4PH0A

Capsid protein from bovine leukemia virus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
206
structure length
201
Chain Sequence
PIISEGNRNRHRAWALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSLTAAIAAAEAANTLQGFNPQNGTLTQQSAQPNAGDLRSQYQNLWLQAWKNLPTPWSTIVQGPAESYVEFVNRLQISLADNLPDGVPKEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQACAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
molecule keywords BLV capsid
total genus 68
structure length 201
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4ph0A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ph0A02
1M9XC 2KGFA 2X2DD 4INBA 2ONTA 4E92A 1G03A 3DS1A 5HGOA 4U0DA 4U0BA 1M9CC 5HGKA 2WLVB 2LF4A 2V4XA 4XFXA 4NX4C 2PWOA 5DCKA 3G26A 2KODA 4J93A 3DS3A 3VRLC 2JO0A 2L6EA 2XGUA 1M9DC 2X83A 2GONA 4LQWC 3DS0A 1A43A 2X82A 1U7KA 1EM9A 5JPAA 3DS5A 4DGEC 4M0IA 1EOQA 4PH3A 1L6NA 3DTJA 3MGEA 2PXRC 2EIAA 1AK4C 3G1IA 2XXMA 2JYLA 3DS2A 2WLVA 4PH2A 2XT1A 2XV6A 2XDEA 1EIAA 3H47A 5HGLA 1M9YC 1AUMA 1P7NA 2XGYA 2BUOA 1D1DA 4B4NA 4XRQA 1BAJA 3DPHA 4IPYA 3G1GA 4PH0A 2GOLB 2Y4ZA 1E6JP 5I4TG 3G21A 2JPRA 4XROA 2XGVA 3G0VA 4DGAC 1QRJA 3DS4A 2M8PA 3G29A 1AFVA 4XFZA 4E91A 3BP9A 5HGNA 1GWPA 4WYMA 2M8NA 4U0AA 3NTEA 2M8LA 2JYGA 4COCA 4U0CA 1M9FC 3LRYA 1A8OA 3H4EA 4U0EA 2PWMA 3P05A 4HTWA 4QNBA 4U0FA 1M9EC 5HGMA 3G28A 4XFYA 4PH1A 4COPA
chains in the Genus database with same CATH superfamily
2X2DD 3CCQP 2MR8A 4E92A 3CC7P 1M9CC 2LF4A 4XFXA 2M5RA 3CMEP 3G26A 2PEKA 3CD6P 3DS3A 2QEXP 2PEIA 3CCUP 2L6EA 3CCMP 1VQLP 2PNGA 1K73Q 1L0HA 2P9XA 1VQPP 1A43A 1U7KA 4BPFA 1IMQA 2AVAA 4M0IA 2AFDA 1L6NA 3DTJA 3MGEA 2FVEA 2PENA 2XXMA 2KGEA 2XZ0D 4DG9A 5HVCA 2LKIA 1M9YC 3CPWO 2JB0A 2NO8A 1N8RQ 2K5XA 3CCEP 3CCVP 1BAJA 1M1KQ 1YI2P 4IPYA 5KP6B 2LTEA 4PH0A 2Y4ZA 2Z46A 3G21A 2JPRA 2EG5A 2Z45A 3WBHA 4DGAC 1YJNP 2LOLA 3G29A 2FAEA 3CE7A 2AFEA 1S72P 2K0YA 4NEOA 5HGNA 3HZQA 4MRTC 2KOOA 4H2XC 3RG6C 2M8LA 2PY8A 1QVGO 4COCA 1CEIA 1W2BO 1M9FC 1ACPA 1AYIA 1GXGA 1VQOP 4QNBA 1BXIA 2DNWA 4U0FA 2CQ8A 2KORA 2CNRA 5F2OA 1IUQA 2EHSA 4R0MA 3GZMA 1M90Q 1IMPA 1AF8A 1VKUA 1M9XC 3I56P 3M1MA 2GZEA 1VQKP 4F37A 1X3OA 2L22A 2JU1A 2L9FA 5HGOA 4U0BA 3DS1A 4BPGA 2AF8A 1Q86Q 2X2BA 2PWOA 2XZ1C 5DCKA 1M6NA 2ROQA 2KODA 1M74A 4BPHA 3VRLC 2JAZA 5EJDA 2X82A 1EM9A 2N98A 3LMOA 3CCLP 3DS5A 2CG5B 1EOQA 4PH3A 3H0DA 2OARA 2EIAA 3G1IA 4H2YC 3OW2O 4IZ6A 4GR2A 3CCJP 2JYLA 3DS2A 2XT1A 3GKLC 2LPKA 1Q82Q 5F2KA 2GZIA 1EIAA 3G71P 1DNYA 3GZLA 2CGQA 4CA3A 2BUOA 1YJ9P 3E2DA 2VSQA 3CC4P 4XRQA 2K93A 4PWVB 3DPHA 5KP7B 5I4TG 1JJ2O 2XGVA 2FQ1A 2FQ2A 1ZNVA 1QRJA 3DS4A 2M8PA 1AFVA 4H2WC 3BP9A 3B4QA 4WYMA 1RO0A 3NTEA 3U43A 2KOSA 4U0CA 2EHTA 1A8OA 4U0EA 3G6EP 2PWMA 1HQBA 4PXHB 1M9EC 2GZFA 1Z6MA 3B5IA 3G28A 5BS2A 1QVFO 4PH1A 1KQSO 3EJBA 2EFJA 1F80D 2PEQA 2FVAA 1NQ4A 4U0DA 2QNWA 1VHNA 2WLVB 2V4XA 4HKGA 3EJEA 3EJDA 3CCRP 1ZMBA 4NX4C 3CMAP 5KP8B 1K9MQ 1EMVA 1VQ8P 4LQWC 3DS0A 2L0QA 2LIWA 2N50A 2FQ0A 2KOQA 2MD9A 2N5HA 2KWLA 2VLNA 2N5IA 1AK4C 1YIJP 5HV8A 1FR2A 4PH2A 2LIUA 2KGDA 3Q20A 5EW5E 3CXCO 5HGLA 1OR5A 1YITP 1D1DA 1KC8Q 2MVVA 1VQNP 2K0XA 2KG9A 2JBGA 2JGPA 2PEMA 1RO2A 2GOLB 4XROA 5BS1A 2GDWA 1KD1Q 2VLPA 1GPJA 2K92A 1M6EX 4XFZA 1VQ7P 1MZ8A 2PEOA 2OTLP 4E91A 2FHSC 1GWPA 1GXHA 2GYKA 1RNIA 2ERHA 2M8NA 4U0AA 2GDYA 2JYGA 2PEJA 2DGYA 2GDXA 3LRYA 2MY5A 2N6ZA 3P05A 1VQ5P 2BHVA 5HGMA 2MF4A 1VQ4P 4XFYA 2GZJA 1VQ9P 2FACA 2KGCA 2KGFA 2OTJP 4INBA 2JU2A 2ONTA 1K8AQ 1G03A 2QA4P 5HGKA 2KGAA 2LMLA 1YJWP 1VQ6P 4J93A 2KG8A 2JO0A 2XGUA 1M9DC 2X83A 3I55P 2GONA 1UNKA 7CEIA 5JPAA 2K0DX 2K94A 4DGEC 2LL8A 1Q7YQ 2PXRC 1K30A 2Z44A 5CZDB 2WLVA 2KG6A 3CCSP 2KR5A 2XV6A 1L0IA 2XDEA 1YHQP 2N6YA 3H47A 3HYBA 1AUMA 1P7NA 2XGYA 2KW2A 1Q81Q 2FVFA 4B4NA 1E0HA 1UJZA 2KOPA 3NY7B 2K2QA 2FADA 2GZGA 1DV5A 3G4SP 3G1GA 1E6JP 2L4BA 3G0VA 5F2NA 2JQ4A 3GJNA 2CWOA 1KLPA 4UHPB 4GR6A 1HY8A 2VLQA 1VQMP 2E1MA 3CC2P 1T8KA 3H4EA 4QKOA 2VLOA 4HTWA 3RG2A 2MVUA 2WPTA 2MR7A 1NJIQ 4COPA
chains in the Genus database with same CATH topology
1KQSO 1M9XC 2KGFA 2EFJA 3I56P 3M1MA 2X2DD 4INBA 2ONTA 3CCQP 1VQKP 2OTJP 4E92A 2PEQA 1G03A 1K8AQ 3DS1A 5HGOA 4U0DA 4U0BA 2QA4P 3CC7P 1M9CC 5HGKA 2WLVB 2LF4A 2V4XA 4XFXA 1Q86Q 3CMEP 3CCRP 1ZMBA 4NX4C 2PWOA 5DCKA 1YJWP 1VQ6P 1M6NA 3G26A 3CMAP 2PEKA 2KODA 1M74A 3CD6P 4J93A 3DS3A 2QEXP 3VRLC 2JO0A 2PEIA 3CCUP 2L6EA 1K9MQ 3CCMP 1VQ8P 2XGUA 1VQLP 1M9DC 2X83A 3I55P 2GONA 4LQWC 3DS0A 1K73Q 2P9XA 1VQPP 1A43A 2X82A 1U7KA 1EM9A 5JPAA 3CCLP 3DS5A 4DGEC 4M0IA 1EOQA 4PH3A 1L6NA 1Q7YQ 3DTJA 3MGEA 2PXRC 1K30A 2Z44A 3H0DA 2OARA 2EIAA 1AK4C 3G1IA 2PENA 3OW2O 2XXMA 4GR2A 3CCJP 1YIJP 2JYLA 3DS2A 2WLVA 4PH2A 3CCSP 2XT1A 2XV6A 3Q20A 1Q82Q 2XDEA 5F2KA 1EIAA 3G71P 1YHQP 3H47A 3CXCO 5HGLA 1M9YC 3HYBA 1AUMA 3CPWO 1P7NA 1YITP 2XGYA 1Q81Q 2BUOA 1D1DA 1KC8Q 1YJ9P 1N8RQ 3E2DA 4B4NA 3CCEP 3CC4P 1VQNP 4XRQA 3CCVP 2PEMA 1BAJA 3DPHA 1YI2P 1M1KQ 1RO2A 4IPYA 3G4SP 3G1GA 4PH0A 2GOLB 2Y4ZA 1E6JP 2Z46A 5I4TG 3G21A 2JPRA 4XROA 2EG5A 1JJ2O 2XGVA 3G0VA 5BS1A 2Z45A 5F2NA 3WBHA 4DGAC 1YJNP 1KD1Q 1QRJA 3DS4A 2M8PA 3G29A 1AFVA 1S72P 1M6EX 4XFZA 1VQ7P 2CWOA 2PEOA 2OTLP 4E91A 3BP9A 5HGNA 3HZQA 1GWPA 3RG6C 4WYMA 1RNIA 1RO0A 2M8NA 4U0AA 3NTEA 2M8LA 2PY8A 4GR6A 2JYGA 1QVGO 4COCA 1VQMP 2PEJA 1W2BO 2DGYA 2E1MA 3CC2P 4U0CA 1M9FC 3LRYA 1A8OA 3H4EA 4U0EA 3G6EP 2PWMA 3P05A 4HTWA 1VQ5P 2BHVA 1VQOP 4QNBA 4U0FA 1M9EC 5HGMA 1VQ4P 3B5IA 5F2OA 1IUQA 3G28A 5BS2A 1NJIQ 4XFYA 1QVFO 4PH1A 1M90Q 4COPA 1VQ9P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9X C;  2KGF A;  2X2D D;  4INB A;  2ONT A;  4E92 A;  1G03 A;  3DS1 A;  5HGO A;  4U0D A;  4U0B A;  1M9C C;  5HGK A;  2WLV B;  2LF4 A;  2V4X A;  4XFX A;  4NX4 C;  2PWO A;  5DCK A;  3G26 A;  2KOD A;  4J93 A;  3DS3 A;  3VRL C;  2JO0 A;  2L6E A;  2XGU A;  1M9D C;  2X83 A;  2GON A;  4LQW C;  3DS0 A;  1A43 A;  2X82 A;  1U7K A;  1EM9 A;  5JPA A;  3DS5 A;  4DGE C;  4M0I A;  1EOQ A;  4PH3 A;  1L6N A;  3DTJ A;  3MGE A;  2PXR C;  2EIA A;  1AK4 C;  3G1I A;  2XXM A;  2JYL A;  3DS2 A;  2WLV A;  4PH2 A;  2XT1 A;  2XV6 A;  2XDE A;  1EIA A;  3H47 A;  5HGL A;  1M9Y C;  1AUM A;  1P7N A;  2XGY A;  2BUO A;  1D1D A;  4B4N A;  4XRQ A;  1BAJ A;  3DPH A;  4IPY A;  3G1G A;  4PH0 A;  2GOL B;  2Y4Z A;  1E6J P;  5I4T G;  3G21 A;  2JPR A;  4XRO A;  2XGV A;  3G0V A;  4DGA C;  1QRJ A;  3DS4 A;  2M8P A;  3G29 A;  1AFV A;  4XFZ A;  4E91 A;  3BP9 A;  5HGN A;  1GWP A;  4WYM A;  2M8N A;  4U0A A;  3NTE A;  2M8L A;  2JYG A;  4COC A;  4U0C A;  1M9F C;  3LRY A;  1A8O A;  3H4E A;  4U0E A;  2PWM A;  3P05 A;  4HTW A;  4QNB A;  4U0F A;  1M9E C;  5HGM A;  3G28 A;  4XFY A;  4PH1 A;  4COP A; 
#chains in the Genus database with same CATH topology
 2X2D D;  3CCQ P;  2MR8 A;  4E92 A;  3CC7 P;  1M9C C;  2LF4 A;  4XFX A;  2M5R A;  3CME P;  3G26 A;  2PEK A;  3CD6 P;  3DS3 A;  2QEX P;  2PEI A;  3CCU P;  2L6E A;  3CCM P;  1VQL P;  2PNG A;  1K73 Q;  1L0H A;  2P9X A;  1VQP P;  1A43 A;  1U7K A;  4BPF A;  1IMQ A;  2AVA A;  4M0I A;  2AFD A;  1L6N A;  3DTJ A;  3MGE A;  2FVE A;  2PEN A;  2XXM A;  2KGE A;  2XZ0 D;  4DG9 A;  5HVC A;  2LKI A;  1M9Y C;  3CPW O;  2JB0 A;  2NO8 A;  1N8R Q;  2K5X A;  3CCE P;  3CCV P;  1BAJ A;  1M1K Q;  1YI2 P;  4IPY A;  5KP6 B;  2LTE A;  4PH0 A;  2Y4Z A;  2Z46 A;  3G21 A;  2JPR A;  2EG5 A;  2Z45 A;  3WBH A;  4DGA C;  1YJN P;  2LOL A;  3G29 A;  2FAE A;  3CE7 A;  2AFE A;  1S72 P;  2K0Y A;  4NEO A;  5HGN A;  3HZQ A;  4MRT C;  2KOO A;  4H2X C;  3RG6 C;  2M8L A;  2PY8 A;  1QVG O;  4COC A;  1CEI A;  1W2B O;  1M9F C;  1ACP A;  1AYI A;  1GXG A;  1VQO P;  4QNB A;  1BXI A;  2DNW A;  4U0F A;  2CQ8 A;  2KOR A;  2CNR A;  5F2O A;  1IUQ A;  2EHS A;  4R0M A;  3GZM A;  1M90 Q;  1IMP A;  1AF8 A;  1VKU A;  1M9X C;  3I56 P;  3M1M A;  2GZE A;  1VQK P;  4F37 A;  1X3O A;  2L22 A;  2JU1 A;  2L9F A;  5HGO A;  4U0B A;  3DS1 A;  4BPG A;  2AF8 A;  1Q86 Q;  2X2B A;  2PWO A;  2XZ1 C;  5DCK A;  1M6N A;  2ROQ A;  2KOD A;  1M74 A;  4BPH A;  3VRL C;  2JAZ A;  5EJD A;  2X82 A;  1EM9 A;  2N98 A;  3LMO A;  3CCL P;  3DS5 A;  2CG5 B;  1EOQ A;  4PH3 A;  3H0D A;  2OAR A;  2EIA A;  3G1I A;  4H2Y C;  3OW2 O;  4IZ6 A;  4GR2 A;  3CCJ P;  2JYL A;  3DS2 A;  2XT1 A;  3GKL C;  2LPK A;  1Q82 Q;  5F2K A;  2GZI A;  1EIA A;  3G71 P;  1DNY A;  3GZL A;  2CGQ A;  4CA3 A;  2BUO A;  1YJ9 P;  3E2D A;  2VSQ A;  3CC4 P;  4XRQ A;  2K93 A;  4PWV B;  3DPH A;  5KP7 B;  5I4T G;  1JJ2 O;  2XGV A;  2FQ1 A;  2FQ2 A;  1ZNV A;  1QRJ A;  3DS4 A;  2M8P A;  1AFV A;  4H2W C;  3BP9 A;  3B4Q A;  4WYM A;  1RO0 A;  3NTE A;  3U43 A;  2KOS A;  4U0C A;  2EHT A;  1A8O A;  4U0E A;  3G6E P;  2PWM A;  1HQB A;  4PXH B;  1M9E C;  2GZF A;  1Z6M A;  3B5I A;  3G28 A;  5BS2 A;  1QVF O;  4PH1 A;  1KQS O;  3EJB A;  2EFJ A;  1F80 D;  2PEQ A;  2FVA A;  1NQ4 A;  4U0D A;  2QNW A;  1VHN A;  2WLV B;  2V4X A;  4HKG A;  3EJE A;  3EJD A;  3CCR P;  1ZMB A;  4NX4 C;  3CMA P;  5KP8 B;  1K9M Q;  1EMV A;  1VQ8 P;  4LQW C;  3DS0 A;  2L0Q A;  2LIW A;  2N50 A;  2FQ0 A;  2KOQ A;  2MD9 A;  2N5H A;  2KWL A;  2VLN A;  2N5I A;  1AK4 C;  1YIJ P;  5HV8 A;  1FR2 A;  4PH2 A;  2LIU A;  2KGD A;  3Q20 A;  5EW5 E;  3CXC O;  5HGL A;  1OR5 A;  1YIT P;  1D1D A;  1KC8 Q;  2MVV A;  1VQN P;  2K0X A;  2KG9 A;  2JBG A;  2JGP A;  2PEM A;  1RO2 A;  2GOL B;  4XRO A;  5BS1 A;  2GDW A;  1KD1 Q;  2VLP A;  1GPJ A;  2K92 A;  1M6E X;  4XFZ A;  1VQ7 P;  1MZ8 A;  2PEO A;  2OTL P;  4E91 A;  2FHS C;  1GWP A;  1GXH A;  2GYK A;  1RNI A;  2ERH A;  2M8N A;  4U0A A;  2GDY A;  2JYG A;  2PEJ A;  2DGY A;  2GDX A;  3LRY A;  2MY5 A;  2N6Z A;  3P05 A;  1VQ5 P;  2BHV A;  5HGM A;  2MF4 A;  1VQ4 P;  4XFY A;  2GZJ A;  1VQ9 P;  2FAC A;  2KGC A;  2KGF A;  2OTJ P;  4INB A;  2JU2 A;  2ONT A;  1K8A Q;  1G03 A;  2QA4 P;  5HGK A;  2KGA A;  2LML A;  1YJW P;  1VQ6 P;  4J93 A;  2KG8 A;  2JO0 A;  2XGU A;  1M9D C;  2X83 A;  3I55 P;  2GON A;  1UNK A;  7CEI A;  5JPA A;  2K0D X;  2K94 A;  4DGE C;  2LL8 A;  1Q7Y Q;  2PXR C;  1K30 A;  2Z44 A;  5CZD B;  2WLV A;  2KG6 A;  3CCS P;  2KR5 A;  2XV6 A;  1L0I A;  2XDE A;  1YHQ P;  2N6Y A;  3H47 A;  3HYB A;  1AUM A;  1P7N A;  2XGY A;  2KW2 A;  1Q81 Q;  2FVF A;  4B4N A;  1E0H A;  1UJZ A;  2KOP A;  3NY7 B;  2K2Q A;  2FAD A;  2GZG A;  1DV5 A;  3G4S P;  3G1G A;  1E6J P;  2L4B A;  3G0V A;  5F2N A;  2JQ4 A;  3GJN A;  2CWO A;  1KLP A;  4UHP B;  4GR6 A;  1HY8 A;  2VLQ A;  1VQM P;  2E1M A;  3CC2 P;  1T8K A;  3H4E A;  4QKO A;  2VLO A;  4HTW A;  3RG2 A;  2MVU A;  2WPT A;  2MR7 A;  1NJI Q;  4COP A; 
#chains in the Genus database with same CATH homology
 1KQS O;  1M9X C;  2KGF A;  2EFJ A;  3I56 P;  3M1M A;  2X2D D;  4INB A;  2ONT A;  3CCQ P;  1VQK P;  2OTJ P;  4E92 A;  2PEQ A;  1G03 A;  1K8A Q;  3DS1 A;  5HGO A;  4U0D A;  4U0B A;  2QA4 P;  3CC7 P;  1M9C C;  5HGK A;  2WLV B;  2LF4 A;  2V4X A;  4XFX A;  1Q86 Q;  3CME P;  3CCR P;  1ZMB A;  4NX4 C;  2PWO A;  5DCK A;  1YJW P;  1VQ6 P;  1M6N A;  3G26 A;  3CMA P;  2PEK A;  2KOD A;  1M74 A;  3CD6 P;  4J93 A;  3DS3 A;  2QEX P;  3VRL C;  2JO0 A;  2PEI A;  3CCU P;  2L6E A;  1K9M Q;  3CCM P;  1VQ8 P;  2XGU A;  1VQL P;  1M9D C;  2X83 A;  3I55 P;  2GON A;  4LQW C;  3DS0 A;  1K73 Q;  2P9X A;  1VQP P;  1A43 A;  2X82 A;  1U7K A;  1EM9 A;  5JPA A;  3CCL P;  3DS5 A;  4DGE C;  4M0I A;  1EOQ A;  4PH3 A;  1L6N A;  1Q7Y Q;  3DTJ A;  3MGE A;  2PXR C;  1K30 A;  2Z44 A;  3H0D A;  2OAR A;  2EIA A;  1AK4 C;  3G1I A;  2PEN A;  3OW2 O;  2XXM A;  4GR2 A;  3CCJ P;  1YIJ P;  2JYL A;  3DS2 A;  2WLV A;  4PH2 A;  3CCS P;  2XT1 A;  2XV6 A;  3Q20 A;  1Q82 Q;  2XDE A;  5F2K A;  1EIA A;  3G71 P;  1YHQ P;  3H47 A;  3CXC O;  5HGL A;  1M9Y C;  3HYB A;  1AUM A;  3CPW O;  1P7N A;  1YIT P;  2XGY A;  1Q81 Q;  2BUO A;  1D1D A;  1KC8 Q;  1YJ9 P;  1N8R Q;  3E2D A;  4B4N A;  3CCE P;  3CC4 P;  1VQN P;  4XRQ A;  3CCV P;  2PEM A;  1BAJ A;  3DPH A;  1YI2 P;  1M1K Q;  1RO2 A;  4IPY A;  3G4S P;  3G1G A;  4PH0 A;  2GOL B;  2Y4Z A;  1E6J P;  2Z46 A;  5I4T G;  3G21 A;  2JPR A;  4XRO A;  2EG5 A;  1JJ2 O;  2XGV A;  3G0V A;  5BS1 A;  2Z45 A;  5F2N A;  3WBH A;  4DGA C;  1YJN P;  1KD1 Q;  1QRJ A;  3DS4 A;  2M8P A;  3G29 A;  1AFV A;  1S72 P;  1M6E X;  4XFZ A;  1VQ7 P;  2CWO A;  2PEO A;  2OTL P;  4E91 A;  3BP9 A;  5HGN A;  3HZQ A;  1GWP A;  3RG6 C;  4WYM A;  1RNI A;  1RO0 A;  2M8N A;  4U0A A;  3NTE A;  2M8L A;  2PY8 A;  4GR6 A;  2JYG A;  1QVG O;  4COC A;  1VQM P;  2PEJ A;  1W2B O;  2DGY A;  2E1M A;  3CC2 P;  4U0C A;  1M9F C;  3LRY A;  1A8O A;  3H4E A;  4U0E A;  3G6E P;  2PWM A;  3P05 A;  4HTW A;  1VQ5 P;  2BHV A;  1VQO P;  4QNB A;  4U0F A;  1M9E C;  5HGM A;  1VQ4 P;  3B5I A;  5F2O A;  1IUQ A;  3G28 A;  5BS2 A;  1NJI Q;  4XFY A;  1QVF O;  4PH1 A;  1M90 Q;  4COP A;  1VQ9 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...