4PH2A

Mature n-terminal domain of capsid protein from bovine leukemia virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
127
structure length
127
Chain Sequence
PIISEGNRNRHRAWALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSLTAAIAAAEAANTLQGFNPQNGTLTQQSAQPNAGDLRSQYQNLWLQAWKNLPTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
molecule keywords BLV capsid - N-terminal domain
total genus 46
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4ph2A00
4QNBA 3BP9A 4PH3A 4U0FA 2PWMA 4E92A 1U7KA 2XGUA 1QRJA 1G03A 1EIAA 2X82A 4WYMA 4XFXA 2XDEA 1M9FC 4U0EA 5HGOA 1AFVA 4U0BA 4DGEC 2XGYA 5HGKA 1M9YC 4E91A 5JPAA 4U0DA 2X2DD 4DGAC 1M9EC 3H47A 3MGEA 4NX4C 4PH0A 1M9CC 4HTWA 3P05A 1E6JP 5HGMA 2M8NA 2XGVA 2GONA 3H4EA 4XFZA 1P7NA 2LF4A 1L6NA 2EIAA 2X83A 4XRQA 1GWPA 1D1DA 2PXRC 2WLVA 4U0AA 4XFYA 4LQWC 2Y4ZA 1EM9A 1M9XC 2PWOA 4J93A 4U0CA 4XROA 4PH2A 5HGNA 2V4XA 2M8LA 4INBA 1M9DC 3NTEA 4B4NA 1AK4C 2WLVB 2GOLB 5HGLA 2KGFA 2JPRA 2M8PA
chains in the Genus database with same CATH superfamily
4QNBA 3BP9A 4PH3A 4U0FA 2PWMA 4E92A 1U7KA 2XGUA 1QRJA 1G03A 1EIAA 2X82A 4WYMA 4XFXA 2XDEA 1M9FC 4U0EA 5HGOA 1AFVA 4U0BA 4DGEC 2XGYA 5HGKA 1M9YC 4E91A 5JPAA 4U0DA 2X2DD 4DGAC 1M9EC 3H47A 3MGEA 4NX4C 4PH0A 1M9CC 4HTWA 3P05A 1E6JP 5HGMA 2M8NA 2XGVA 2GONA 3H4EA 4XFZA 1P7NA 2LF4A 1L6NA 2EIAA 2X83A 4XRQA 1GWPA 1D1DA 2PXRC 2WLVA 4U0AA 4XFYA 4LQWC 2Y4ZA 1EM9A 1M9XC 2PWOA 4J93A 4U0CA 4XROA 4PH2A 5HGNA 2V4XA 2M8LA 4INBA 1M9DC 3NTEA 4B4NA 1AK4C 2WLVB 2GOLB 5HGLA 2KGFA 2JPRA 2M8PA
chains in the Genus database with same CATH topology
4QNBA 3BP9A 4PH3A 4U0FA 2PWMA 4E92A 1U7KA 2XGUA 1QRJA 1G03A 1EIAA 2X82A 4WYMA 4XFXA 2XDEA 1M9FC 4U0EA 5HGOA 1AFVA 4U0BA 4DGEC 2XGYA 5HGKA 1M9YC 4E91A 5JPAA 4U0DA 2X2DD 4DGAC 1M9EC 3H47A 3MGEA 4NX4C 4PH0A 1M9CC 4HTWA 3P05A 1E6JP 5HGMA 2M8NA 2XGVA 2GONA 3H4EA 4XFZA 1P7NA 2LF4A 1L6NA 2EIAA 2X83A 4XRQA 1GWPA 1D1DA 2PXRC 2WLVA 4U0AA 4XFYA 4LQWC 2Y4ZA 1EM9A 1M9XC 2PWOA 4J93A 4U0CA 4XROA 4PH2A 5HGNA 2V4XA 2M8LA 4INBA 1M9DC 3NTEA 4B4NA 1AK4C 2WLVB 2GOLB 5HGLA 2KGFA 2JPRA 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNB A;  3BP9 A;  4PH3 A;  4U0F A;  2PWM A;  4E92 A;  1U7K A;  2XGU A;  1QRJ A;  1G03 A;  1EIA A;  2X82 A;  4WYM A;  4XFX A;  2XDE A;  1M9F C;  4U0E A;  5HGO A;  1AFV A;  4U0B A;  4DGE C;  2XGY A;  5HGK A;  1M9Y C;  4E91 A;  5JPA A;  4U0D A;  2X2D D;  4DGA C;  1M9E C;  3H47 A;  3MGE A;  4NX4 C;  4PH0 A;  1M9C C;  4HTW A;  3P05 A;  1E6J P;  5HGM A;  2M8N A;  2XGV A;  2GON A;  3H4E A;  4XFZ A;  1P7N A;  2LF4 A;  1L6N A;  2EIA A;  2X83 A;  4XRQ A;  1GWP A;  1D1D A;  2PXR C;  2WLV A;  4U0A A;  4XFY A;  4LQW C;  2Y4Z A;  1EM9 A;  1M9X C;  2PWO A;  4J93 A;  4U0C A;  4XRO A;  4PH2 A;  5HGN A;  2V4X A;  2M8L A;  4INB A;  1M9D C;  3NTE A;  4B4N A;  1AK4 C;  2WLV B;  2GOL B;  5HGL A;  2KGF A;  2JPR A;  2M8P A; 
#chains in the Genus database with same CATH topology
 4QNB A;  3BP9 A;  4PH3 A;  4U0F A;  2PWM A;  4E92 A;  1U7K A;  2XGU A;  1QRJ A;  1G03 A;  1EIA A;  2X82 A;  4WYM A;  4XFX A;  2XDE A;  1M9F C;  4U0E A;  5HGO A;  1AFV A;  4U0B A;  4DGE C;  2XGY A;  5HGK A;  1M9Y C;  4E91 A;  5JPA A;  4U0D A;  2X2D D;  4DGA C;  1M9E C;  3H47 A;  3MGE A;  4NX4 C;  4PH0 A;  1M9C C;  4HTW A;  3P05 A;  1E6J P;  5HGM A;  2M8N A;  2XGV A;  2GON A;  3H4E A;  4XFZ A;  1P7N A;  2LF4 A;  1L6N A;  2EIA A;  2X83 A;  4XRQ A;  1GWP A;  1D1D A;  2PXR C;  2WLV A;  4U0A A;  4XFY A;  4LQW C;  2Y4Z A;  1EM9 A;  1M9X C;  2PWO A;  4J93 A;  4U0C A;  4XRO A;  4PH2 A;  5HGN A;  2V4X A;  2M8L A;  4INB A;  1M9D C;  3NTE A;  4B4N A;  1AK4 C;  2WLV B;  2GOL B;  5HGL A;  2KGF A;  2JPR A;  2M8P A; 
#chains in the Genus database with same CATH homology
 4QNB A;  3BP9 A;  4PH3 A;  4U0F A;  2PWM A;  4E92 A;  1U7K A;  2XGU A;  1QRJ A;  1G03 A;  1EIA A;  2X82 A;  4WYM A;  4XFX A;  2XDE A;  1M9F C;  4U0E A;  5HGO A;  1AFV A;  4U0B A;  4DGE C;  2XGY A;  5HGK A;  1M9Y C;  4E91 A;  5JPA A;  4U0D A;  2X2D D;  4DGA C;  1M9E C;  3H47 A;  3MGE A;  4NX4 C;  4PH0 A;  1M9C C;  4HTW A;  3P05 A;  1E6J P;  5HGM A;  2M8N A;  2XGV A;  2GON A;  3H4E A;  4XFZ A;  1P7N A;  2LF4 A;  1L6N A;  2EIA A;  2X83 A;  4XRQ A;  1GWP A;  1D1D A;  2PXR C;  2WLV A;  4U0A A;  4XFY A;  4LQW C;  2Y4Z A;  1EM9 A;  1M9X C;  2PWO A;  4J93 A;  4U0C A;  4XRO A;  4PH2 A;  5HGN A;  2V4X A;  2M8L A;  4INB A;  1M9D C;  3NTE A;  4B4N A;  1AK4 C;  2WLV B;  2GOL B;  5HGL A;  2KGF A;  2JPR A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...