4PH0A

Capsid protein from bovine leukemia virus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
206
structure length
201
Chain Sequence
PIISEGNRNRHRAWALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSLTAAIAAAEAANTLQGFNPQNGTLTQQSAQPNAGDLRSQYQNLWLQAWKNLPTPWSTIVQGPAESYVEFVNRLQISLADNLPDGVPKEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQACAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLV capsid
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
total genus 68
structure length 201
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4ph0A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ph0A02
4WYMA 2JYGA 3LRYA 1M9EC 2XT1A 1E6JP 4U0DA 4U0EA 4PH1A 2X83A 1A43A 2X82A 4PH0A 3G0VA 4J93A 2ONTA 4XFXA 1EOQA 4HTWA 3BP9A 1GWPA 2XV6A 2BUOA 2LF4A 4U0FA 2JO0A 2PXRC 2JPRA 2M8PA 4IPYA 4E91A 1A8OA 3G29A 5HGOA 5HGLA 4PH3A 2XGUA 3DS3A 3DS1A 4M0IA 2XDEA 4XRQA 1QRJA 2PWOA 4XROA 2GONA 1D1DA 5HGKA 3DS2A 3P05A 2M8NA 2WLVA 3NTEA 2X2DD 1M9XC 4NX4C 4B4NA 1BAJA 3G28A 4COPA 1M9DC 3G21A 3DS4A 1L6NA 4PH2A 4XFYA 5I4TG 3G1IA 5HGMA 5JPAA 2V4XA 3H4EA 4U0AA 3DS0A 1U7KA 1M9CC 3MGEA 2M8LA 1EIAA 3G26A 2PWMA 2XXMA 4DGAC 3DTJA 1M9YC 1P7NA 1EM9A 2Y4ZA 2XGVA 2XGYA 4QNBA 4U0CA 2GOLB 4DGEC 2WLVB 3DS5A 2L6EA 4INBA 4LQWC 4U0BA 4E92A 3G1GA 4COCA 1AK4C 1AUMA 2JYLA 3DPHA 4XFZA 2EIAA 3VRLC 2KGFA 2KODA 1AFVA 1G03A 5DCKA 1M9FC 5HGNA 3H47A
chains in the Genus database with same CATH superfamily
2JAZA 3LRYA 1M9EC 2KORA 2LOLA 4PH1A 5CZDB 1GXGA 4PH0A 1ZMBA 1K73Q 2K0DX 4XFXA 3GZLA 2QNWA 2LF4A 2ERHA 1N8RQ 2JO0A 2JPRA 1NQ4A 3CCEP 1A8OA 2X2BA 1GPJA 1YJWP 1VQPP 4PH3A 3DS3A 1Q81Q 2FACA 2N5IA 2KOSA 5HGKA 2KGCA 1F80D 1VKUA 3CCMP 1DNYA 5KP8B 2Z45A 2DGYA 1AF8A 2FHSC 1NJIQ 2PEJA 2JGPA 3G28A 2M5RA 4MRTC 2VLPA 2JU2A 1CEIA 3DS4A 2AFDA 3B4QA 4PH2A 5I4TG 3I55P 3CMEP 2KOOA 3H4EA 1ZNVA 3E2DA 3MGEA 2L22A 4PXHB 1EIAA 2VLNA 3WBHA 2LMLA 2Y4ZA 2AFEA 2K5XA 2XGYA 2GZIA 4GR2A 1L0IA 4U0CA 3DS5A 4INBA 3G1GA 4E92A 4COCA 4XFZA 1AFVA 1G03A 5DCKA 1VQ6P 3CPWO 3CCVP 2XT1A 3G4SP 2FVFA 2MVUA 1IMQA 2ROQA 3HZQA 3EJBA 1VQ7P 2GYKA 1M74A 2MR7A 2X82A 1W2BO 4QKOA 4HTWA 3CCRP 2JQ4A 1VHNA 1RO0A 2GDXA 2MVVA 4H2XC 2K94A 5HGOA 5HGLA 2LIWA 3CMAP 2KGEA 1KC8Q 2XDEA 4XRQA 5F2NA 3CE7A 2WPTA 2XZ0D 2VSQA 2K0YA 1S72P 2JU1A 2LKIA 5EJDA 2N6ZA 2X2DD 1M9XC 2N98A 1L0HA 2GDWA 1BAJA 1UNKA 4COPA 1FR2A 1BXIA 1OR5A 2PEKA 1K8AQ 1M1KQ 1YI2P 3U43A 1L6NA 1Q82Q 2AF8A 5HGMA 2Z46A 2QEXP 5JPAA 2PEOA 2MY5A 2PY8A 4U0AA 3CC2P 1M9CC 2M8LA 2LPKA 1AYIA 1VQNP 3CCUP 2XXMA 4PWVB 1X3OA 1VQ5P 3LMOA 1M9YC 2CQ8A 2MF4A 4H2WC 2K93A 5BS2A 3CXCO 2LIUA 2N50A 3G71P 1VQMP 2GOLB 2PEIA 4HKGA 2WLVB 1IUQA 1YJNP 2FAEA 2JYLA 3CCQP 2EIAA 1M6EX 2KGFA 2PNGA 2Z44A 3EJDA 4DG9A 1E0HA 3H47A 2PENA 2XZ1C 2JYGA 2FQ2A 1Q7YQ 1E6JP 3CCLP 3B5IA 2MD9A 5KP7B 2CG5B 1K30A 4UHPB 2ONTA 3BP9A 2OTJP 1GWPA 2CGQA 2BUOA 2KWLA 4U0FA 3GJNA 2PXRC 2K0XA 2K2QA 2FQ0A 7CEIA 3G29A 5F2OA 3RG2A 4F37A 2PEQA 3DS1A 1RO2A 2KGDA 4XROA 1ACPA 2L9FA 2GZGA 1MZ8A 2N6YA 2M8NA 1M90Q 1KD1Q 2QA4P 4NX4C 3GKLC 2GZFA 3GZMA 4IZ6A 4H2YC 4B4NA 1M9DC 2CNRA 2FVEA 1YIJP 2V4XA 3NY7B 2FQ1A 4GR6A 2N5HA 4BPGA 2VLOA 2PWMA 1P7NA 1HY8A 2GZJA 4QNBA 1KLPA 2CWOA 4DGEC 2FVAA 2L6EA 3CD6P 2KG6A 2KG8A 3DPHA 5F2KA 2KW2A 1M9FC 5HGNA 1GXHA 1YHQP 2L0QA 1KQSO 4WYMA 2DNWA 2EG5A 3HYBA 4CA3A 4U0DA 1VQ9P 1Z6MA 4U0EA 5KP6B 1VQ8P 2FADA 2X83A 1A43A 4BPFA 3H0DA 4BPHA 3G0VA 1VQLP 4J93A 3I56P 1EOQA 2LTEA 1Q86Q 3CC4P 2VLQA 2XV6A 1VQOP 1DV5A 2LL8A 1QVFO 2PEMA 2M8PA 4IPYA 4E91A 2E1MA 1K9MQ 1YJ9P 3CCJP 3EJEA 2GZEA 3G6EP 1UJZA 2P9XA 2XGUA 1VQKP 3CC7P 4M0IA 3Q20A 5BS1A 2OARA 1QRJA 2PWOA 2GONA 1D1DA 1VQ4P 3DS2A 3P05A 2OTLP 2WLVA 3NTEA 3M1MA 2EHTA 3G21A 2JB0A 3OW2O 2KG9A 2JBGA 5HV8A 4XFYA 2EHSA 5HVCA 3G1IA 2GDYA 3RG6C 3DS0A 2BHVA 4NEOA 1U7KA 1EMVA 2KOPA 1RNIA 2MR8A 1T8KA 3G26A 5EW5E 1QVGO 4DGAC 2KOQA 3DTJA 3CCSP 1M6NA 1EM9A 2XGVA 2NO8A 2KGAA 4LQWC 4U0BA 1HQBA 1YITP 1AK4C 1AUMA 2KR5A 2K92A 1JJ2O 3VRLC 2KODA 2EFJA 2L4BA 2AVAA 4R0MA 1IMPA
chains in the Genus database with same CATH topology
4WYMA 2JYGA 2EG5A 3LRYA 1M9EC 2XT1A 3G4SP 3CD6P 1Q7YQ 3HYBA 1E6JP 4U0DA 1VQ9P 3HZQA 1VQ7P 4U0EA 4PH1A 3CCLP 1VQ8P 3B5IA 2X83A 1A43A 1M74A 2X82A 1K30A 3H0DA 1W2BO 4PH0A 1ZMBA 3G0VA 1K73Q 1VQLP 4J93A 2ONTA 4XFXA 3I56P 1EOQA 4HTWA 1Q86Q 3BP9A 3CCRP 3CC4P 2OTJP 1GWPA 2XV6A 2BUOA 1VQOP 2LF4A 4U0FA 1RO0A 1QVFO 2PEMA 1N8RQ 2JO0A 2PXRC 2JPRA 2M8PA 4IPYA 4E91A 2E1MA 1K9MQ 3CCEP 1A8OA 3G29A 5HGOA 3CCJP 5F2OA 1YJ9P 5HGLA 3G6EP 1YJWP 1VQPP 2P9XA 4PH3A 2XGUA 2PEQA 3DS3A 3CMAP 1Q81Q 1VQKP 3DS1A 3CC7P 4M0IA 3Q20A 5BS1A 1RO2A 2XDEA 2OARA 1KC8Q 4XRQA 1QRJA 2PWOA 4XROA 5F2NA 2GONA 1D1DA 1VQ4P 5HGKA 1S72P 3DS2A 3P05A 2OTLP 2M8NA 1M90Q 1KD1Q 2WLVA 3CCMP 2QA4P 3NTEA 2X2DD 2Z45A 3M1MA 2DGYA 1M9XC 4NX4C 1NJIQ 2PEJA 4B4NA 1BAJA 3G28A 4COPA 1M9DC 3G21A 3OW2O 2PEKA 1K8AQ 3DS4A 1M1KQ 1YI2P 1L6NA 4PH2A 4XFYA 1YIJP 5I4TG 1Q82Q 3I55P 3G1IA 2Z46A 5HGMA 3CMEP 2QEXP 5JPAA 2PEOA 3RG6C 2V4XA 3H4EA 4U0AA 2BHVA 2PY8A 3DS0A 1U7KA 3E2DA 3CC2P 1M9CC 3MGEA 1RNIA 4GR6A 2M8LA 1EIAA 3WBHA 1VQNP 3CCUP 3G26A 2PWMA 2XXMA 1QVGO 4DGAC 3DTJA 1VQ5P 3CCSP 1M6NA 1M9YC 1P7NA 1EM9A 2Y4ZA 2XGVA 2XGYA 4QNBA 4GR2A 2CWOA 5BS2A 3CXCO 3G71P 4U0CA 2GOLB 4DGEC 1VQMP 2PEIA 2WLVB 3DS5A 2L6EA 1IUQA 4INBA 4LQWC 4U0BA 4E92A 3G1GA 4COCA 1YITP 1AK4C 1AUMA 1YJNP 2JYLA 3DPHA 3CCQP 4XFZA 2EIAA 1M6EX 1JJ2O 5F2KA 3VRLC 2KGFA 2KODA 2Z44A 1AFVA 1G03A 2EFJA 1M9FC 5HGNA 5DCKA 1VQ6P 3H47A 1YHQP 1KQSO 3CPWO 2PENA 3CCVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYM A;  2JYG A;  3LRY A;  1M9E C;  2XT1 A;  1E6J P;  4U0D A;  4U0E A;  4PH1 A;  2X83 A;  1A43 A;  2X82 A;  4PH0 A;  3G0V A;  4J93 A;  2ONT A;  4XFX A;  1EOQ A;  4HTW A;  3BP9 A;  1GWP A;  2XV6 A;  2BUO A;  2LF4 A;  4U0F A;  2JO0 A;  2PXR C;  2JPR A;  2M8P A;  4IPY A;  4E91 A;  1A8O A;  3G29 A;  5HGO A;  5HGL A;  4PH3 A;  2XGU A;  3DS3 A;  3DS1 A;  4M0I A;  2XDE A;  4XRQ A;  1QRJ A;  2PWO A;  4XRO A;  2GON A;  1D1D A;  5HGK A;  3DS2 A;  3P05 A;  2M8N A;  2WLV A;  3NTE A;  2X2D D;  1M9X C;  4NX4 C;  4B4N A;  1BAJ A;  3G28 A;  4COP A;  1M9D C;  3G21 A;  3DS4 A;  1L6N A;  4PH2 A;  4XFY A;  5I4T G;  3G1I A;  5HGM A;  5JPA A;  2V4X A;  3H4E A;  4U0A A;  3DS0 A;  1U7K A;  1M9C C;  3MGE A;  2M8L A;  1EIA A;  3G26 A;  2PWM A;  2XXM A;  4DGA C;  3DTJ A;  1M9Y C;  1P7N A;  1EM9 A;  2Y4Z A;  2XGV A;  2XGY A;  4QNB A;  4U0C A;  2GOL B;  4DGE C;  2WLV B;  3DS5 A;  2L6E A;  4INB A;  4LQW C;  4U0B A;  4E92 A;  3G1G A;  4COC A;  1AK4 C;  1AUM A;  2JYL A;  3DPH A;  4XFZ A;  2EIA A;  3VRL C;  2KGF A;  2KOD A;  1AFV A;  1G03 A;  5DCK A;  1M9F C;  5HGN A;  3H47 A; 
#chains in the Genus database with same CATH topology
 2JAZ A;  3LRY A;  1M9E C;  2KOR A;  2LOL A;  4PH1 A;  5CZD B;  1GXG A;  4PH0 A;  1ZMB A;  1K73 Q;  2K0D X;  4XFX A;  3GZL A;  2QNW A;  2LF4 A;  2ERH A;  1N8R Q;  2JO0 A;  2JPR A;  1NQ4 A;  3CCE P;  1A8O A;  2X2B A;  1GPJ A;  1YJW P;  1VQP P;  4PH3 A;  3DS3 A;  1Q81 Q;  2FAC A;  2N5I A;  2KOS A;  5HGK A;  2KGC A;  1F80 D;  1VKU A;  3CCM P;  1DNY A;  5KP8 B;  2Z45 A;  2DGY A;  1AF8 A;  2FHS C;  1NJI Q;  2PEJ A;  2JGP A;  3G28 A;  2M5R A;  4MRT C;  2VLP A;  2JU2 A;  1CEI A;  3DS4 A;  2AFD A;  3B4Q A;  4PH2 A;  5I4T G;  3I55 P;  3CME P;  2KOO A;  3H4E A;  1ZNV A;  3E2D A;  3MGE A;  2L22 A;  4PXH B;  1EIA A;  2VLN A;  3WBH A;  2LML A;  2Y4Z A;  2AFE A;  2K5X A;  2XGY A;  2GZI A;  4GR2 A;  1L0I A;  4U0C A;  3DS5 A;  4INB A;  3G1G A;  4E92 A;  4COC A;  4XFZ A;  1AFV A;  1G03 A;  5DCK A;  1VQ6 P;  3CPW O;  3CCV P;  2XT1 A;  3G4S P;  2FVF A;  2MVU A;  1IMQ A;  2ROQ A;  3HZQ A;  3EJB A;  1VQ7 P;  2GYK A;  1M74 A;  2MR7 A;  2X82 A;  1W2B O;  4QKO A;  4HTW A;  3CCR P;  2JQ4 A;  1VHN A;  1RO0 A;  2GDX A;  2MVV A;  4H2X C;  2K94 A;  5HGO A;  5HGL A;  2LIW A;  3CMA P;  2KGE A;  1KC8 Q;  2XDE A;  4XRQ A;  5F2N A;  3CE7 A;  2WPT A;  2XZ0 D;  2VSQ A;  2K0Y A;  1S72 P;  2JU1 A;  2LKI A;  5EJD A;  2N6Z A;  2X2D D;  1M9X C;  2N98 A;  1L0H A;  2GDW A;  1BAJ A;  1UNK A;  4COP A;  1FR2 A;  1BXI A;  1OR5 A;  2PEK A;  1K8A Q;  1M1K Q;  1YI2 P;  3U43 A;  1L6N A;  1Q82 Q;  2AF8 A;  5HGM A;  2Z46 A;  2QEX P;  5JPA A;  2PEO A;  2MY5 A;  2PY8 A;  4U0A A;  3CC2 P;  1M9C C;  2M8L A;  2LPK A;  1AYI A;  1VQN P;  3CCU P;  2XXM A;  4PWV B;  1X3O A;  1VQ5 P;  3LMO A;  1M9Y C;  2CQ8 A;  2MF4 A;  4H2W C;  2K93 A;  5BS2 A;  3CXC O;  2LIU A;  2N50 A;  3G71 P;  1VQM P;  2GOL B;  2PEI A;  4HKG A;  2WLV B;  1IUQ A;  1YJN P;  2FAE A;  2JYL A;  3CCQ P;  2EIA A;  1M6E X;  2KGF A;  2PNG A;  2Z44 A;  3EJD A;  4DG9 A;  1E0H A;  3H47 A;  2PEN A;  2XZ1 C;  2JYG A;  2FQ2 A;  1Q7Y Q;  1E6J P;  3CCL P;  3B5I A;  2MD9 A;  5KP7 B;  2CG5 B;  1K30 A;  4UHP B;  2ONT A;  3BP9 A;  2OTJ P;  1GWP A;  2CGQ A;  2BUO A;  2KWL A;  4U0F A;  3GJN A;  2PXR C;  2K0X A;  2K2Q A;  2FQ0 A;  7CEI A;  3G29 A;  5F2O A;  3RG2 A;  4F37 A;  2PEQ A;  3DS1 A;  1RO2 A;  2KGD A;  4XRO A;  1ACP A;  2L9F A;  2GZG A;  1MZ8 A;  2N6Y A;  2M8N A;  1M90 Q;  1KD1 Q;  2QA4 P;  4NX4 C;  3GKL C;  2GZF A;  3GZM A;  4IZ6 A;  4H2Y C;  4B4N A;  1M9D C;  2CNR A;  2FVE A;  1YIJ P;  2V4X A;  3NY7 B;  2FQ1 A;  4GR6 A;  2N5H A;  4BPG A;  2VLO A;  2PWM A;  1P7N A;  1HY8 A;  2GZJ A;  4QNB A;  1KLP A;  2CWO A;  4DGE C;  2FVA A;  2L6E A;  3CD6 P;  2KG6 A;  2KG8 A;  3DPH A;  5F2K A;  2KW2 A;  1M9F C;  5HGN A;  1GXH A;  1YHQ P;  2L0Q A;  1KQS O;  4WYM A;  2DNW A;  2EG5 A;  3HYB A;  4CA3 A;  4U0D A;  1VQ9 P;  1Z6M A;  4U0E A;  5KP6 B;  1VQ8 P;  2FAD A;  2X83 A;  1A43 A;  4BPF A;  3H0D A;  4BPH A;  3G0V A;  1VQL P;  4J93 A;  3I56 P;  1EOQ A;  2LTE A;  1Q86 Q;  3CC4 P;  2VLQ A;  2XV6 A;  1VQO P;  1DV5 A;  2LL8 A;  1QVF O;  2PEM A;  2M8P A;  4IPY A;  4E91 A;  2E1M A;  1K9M Q;  1YJ9 P;  3CCJ P;  3EJE A;  2GZE A;  3G6E P;  1UJZ A;  2P9X A;  2XGU A;  1VQK P;  3CC7 P;  4M0I A;  3Q20 A;  5BS1 A;  2OAR A;  1QRJ A;  2PWO A;  2GON A;  1D1D A;  1VQ4 P;  3DS2 A;  3P05 A;  2OTL P;  2WLV A;  3NTE A;  3M1M A;  2EHT A;  3G21 A;  2JB0 A;  3OW2 O;  2KG9 A;  2JBG A;  5HV8 A;  4XFY A;  2EHS A;  5HVC A;  3G1I A;  2GDY A;  3RG6 C;  3DS0 A;  2BHV A;  4NEO A;  1U7K A;  1EMV A;  2KOP A;  1RNI A;  2MR8 A;  1T8K A;  3G26 A;  5EW5 E;  1QVG O;  4DGA C;  2KOQ A;  3DTJ A;  3CCS P;  1M6N A;  1EM9 A;  2XGV A;  2NO8 A;  2KGA A;  4LQW C;  4U0B A;  1HQB A;  1YIT P;  1AK4 C;  1AUM A;  2KR5 A;  2K92 A;  1JJ2 O;  3VRL C;  2KOD A;  2EFJ A;  2L4B A;  2AVA A;  4R0M A;  1IMP A; 
#chains in the Genus database with same CATH homology
 4WYM A;  2JYG A;  2EG5 A;  3LRY A;  1M9E C;  2XT1 A;  3G4S P;  3CD6 P;  1Q7Y Q;  3HYB A;  1E6J P;  4U0D A;  1VQ9 P;  3HZQ A;  1VQ7 P;  4U0E A;  4PH1 A;  3CCL P;  1VQ8 P;  3B5I A;  2X83 A;  1A43 A;  1M74 A;  2X82 A;  1K30 A;  3H0D A;  1W2B O;  4PH0 A;  1ZMB A;  3G0V A;  1K73 Q;  1VQL P;  4J93 A;  2ONT A;  4XFX A;  3I56 P;  1EOQ A;  4HTW A;  1Q86 Q;  3BP9 A;  3CCR P;  3CC4 P;  2OTJ P;  1GWP A;  2XV6 A;  2BUO A;  1VQO P;  2LF4 A;  4U0F A;  1RO0 A;  1QVF O;  2PEM A;  1N8R Q;  2JO0 A;  2PXR C;  2JPR A;  2M8P A;  4IPY A;  4E91 A;  2E1M A;  1K9M Q;  3CCE P;  1A8O A;  3G29 A;  5HGO A;  3CCJ P;  5F2O A;  1YJ9 P;  5HGL A;  3G6E P;  1YJW P;  1VQP P;  2P9X A;  4PH3 A;  2XGU A;  2PEQ A;  3DS3 A;  3CMA P;  1Q81 Q;  1VQK P;  3DS1 A;  3CC7 P;  4M0I A;  3Q20 A;  5BS1 A;  1RO2 A;  2XDE A;  2OAR A;  1KC8 Q;  4XRQ A;  1QRJ A;  2PWO A;  4XRO A;  5F2N A;  2GON A;  1D1D A;  1VQ4 P;  5HGK A;  1S72 P;  3DS2 A;  3P05 A;  2OTL P;  2M8N A;  1M90 Q;  1KD1 Q;  2WLV A;  3CCM P;  2QA4 P;  3NTE A;  2X2D D;  2Z45 A;  3M1M A;  2DGY A;  1M9X C;  4NX4 C;  1NJI Q;  2PEJ A;  4B4N A;  1BAJ A;  3G28 A;  4COP A;  1M9D C;  3G21 A;  3OW2 O;  2PEK A;  1K8A Q;  3DS4 A;  1M1K Q;  1YI2 P;  1L6N A;  4PH2 A;  4XFY A;  1YIJ P;  5I4T G;  1Q82 Q;  3I55 P;  3G1I A;  2Z46 A;  5HGM A;  3CME P;  2QEX P;  5JPA A;  2PEO A;  3RG6 C;  2V4X A;  3H4E A;  4U0A A;  2BHV A;  2PY8 A;  3DS0 A;  1U7K A;  3E2D A;  3CC2 P;  1M9C C;  3MGE A;  1RNI A;  4GR6 A;  2M8L A;  1EIA A;  3WBH A;  1VQN P;  3CCU P;  3G26 A;  2PWM A;  2XXM A;  1QVG O;  4DGA C;  3DTJ A;  1VQ5 P;  3CCS P;  1M6N A;  1M9Y C;  1P7N A;  1EM9 A;  2Y4Z A;  2XGV A;  2XGY A;  4QNB A;  4GR2 A;  2CWO A;  5BS2 A;  3CXC O;  3G71 P;  4U0C A;  2GOL B;  4DGE C;  1VQM P;  2PEI A;  2WLV B;  3DS5 A;  2L6E A;  1IUQ A;  4INB A;  4LQW C;  4U0B A;  4E92 A;  3G1G A;  4COC A;  1YIT P;  1AK4 C;  1AUM A;  1YJN P;  2JYL A;  3DPH A;  3CCQ P;  4XFZ A;  2EIA A;  1M6E X;  1JJ2 O;  5F2K A;  3VRL C;  2KGF A;  2KOD A;  2Z44 A;  1AFV A;  1G03 A;  2EFJ A;  1M9F C;  5HGN A;  5DCK A;  1VQ6 P;  3H47 A;  1YHQ P;  1KQS O;  3CPW O;  2PEN A;  3CCV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...