4PH2A

Mature n-terminal domain of capsid protein from bovine leukemia virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
127
structure length
127
Chain Sequence
b'PIISEGNRNRHRAWALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSLTAAIAAAEAANTLQGFNPQNGTLTQQSAQPNAGDLRSQYQNLWLQAWKNLPTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLV capsid - N-terminal domain
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
total genus 46
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4ph2A00
3P05A 2GOLB 4PH0A 2XGYA 2KGFA 1EM9A 1G03A 4J93A 2M8NA 4DGAC 2Y4ZA 4XROA 5HGMA 2X82A 2GONA 1M9EC 4XFXA 1D1DA 1U7KA 2XDEA 1AFVA 2LF4A 1M9DC 4U0EA 1E6JP 2PWMA 4E92A 4XRQA 5HGLA 3BP9A 1QRJA 2PXRC 2X2DD 4E91A 5HGOA 4XFZA 3NTEA 1EIAA 4XFYA 4U0FA 4B4NA 4DGEC 4U0AA 4U0BA 5HGKA 2JPRA 2XGVA 4U0CA 1AK4C 2XGUA 4WYMA 2EIAA 1P7NA 4HTWA 4PH2A 1L6NA 3MGEA 5JPAA 4LQWC 1M9FC 1M9YC 2PWOA 2X83A 1M9CC 2WLVA 2M8PA 4INBA 4U0DA 4NX4C 3H47A 2WLVB 4PH3A 2M8LA 1M9XC 3H4EA 4QNBA 1GWPA 2V4XA 5HGNA
chains in the Genus database with same CATH superfamily
3P05A 2GOLB 4PH0A 2XGYA 2KGFA 1EM9A 1G03A 4J93A 2M8NA 4DGAC 2Y4ZA 4XROA 5HGMA 2X82A 2GONA 1M9EC 4XFXA 1D1DA 1U7KA 2XDEA 1AFVA 2LF4A 1M9DC 4U0EA 1E6JP 2PWMA 4E92A 4XRQA 5HGLA 3BP9A 1QRJA 2PXRC 2X2DD 4E91A 5HGOA 4XFZA 3NTEA 1EIAA 4XFYA 4U0FA 4B4NA 4DGEC 4U0AA 4U0BA 5HGKA 2JPRA 2XGVA 4U0CA 1AK4C 2XGUA 4WYMA 2EIAA 1P7NA 4HTWA 4PH2A 1L6NA 3MGEA 5JPAA 4LQWC 1M9FC 1M9YC 2PWOA 2X83A 1M9CC 2WLVA 2M8PA 4INBA 4U0DA 4NX4C 3H47A 2WLVB 4PH3A 2M8LA 1M9XC 3H4EA 4QNBA 1GWPA 2V4XA 5HGNA
chains in the Genus database with same CATH topology
3P05A 2GOLB 4PH0A 2XGYA 2KGFA 1EM9A 1G03A 4J93A 2M8NA 4DGAC 2Y4ZA 4XROA 5HGMA 2X82A 2GONA 1M9EC 4XFXA 1D1DA 1U7KA 2XDEA 1AFVA 2LF4A 1M9DC 4U0EA 1E6JP 2PWMA 4E92A 4XRQA 5HGLA 3BP9A 1QRJA 2PXRC 2X2DD 4E91A 5HGOA 4XFZA 3NTEA 1EIAA 4XFYA 4U0FA 4B4NA 4DGEC 4U0AA 4U0BA 5HGKA 2JPRA 2XGVA 4U0CA 1AK4C 2XGUA 4WYMA 2EIAA 1P7NA 4HTWA 4PH2A 1L6NA 3MGEA 5JPAA 4LQWC 1M9FC 1M9YC 2PWOA 2X83A 1M9CC 2WLVA 2M8PA 4INBA 4U0DA 4NX4C 3H47A 2WLVB 4PH3A 2M8LA 1M9XC 3H4EA 4QNBA 1GWPA 2V4XA 5HGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P05 A;  2GOL B;  4PH0 A;  2XGY A;  2KGF A;  1EM9 A;  1G03 A;  4J93 A;  2M8N A;  4DGA C;  2Y4Z A;  4XRO A;  5HGM A;  2X82 A;  2GON A;  1M9E C;  4XFX A;  1D1D A;  1U7K A;  2XDE A;  1AFV A;  2LF4 A;  1M9D C;  4U0E A;  1E6J P;  2PWM A;  4E92 A;  4XRQ A;  5HGL A;  3BP9 A;  1QRJ A;  2PXR C;  2X2D D;  4E91 A;  5HGO A;  4XFZ A;  3NTE A;  1EIA A;  4XFY A;  4U0F A;  4B4N A;  4DGE C;  4U0A A;  4U0B A;  5HGK A;  2JPR A;  2XGV A;  4U0C A;  1AK4 C;  2XGU A;  4WYM A;  2EIA A;  1P7N A;  4HTW A;  4PH2 A;  1L6N A;  3MGE A;  5JPA A;  4LQW C;  1M9F C;  1M9Y C;  2PWO A;  2X83 A;  1M9C C;  2WLV A;  2M8P A;  4INB A;  4U0D A;  4NX4 C;  3H47 A;  2WLV B;  4PH3 A;  2M8L A;  1M9X C;  3H4E A;  4QNB A;  1GWP A;  2V4X A;  5HGN A; 
#chains in the Genus database with same CATH topology
 3P05 A;  2GOL B;  4PH0 A;  2XGY A;  2KGF A;  1EM9 A;  1G03 A;  4J93 A;  2M8N A;  4DGA C;  2Y4Z A;  4XRO A;  5HGM A;  2X82 A;  2GON A;  1M9E C;  4XFX A;  1D1D A;  1U7K A;  2XDE A;  1AFV A;  2LF4 A;  1M9D C;  4U0E A;  1E6J P;  2PWM A;  4E92 A;  4XRQ A;  5HGL A;  3BP9 A;  1QRJ A;  2PXR C;  2X2D D;  4E91 A;  5HGO A;  4XFZ A;  3NTE A;  1EIA A;  4XFY A;  4U0F A;  4B4N A;  4DGE C;  4U0A A;  4U0B A;  5HGK A;  2JPR A;  2XGV A;  4U0C A;  1AK4 C;  2XGU A;  4WYM A;  2EIA A;  1P7N A;  4HTW A;  4PH2 A;  1L6N A;  3MGE A;  5JPA A;  4LQW C;  1M9F C;  1M9Y C;  2PWO A;  2X83 A;  1M9C C;  2WLV A;  2M8P A;  4INB A;  4U0D A;  4NX4 C;  3H47 A;  2WLV B;  4PH3 A;  2M8L A;  1M9X C;  3H4E A;  4QNB A;  1GWP A;  2V4X A;  5HGN A; 
#chains in the Genus database with same CATH homology
 3P05 A;  2GOL B;  4PH0 A;  2XGY A;  2KGF A;  1EM9 A;  1G03 A;  4J93 A;  2M8N A;  4DGA C;  2Y4Z A;  4XRO A;  5HGM A;  2X82 A;  2GON A;  1M9E C;  4XFX A;  1D1D A;  1U7K A;  2XDE A;  1AFV A;  2LF4 A;  1M9D C;  4U0E A;  1E6J P;  2PWM A;  4E92 A;  4XRQ A;  5HGL A;  3BP9 A;  1QRJ A;  2PXR C;  2X2D D;  4E91 A;  5HGO A;  4XFZ A;  3NTE A;  1EIA A;  4XFY A;  4U0F A;  4B4N A;  4DGE C;  4U0A A;  4U0B A;  5HGK A;  2JPR A;  2XGV A;  4U0C A;  1AK4 C;  2XGU A;  4WYM A;  2EIA A;  1P7N A;  4HTW A;  4PH2 A;  1L6N A;  3MGE A;  5JPA A;  4LQW C;  1M9F C;  1M9Y C;  2PWO A;  2X83 A;  1M9C C;  2WLV A;  2M8P A;  4INB A;  4U0D A;  4NX4 C;  3H47 A;  2WLV B;  4PH3 A;  2M8L A;  1M9X C;  3H4E A;  4QNB A;  1GWP A;  2V4X A;  5HGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...