4PH0A

Capsid protein from bovine leukemia virus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
206
structure length
201
Chain Sequence
PIISEGNRNRHRAWALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSLTAAIAAAEAANTLQGFNPQNGTLTQQSAQPNAGDLRSQYQNLWLQAWKNLPTPWSTIVQGPAESYVEFVNRLQISLADNLPDGVPKEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQACAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
molecule keywords BLV capsid
total genus 68
structure length 201
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4ph0A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ph0A02
3G29A 3G21A 2X82A 5HGLA 4PH3A 2JYLA 2KGFA 2PXRC 5HGKA 4DGEC 3P05A 2KODA 4IPYA 4PH0A 3G26A 2XGYA 2JO0A 1M9CC 3BP9A 3H47A 1M9XC 4QNBA 3DS3A 4E92A 1QRJA 2XT1A 2LF4A 4XFZA 5I4TG 1G03A 3DS1A 2XDEA 4XFYA 4U0EA 3G1GA 4M0IA 2PWOA 4J93A 5HGMA 2JPRA 2GOLB 4COCA 1M9FC 1A8OA 2JYGA 2ONTA 3DTJA 2WLVB 2WLVA 1EOQA 2X83A 4PH1A 5JPAA 1A43A 4XRQA 1P7NA 3DS4A 2PWMA 4LQWC 2BUOA 1GWPA 1E6JP 5HGOA 1U7KA 4INBA 4DGAC 4XROA 4U0FA 2M8NA 2V4XA 3LRYA 4COPA 2XGUA 4PH2A 1M9DC 3NTEA 3VRLC 3H4EA 4U0CA 1BAJA 2XV6A 1EM9A 4WYMA 3MGEA 4U0BA 3G28A 2XXMA 1D1DA 3DS5A 3DS2A 2GONA 1AUMA 2M8PA 2M8LA 1AK4C 1EIAA 2XGVA 3G1IA 2L6EA 1L6NA 2EIAA 2X2DD 4U0AA 4XFXA 3G0VA 1AFVA 4U0DA 4NX4C 5DCKA 4E91A 4HTWA 3DPHA 2Y4ZA 1M9YC 4B4NA 1M9EC 5HGNA 3DS0A
chains in the Genus database with same CATH superfamily
2LPKA 3CCJP 2PXRC 2KOOA 3P05A 2FAEA 2VSQA 2KOSA 4PH0A 2XZ0D 1VQPP 2JO0A 4H2WC 2MF4A 2VLOA 2FVEA 2LTEA 1E0HA 2LF4A 2CQ8A 2LIWA 2KOQA 2FVAA 4UHPB 1Z6MA 2PEMA 5I4TG 4PWVB 1DNYA 3CCRP 2AVAA 3CC4P 2KGEA 4M0IA 3CD6P 2EHSA 1M9FC 2OTJP 2CNRA 2K2QA 2K94A 1YJ9P 1EOQA 2X83A 4BPFA 3G4SP 5EW5E 1A43A 2AF8A 2VLQA 1E6JP 1KQSO 2PENA 2L4BA 3LRYA 2N6ZA 3NTEA 1HQBA 1ZMBA 2XV6A 5KP8B 1JJ2O 3MGEA 1UJZA 3G28A 2E1MA 1YJNP 1GPJA 1HY8A 2ROQA 5KP6B 2L0QA 2L22A 4MRTC 2FACA 2FADA 2XGVA 2FQ0A 4DG9A 3G1IA 1L6NA 3RG6C 4U0DA 2EFJA 1M9YC 4B4NA 1M9EC 2K0DX 1EMVA 1W2BO 3NY7B 3G29A 2EHTA 3G21A 3HZQA 2JAZA 1L0IA 5HGKA 1VQ8P 4DGEC 2K0XA 3EJDA 5HVCA 4IPYA 3G26A 2XGYA 1IUQA 2K93A 2CWOA 5CZDB 1M9CC 3H47A 4E92A 1QRJA 4BPHA 1RO2A 4XFZA 1AF8A 2DGYA 1NQ4A 1YJWP 1VHNA 2GZJA 2PWOA 2PEKA 2KGDA 2NO8A 2JB0A 2KG9A 2GOLB 2KG6A 4COCA 1A8OA 3DTJA 3WBHA 1KLPA 1Q7YQ 1QVFO 1BXIA 2MD9A 2FQ2A 5JPAA 2BHVA 3DS4A 2K92A 2BUOA 1U7KA 2KGAA 2M8NA 2PNGA 4COPA 3GJNA 1QVGO 4PH2A 1UNKA 1Q81Q 3RG2A 2LMLA 4H2YC 1T8KA 1VQ4P 2XZ1C 2LKIA 4U0BA 4BPGA 3CCEP 2KWLA 3DS5A 3DS2A 2GONA 1VQ5P 1K30A 7CEIA 1EIAA 3B4QA 2MY5A 2K5XA 2VLNA 4GR2A 4U0AA 4XFXA 1ACPA 2K0YA 2Y4ZA 3CXCO 3M1MA 2GZEA 3GZMA 1RNIA 5HGLA 2JYLA 2KGFA 1AYIA 2N5IA 1Q86Q 5F2KA 3BP9A 1M9XC 1KD1Q 3DS3A 2X2BA 1K8AQ 5BS1A 3CC2P 1G03A 3DS1A 2XDEA 4XFYA 4U0EA 1M90Q 1VQMP 1L0HA 2MVVA 4J93A 3HYBA 2KR5A 3CC7P 2JYGA 5EJDA 1VQ7P 2WLVB 2N5HA 3CMAP 3CCVP 4IZ6A 1M1KQ 4XRQA 1P7NA 2FHSC 2N98A 1YIJP 3EJBA 2GZIA 4DGAC 2KORA 4XROA 4U0FA 2QA4P 1YITP 2PEIA 1X3OA 2JGPA 1K9MQ 3VRLC 1M9DC 2AFDA 5KP7B 1FR2A 1VQ6P 2FQ1A 4U0CA 1KC8Q 2KOPA 2QEXP 1EM9A 2OARA 2GDYA 5F2NA 2CGQA 2N50A 2M8PA 4PXHB 2JU1A 2M8LA 5F2OA 1NJIQ 2LIUA 5BS2A 3CCQP 1M6NA 2L6EA 1IMPA 2EIAA 2X2DD 4H2XC 3G0VA 1N8RQ 4NX4C 5DCKA 4E91A 3DPHA 2KG8A 3G71P 1VQ9P 2X82A 4PH3A 4F37A 1YI2P 2LOLA 2KODA 1CEIA 1VQOP 4QNBA 2MR7A 3Q20A 2WPTA 1VQNP 1F80D 3CPWO 1M6EX 2XT1A 2Z45A 2DNWA 2VLPA 3CCLP 4NEOA 3GZLA 1ZNVA 1YHQP 3GKLC 2LL8A 4GR6A 3I56P 2JBGA 2EG5A 3B5IA 3G1GA 1OR5A 2GYKA 2PEOA 2CG5B 5HGMA 2JPRA 2KW2A 2GZFA 2ONTA 2JQ4A 1VQKP 4QKOA 2WLVA 4R0MA 2AFEA 3U43A 1GXHA 2Z44A 2ERHA 2PY8A 2MR8A 3CCMP 4PH1A 3G6EP 3I55P 1DV5A 2FVFA 3CCUP 2M5RA 2GZGA 2PWMA 4LQWC 1GWPA 2GDXA 5HGOA 1MZ8A 3OW2O 4INBA 1Q82Q 3E2DA 2V4XA 2L9FA 2XGUA 2PEJA 3LMOA 2MVUA 3H4EA 2GDWA 1IMQA 1BAJA 2QNWA 4WYMA 1VQLP 1RO0A 2XXMA 1S72P 1D1DA 2KGCA 3H0DA 2N6YA 1AUMA 1VKUA 1M74A 3CMEP 2PEQA 2JU2A 1AK4C 2OTLP 3EJEA 1AFVA 3CE7A 2Z46A 1K73Q 1GXGA 5HV8A 4HTWA 3CCSP 4HKGA 5HGNA 2P9XA 4CA3A 3DS0A
chains in the Genus database with same CATH topology
1VQ9P 1W2BO 3G29A 1RNIA 3G21A 2X82A 5HGLA 3HZQA 4PH3A 1YI2P 3CCJP 2JYLA 2KGFA 2PXRC 5HGKA 1VQ8P 4DGEC 3P05A 2KODA 4IPYA 4PH0A 1Q86Q 1VQPP 5F2KA 3G26A 2XGYA 1IUQA 2JO0A 2CWOA 1M9CC 3BP9A 3H47A 1VQOP 1M9XC 4QNBA 3Q20A 1KD1Q 3DS3A 4E92A 1QRJA 1VQNP 3CPWO 1M6EX 2XT1A 2Z45A 2LF4A 1K8AQ 3CCLP 5BS1A 3CC2P 1YHQP 1RO2A 4XFZA 2PEMA 4GR6A 3I56P 5I4TG 1G03A 3DS1A 2XDEA 2EG5A 2DGYA 4XFYA 3CCRP 4U0EA 3B5IA 1YJWP 3G1GA 1M90Q 4M0IA 1VQMP 3CC4P 2PWOA 3HYBA 4J93A 2PEKA 2PEOA 3CC7P 5HGMA 3CD6P 2JPRA 2GOLB 4COCA 1M9FC 2OTJP 1A8OA 2JYGA 2ONTA 1VQ7P 1VQKP 3DTJA 3WBHA 2WLVB 2WLVA 1YJ9P 1Q7YQ 2Z44A 1QVFO 2PY8A 1EOQA 3CMAP 3CCMP 2X83A 4PH1A 3G6EP 3I55P 3CCVP 3G4SP 5JPAA 2BHVA 1M1KQ 1A43A 3CCUP 4XRQA 1P7NA 3DS4A 2PWMA 4LQWC 2BUOA 1GWPA 1YIJP 1E6JP 5HGOA 1U7KA 3OW2O 1KQSO 4INBA 4DGAC 2PENA 1Q82Q 4XROA 4U0FA 2QA4P 2M8NA 3E2DA 1YITP 2V4XA 2PEIA 3LRYA 4COPA 2XGUA 2PEJA 1K9MQ 1QVGO 4PH2A 1M9DC 3NTEA 3VRLC 1Q81Q 1VQ6P 3H4EA 4U0CA 1BAJA 1KC8Q 1ZMBA 2XV6A 2QEXP 1EM9A 1VQ4P 1JJ2O 4WYMA 3MGEA 4U0BA 1VQLP 3G28A 1RO0A 2E1MA 1YJNP 2XXMA 2OARA 1D1DA 1S72P 3CCEP 5F2NA 3DS5A 3H0DA 3DS2A 2GONA 1VQ5P 1AUMA 2M8PA 1K30A 1M74A 3CMEP 2PEQA 2M8LA 1AK4C 1EIAA 5F2OA 2OTLP 1NJIQ 5BS2A 2XGVA 3CCQP 1M6NA 3G1IA 2L6EA 1L6NA 2EIAA 4GR2A 2X2DD 4U0AA 4XFXA 3G0VA 3RG6C 1AFVA 1N8RQ 2Z46A 4U0DA 1K73Q 4NX4C 5DCKA 4E91A 4HTWA 3DPHA 3CCSP 2EFJA 2Y4ZA 1M9YC 4B4NA 3CXCO 1M9EC 5HGNA 2P9XA 3DS0A 3M1MA 3G71P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G29 A;  3G21 A;  2X82 A;  5HGL A;  4PH3 A;  2JYL A;  2KGF A;  2PXR C;  5HGK A;  4DGE C;  3P05 A;  2KOD A;  4IPY A;  4PH0 A;  3G26 A;  2XGY A;  2JO0 A;  1M9C C;  3BP9 A;  3H47 A;  1M9X C;  4QNB A;  3DS3 A;  4E92 A;  1QRJ A;  2XT1 A;  2LF4 A;  4XFZ A;  5I4T G;  1G03 A;  3DS1 A;  2XDE A;  4XFY A;  4U0E A;  3G1G A;  4M0I A;  2PWO A;  4J93 A;  5HGM A;  2JPR A;  2GOL B;  4COC A;  1M9F C;  1A8O A;  2JYG A;  2ONT A;  3DTJ A;  2WLV B;  2WLV A;  1EOQ A;  2X83 A;  4PH1 A;  5JPA A;  1A43 A;  4XRQ A;  1P7N A;  3DS4 A;  2PWM A;  4LQW C;  2BUO A;  1GWP A;  1E6J P;  5HGO A;  1U7K A;  4INB A;  4DGA C;  4XRO A;  4U0F A;  2M8N A;  2V4X A;  3LRY A;  4COP A;  2XGU A;  4PH2 A;  1M9D C;  3NTE A;  3VRL C;  3H4E A;  4U0C A;  1BAJ A;  2XV6 A;  1EM9 A;  4WYM A;  3MGE A;  4U0B A;  3G28 A;  2XXM A;  1D1D A;  3DS5 A;  3DS2 A;  2GON A;  1AUM A;  2M8P A;  2M8L A;  1AK4 C;  1EIA A;  2XGV A;  3G1I A;  2L6E A;  1L6N A;  2EIA A;  2X2D D;  4U0A A;  4XFX A;  3G0V A;  1AFV A;  4U0D A;  4NX4 C;  5DCK A;  4E91 A;  4HTW A;  3DPH A;  2Y4Z A;  1M9Y C;  4B4N A;  1M9E C;  5HGN A;  3DS0 A; 
#chains in the Genus database with same CATH topology
 2LPK A;  3CCJ P;  2PXR C;  2KOO A;  3P05 A;  2FAE A;  2VSQ A;  2KOS A;  4PH0 A;  2XZ0 D;  1VQP P;  2JO0 A;  4H2W C;  2MF4 A;  2VLO A;  2FVE A;  2LTE A;  1E0H A;  2LF4 A;  2CQ8 A;  2LIW A;  2KOQ A;  2FVA A;  4UHP B;  1Z6M A;  2PEM A;  5I4T G;  4PWV B;  1DNY A;  3CCR P;  2AVA A;  3CC4 P;  2KGE A;  4M0I A;  3CD6 P;  2EHS A;  1M9F C;  2OTJ P;  2CNR A;  2K2Q A;  2K94 A;  1YJ9 P;  1EOQ A;  2X83 A;  4BPF A;  3G4S P;  5EW5 E;  1A43 A;  2AF8 A;  2VLQ A;  1E6J P;  1KQS O;  2PEN A;  2L4B A;  3LRY A;  2N6Z A;  3NTE A;  1HQB A;  1ZMB A;  2XV6 A;  5KP8 B;  1JJ2 O;  3MGE A;  1UJZ A;  3G28 A;  2E1M A;  1YJN P;  1GPJ A;  1HY8 A;  2ROQ A;  5KP6 B;  2L0Q A;  2L22 A;  4MRT C;  2FAC A;  2FAD A;  2XGV A;  2FQ0 A;  4DG9 A;  3G1I A;  1L6N A;  3RG6 C;  4U0D A;  2EFJ A;  1M9Y C;  4B4N A;  1M9E C;  2K0D X;  1EMV A;  1W2B O;  3NY7 B;  3G29 A;  2EHT A;  3G21 A;  3HZQ A;  2JAZ A;  1L0I A;  5HGK A;  1VQ8 P;  4DGE C;  2K0X A;  3EJD A;  5HVC A;  4IPY A;  3G26 A;  2XGY A;  1IUQ A;  2K93 A;  2CWO A;  5CZD B;  1M9C C;  3H47 A;  4E92 A;  1QRJ A;  4BPH A;  1RO2 A;  4XFZ A;  1AF8 A;  2DGY A;  1NQ4 A;  1YJW P;  1VHN A;  2GZJ A;  2PWO A;  2PEK A;  2KGD A;  2NO8 A;  2JB0 A;  2KG9 A;  2GOL B;  2KG6 A;  4COC A;  1A8O A;  3DTJ A;  3WBH A;  1KLP A;  1Q7Y Q;  1QVF O;  1BXI A;  2MD9 A;  2FQ2 A;  5JPA A;  2BHV A;  3DS4 A;  2K92 A;  2BUO A;  1U7K A;  2KGA A;  2M8N A;  2PNG A;  4COP A;  3GJN A;  1QVG O;  4PH2 A;  1UNK A;  1Q81 Q;  3RG2 A;  2LML A;  4H2Y C;  1T8K A;  1VQ4 P;  2XZ1 C;  2LKI A;  4U0B A;  4BPG A;  3CCE P;  2KWL A;  3DS5 A;  3DS2 A;  2GON A;  1VQ5 P;  1K30 A;  7CEI A;  1EIA A;  3B4Q A;  2MY5 A;  2K5X A;  2VLN A;  4GR2 A;  4U0A A;  4XFX A;  1ACP A;  2K0Y A;  2Y4Z A;  3CXC O;  3M1M A;  2GZE A;  3GZM A;  1RNI A;  5HGL A;  2JYL A;  2KGF A;  1AYI A;  2N5I A;  1Q86 Q;  5F2K A;  3BP9 A;  1M9X C;  1KD1 Q;  3DS3 A;  2X2B A;  1K8A Q;  5BS1 A;  3CC2 P;  1G03 A;  3DS1 A;  2XDE A;  4XFY A;  4U0E A;  1M90 Q;  1VQM P;  1L0H A;  2MVV A;  4J93 A;  3HYB A;  2KR5 A;  3CC7 P;  2JYG A;  5EJD A;  1VQ7 P;  2WLV B;  2N5H A;  3CMA P;  3CCV P;  4IZ6 A;  1M1K Q;  4XRQ A;  1P7N A;  2FHS C;  2N98 A;  1YIJ P;  3EJB A;  2GZI A;  4DGA C;  2KOR A;  4XRO A;  4U0F A;  2QA4 P;  1YIT P;  2PEI A;  1X3O A;  2JGP A;  1K9M Q;  3VRL C;  1M9D C;  2AFD A;  5KP7 B;  1FR2 A;  1VQ6 P;  2FQ1 A;  4U0C A;  1KC8 Q;  2KOP A;  2QEX P;  1EM9 A;  2OAR A;  2GDY A;  5F2N A;  2CGQ A;  2N50 A;  2M8P A;  4PXH B;  2JU1 A;  2M8L A;  5F2O A;  1NJI Q;  2LIU A;  5BS2 A;  3CCQ P;  1M6N A;  2L6E A;  1IMP A;  2EIA A;  2X2D D;  4H2X C;  3G0V A;  1N8R Q;  4NX4 C;  5DCK A;  4E91 A;  3DPH A;  2KG8 A;  3G71 P;  1VQ9 P;  2X82 A;  4PH3 A;  4F37 A;  1YI2 P;  2LOL A;  2KOD A;  1CEI A;  1VQO P;  4QNB A;  2MR7 A;  3Q20 A;  2WPT A;  1VQN P;  1F80 D;  3CPW O;  1M6E X;  2XT1 A;  2Z45 A;  2DNW A;  2VLP A;  3CCL P;  4NEO A;  3GZL A;  1ZNV A;  1YHQ P;  3GKL C;  2LL8 A;  4GR6 A;  3I56 P;  2JBG A;  2EG5 A;  3B5I A;  3G1G A;  1OR5 A;  2GYK A;  2PEO A;  2CG5 B;  5HGM A;  2JPR A;  2KW2 A;  2GZF A;  2ONT A;  2JQ4 A;  1VQK P;  4QKO A;  2WLV A;  4R0M A;  2AFE A;  3U43 A;  1GXH A;  2Z44 A;  2ERH A;  2PY8 A;  2MR8 A;  3CCM P;  4PH1 A;  3G6E P;  3I55 P;  1DV5 A;  2FVF A;  3CCU P;  2M5R A;  2GZG A;  2PWM A;  4LQW C;  1GWP A;  2GDX A;  5HGO A;  1MZ8 A;  3OW2 O;  4INB A;  1Q82 Q;  3E2D A;  2V4X A;  2L9F A;  2XGU A;  2PEJ A;  3LMO A;  2MVU A;  3H4E A;  2GDW A;  1IMQ A;  1BAJ A;  2QNW A;  4WYM A;  1VQL P;  1RO0 A;  2XXM A;  1S72 P;  1D1D A;  2KGC A;  3H0D A;  2N6Y A;  1AUM A;  1VKU A;  1M74 A;  3CME P;  2PEQ A;  2JU2 A;  1AK4 C;  2OTL P;  3EJE A;  1AFV A;  3CE7 A;  2Z46 A;  1K73 Q;  1GXG A;  5HV8 A;  4HTW A;  3CCS P;  4HKG A;  5HGN A;  2P9X A;  4CA3 A;  3DS0 A; 
#chains in the Genus database with same CATH homology
 1VQ9 P;  1W2B O;  3G29 A;  1RNI A;  3G21 A;  2X82 A;  5HGL A;  3HZQ A;  4PH3 A;  1YI2 P;  3CCJ P;  2JYL A;  2KGF A;  2PXR C;  5HGK A;  1VQ8 P;  4DGE C;  3P05 A;  2KOD A;  4IPY A;  4PH0 A;  1Q86 Q;  1VQP P;  5F2K A;  3G26 A;  2XGY A;  1IUQ A;  2JO0 A;  2CWO A;  1M9C C;  3BP9 A;  3H47 A;  1VQO P;  1M9X C;  4QNB A;  3Q20 A;  1KD1 Q;  3DS3 A;  4E92 A;  1QRJ A;  1VQN P;  3CPW O;  1M6E X;  2XT1 A;  2Z45 A;  2LF4 A;  1K8A Q;  3CCL P;  5BS1 A;  3CC2 P;  1YHQ P;  1RO2 A;  4XFZ A;  2PEM A;  4GR6 A;  3I56 P;  5I4T G;  1G03 A;  3DS1 A;  2XDE A;  2EG5 A;  2DGY A;  4XFY A;  3CCR P;  4U0E A;  3B5I A;  1YJW P;  3G1G A;  1M90 Q;  4M0I A;  1VQM P;  3CC4 P;  2PWO A;  3HYB A;  4J93 A;  2PEK A;  2PEO A;  3CC7 P;  5HGM A;  3CD6 P;  2JPR A;  2GOL B;  4COC A;  1M9F C;  2OTJ P;  1A8O A;  2JYG A;  2ONT A;  1VQ7 P;  1VQK P;  3DTJ A;  3WBH A;  2WLV B;  2WLV A;  1YJ9 P;  1Q7Y Q;  2Z44 A;  1QVF O;  2PY8 A;  1EOQ A;  3CMA P;  3CCM P;  2X83 A;  4PH1 A;  3G6E P;  3I55 P;  3CCV P;  3G4S P;  5JPA A;  2BHV A;  1M1K Q;  1A43 A;  3CCU P;  4XRQ A;  1P7N A;  3DS4 A;  2PWM A;  4LQW C;  2BUO A;  1GWP A;  1YIJ P;  1E6J P;  5HGO A;  1U7K A;  3OW2 O;  1KQS O;  4INB A;  4DGA C;  2PEN A;  1Q82 Q;  4XRO A;  4U0F A;  2QA4 P;  2M8N A;  3E2D A;  1YIT P;  2V4X A;  2PEI A;  3LRY A;  4COP A;  2XGU A;  2PEJ A;  1K9M Q;  1QVG O;  4PH2 A;  1M9D C;  3NTE A;  3VRL C;  1Q81 Q;  1VQ6 P;  3H4E A;  4U0C A;  1BAJ A;  1KC8 Q;  1ZMB A;  2XV6 A;  2QEX P;  1EM9 A;  1VQ4 P;  1JJ2 O;  4WYM A;  3MGE A;  4U0B A;  1VQL P;  3G28 A;  1RO0 A;  2E1M A;  1YJN P;  2XXM A;  2OAR A;  1D1D A;  1S72 P;  3CCE P;  5F2N A;  3DS5 A;  3H0D A;  3DS2 A;  2GON A;  1VQ5 P;  1AUM A;  2M8P A;  1K30 A;  1M74 A;  3CME P;  2PEQ A;  2M8L A;  1AK4 C;  1EIA A;  5F2O A;  2OTL P;  1NJI Q;  5BS2 A;  2XGV A;  3CCQ P;  1M6N A;  3G1I A;  2L6E A;  1L6N A;  2EIA A;  4GR2 A;  2X2D D;  4U0A A;  4XFX A;  3G0V A;  3RG6 C;  1AFV A;  1N8R Q;  2Z46 A;  4U0D A;  1K73 Q;  4NX4 C;  5DCK A;  4E91 A;  4HTW A;  3DPH A;  3CCS P;  2EFJ A;  2Y4Z A;  1M9Y C;  4B4N A;  3CXC O;  1M9E C;  5HGN A;  2P9X A;  3DS0 A;  3M1M A;  3G71 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...