 1JJ2O 2OTLP 1VQLP 4GR6A 2XT1A 3RG6C 4DGAC 1AUMA 3DS0A 4U0CA 2PEIA 3P05A 2QA4P 2PXRC 1KQSO 1QVFO 4XRQA 2Z44A 5DCKA 4M0IA 2JPRA 2WLVA 3CCLP 4U0AA 2P9XA 1W2BO 3CMEP 2X83A 2PEJA 3G1GA 1QVGO 5JPAA 2XGYA 4XROA 4U0EA 4XFYA 2L6EA 2Z45A 3G0VA 4PH1A 3OW2O 2JYLA 1A8OA 2Z46A 2KGFA 3CXCO 4WYMA 1YJ9P 4J93A 4E91A 3CCJP 3G6EP 4HTWA 3LRYA 1YIJP 1VQ5P 5BS1A 4PH2A 1VQKP 1GWPA 4QNBA 5HGKA 2X82A 1ZMBA 2OARA 2PEQA 4U0FA 3I55P 4PH0A 2M8NA 1BAJA 3B5IA 3G29A 1M9CC 1VQMP 1EIAA 1M6EX 5F2KA 1KC8Q 1VQ8P 1VQOP 2E1MA 3Q20A 4U0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRL C;  2XGV A;  5HGM A;  1E6J P;  1M9D C;  1AFV A;  2EIA A;  2Y4Z A;  3G1I A;  4XFX A;  3BP9 A;  4XFZ A;  3DS4 A;  1M9Y C;  4INB A;  3G28 A;  3G26 A;  1EM9 A;  2V4X A;  4U0D A;  4E92 A;  5HGO A;  5HGL A;  4DGE C;  4COP A;  1QRJ A;  2X2D D;  3DPH A;  5I4T G;  3MGE A;  3H4E A;  1G03 A;  2XV6 A;  3H47 A;  4COC A;  3NTE A;  1EOQ A;  2JYG A;  2WLV B;  1P7N A;  2M8L A;  1L6N A;  4B4N A;  4PH3 A;  1A43 A;  2GON A;  3DS3 A;  5HGN A;  3DTJ A;  4NX4 C;  2PWO A;  4IPY A;  1U7K A;  3DS2 A;  2XGU A;  2GOL B;  2KOD A;  2XXM A;  2ONT A;  2LF4 A;  2XDE A;  2JO0 A;  1M9X C;  4LQW C;  2BUO A;  1D1D A;  1AK4 C;  1M9F C;  2M8P A;  1M9E C;  3DS1 A;  3G21 A;  2PWM A;  3DS5 A;  2XT1 A;  4DGA C;  1AUM A;  3DS0 A;  4U0C A;  3P05 A;  2PXR C;  4XRQ A;  5DCK A;  4M0I A;  2JPR A;  2WLV A;  4U0A A;  2X83 A;  3G1G A;  5JPA A;  2XGY A;  4XRO A;  4U0E A;  4XFY A;  2L6E A;  3G0V A;  4PH1 A;  2JYL A;  1A8O A;  2KGF A;  4WYM A;  4J93 A;  4E91 A;  4HTW A;  3LRY A;  4PH2 A;  1GWP A;  4QNB A;  5HGK A;  2X82 A;  4U0F A;  4PH0 A;  2M8N A;  1BAJ A;  3G29 A;  1M9C C;  1EIA A;  4U0B A; 
#chains in the Genus database with same CATH topology
 3G1I A;  4XFX A;  5BS2 A;  5KP6 B;  2DNW A;  2VLQ A;  2GZE A;  2LOL A;  2KOP A;  2LTE A;  2FAD A;  1QRJ A;  1YHQ P;  4DG9 A;  3M1M A;  2KG8 A;  3G71 P;  2VLO A;  1VQ7 P;  2KOO A;  4COC A;  1VKU A;  3CMA P;  3CCM P;  1KLP A;  1L6N A;  2FQ2 A;  2MD9 A;  2EG5 A;  3CPW O;  1GXG A;  1T8K A;  4PH3 A;  2MY5 A;  2LIW A;  2PWO A;  4IPY A;  2KG6 A;  3DS2 A;  2GOL B;  2GYK A;  3GZL A;  2GZI A;  1FR2 A;  1RO0 A;  1K8A Q;  1HQB A;  2XDE A;  2OTJ P;  2JO0 A;  4QKO A;  3G4S P;  2BHV A;  4LQW C;  1M1K Q;  2GZF A;  2LKI A;  1AK4 C;  2VLP A;  1YJN P;  4BPH A;  2FQ1 A;  5KP7 B;  3DS1 A;  1M6N A;  1UJZ A;  3DS5 A;  1JJ2 O;  2K5X A;  1MZ8 A;  3DS0 A;  3P05 A;  4M0I A;  2AFE A;  2FAE A;  2CGQ A;  2L6E A;  2N6Y A;  3OW2 O;  2KOS A;  4H2X C;  3G6E P;  2N6Z A;  4QNB A;  5HGK A;  2X82 A;  3I55 P;  3B5I A;  2X2B A;  2JQ4 A;  1VQ8 P;  1AYI A;  4U0B A;  3VRL C;  2PY8 A;  1Q82 Q;  1Q86 Q;  1E0H A;  2K2Q A;  4H2W C;  4MRT C;  4INB A;  3HYB A;  2LML A;  3G28 A;  2CNR A;  1VQ4 P;  4U0D A;  1BXI A;  5HGO A;  5HGL A;  3GJN A;  3MGE A;  2KR5 A;  1G03 A;  2VSQ A;  3H0D A;  2XZ1 C;  3CC4 P;  2PEO A;  3NTE A;  4HKG A;  1P7N A;  2AVA A;  2LIU A;  3CCU P;  1K73 Q;  3CD6 P;  2N5I A;  1VQ9 P;  3CE7 A;  4BPF A;  1YIT P;  2KOD A;  2K93 A;  1L0I A;  1K30 A;  3CCQ P;  5F2N A;  2ONT A;  3CCV P;  1M9X C;  2M8P A;  2N98 A;  2GZJ A;  2CWO A;  3EJE A;  3CCS P;  1VQL P;  4GR6 A;  3RG6 C;  2FHS C;  2KGC A;  5EW5 E;  1QVF O;  4XRQ A;  5DCK A;  2PNG A;  2XZ0 D;  2P9X A;  1W2B O;  3CME P;  2PEJ A;  1QVG O;  5JPA A;  2XGY A;  2K0Y A;  4U0E A;  2Z45 A;  1A8O A;  3B4Q A;  2KGF A;  4WYM A;  3CCJ P;  2MVV A;  4HTW A;  1VQ5 P;  5BS1 A;  1VQK P;  1GWP A;  2FQ0 A;  4U0F A;  4PH0 A;  1CEI A;  1M9C C;  3Q20 A;  2ROQ A;  1M9D C;  2Y4Z A;  4PXH B;  3CCR P;  2FVA A;  1YI2 P;  4XFZ A;  2KG9 A;  2JGP A;  3DS4 A;  2WPT A;  1EM9 A;  2GDX A;  5KP8 B;  2ERH A;  1X3O A;  4E92 A;  4COP A;  3I56 P;  3CC7 P;  2X2D D;  3WBH A;  1N8R Q;  3DPH A;  3H4E A;  2XV6 A;  3CCE P;  3H47 A;  1M90 Q;  1Z6M A;  1F80 D;  1OR5 A;  2JAZ A;  3HZQ A;  1EOQ A;  2FAC A;  2JYG A;  2QNW A;  1AF8 A;  1M74 A;  2CQ8 A;  2PEN A;  1A43 A;  3E2D A;  5HGN A;  1YJW P;  4R0M A;  1Q81 Q;  1GPJ A;  2XGU A;  1ZNV A;  2XXM A;  3LMO A;  1RO2 A;  2K0X A;  2K0D X;  2PEK A;  3EJB A;  3CC2 P;  3RG2 A;  1D1D A;  1NQ4 A;  3NY7 B;  1M9F C;  2CG5 B;  2QEX P;  1KD1 Q;  2LPK A;  2PWM A;  1VHN A;  2KOQ A;  2GDW A;  2PEM A;  2L0Q A;  2XT1 A;  2FVE A;  2GZG A;  1AUM A;  4U0C A;  4IZ6 A;  2PEI A;  2PXR C;  3CCL P;  2JPR A;  2N5H A;  3G1G A;  3EJD A;  4H2Y C;  2MVU A;  4XFY A;  3G0V A;  2K92 A;  2AFD A;  2JYL A;  2Z46 A;  2MR8 A;  3CXC O;  2EHT A;  2M5R A;  1YJ9 P;  4E91 A;  1HY8 A;  1UNK A;  2VLN A;  1YIJ P;  2PEQ A;  1BAJ A;  3G29 A;  5F2O A;  2E1M A;  2JU2 A;  2NO8 A;  2XGV A;  5HGM A;  1E6J P;  2EFJ A;  1GXH A;  1AFV A;  2AF8 A;  2EIA A;  2KGD A;  5EJD A;  2LL8 A;  3BP9 A;  2KWL A;  1L0H A;  1VQP P;  1M9Y C;  3G26 A;  4BPG A;  2V4X A;  1DV5 A;  2L22 A;  4DGE C;  2KOR A;  5I4T G;  4CA3 A;  1IMP A;  1RNI A;  1S72 P;  2WLV B;  2M8L A;  2KGE A;  3U43 A;  4B4N A;  2GON A;  3DS3 A;  1NJI Q;  3DTJ A;  3GKL C;  4NX4 C;  2JU1 A;  1U7K A;  2DGY A;  1Q7Y Q;  1VQN P;  1K9M Q;  2EHS A;  1VQ6 P;  4GR2 A;  2MF4 A;  1IMQ A;  2LF4 A;  1IUQ A;  2JB0 A;  2N50 A;  2BUO A;  2L4B A;  4NEO A;  1ACP A;  1M9E C;  3G21 A;  2JBG A;  5CZD B;  5HVC A;  2KGA A;  2OTL P;  4DGA C;  1EMV A;  3GZM A;  2QA4 P;  4F37 A;  1KQS O;  2GDY A;  2Z44 A;  2WLV A;  4U0A A;  2X83 A;  4UHP B;  5HV8 A;  4XRO A;  1DNY A;  2KW2 A;  2L9F A;  4PH1 A;  2FVF A;  4J93 A;  2K94 A;  3LRY A;  4PH2 A;  2MR7 A;  1ZMB A;  2OAR A;  7CEI A;  2M8N A;  4PWV B;  1VQM P;  1EIA A;  1M6E X;  5F2K A;  1KC8 Q;  1VQO P; 
#chains in the Genus database with same CATH homology
 3VRL C;  2XGV A;  5HGM A;  1E6J P;  2EFJ A;  1M9D C;  2PY8 A;  1AFV A;  2EIA A;  2Y4Z A;  3G1I A;  4XFX A;  1Q82 Q;  1Q86 Q;  3BP9 A;  3CCR P;  5BS2 A;  1YI2 P;  1VQP P;  4XFZ A;  3DS4 A;  1M9Y C;  4INB A;  3HYB A;  3G28 A;  3G26 A;  1EM9 A;  2V4X A;  1VQ4 P;  4U0D A;  4E92 A;  5HGO A;  5HGL A;  4DGE C;  4COP A;  3I56 P;  1QRJ A;  3CC7 P;  2X2D D;  1YHQ P;  3WBH A;  1N8R Q;  3DPH A;  5I4T G;  3MGE A;  3H4E A;  3M1M A;  1G03 A;  3G71 P;  3H0D A;  2XV6 A;  1VQ7 P;  3CCE P;  1RNI A;  3H47 A;  4COC A;  1M90 Q;  1S72 P;  3CMA P;  3CCM P;  3CC4 P;  2PEO A;  3HZQ A;  3NTE A;  1EOQ A;  2JYG A;  2WLV B;  1P7N A;  2M8L A;  1M74 A;  1L6N A;  2EG5 A;  3CPW O;  4B4N A;  2PEN A;  4PH3 A;  1A43 A;  3CCU P;  2GON A;  3DS3 A;  3E2D A;  5HGN A;  1YJW P;  1Q81 Q;  3DTJ A;  1K73 Q;  1NJI Q;  4NX4 C;  3CD6 P;  2PWO A;  4IPY A;  1VQ9 P;  1U7K A;  3DS2 A;  1YIT P;  2DGY A;  2XGU A;  2GOL B;  2KOD A;  1Q7Y Q;  1VQN P;  1K9M Q;  1K30 A;  3CCQ P;  5F2N A;  2XXM A;  2ONT A;  1VQ6 P;  4GR2 A;  5F2O A;  1RO0 A;  1RO2 A;  2LF4 A;  1K8A Q;  2XDE A;  3CCV P;  2OTJ P;  2JO0 A;  1IUQ A;  2PEK A;  3G4S P;  3CC2 P;  1M9X C;  2BHV A;  4LQW C;  2BUO A;  1M1K Q;  1D1D A;  1AK4 C;  1YJN P;  1M9F C;  2M8P A;  1M9E C;  2QEX P;  3DS1 A;  3G21 A;  1M6N A;  1KD1 Q;  2CWO A;  2PWM A;  2PEM A;  3DS5 A;  3CCS P;  1JJ2 O;  2OTL P;  1VQL P;  4GR6 A;  2XT1 A;  3RG6 C;  4DGA C;  1AUM A;  3DS0 A;  4U0C A;  2PEI A;  3P05 A;  2QA4 P;  2PXR C;  1KQS O;  1QVF O;  4XRQ A;  2Z44 A;  5DCK A;  4M0I A;  2JPR A;  2WLV A;  3CCL P;  4U0A A;  2P9X A;  1W2B O;  3CME P;  2X83 A;  2PEJ A;  3G1G A;  1QVG O;  5JPA A;  2XGY A;  4XRO A;  4U0E A;  4XFY A;  2L6E A;  2Z45 A;  3G0V A;  4PH1 A;  3OW2 O;  2JYL A;  1A8O A;  2Z46 A;  2KGF A;  3CXC O;  4WYM A;  1YJ9 P;  4J93 A;  4E91 A;  3CCJ P;  3G6E P;  4HTW A;  3LRY A;  1YIJ P;  1VQ5 P;  5BS1 A;  4PH2 A;  1VQK P;  1GWP A;  4QNB A;  5HGK A;  2X82 A;  1ZMB A;  2OAR A;  2PEQ A;  4U0F A;  3I55 P;  4PH0 A;  2M8N A;  1BAJ A;  3B5I A;  3G29 A;  1M9C C;  1VQM P;  1EIA A;  1M6E X;  5F2K A;  1KC8 Q;  1VQ8 P;  1VQO P;  2E1M A;  3Q20 A;  4U0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...