4PH8A

Crystal structure of agga, the major subunit of aggregative adherence fimbriae type i (aaf/i) from the escherichia coli o4h104
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
HHHVTNDCPVTITTTPPQTVGVSSTTPIGFSAKVTTSDQCIKAGAKVWLWGTGPANKWVLQHAKVAKQKYTLNPSIDGGADFVNQGTDAKIYKKLTSGNKFLNASVSVNPKTQVLIPGEYTMILHAAVDFDNKQGGASQQTTQTIRLTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aggregative adherence fimbrial subunit AggA
publication title Structural Insight into Host Recognition by Aggregative Adherence Fimbriae of Enteroaggregative Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli o104:h4 str. c227-11
molecule tags Cell adhesion
total genus 31
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ph8A00
4PH8A 2MPVA
chains in the Genus database with same CATH superfamily
4WK2B 3CFKA 1E6OL 2DIBA 4H1LA 4L18A 4FOMA 3BWAB 4N90D 4UYPA 3T0WA 1F13A 1ZEAH 4RVBA 3X12A 4WSGA 3GC3A 3O2VL 4KU1A 1OGPA 4OFYA 5C07D 3WUWB 2YD8A 3KW8A 1TUPA 1E43A 1EDHA 2GJ6D 3NJFA 3NJKA 3QDME 5IB2A 4QRRB 1DBKH 1LD9B 5I66A 3BPOC 3LD8B 3L3OB 1P84K 4K71C 4YWGH 3LKQB 5I1HL 3BVNA 3LIZH 5E1AB 4ZPTB 1D7FA 1DQQA 2PR4L 4HS6B 4U6YA 2CBQA 1NM9A 1G1OA 1LO2L 4PS3A 5EU5B 2EIEA 2YEVB 3DUHA 4I18B 4BFOA 1M1XA 2PABA 1HCZA 5FA3B 2EH8H 2EIJB 3DARA 4N2EA 4PR5A 2BMKB 4UB0H 2YR3A 1MCEA 1KPVB 4KKQA 3UROR 1IC7H 4MNQE 3F7QA 3FCTA 3I9IA 3SCMA 4GYBA 2MSPA 3MUZ1 2J71A 3BKJH 1HQRA 5J6GB 1EIBA 2APXA 4N0UE 3Q9QA 1NPJA 2E7LC 3VACA 2DLHA 2NOYA 3BC9A 2AVFA 4WW1B 4DVRH 4X5QA 3DIVA 5FUZL 1JGUH 2UZIL 3ZL1A 3INUH 3BCFA 2X38A 1E2ZA 2XX1A 4UV7H 1RZGB 2UYLB 5FUCC 1IB5A 1IQWL 1NBYB 4FXGC 4LQFL 5EZIH 2K8MA 3SPVB 4R7LA 5SX5K 1G4MA 3EFFA 2XSKA 2AANA 5I82A 3Q1EA 1CD1B 1E27A 5AKSA 1I1RA 2ATPA 3DROB 1AR2A 3ZUNC 3NOIA 1SJEB 5C2UB 4C4BA 4RIRB 2HUEA 3T1FA 5BO0D 3HS0B 3S37H 2YXMA 1HDMA 2APTA 1AVAA 5BZDB 1TPXC 5GSRB 5C0IA 3SE4C 1XGYL 3P9MA 3S3JA 4PJGB 2BSSB 1XVSA 1L0QA 1JJUA 1K3ZA 2DYPA 1BBDL 4W1TA 4JO3L 3V7MA 1KCUL 4MQSB 4F2ME 4OSUH 4D0CB 2X7LB 3ALXA 2APVA 4GXFA 2QPUA 1CK0H 1PF3A 4FDWA 1HXYA 4R4BB 3H4HA 3S37X 3A4DA 2R9HD 4FXGA 4OF6A 4UOW1 4X6CE 5E6RB 2WLIA 4MA3B 1XZ0B 1QQDA 3GHEH 4A2GA 2YA1A 1J1OH 1JHKH 1N0LB 1Y18A 1DN0A 3VGEA 3DWTA 4OZFA 1Z1WA 4Z7WA 3RPIB 3V0VA 3ULSA 2GHWB 4NQXA 2IGTA 4U1IA 2EYSB 4P5MA 4B7IA 3EHBC 4ODHL 1Z0NA 4KXAA 3VFTB 4N0FB 4DO5A 1PZ5A 3NSFA 1QUPA 4CMHC 1XD0A 5EG6C 3OBAA 3BKML 1VFBB 1IGIL 1WFNA 4PJBA 4PTTB 2HG5B 4R4FL 3EYOB 1E5UI 4QRPE 1D5IL 3OMIB 3IDJB 3NVQA 4JQVC 3RQ3A 2HA1A 1N18A 3N04A 2J55A 2F8IA 1SPDA 2XTJC 4D94A 1E6JH 4PLKD 3UZQA 3LVEA 4LNRA 5A3ID 3PGDB 2Y7QB 2OTPA 2VLRD 1JNNL 1RK0A 4NWUH 3HC3L 1ZSDB 4JE4B 2C3VA 1TVHA 3VXUD 1MF2L 4LBAA 5TF0A 3U4KA 4P5TD 4ZMTA 4A6YL 4MNGB 3D85D 5AZEH 2WZ6A 1BIIA 3TEYA 2F18A 1YY8A 3VWKD 2PPDA 1MCPH 1CFVH 1RU9L 2CXKA 1RD6A 4Z7QF 2OMWB 2PR9A 5FYJE 2C9UA 2YMTA 2HPTA 3VFPB 3P0VL 5JHLL 4PY8I 2Y36H 1AOHA 3Q6GL 5DDHB 5A2AA 3ARVA 3QO1A 3RTQC 2GK0B 4ZFZA 4DTGL 1ZPLA 4WV1B 3CUPA 4YHYC 5GGTL 4L4TA 1W0WA 3QH3B 1G0YR 3GI8H 3IJ7A 4JQVA 2YGOA 1WZ1H 2YUXA 1EUTA 3G5XB 3D25A 1AI1H 5HYJA 1O6SA 2VQ1B 4AMXA 1ACYL 1HHHA 2ARJA 3QO0B 4KGJA 3KXFA 3T0BA 4G71B 4ANWA 1DSFH 3FCUB 4JGUA 4KGLA 3MACH 1IEAA 2E5EA 2NY7L 2PYEE 2WNXA 5F1IB 4G5AA 1UH2A 5CGMA 5AW0B 1J05B 4TLTA 4XOBA 3F7LA 1YNTB 1BQ5A 2IOIA 4N8VA 5IT2H 2L7QA 4U7MA 3WMSA 2VXVH 2KQMA 4IMKC 1YJDL 4GW1B 2AMGA 3LRLA 2OXGB 1TETH 2OMZB 3Q8EA 2GBVA 1Z32X 3F58L 4JRXD 1EANA 1S7UA 1W72B 3K2UL 4JJ5A 4WRLA 4AYFA 5JYMA 5MEOB 4KQ4H 4JB9H 4ZAKC 1CQYA 1DEEB 2I9TA 1BBJB 1S9KC 3QDJE 4R3SB 1MY7A 3R06B 2W07A 4OCRH 5AUMA 3DTXA 5CIPA 3GRWA 5EPMA 5C0GB 4P46B 3UP6A 5BV7B 3U9UA 1JXJA 4R5XA 1JE6A 3Q01A 2B0SL 4LVEA 4N2IA 4N0YH 2B4CH 3L48A 2ED6A 4F91B 4FEMA 4D3CL 4BWUA 1XGPA 3ZDYF 4P2RB 4ZZKA 4UAOC 1ZS2A 4L37B 4GI9A 4IDJL 1BQRA 4HHAB 4QRTB 2R27A 3GI9H 4B9ZA 2OP4H 4FTVE 3C09B 4MD0A 3LRGA 3R8QA 3PAYA 4N2GA 2ZXAA 4QTHB 3SQBB 5J13C 3GWJA 3IAGC 3IXAA 1A3RH 5CWSB 5EOTA 3VGDA 6FABL 1PKOA 1CBJA 2E76C 3GMPB 3O6FB 4LCWE 3I9AA 4S1RL 2EVIA 4NQTA 4ZAKA 4MB3A 3K2KA 4FXKB 4PGEB 1YPZF 1IL1B 5KSAD 1GTFA 3FRPG 3AY4C 2V5RA 3EUUA 2R4SH 3EBHA 3KJ4B 4KI5C 3VI3A 2F1EA 1A9BA 5E7BA 3Q06A 4Y16B 2R29A 2X44D 4ODVH 3FNKA 5C9JB 5IEKA 3BPLB 5HGHB 1ZV2A 2NY4C 4F1ZA 3DGGB 1CU4H 3RWGA 4F7EB 3PWPE 12E8H 3RKDC 4F57H 4J8RA 3BAWA 3NACH 1IAKB 1WJ3A 5IMKB 5HHOB 1C7SA 1BQKA 3DRTB 3WFEL 3ILQD 2CLZA 4BFIA 4Y19E 5FGCB 3QHZL 5I16A 5G4MA 1HIMH 5E8NB 1WISA 5FYKD 4IW4C 1AIFB 1OP4A 3BN3B 1CG9B 4X8JB 5INDA 2Y7LA 3LZQA 1KXTA 5I8CA 1TZ8A 1HSAB 3OAUH 1SHMA 4ANVA 5B3JF 4JPSA 2KHAA 2VDNL 3MJ9A 3P0YL 4QTIH 5FC9A 5D7JB 1FGVL 4CJ0A 1JOIA 4QCIB 4HMCA 4Q7DA 4NQEB 1JGEB 3AY4A 3GB7A 5C0ND 2J8UB 3RJOA 2ARJQ 4BH7A 3ARXA 4C59B 1JCVA 4OZGE 3SJVD 1AXIB 2YPVL 2WTRA 1GW0A 1PIGA 4RGMB 1WPCA 2YKLH 4LASH 4Z7OE 4XC3L 2FX7L 4QXVA 3WJMB 3VNYA 4L3EE 3FT2B 2LV4A 1FNHA 3DPDA 5AEAA 3J2PA 2IXQB 4OLUH 3EDFA 1SJXA 1JUFA 2W1NA 2B2XH 3BFWA 4XCFH 4N3UA 3BT2H 2EUVA 1D6EA 3F00A 3T0DA 1FN4A 3RHWK 1JGVH 4OJEH 2O6EA 1F18A 3MCKA 3F7KA 5IW6B 1WZKA 1KJ3H 2R9HC 2J88L 3BEWB 5J8OA 2X2IA 2DQMA 3FU5A 2AEPL 1OTTD 3ZKMD 1RZIA 1DCEA 3Q1SL 4UT6A 2FT8A 2DTML 3M1OA 1E5YA 1JRHL 4OZIE 4DO6A 1MRFL 2NX5E 1L9QA 1MZZA 3DUUB 4Y1AB 4BQ9A 1KF9B 3MRPB 5TE4L 4G9DA 7TAAA 4B5ZA 1FZOB 3LJ3A 2Q7NA 5CHNB 2Q86B 1BVNP 2QKIC 3IJ9A 3L3JB 4OM0H 5F3HB 4CC4C 1MXDA 4Z95L 1R24B 5KSBA 2KLTA 3IJEA 1A0QH 2R8SL 3INOA 1MWAL 4EDXA 4N6RA 5IB4B 2Z6FA 4HJIA 4MQ7B 4XT1C 3TX4A 2H4EA 1XV8A 2LTQB 2A6DA 4CKVX 3F7YB 2RCSH 1ZK9A 2DQTH 3MLYH 3ERXA 5IW1B 5JQ6L 2ZD0A 2TAAA 3CFJB 2Q0ZX 2J8OA 3NCCB 5HDBB 4BFGA 4BRVA 2CM6A 1A21A 3UTSA 3MRQA 4G11A 1DCLA 4HV8A 1QD0A 5D6DA 3B3IA 1BFSA 2AJXL 1B9ZA 4OD3H 2XV6B 3EO0B 3BP7A 3FUJA 3BVUA 4PW3A 3RNQA 3SDAB 2WC7A 4XPHL 3MODL 2AXGB 4Z7WF 2G5BA 1R5IB 3JQOB 5T5FL 2VM9A 4MNHA 2QDWA 3ZLQC 1NDMB 1IKNC 2QKIA 1XCWA 2WVTA 1M6UA 5DMKB 1FP5A 3MTRA 3OB0K 4JG0L 4CC4A 5I19H 3KPTA 1K2DB 1ZV9A 1JZ5A 1MCNA 3S8GB 2IGFH 4PJBF 4QXTB 5HJDA 2MPAH 3RP1A 5FCUL 1PJWA 5TQ0H 1SRDA 3EYQD 3H3KA 4GBXB 4Y7MA 2HN7A 1T4KB 4QRFA 4P46D 4R90L 1N8ZB 1FLTX 1SQMA 3QDMA 4OZHB 4BFEA 3KDMB 5D1QD 4DFHA 3WSQL 4JFHE 3HC4H 1T22A 2HWZL 4FE9A 1PNDA 2F58H 5DJZA 5FO7B 3UTZB 3U0PB 3D39E 4ZTPL 1Z0MA 4YR6B 4ZD3L 4TQIA 3BDYL 3FQUB 3HNTL 1B3IA 4P2RD 5ECJE 4NM8H 4EIGB 2O6PA 4V33A 3WEXB 3BLPX 4XPBH 1CXHA 5F1NA 2BVEA 3IDMB 4PD4J 3FSAA 4P59L 3LD8C 4AGNA 1UKSA 2BVOA 1QI4A 1MPAH 3IMUA 2UX7A 1D6VH 1HHIA 1LEGB 2JJSC 3NIDB 5E08H 3BSGA 4PJ7E 4G8EB 2GI0A 4UAHA 3CFNA 4AGMA 3N42F 3ULVL 3TBWA 1P4IH 1IGYA 3RGBA 4AL8H 4JM4H 5IVXE 1H6TA 3CC5B 3PFUA 3VUAA 3KPLA 1C12B 1AZCA 4CSPA 2W9EH 4V1DB 2G30A 1IZJA 3WDJA 1B4RA 1PD1A 3U2JA 1REIA 3MJ7B 4HK0A 4JFQB 4DZ8B 1T83C 5CNHA 4HOZA 2Y5EA 2L0DA 5C6TL 4U49A 5JXEA 5D2LE 5DFWH 4A38A 2EDOA 2F6AA 1TKWB 5GGVL 2E6PA 5SWZE 1JVKA 1BQSA 4HS8L 1KCVL 2XVKA 5BZZA 3REWA 2YZ8A 3FMGL 4HJ0C 1T21A 2WNWA 1KELL 4FFTA 4HZLB 4UIMB 3X14B 1O7VA 5KSAC 1D5XA 4B9CA 1VLXA 1UFGA 4PQXA 3FU6A 4GSDH 1A22B 4ZOCA 3S9DB 4WFHD 3U0WL 4X6EB 3OAZK 1XTMA 4I1RA 3HLKA 2OYLA 1NCCH 5J3HC 5K69A 2OTWB 4F7KA 1F3DH 2GITB 1QR1B 1YN6A 4EN3B 1OHZA 1INQA 1JK8B 3NA9H 3C60B 4PG2A 2VDLH 2XN1A 2OZ4A 1UG9A 2HJFA 1QP1A 3GK8H 2K7PA 4YL4A 3L5IA 2N59A 3DX7B 2D4FA 1KENH 2V6HA 2WYHA 3HMWL 3ILQC 4X6CA 4XN7A 2VZ1A 4QO1B 1T83A 3FULA 4LHUB 1A6PA 3O6KH 4I48B 1NIEA 4FL4C 4Z23A 1SDAB 5I1CL 4WI3A 4OF5A 4WNJA 2X41A 4ELME 1BMWA 4NPYA 2GJJA 1S7SA 2DMBA 3K6DA 1HL8A 1BPVA 3OZKA 3AB0B 5LBGA 2VB5A 4KKAD 2V2TA 4QRPA 5C0NC 1OARH 1W15A 2RALA 5DZPA 4Z3GA 3IGKA 2ZX6A 4YHIA 1DQML 3BE1L 1R19A 1IV8A 1JPGB 3LKRB 5CILH 3LEVL 4Y1AD 1WEJL 1F42A 4OIIL 3V6BR 5CM1A 3VI3F 2VC2H 5ADPL 4UM8A 3R1GL 4YLCA 4MAUL 4UU9B 3CTTA 4LE8A 1VFUA 3CMOH 3MBWA 5MERA 4Z8FL 1DJSA 2QSTA 3AG3B 3MROA 4KDWA 3BUYA 3QDGE 3FOMA 5E8DL 1SVZA 2KZ1B 2VQTA 3DV4B 5E2VL 1WBXB 4FFZA 4JGNA 4N5UA 1X5ZA 1KLGA 3DHUA 4C55A 4HIQA 3RWHB 2Y23A 2E6JA 2X1QA 2VMJA 5CSZA 2GTZB 2QR0B 3ORJA 4YHMH 3V0WH 1A9EB 1CL7I 2EDBA 2FB4H 3HN3A 5E2TL 2YAHA 1OP3H 3VE0B 3FQYA 2ENYA 3I75B 5DMGC 1AZBA 3SYOA 4YHNB 1CXIA 3MO1A 1ICTA 2Z31D 3SDAD 1A6TB 1GYAA 1FWXA 4QAMB 1T1WB 2E75C 3Q2VA 4B9FA 4NQCD 5GSVB 4GQPH 1DVZA 4TQPA 2OL3L 3SBWC 4YHKL 1SMDA 1DZ0A 3PJSB 3N9GH 1HZKA 4Y4FC 1OK8A 3B6SA 3EJUA 3GTVA 3SE3C 5SWQA 4CNIB 1EX0A 4DVBA 5KG9B 3NUKA 5D5ME 1DANU 4G8FA 4X7SL 4IU2A 1P6AB 2FL5A 2EH7H 5D6CB 1KEML 4GBXD 4FMVA 1U36A 1I1YA 4MFHA 1D9KD 4WWOA 4HOWA 2VABA 4YGAB 5A2KH 3WD5H 2XHNA 4UT9A 1UB6B 4QHKJ 3SDCB 2H32A 1IGCH 5FS5A 3ME0A 1E8XA 1OAQL 2WIIA 3QQ4A 1TNMA 4HKJA 1LE5B 3QDJA 3C75A 4NYLB 3RWEA 3ESMA 2ID5A 5SWSB 4JFDA 2Q8AL 1XL4A 3BCDA 1Q72L 3O3UN 4NCC2 3DHJA 4Q6IC 4HKBA 4QTFA 1QAWA 3A4AA 1NTDA 2GTWA 2P8MA 4NC1C 3RL2A 2ADIB 4Q9QH 5LUMA 3HNSH 1QX1A 1P7HL 1H9DA 5GS0L 1AHMA 4NS0A 4TQEL 4GH7B 3Q3GA 1PY0A 1ZWIA 1AGCA 4TLKA 4LPWA 3RI5F 3V4VA 1KEGH 2FHCA 3MRDB 4UQ9A 4EIZC 2O5XL 1JXKA 1ZY9A 3BVTA 1K6QL 1JPFA 1A4KA 4FQQB 4LP4A 4Y4FA 1I3UA 5I8OL 3GJFB 3ZE1E 2YO3A 3SE3A 5KSBF 5IM7A 5D1QC 2OMBA 4EPSA 4HU2A 4X4XA 1F90L 2FJFA 4OAWB 5CJOL 1YQ2A 2VAAB 3VYOA 4LVHB 5DUBA 3KG5A 4TSAH 3OPZL 4A67A 1T7VA 5IQMA 1I53A 4EOWH 4HG4K 3IF1B 4LXFA 2J6WA 4V1DD 1BA9A 3QUGA 2X2UA 2KZKA 4ANUA 2YPLA 3QXVA 3RZWA 1H9VA 5HHPA 5I1GL 3DOIA 2AJZB 2ZXQA 2DD8H 3BIBX 4GXUM 5IFJA 1AFVH 3FT1A 3WUWG 4NJAH 2OJZL 3DJRA 4Y4HA 3HJEA 3SKUD 5JW3H 5K1JA 2AI0L 3ZXAC 4IU3A 3U36A 2MEJB 3ZDYB 2A9CA 4HCRH 1DBAL 1TO4A 5A2JH 5DA0B 2WAQA 4F9LC 3B8YA 3PGCB 4HLZH 3OKOA 4WHYG 5F3FA 2CIIA 3IVKB 4XPTL 4U3XA 1MCWW 4DFIA 1S5HA 2EAEA 4U3SB 1RK1A 1CGWA 3RZCA 1NGYB 3IU3B 3MV7D 3KJ4C 3TA3B 3VXRE 1SHSA 2BW5A 4G6KL 4Y19A 5JR1H 2D7OA 3JVGC 4LLWA 1XGTB 5J57B 4CUCA 5AVUB 1S9WA 4EN3D 2VW6A 1F6AB 3C60D 3DVIA 4MVBC 4H88L 3EH2A 1YQVH 4Z9KB 4UDTB 1YPZB 4PS8A 4NHUA 1NC2B 3VJ6A 5MI0C 2IV9A 4HWZA 5BRZE 4R83A 1I9RL 1RZ8A 1JZHA 3PXJA 5D1ZB 1F4YL 3K4ZA 3NSDA 1BVNT 4RAUB 3O41B 4YSEA 4LHUD 1ZE3C 2BSRB 3GRGA 2OA9A 4GXVH 4K8RH 3GBNH 3LN5B 4YDIL 2DQUL 3V5KB 5GS2D 3L7EA 4OCWH 2HX8A 4XN5A 1QW8A 4DN3H 5B3SB 3G6AA 2X4NA 2DQEL 4AM0A 4AJWA 4L5FE 3ZGIA 4O02H 2D7TL 1DVFC 1E3FA 3EDKA 3NRPA 2HYMA 4NBZB 3I2CH 1TEFA 4WIQA 4KVNL 3GSNB 2PXYB 5IB2B 4NZTL 2IDSA 5AZ2L 4RGMC 4NZUH 4K94C 4I88A 2DWTA 4PWKA 4XPFL 3BYYA 4NX0A 2B5IB 2CDFB 2ZP8A 1QLEB 1N10A 3TBYA 1DBMH 4G9FA 2YXVA 3DX2A 1FPTH 4YVNA 1DQQB 3VRIA 4K7PH 2VSKB 3K80A 5GGQH 2X89A 5I1LA 2I69A 5I30L 1FFTB 1UWXH 3U1SL 4OZIA 2NW3B 1JGLH 4AEHH 2UXGA 2YSSA 3WFDL 2XXCB 4RBPK 3AQZA 4PR5B 2WTPA 1SY6H 3PUCA 1BHGA 1ZVSB 4CADB 3HE7B 3GMOA 1KC5L 4DGYH 2XIDA 4KKAC 3VFUB 3HBGA 1LP9A 2ADFH 1HQRB 4I0PA 1HFUA 4UF7C 5E8PA 2ZG3A 3ALWA 1EA9C 3O2WL 5LG1A 1DVFA 4YPGB 4K7PX 3E0GA 5D96B 25C8L 1O9VA 4OKVB 3OKNB 2FBJL 2ZG2A 5CGYC 3QARA 1FRGL 2LAGB 4KQ3L 5FHBL 2YUVA 1IAOA 1USQA 2P3YA 4X99A 1J9QA 2XYCA 1LJMA 1ID5I 2A6IA 1BEYL 3HJ0A 5AYUL 3EFFB 5IHUL 4FLHA 4W68A 1L7TH 2I60H 2ZKXA 3OKLA 1MREL 4X6CF 3SPGA 1IBFA 3B43A 1NCBH 2CNZA 3U6RA 1JF1A 2ATPB 4ONGH 1B4LA 3QI9D 1N6QL 2AZUA 1ZGLA 3DIFA 3T1FB 3HUJA 4HIEA 3AY2A 3TPKA 2DQFA 2HLEB 4I3GA 1BD2B 4NKDA 5C0IB 4Z3FA 3NFSH 1I1CA 4P9HH 3P9MB 1PLBA 2K6WA 4N9GB 3SDCD 3NSCA 3EBGA 1FVDA 2BRRL 2ZSWA 4R96A 1AGEA 2Z31C 3SDAC 1EBPA 1NKOA 2GIYA 4QD2E 2X4OA 4GXUN 3F84A 3RE0A 5SWSD 4JMNA 4JO4L 4UOJA 5KOVC 4FD0A 5IZ7A 3BH9A 3QAZB 2YFNA 1B4TA 2QDVA 1RFDL 1T0PB 5B8CB 5C0BE 1CL7H 3ZT5A 4W9KC 5D7KD 4X9GA 1OTUC 2VN5A 2WLIB 3Q6FB 4I7ZC 1QQDB 5BZWB 1BLNA 2H26B 4KZCA 5T3ZD 1GC1C 1DN0B 4Z7WB 3V0VB 2F7IA 5IJKC 1D9KC 1PKQE 1PX8A 2YD4A 4NQXB 5FM5M 4X98A 3LVTA 5F0PB 2I5YH 1F45A 2H41A 3WTTA 4BBWA 4HC1A 1RJYB 1HX0A 5E70A 2CG9X 4AM0Q 4GO6B 2F19H 1ZEAL 4KBPA 6TAAA 5CFAA 1ONQA 4JKWA 4PJBB 3OJ2C 3RWJA 2OMTA 3LS5H 3RGVA 1H6EA 1QEWB 2JKRM 5JW4M 4XZ4A 4PJ7A 2FWLB 1MW3A 2K3TA 2NY6C 4XAKD 3PREA 1EZLA 3EJSA 4X7TA 4JHAH 3KH4A 3UZQB 4LNRB 4E9XA 3SKMA 4E9YA 2W9DH 1RZKH 1DBKL 3WELA 1Y1DA 2V2WA 3OLGA 1X4ZA 2C3VB 5AL8A 5J89A 1M7IA 4YWGL 5I71B 1SLWA 1HWWA 3IB4A 3VQ2C 3LIZL 4K5PA 5EF2A 1MCIA 2A6JA 1T7XA 5ID0B 4OGZA 1J0KA 1SXNA 3AZUA 4P57A 4ESKA 3TA3D 2EH8L 1YMMB 4UB0L 1VCBC 2Q87A 4AK2A 1IC7L 1QR4A 2VWEC 3L5HA 5DZLA 5AVZB 2DBLH 3W9EA 1AO7B 3QO1B 4PGBB 4C4KT 3L3IB 3BKJL 4U6TA 1BXUA 2XACC 3CUPB 1A64A 4ODTH 4O9HH 4L4TB 4X2UA 4Y89A 1W0WB 2YSTA 4L3CB 4PI0A 5HYIA 3C5SA 4YBHA 4XP6H 1PCSA 5D1ZD 4DVRL 3L81A 1RSFA 4TUOB 1L9MA 1MXGA 1DQJB 3TXAA 3UDWC 3D25B 5HYJB 1JGUL 3GLAA 3RYMA 4M43H 3K91A 4BUGA 3INUL 2ARJB 5HI4D 3KXFB 4M03A 4CW1B 4EIBA 1RPUA 4HYTB 4UV7L 3CX2A 2FD6H 1AD9B 4ZMXA 4LKCB 3QEGH 5EZIL 3B9DA 1FH5H 1J5DA 1U42A 4U7KA 3HNVH 2ICEA 4Y5XB 5DRXB 5IFAH 1X44A 3BP4A 1X5FA 1QW9A 3NZHH 1G9MH 2VIRA 2PXYD 2NYZA 1XH0A 2OSLA 4Y9FA 4BFFA 3RX8A 1BVLA 1Q9KB 3SIKA 3O3BB 3S37L 2Y72A 1MJ7H 3CFBA 1AR1C 1XL6A 4JJ5B 2HFTA 3QYNA 3ZDWA 1BM7A 2PMZA 3FSVA 5DI8A 3TYFA 5I1EH 4TMPA 5IVZB 2W07B 1G7IA 4CRPA 5EPMB 2E9GA 3DJTA 3BPCA 2YRLA 3WEBA 5JDJA 2ALAA 2ISDA 4OSUL 4H20H 3PNWA 2LU4A 3LSOA 1CK0L 4OQTA 4ANKA 4PJCA 1DE4A 1D7DA 4KKBD 5J0BA 4MJ6B 2XYBA 3HE7D 1FO0A 4A37A 1MLBA 1T6BX 1IRAY 2EDYA 1DTUA 3FSZA 3ZSTA 3GHEL 2VDOH 2DQIH 3EG9A 1J1OL 1B3JA 1JHKL 4MD0B 1JNJA 5IJCC 1KJ2H 2IBZX 1CGTA 4WI9A 3TL5A 4FA6A 1JZ2A 4XHQA 3MR9A 5I28A 3IXAB 1KTDA 1PFCA 1RUMH 4AW4A 3FCBA 3FO0H 5E5MB 4QY8B 1MH5B 2F74B 2Z65C 4PG9B 2CR3A 5IESH 4JY6A 4K3DH 1U4FA 1VFOA 2VDMH 2X6CA 4XZUA 1HSBB 1KIQB 5IJVB 4D0DA 3NCXA 1GZPA 4MDIA 1T04A 3T71A 3CBKB 1NC4B 5FOBB 1G6RA 2XFGB 4JY4A 1FAIH 1FHGA 2DQHH 2YC1A 1T89C 3NQIA 1A9BB 1E6JL 3VI3B 2DJ4A 3FT9A 3NJHA 3L4TA 4NBXB 3UTPD 1LE9A 1RY7B 4NWUL 1ES0A 2OR8A 3F04A 3QWOA 4YO0A 5D2NB 2CUHA 3VM5A 4S10A 4TUKH 4LSVH 1S78C 4GRLC 4PUBH 4J8RB 1BD2D 5EOCJ 4JRYA 5AZEL 4Z7OF 5ICZB 1JL8A 4AGQA 3W1ZA 1PLCA 4WI6A 4NRZA 5JW4N 2A0LC 3FTUA 2CLZB 5I16B 1MCPL 1CFVL 2VERN 2LFGA 5EBLB 1MCRA 5I8CB 5INDB 1KXTB 4APXA 4A7GA 1OT4A 1WBZA 4KNQA 5HGAA 1DDTA 2K0RA 2Y36L 3C87A 1CICB 4NQSA 2XCMC 3GJEA 1AP2A 3I3DA 4JDEB 2WTOA 1EHLL 2VXUH 3K6SA 4LLQA 2DJSA 3AAZA 3D7PA 4ZO6A 3LH9A 3QI9C 3GI8L 1X3DA 1WZ1L 1X7QB 5CGTA 4BH7B 1QFUH 2DWXA 4KTEH 4MDJB 5DF0A 1AI1L 1UD4A 4OZIF 4I89A 5ABDE 4WFFD 3T0XA 5IUCA 1JMZA 4CN1A 1DVQA 4Y5VA 3IETB 3T6XA 3GGWB 1DSFL 4FFYA 4RH4A 3U4EA 1X6NA 2NY1B 4GRLA 5FX3A 3OMZA 2E9WA 1ZLWK 3MACL 4RMQA 2FNWA 1LP9F 3VG0H 3B37A 1AE6H 4CVXB 5MHSE 3LPWA 1EGJA 15C8H 2BVUA 3MNMA 1A8JH 1YYCA 1TQSA 1D6EB 3X1GA 5IT2L 4M93B 2N0MA 2UXVA 3TA4D 2VXVL 1NEPA 3BUBA 5E4AA 4ATTA 1F8TH 4B9JA 1E50A 4C58B 1TETL 4OFKA 4PJEB 2JE8A 4WUKH 5DRZA 1PVHA 3CPLB 3KGTA 2RA1A 5C9KA 4NRXB 4KQ4L 4JB9L 3V7AG 1KFAH 4FG0A 3VU2A 2I25N 1WAAE 4OCRL 1TZAA 4LEEA 3MLZH 5GS1C 3H9SB 2P5WE 4HUCA 4L1HA 2X6VA 2Q20A 4PWJA 4LVHC 2D73A 3EZ8A 4N0YL 2QVFB 3B1TA 4XNQA 2B4CL 1YMMD 1T1YB 3S5LA 1F2XK 1ZTMA 4LLMA 1EEQA 4WW2C 5ESVA 5I6KA 3RVTD 2WQWA 1AO7D 3HUJF 2X70B 1SYVA 4LL9A 2EEFA 5EFIA 2WZPD 1X5YA 4LPVA 1P5VA 5F9JA 5TFSH 3GI9L 4N6RB 4AENA 3QEHA 4EDXB 2OP4L 3VMNA 4L4TD 4YDKH 4HMDA 3RHWF 4NN5B 5AB2A 4K3EH 1FGNH 3CXHK 5JTWA 1AZRA 1A3RL 4PREA 1NBZA 3MFGB 3X3GH 1IIKA 4JVUA 1AIZA 4PRPA 3CD4A 1OE1A 1P7KA 3DX6A 4FA7B 3HA0A 1OD7A 4LSUH 3OLEA 4UOW0 2L04A 4PRIA 3TA3C 1OF2A 2QMJA 5GS1A 1XGQA 1LGVA 1BQHG 2R4SL 2Y9RT 5DJ6A 3O3DB 4NQVA 2N01B 1DUZB 3ZMNA 4MNHB 5E9DE 3ARSA 1BFTA 3U6XA 5KYYA 4ODVL 1JWMB 4BSWB 2ZF9A 2X3BA 4WW2A 1CU4L 4L4VA 1YCSA 12E8L 4D8PB 1OWWA 4F57L 2AJSH 3ZPDA 3NACL 1EAPA 1QSEE 1A3ZA 2FECI 5KVEH 4WFEE 4HGMA 3V6OE 4DNLA 4PJ7F 2DIAA 1CGXA 5HI4C 1RV6X 1HIML 1QSVA 3QDMB 4CN6A 2F2HA 2M8XA 5I6LA 2HLFC 4XXCC 2W38A 2Y5TB 5JOPE 5DJZB 1J5OH 3Q13A 3OAUL 3II1A 4HALA 4WHYH 2OK0H 3CVHA 5IOPA 2ATAA 4QTIL 4JVWA 1IO4C 3D0LB 3VH8A 4LIQH 1MQ8A 2NZ1A 3C5JB 3MXWH 2PXYC 3FT4B 4F58H 1XR8A 5G4NA 1PY9A 2D2OA 2DQ6A 1AHKA 3P11H 4M48H 2B08A 3CG8A 1H8OA 2FJUB 4MNQB 2WQRA 2YKLL 4LASL 2AKRB 1LO5A 2D7PA 2EE6A 4IYKA 1HHIB 1ET7A 3EJYD 3ARDA 3IDXH 4N0UB 4DEPC 1MVUA 2BIPA 3NEEA 4OLUL 1ZXQA 4ZO9A 3S5YA 3TN0D 4XCFL 2B2XL 5DD3H 3BT2L 4LHUG 3TBWB 1NC4D 5IKCA 4KKBC 1JGVL 3L4XA 1EK3A 4MJIA 2VUOA 1KJ3L 3VFVB 1PLAA 4R0LC 1CPUA 1EJFA 1AY1H 4XXCA 1NCHA 4P2QE 1PNCA 1ILSA 1XDTT 2IDQA 2OJ1A 4JFED 3EKCA 2ZWYA 1LO4H 1P5UA 3TBCA 4PJIE 1C8PA 3HE6A 1DANT 3U9WA 1BEXA 5HGBA 1HHKA 4LKXA 4AYGA 4ISVB 4PBXA 4RWHA 3REWB 2QGCA 2VN3A 1JNHA 1WO2A 4ZUVB 5AVXB 1OSZA 2BP0A 2E46A 4KKLD 4OM0L 1CICD 5JIIA 1NOFA 3OMNB 1W91A 3CC1A 1A0QL 3DX9B 4YMPA 3LEXB 5H8DA 3NCMA 3D50A 5FK9A 4Y2LA 5FYKH 2Y1AA 2QGDA 4F2MB 4PV8A 2RCSL 2DQTL 2HJFB 3MLYL 3O2DH 4AGOA 5FV2A 3DBSA 5JPNB 4GIPD 5SV3A 5HHVH 2XXFA 2PW2B 4PJCF 4B3EA 4X6CB 2NY1D 2FLRT 2R1YB 2BVQA 4TN9A 1ASPA 4OD3L 5LHDA 4U0RB 1PKQA 4ATWA 2MQ0A 5D7IE 2WOYA 1CXEA 1XF1A 5BW7A 1KCRH 3RFZC 5IK3B 5JHBA 3FUEA 5E6IB 5L8LB 1KZYA 3FQRB 1X7TA 4HEME 1J9RA 5I19L 1AJ7H 4QRPB 1TYEB 4NO0A 5CLYA 2IGFL 2MPAL 4H8UA 5TQ0L 3CXDH 1NUNB 1QLFB 2CRMA 3H9SD 3APDA 1FZJB 4HPYH 4WDIA 3WY2A 3HC4L 3MFFA 4X4ME 1ZLVH 4C57C 2F58L 1G1KA 3WIHH 4UILH 1U93B 1UXSA 3MBWB 4DERA 5HYQA 4KXBA 3FB7B 1BJ1J 4NM8L 1QKZH 3BDBA 3BUYB 3AMLA 2HMID 4XN8A 5DJXB 3FOMB 4ELKA 4TTDD 4XPBL 5DUMH 5L2JA 1GJWA 1M3JA 4GMTH 4LSDA 3QA3B 4JGMA 3VD0A 2VXSH 3T65A 5HY9B 4NQDE 3RFZA 5I71C 2V5SA 1KXVA 4X6BB 3TIDB 3VI4E 3MNVA 4A7GF 5CSZB 1MPAL 2O6FA 4W9FC 1CZ8H 1D6VL 1FQ9C 4HZAA 4RFNB 3VTAA 5EBWB 5B1BB 5E08L 4XO4A 2WXGA 3RG1C 2JB6A 2BCKA 2PP7A 3TO4A 5D7HA 1K8DB 4I5BA 2C3GA 5T5NG 4AL8L 1P4IL 4A7SA 2EKSA 2E8ZA 1JYVA 2NQCA 3S8WA 4JM4L 4L8BA 4OCYL 3CLFH 3RVTC 5DZAA 1T0OA 4QHNA 1TR7A 1A1NB 2W9EL 4HUWA 4M3JA 1CYGA 2OMVB 3ESVF 3S35H 3EAKA 3ULUE 2PYEB 4P48A 3QJTB 2IEPA 4O5LH 4XRCA 5BMFH 5SWQB 2ZSVA 2D7MA 4S11A 2CA3A 2FL5B 4WWNA 5ADOH 3ZE1F 4PJAE 1I1YB 2D0FA 2VABB 1OB1A 3CSYA 4LCVA 4YIQB 3TBSB 2BNRA 3DVNA 3BYTA 3T4YA 1F3JA 3ARYA 5DGQA 5JA9A 5G4OA 4LT7A 3ZKXB 1U2CA 2ROXA 1W72H 2JI2A 2JQMA 2OFQA 4GSDL 2JV6A 3QWNA 4Y5XC 4LLDA 3QDJB 4MA7H 6PCYA 3S35X 1F4WH 2A5UA 4Z1PA 1YEJH 2DMKA 3WNMA 1NCCL 4JPQA 2CCVA 3APNA 3JV6A 3SGKA 5BV7H 2P8MB 3HG1E 1N59A 3FB8A 4PTUA 3RL2B 3ZX1A 3NA9L 3MRNB 2ZUUA 3N3EA 2YN3A 5B1CA 4F7TB 3QEQD 3GK8L 2XG4B 3Q3GB 1G43A 1HH9B 1AGCB 2C26A 4KHTH 2ED8A 4MNQD 3V4VB 3VFMA 1KENL 1JPFB 1E8WA 2R69A 3OGCB 4FTVB 3O6KL 4XR8C 2E6QA 2ZJSH 1BFOA 5F7YC 3DNKA 2IWGA 5E00B 1GHFH 3T6VA 2XWDA 3IBOA 2XDHA 3HI6H 3QIUD 4GUPB 5A7EA 3ZTEA 2NSQA 4QHPA 1MUJA 4EVNA 1FDLH 1FJ1B 2FYYA 1A4JB 4X6DE 2KLSA 4W9CC 2IG2H 4LCWB 4B9YA 2EDMA 4XNZC 1UC6A 5DT1H 2BIMA 3P9WB 1TCMA 3BQUA 4RMWA 1OARL 5IFJB 5FYLH 3ZDZB 5JXED 2QHRH 3IDNA 4FKHA 3BW9B 4Y4HB 5HDWA 4U31A 3VB9A 2Y4SA 4RAVB 3TFKD 2YD9A 4BZ2H 4PU2A 1KBGH 3QFGA 5LCVA 4J3OD 3A3YB 4UQCA 4MCMA 5K9QG 3LRSA 4L9DA 1XB3A 2VC2L 4FNLH 4HK3N 3OKOB 4NB7A 5F7NC 3VXPB 3PWPB 4M7ZB 4XN9A 3CMOL 3TN0C 1S5HB 1HWGB 1N12A 3LV3A 4JL1A 4WW2F 2O61A 1RK1B 3RZCB 2BNQA 1U8JB 4HGWB 2PKDA 3THMH 4Y19B 1JAEA 3LZNA 2WBWB 4HLJA 1QO3A 2WBXA 3QULB 3TESA 1ZE3H 1S9WB 1Q9OA 4WJ5A 1FSKB 4XVOA 2M1KA 1GMEA 5DVOA 3QCUH 3ZRSA 1U95B 4M8QB 4B3VA 4YHML 3V0WL 3EO9H 1ROCA 1BLIA 1RZ8B 1KJVA 1SOQA 2FB4L 5DK3A 5DR5H 3ESOA 1O7DE 4N86A 3JVFC 2K78A 3ZDZF 1MW2A 1E4JA 3AXIA 5E94A 1KZQA 4DPAX 4OZGB 3GS4A 4Z7OB 3JV5A 5E6ID 4L3EB 5C0CE 2M26A 2IH3A 2RACA 4F37K 4AM0B 3N9GL 2DM7A 4M1CD 1KGJA 4L1LA 3N41F 4IJ3C 5IVNA 4QRPD 3DXAA 1XR9A 1I8LA 2AXFB 4P4KC 2VQ4A 2QKSA 2UY6B 2DQJH 2EH7L 5I0VA 5T33H 3AREC 3U30B 3SSGA 5D4QA 3H0TA 3IJHA 3WD5L 3L9EA 3EXLA 2D4DA 4HG4J 4A55A 3WNNA 1IGCL 5DZJA 4KVCH 4X7EC 3VRIB 4N1EA 1MVFA 1QVOA 4JO5A 4WGKA 1QLRA 4JFSA 5ENWA 4OZIB 1UWFA 2P5WA 2NX5B 4I4WA 2YSSB 2VMEA 3KPOA 3OJDB 4Q9QL 3BZFA 1KN4H 3GMOB 3HNSL 1E4WH 1FFNB 3TP4A 4MA1C 2F7PA 5ICXB 3KS0H 4YK4B 3VX0A 1E7VA 3PXHA 1KEGL 3HHMA 4M6OH 3TVMB 4R7XA 4OR1A 5E8PB 5LKNA 3KPQA 1O5DT 3BJLA 5KBPA 3H6AA 3IU4H 4N2AA 1N7MH 1INEH 4P4KA 3O4OB 4XB7A 4ZUWA 1GGUA 3F3HA 3TZVA 3AREA 3U4AA 2WXLA 3NFPB 4TSAL 2EUWA 1IAOB 5KVDE 4B50A 3KVPA 4EOWL 2A6IB 4RMUA 1JZ4A 3B2VH 2CALA 4IKKA 4QOKE 2C3XA 4EEEA 2G3ZA 1SMAA 3CFTA 4N26A 3IGAA 4DP5X 5JMOC 1YG9A 2DD8L 2PYED 2B1OA 4Q2ZA 1AFVL 5DJAA 4NJAL 1JV5A 1U8IA 3U6RB 1JF1B 5AVTB 5JW3L 4GLRI 2KLRA 2J72A 3ECBB 4ZMQA 1T0NB 4HCRL 3UTTE 4HIEB 3LHAA 1YNKH 1UD8A 2RAMA 4DO4A 4D8OA 4MAYB 1FVDB 1WDAA 1F1GA 2ZSWB 3VSUA 1H19A 3E6FA 4R8WH 4AIZA 2IH9A 3C2AH 2FZ3B 4J6IA 5EIVA 1JZ3A 4AW7A 1XH3A 5JR1L 3TF7C 3HI5H 2QVMA 4ONHB 5I1AB 2VITA 2XXGA 3BH4A 1N64H 3D39B 1YQVL 2GSIB 3MC0A 4ES8A 1Z3GH 3ML9A 1OGAD 5L2KA 2BFGA 2HPOA 4NO2A 5GZND 1XSKA 5ICYB 1KY6A 4MXQD 4W9DC 4FTVD 4X98B 5CF3A 3CN0A 3IAPA 4GXVL 4LCYB 4K8RL 3GBNL 4E41E 5HI3D 5F89B 4XBPA 4P2OC 1CI5A 4RGNE 3GDBA 4M8UA 4OCWL 4DN3L 2CSPA 1EZUA 2BM3A 5JHDE 2VR3A 2WLZA 3FFCE 3RWJB 1ETZA 4LCWD 4O02L 3UZVB 3ABLB 4PJ7B 4FP8H 1FFQA 2IAMA 4N0RA 3I2CL 5BZXA 5CD5C 4M4RA 5IWLA 4NN6C 3AWEA 3ZO9A 4KKZA 3H3PH 3BKCH 6PAZA 4X8XA 3SKMB 2AP2A 5IVXB 4HWBH 1M2VB 3WS3A 5LLIC 5D1ZI 4NZUL 4YS4A 5CS7A 2B9AA 1M7IB 4J1UA 4HZ1A 1GYUA 1DBML 3GBEA 2DAVA 1FPTL 2C9XA 4K7PL 3PWPD 2NPLX 1FG2A 5GGQL 3WJLA 1IM3D 2FE0A 4KXDA 3B2UD 5HGGS 5I76B 2GTQA 2OI9C 4PJIA 4XBMA 5D2LB 3UJJH 4BKSC 4J12A 4OU3A 1ROWA 2NY0B 2EE2A 3GS0A 3QIUC 1JGLL 4AEHL 5FLVA 2WVVA 5SWZB 2YEQA 4YFDB 1SY6L 5JW4R 1BOGA 1KV3A 4P2OA 3RZCD 3FO1A 1FH2A 3WN5B 2R2BA 4DGYL 1XIWB 3DPBB 1GGIH 2CMRH 1B0WA 4JG9A 2ADFL 5K9QI 2I9LA 3DO3A 2PCYA 4GW4A 4NUJA 3HBPA 3TFKC 2JF1A 3GLZA 1JCKA 3MJGX 2WLLA 4IRZH 4XX5A 5JNYA 5C0AE 1YMHA 1H3GA 1PZCA 3K46A 4MJJA 1JPSH 2YGQA 2XVLA 4PYHA 4DPCX 4NKOA 4XVSH 1S9YA 4AKOA 3FOLA 5D1XE 4ZNEE 1SHWA 4MMZC 4QR7A 3JWDH 1TF4A 3PJLA 2FIKA 2MOVA 3HPJA 2DY2A 1H15A 2HXAA 4L3ED 5FO8A 1L7TL 3VSQA 1OK0A 2I60L 2YAMA 3BP4B 3MHZA 4XN1A 5DO2C 3AGVA 2CE6A 1NCBL 1ORQA 1N3NB 4D9QE 1J1XH 4ONGL 4ORZC 4JHUA 2HFFB 5EDXA 4GG6E 4ELMB 3STZA 1JHTA 2WKOA 1BVLB 4HIJA 3L95A 5JPNC 3CFBB 3TPUA 1TCRA 3IE4A 1I7TA 2OQJA 4W93A 3NFSL 5ISZE 4P9HL 5D55A 1PEZA 3KL0A 5CCGE 1G7IB 2NY3B 2X1OA 3BIAX 3SBRA 4KUCD 3M1CA 3BPCB 3B9VA 4KITB 3LQZA 2VW4A 5JHLA 2NX5D 3B8SA 2WYTA 3LSOB 4HKXA 2KUTA 4RFOH 4X4MA 4TULH 1CL7L 4IOSD 5DHVB 5DK2B 1FO0B 3L45A 4M1CC 1VKXA 4MMZA 2XC8A 3T0VA 1L0YA 2VRAA 3M17B 2OKMA 2YD2A 3IJSA 5I1JH 2ZOLA 4NC2B 1IGJA 1WCBA 2VLME 3HIZA 3QDGB 5AKTA 3TVMD 1OL0A 5D7LE 3QK0A 4A2EA 3GSOA 2KPNA 5C8JB 5BVPH 2I5YL 3ULVD 1KTDB 1PD6A 2WKGA 1RZPA 4Z18A 5BRPA 4GAGH 4NQDA 4JY6B 5J11C 4PJXA 2OXHB 1T1XA 2F19L 3QW9A 4UYQA 2AJVH 3LS5L 3BXNB 4D0DB 5J4MA 4U1JA 1KY7A 2GJPA 3R19A 1Z9OA 4WI5A 4PLNC 4FQJH 2YC1B 4JHAL 3HTLX 2OMXB 4W6XB 3U46B 1WLHA 4PIBA 1BSIA 2W9DL 1RZKL 3D30A 1LE9B 3QCVH 1ES0B 3QWOB 4F2FA 5I17A 1GA2A 4PJDE 1UENA 4PCTA 1XAKA 1WHPA 3T3PE 1Z9PA 4MAYD 2CHXA 4DWHA 1EERB 4DP4X 3JWNC 2SODB 5D5MB 4L8DA 4NFCA 1ECYA 2OULB 2AF2A 4NO5A 4BXSV 5FGBC 4PJAA 4APXB 1WGVA 3PDDA 4Y2OA 1ORSA 5HGAB 5GRXG 1SJMA 2DBLL 4Q9BA 4JFHD 2IMMA 4Z7UA 4NQSB 3WFHA 3D39D 1AP2B 4UTAH 2CH8A 4M6MH 3T2PA 4F1SA 2PLTA 4ODTL 4Y9GA 2OMYA 4O9HL 4RWYH 2ZXDA 3QQDA 3BP5A 4QRUA 2EDKA 3FTSA 4IKLA 4XP6L 3B83A 2VLKE 4JFFE 4IK7A 4HW6A 4ZOEA 4U6HA 2EXWD 4M43L 2HKAA 3VGHA 4PSRA 5AW6B 2WCSA 4JO1H 3QJUB 1NGQH 1E8YA 2X0VA 4QUOA 2OR7A 3N0PB 2FD6L 1F1DA 1F00I 1HKLH 2XWZA 2YN5A 4N2KA 4U7SA 3QEGL 1FH5L 5FWQA 3VDCA 1IQDB 2K8QA 4GLRH 1PL3A 3HNVL 4KRLB 4P0DA 5AQ0A 3TIEB 2VR5A 3PQYE 3RWCA 3ZE1B 2Z92B 5IFAL 3GJFH 1S3RA 2A3TA 4HH9A 4JY5H 1JZ7A 3GD1C 3FAXA 1G9ML 3NZHL 4BDVB 1XZWA 2AK1H 4H0GA 3MX0A 3S4SA 3MJ8A 3KCWA 4JHBA 5JIMA 3AITA 2ZTBA 3OB8A 2AQTA 1RCYA 5DRZB 1MJ7L 3TBTB 4DPRA 1QPKA 2WKLA 4P3WA 3TV3H 1EEYB 1PY4A 3NCJH 5GZNC 4JVPA 3TTYA 4AKPA 5I1EL 1WFOA 4MXQC 1BG1A 1A7NH 2WO2B 5HHQB 1ML0A 2P7TB 5HI3C 5C70A 3Q8CA 3F6IA 3R18A 4ZW5A 3KAAA 3HBQA 2CHDA 2IMNA 3GEFA 3B7TA 3DLQR 3BIKA 1IJ9A 4H20L 1J8HD 1BZEA 5SWZD 1UD6A 2WLMA 3UYPA 2GSGA 5ESVB 3TO2A 3BOVA 1ZD6A 3QIWD 1XIWD 2MCAA 5FUOH 4GRMB 1HEZA 1R0AH 5EFIB 2IH8A 1GGTA 2VDOL 2X4QB 4BD4A 2DQIL 3GDCA 1KJ2L 5E99L 2VR4A 4HSCX 3DTDA 3VXRB 1F56A 4I9WD 1ZA3A 2NTSP 4Y0GA 3TT1H 1NM4A 1LO0H 4JDVA 2X4RA 1M3IA 1RUML 3FO0L 4K9JA 5IJBC 3IKKA 1NBZB 3PV6B 4PREB 5DLLA 5IESL 2GEQA 4OJYA 3ZSSA 4K3DL 3BGMA 3DX6B 2VDML 4BGDA 5BRZB 1E28A 4S2SA 3A6CH 2VLLA 4ZMYA 5HYSA 1E9OA 3PJNA 4Q97A 1OF2B 3V0FA 2NUPA 2C4XA 3BGFC 4KRNA 1XGQB 4NSKA 5DJ6B 1FAIL 2DQHL 4NQVB 4PW9A 3JSSA 5IQ7H 4JKMA 1KB5A 1AC6A 2W65B 2EYRB 2VE6B 2VJ0A 5KYYB 2DEWX 4YC2C 3GYRA 4TUKL 4LSVL 4PUBL 5C0CA 3P77A 4BQCA 3Q48A 5AALA 2M2DA 3MRCA 1CD9B 3QC6X 1ZA6A 4JPKH 1F4HA 4ZSOE 3D06A 8FABB 1B0RB 1JYNA 4M7LH 5IEHB 3GSNH 3IKCA 5B1JC 1UT2A 4PBVC 2GY5A 1UATA 4J3OG 2Y06H 4XMZA 5T1LA 5H35A 3G5YA 5GS0D 5IOPB 1S46A 1K5NB 5EF3A 2K7QA 4U1LA 1QLEH 3BFQG 2YUWA 3EFOB 5TDPA 1TQWA 1WA0X 2VXUL 2Z64C 3OKKB 4AGPA 2YGVA 4IGBC 1YEGH 2D3JA 3QDGD 1XR8B 5TE7H 3D87B 4UTBH 2LABA 1NINA 2KYIA 3OTTA 1QFUL 4PJIF 2ROYA 2ZXWB 4KTEL 5CZXC 4AUUA 3DMMD 4TVSa 1U3NA 3LYRA 4NRYA 5F0LB 1LO5B 1ZHBB 3AM8A 3L1EA 4OV5A 5KBNC 4LEOB 3ARDB 5DZ9A 1TXKA 5DQ9B 2JIXA 1OAUH 4GSRA 1B2YA 2IFGA 3NZUA 4ODWB 3VG0L 1FIGH 1AE6L 1JF5A 2AAVA 2QVTA 4M6AA 15C8L 1I3GH 4AZ8B 2VISB 4J3WA 1TVDA 3T4AA 3WS6A 5ERWA 4JG5A 1TYRA 3D0AA 1MW0A 4LP5A 3N44B 4K3JH 1F8TL 2Y1ZA 2NXYB 4E9WA 2E9BA 4MD5B 4WUKL 4YK4C 3L9YA 1CF8H 2Z4QB 4Q89A 1NBCA 4PPTA 3TVMC 1DQVA 1KFAL 5AKVA 2OAAA 1P5UB 4JEGB 3ULVC 2ICES 3HE6B 1TLKA 3MLZL 4FZEH 4IGBA 1HHKB 2Z7YA 3O4OC 3H4FA 3MDJA 3DYPA 4LKXB 2C1OB 3DK0A 4HUNB 2AJ3A 5EIIA 5KBMA 1UJ3B 2ZAGA 5F88B 1OSZB 2BP0B 4EUPA 2E7DA 1UA7A 2BERA 2NCMA 4M4PA 2H9GA 2AV7B 2WKOF 3AS3A 3L7FA 3DECA 3Q43A 5ESAA 3GXDA 3MLVH 3O8XB 4KZ0A 1KYUA 5TFSL 2F7OA 3V4LA 4DQAA 2FGZA 4YDKL 3VDAA 4YXKH 2X10A 4K3EL 3JV4A 1FGNL 5C6PB 1HZLA 2KS0A 3B9KB 1JPEA 1MFBH 4GSQA 3LIUA 4JHZA 5C0BB 4U1SA 4KX8A 5AWNH 4X0NA 3X3GL 1G7JA 4PS7A 1S8DA 4LSUL 2ZICA 3SZ6A 2E7HA 2BSED 2X9YA 1W0YT 4NNYB 4OF0A 1PKQB 4MBRA 3LS4H 4PW4A 1WRFA 3BKYH 1EV2E 4E41A 3C9NB 3CPUA 3GXTA 1M05B 2DIJA 2RHEA 1OANA 2DQGH 2YIHA 2ICWJ 5I6PA 4PJHA 2EVHA 4X4YA 4WKZB 3L1OH 3PWLA 2JJUA 2J2ZA 4PJXF 5JHDA 3FFCA 2AJSL 1IT9H 1FORH 2HB0A 2EXWC 3BAEH 3RVVD 2J1XA 5KVEL 3FXIC 2Z0UA 1WIUA 5C2BH 1W6WA 1MJJB 3KYOA 4IIQC 1J5OL 2J1YA 1GAFH 1KGIA 2OK0L 1EEZB 3H8NA 1Z5LB 1D2OA 4NUGH 1X4YA 4LIQL 1K4CA 5GGRB 4ELDA 3IPFA 2PYFB 3KPSE 4ELKB 4JHWH 1OXYA 3MXWL 4F58L 2NDFA 3ULUF 1OGTB 1FNEA 2OW7A 5LGHH 1V5JA 3VXRD 3WE6B 3P11L 1WS7A 3T65B 4AYBA 4M48L 3VW3H 4HJEA 3OC8A 1HH6B 3AFLA 1MVYA 4PJAF 2Y24A 1HL4A 2X05A 5BS0A 3FB6A 3WJJC 3EJTA 3IDXL 4NUMA 2B1AH 4Z7UF 1JYWA 3IFOB 5BRZD 4MB1A 2DV6A 4Q8BA 1CE6B 2HRLA 3TO4B 3G6JE 4I5BB 5DD3L 5C0AA 2BHUA 2EKSB 3EXJA 2UVEA 4IRJD 3RVXD 4L8BB 2AV1A 3HRZB 3QIWC 3WN5C 4E9SA 4AEFA 1AY1L 4H13C 4ZS6C 5F7LB 1FBIH 3TEXA 3GXUB 5JA8B 4HUWB 2GC4C 5IBLD 1A3LH 3DYOA 1TQVA 1GY2A 3VWJA 3ENEA 4XRCB 1LO4L 5FF6A 4IBTA 5DK0A 3B5HA 3P4MA 3FQ4A 3RB7A 2ZYIA 5DURD 1OB1B 3E8VA 4XH2B 4CILA 1B6UA 3HZYA 3G3LA 1QA9B 5LGJA 2QV4A 4HUUB 5I8EB 4O2EA 1NCDH 4QRQA 3V6FA 1UXLA 4F5CA 2X5PA 1B0GA 3FU7B 3U0TA 3GRWH 3Q2CA 2YWZA 3PE9A 2YUZA 5FYKL 1T3FB 4Q4IA 4PTUB 4JM2B 2DMHA 4ZX3A 2QPDB 3GXIA 3NJJA 2Z8RA 3VGAC 2KMWA 2IWEA 1IM9B 2ITCA 3DURA 3IYLW 3C6LB 3QWRD 4WI0B 4Z7VE 2IQAA 3O2DL 3SY0B 1XMWA 4XI5D 5LDSA 3QUXC 4PLOB 2V9TA 3DA0A 4PJFE 1H3WM 5HHVL 3DETC 4YSDA 3KYMA 2HLAA 5HXMA 2H45A 4YSAA 1BVZA 3VFMB 3NJXA 3NEXA 5EC1B 4BIKA 2ADGB 2J5WA 3HZVB 1BFOB 3HR5A 3NG5A 3U4BH 4OLZH 5DEZA 5GS0C 2G9HA 3CN1A 1KCRL 2OL3A 3CZSA 1P7BA 1OKEA 5ETUB 1MUJB 3PP3K 4EVNB 2FYYB 5EN3A 5DHXB 1C9SA 3W0WE 3B7YA 1E4HA 2JFCA 5K1VA 5AAMC 4F15B 2GYSA 5FDWA 1AJ7L 3LXAA 3RDTC 3D1MC 3OSKA 1CURA 5DD1H 2QQQA 5HGDB 3FYEB 2BIQA 3DMMC 2BRQA 4F7PA 2ICCA 3CXDL 3E9TA 5DSCA 5L6YH 4O00A 4L0PB 4HPYL 3O0RH 4YE0A 4B53A 1RZQA 1HOCB 2R29H 1L9RA 2X4PA 1MAJA 5J12C 1RZFH 3QUXA 3BP6B 2XN9E 4NWTH 4UILL 4PJDA 5CEYA 3WIHL 1R17A 3BRFA 4OCXH 3NABH 1IBYA 1D5MA 2XA3A 5I74B 1QKZL 2V37A 4TUJA 3KLAA 1KXQE 4JREC 3KW7A 3HFFA 3ECWA 3O8XD 3IDIA 2D31B 2WUBH 2ZYHA 4TNWK 5DUML 3TNNA 1J0HA 4GMTL 3T8MA 3WYRA 3CN2A 2VXSL 2ZCKH 2X53A 1EBAA 4WJ5B 2JI3A 3B9KD 4KV5F 2IPTH 4XB3A 5C0BD 2A74C 5JDSA 2V5MA 3ARWA 1CZ8L 3MJ9H 4OJDH 5AAMA 4HUVA 5B38A 3J7HA 1T7YA 3RDTA 5A6MA 4WFGE 2CNYA 3GSWA 3OR7B 4GP8B 4GT0A 3FB5A 3KYAA 3GSUA 3MV8E 1QUNB 4PBWD 2R15A 2CU9A 1A6VH 5I73C 1NUDA 3QORA 2IH3B 1NUFA 4RRPA 1K9TA 3S35L 5HVHC 1DDHB 2NQDA 1WFUA 4CDHA 1AGBA 4O5LL 5BMFL 3Q9PA 4YHPB 1KTCA 1PPIA 1EJ6A 4MHHI 4ODUB 2X2HA 2OTUB 1R3KA 3S0PA 5ADOL 1KSRA 3V10A 1E3ZA 5IF0B 1J9TA 4AQ1C 3H0TB 3IJHB 5LNDA 3MMEA 2WB7A 2WXKA 1W72L 3IDGB 1PBYA 1XSIA 4U0QB 4XC1H 1HNGA 1QVOB 2MQCA 4MA7L 5ENWB 1T1ZA 1RAMA 1F4WL 4UT6H 2AEOA 1YEJL 2P5WB 5AVVB 3UPRB 4PV1C 5BV7L 1V7NH 3KPOB 4NENA 1YA5A 2KDGA 1LILA 4FYQA 1S7WB 3UFIA 3BZFB 5FIEA 4AC2A 5HJBA 4AYSA 3ECQA 4HH8A 3LXCA 7FABH 2P52A 4KHTL 4F37F 2QPFA 5K9KA 4PSPA 3RVVC 2RFXA 1U8CB 2WHVA 3HZ3A 3QUKA 4ABVA 4OGQC 1Y7VA 2J25A 2IANE 1FL3A 3QT2A 4MWFA 2ZJSL 3CGTA 4ZUWB 1GS8A 2MH4A 1GHFL 3BWUF 3HI6L 4I3SH 4NNPH 4DN4H 4GEIA 4AQ1A 1FDLL 2DQCH 4Q52A 4JR9H 3CH1B 1Y6NR 4OFQA 3KCPB 2FECL 2IG2L 4N5ED 5DT1L 4HPOH 3WGUB 3EF7A 4N2NA 2DLIA 1K8IB 1OV8A 5FYLL 5KYXA 4LAJH 2QHRL 1JV5B 1U8IB 2HT2C 3NIGE 2CIKA 3EF4A 1MHEB 5DJ8B 1AQ8A 5DUPH 5IBUB 5B39B 4BZ2L 4WO0A 2CDEA 1KBGL 3LKSA 4ETYA 5E9DB 2DQDH 1A2YA 2VLJD 4FNLL 1Z3RA 3MGAA 5EO9B 3E6FB 4KNSA 4PJHF 5AVRB 1KLUB 3WBDA 4AIZB 3EGDB 1QSEB 3DVGA 4IRJC 3VFGH 1HILA 3QCTH 3RBSA 4KTYA 4NZJA 3THML 1CD0A 1XH3B 7PCYA 5CJBA 4MMYA 5F71A 4JM2D 1E5AA 2VN7A 1J1PH 4G43A 3A5VA 4P5KB 2K6ZA 1IM9D 3NRQA 4JE0A 3C6LD 3QCUL 4WO4C 3NJLA 5B22A 3EO9L 3DO7A 4GPVA 1EHXA 3D09A 4NO2B 1IC5H 5DR5L 3RURA 3FSOA 5C09D 5TPWH 2VH5H 5DRWA 3K1KC 3ABKB 4FQIH 1BVKB 4MX7B 4F3FA 1WIPA 3PV7A 4P3DA 2IFFH 3KZ8A 4LPTA 1PZ2A 5TTRA 2G3NA 3QJHA 1ZTXE 2WSKA 4ZQTA 4J4PD 1EVTC 1MI5E 2TSAA 4LVOB 4WGVB 5J56B 4LDEB 4XHJD 3MNWA 4PCSA 5DYOB 4KO9A 5E6YA 2A4CA 3HHSA 4LSPH 4FZ8H 4GSXA 4QHLA 1LMKA 2DQJL 1NGXA 3ILPA 1QATA 4JZJC 4XI5C 5T33L 1CS6A 3WS3B 3ZZQA 1W9XA 4TTGA 1TTGA 2EIBA 4J1UB 2VTFA 4P2QB 3KPPB 4WO4A 4HHWA 2Y1YA 4KVCL 4L8SC 3MYJB 1I3VA 1KTLA 4M00A 5J6SA 1ZLUH 4PJIB 4GW5A 2LU3A 3FL7A 1FA4A 2FJGA 5E1IA 5G5DA 1KJMA 4G42A 2PUQT 2BHFA 1BOGB 4J3OH 4P23B 2NXZB 1G94A 3JZ7A 4X7DC 1KN4L 3FO1B 3VFWA 1E4WL 4HULB 3EO1B 2R2BB 1VACA 5LNGA 3RIKA 2QVIA 1I1AB 3PWUB 3QIBB 5FWRA 5F3BA 3HMXH 2JNZA 2DI7A 3QSKB 3K1DA 2BW4A 1EJOH 4GW4B 4M6OL 4BCXA 1M42A 3D9AH 3POCA 3WY1A 2E74C 5JNYB 3GTNA 2VO5A 3SHSA 1ZHNB 2XICA 3IU4L 1N7ML 1INEL 1FLRH 3QUZA 2CPUA 4S0SD 3X11B 1E30A 3MRLA 3QPQD 2YPKA 2OZ4H 3ABZA 4NKOB 4WEEA 3WN6A 1DQTA 3HZKA 5HYEA 4XN4A 3HG3A 2WN3A 4POZD 4A2HA 3BZDA 3HPJB 3B2VL 1H15B 4Q9RH 3ARBA 5AG9A 3MGTA 2WXQA 4L8SA 2AEQH 3L4VA 4GY4A 4FULA 3ABGA 3QQ3A 1YEEH 2V7HA 2VM3A 5F93C 1KG0B 1ORQB 1FNLA 3IEAA 5D7IB 3QQXA 4N6QA 5F6HI 5C08A 3ABMB 4HIJB 4O4YH 5FLUA 4QIRA 1YNKL 3SDDA 3LIZA 4ONOA 5ABAA 2XA8H 1VESA 4JK0D 4R8WL 4OZ4A 3C2AL 3DBXB 4H8HA 3GMMA 3ISRA 2BVPA 4RMBA 2FH6A 3DOSB 3FJTA 3LQZB 4J3BA 3HI5L 4ZUUB 4ENZA 3QISA 3GUTA 2YAFA 1EO5A 3CZFA 5LXGH 1UTDA 2YHGA 5K39B 1FVEA 1N64L 5T3XE 1Z3GL 3UERA 4BE6A 5AAPA 3V0JA 4MB4A 1I3RB 2ZOLB 4L23A 1IGJB 1WCBB 4PJDF 5EU6A 2EC9U 3O3EA 4GP4B 2MWCA 5EZJA 3L4CA 1CDHA 1T5WB 1XHHA 2DMCA 5FYJH 2Q8BH 3N91A 4NQDB 4QWWD 5DFVC 3VI4B 4OFDA 2YK1H 4I85A 3U2SB 1NIAA 4W4NA 2BOBA 2YQ3A 2YRPA 4FP8L 2EYTB 4GS7B 4IM8A 1TLMA 4NM4H 1E4XI 3CIAA 3G04A 3H3PL 3BKCL 2XXMB 2B20A 4CMMB 4D9RE 5F9AC 4HWBL 3RY5A 4JANB 3SZKC 5A7BA 4FFWD 3T3MF 2CLRB 5E9DD 5I17B 1ZLDA 1XTLA 5ALBH 4DKFH 1LLAA 3KVDD 1CGVA 4U6XA 1C16A 1I85C 2VZOA 4OLWH 4OKDA 4EZJA 4F92B 3IMWA 4UQEA 1VGKA 1E2WA 4BK5A 5KSUA 5DUJA 3UJJL 1D7BA 1QSED 1R33A 2WBJA 4YGVA 2O1AA 2PO6D 1Y6MR 2A2QT 4WFED 4Y5YA 2AQ3A 2R7EA 4FG6D 4PJAB 1DJYA 2VR8A 1YECL 4Y2OB 1ORSB 3EJPA 3KPRE 3ROLA 3F6LA 4CSSA 4NUQA 2ZX9A 4RDQF 1DYZA 1GGIL 2CMRL 3CDGB 3K71A 2X3AA 4PJ5D 5AAWC 3R7RA 3BP5B 2ITFA 1S7TA 4UM9D 4OY9A 5IY5B 1H0DB 3IRCA 4IRZL 2EXYD 3VNZA 4IKNA 4U4BA 1GKOA 2ZCLH 4W9LC 3MLPA 3QFJE 3I6KA 3HG1B 1JPSL 1ZHKA 3C08H 3QXAA 3UO1H 2NR6A 5HYFA 3OGOE 3ZW3A 1AXTH 1U8PA 4XVSL 1XQ4A 4G6MH 5FB8A 5A2CA 2JWYA 3JWDL 4PJFA 4XNXH 5CN3A 1S9XA 3V4VH 2BHZA 2OYPA 3QS2A 2DEYX 4C4UA 1I85A 4HQQH 2P80A 2O4EA 4JZNA 5DC0A 5EZLA 1VFAA 1WF5A 1Y07A 4L0ZA 2H3KA 5I75C 4Z7QE 3UH8A 1IKOP 2VDPB 1YN7A 1J1XL 3C6LC 1ND0A 1FYTA 2VL5B 5C86A 1VADA 3T6ZA 2FIRT 2JJTC 1XD1A 4N4YB 3G5VB 4X6DB 4YLQT 5F7WC 4Q74A 1E40A 4P2QD 2XNAB 4PP2B 3ATDA 3VFNA 2E3VA 3UAJD 4LOEA 3D2UA 3PL6A 2IV8A 4E42A 4NZ8A 2XQ0A 3PWVA 1NKRA 4TNEA 5CR8A 3L08A 4PGDA 3OKMA 3FTGA 5TE4H 4J4PC 3UBXG 2VUKA 5C0FA 4PGJA 2XQYA 4G7RB 4ORGA 4RFOL 2YD6A 1RPQA 2AEIT 2NXZD 3OKDB 3MNZB 4P23D 4TULL 4XVJH 5EH1A 1S7RA 4AMKH 1HEZB 1I1AD 1T7WA 3QIBD 5I1JL 1EZVX 5G55A 4BJLA 3OKEB 1YY9D 4F8LA 1XSOA 3KLDA 1KXQA 5E2WH 3QZLA 4C56A 4PH8A 3X13A 2H47C 5FGSA 2FSEA 2VOTA 2B4CC 3KJ6H 5BVPL 1CO1A 5DJDA 2J56A 3L3HA 4PN6A 2FX9H 3QZWB 4XNMA 1UB5A 1JZIA 4FC3E 4GAGL 4G1EA 1J5HA 5E5LA 4L9LB 2WJ5A 2JJTA 2AJVL 1E28B 2XWBB 1E9OB 3DSNA 4KMTH 3AXLB 4UBDC 1CLVA 2P24A 2WCGA 4FQJL 1KB5B 3L1FA 4P3CH 4KTGA 3QUYA 5HD8D 1QSFE 3QCVL 2X6AA 3U82B 4ABUA 2A6KA 3ESNA 2YD7A 5ANHA 4O2FA 1URIA 1L9PA 5C0CB 2CBMA 3TM6A 3JXAA 3MRCB 4Y2NA 2R1XA 3CHRA 4WTZA 3IKCB 2W88A 5E24E 1RQ5A 4N2CA 5DJYB 2C8NA 2E56A 4POZC 3VXSE 2HWZH 3BD3A 3QP3A 3UZEC 3G5YB 5FM8A 3NZSA 5CLTA 1ZGLM 5HJGA 4UTAL 4M6ML 2GCYA 4JMXA 4MDRA 3WIIH 3UBFA 2P8PA 3IN0A 4RWYL 1AS6A 3CFCH 1GYCA 3BLBA 3O9WC 4LRIC 3RA7H 3K5SA 3Q5YA 5CEZE 1LEKB 3D69A 1NANI 4JCWA 3T2NH 2J5LC 2O26U 4NRYB 4JO1L 1NGQL 3BUIA 2IALB 3POHA 4NQDD 5IMMB 4OV5B 5J6HB 2P48B 2CRYA 1HKLL 2DWDA 1MFMA 3KLHD 4NOBA 1BV8A 4YDLC 4XXDA 1J86A 2ZOWA 4FLSA 3CN3A 2BK8A 4JY5L 3T4AB 4HCGA 3Q8FA 4ENEC 3X1NA 2WWKO 1UWXK 2AK1L 5JO5A 4L29B 1AMYA 1WZLA 1AHWC 2CCWA 4P05A 1ZIBA 4PRDB 4M5TA 3TV3L 3NCJL 2EILB 1AH1A 2R2HA 2NZ9C 4IOFD 4QOKB 1A7NL 5DZVA 3ZN6A 2BOCA 3L9BA 2UX6A 1GOHA 3MLSH 2ITDA 4BWWA 5GZOA 2WSPA 3HPLB 5L8JB 2AJ3B 3II3A 4DCQA 5ID1A 5E4OA 5IB5A 2FR4A 1G7HB 5F1KC 3UTTB 4NN7B 3TGXA 3RUGA 4KROD 2H9GB 4LVNC 3P3SA 1QFHA 3WNIA 1I4FA 1KLFB 1BYOA 2WO4A 5FUOL 5GIRA 4AVKA 2JJWA 3KWWA 1R0AL 3QR1A 1A1OB 4CDGC 1NGZB 1YEKH 3OXRB 3VD5A 5GGSB 2X4TB 2Y2WA 3L54A 1M7UA 4JFOA 4JRWA 2HFGH 3WTUA 3TT1L 3MXVH 1LO0L 1NMCB 4B0MB 4NQQA 3ZO0A 3HG1D 3UCQA 4APQC 5D4HA 1DLHA 4IBSA 3MUY1 1TQBC 1E4XH 4JQXC 3M8OH 3GMRA 3A6CL 4JPVH 2PO6C 1HKFA 4E9RA 3V6OC 2GQHA 3MRFA 2VT0A 3HCVA 4OI9A 4OGYH 2JKJA 3PS6A 9CGTA 2YAOA 4E41B 2VGLM 4LCUA 5IQ7L 3JYCA 4JDZB 3D3VE 4PRAA 3N85H 3GLDA 4RGNB 4UNTA 2X40A 5KS9E 5CKAA 1MI5A 3PWLB 5JHDB 2QSQA 4NZFA 2EXYC 3FFCB 1UZGA 5TH2B 5BXFA 1A4BA 3JZYA 4JPKL 3TASA 4M7LL 1I7ZA 3GSNL 5EIQA 3VXNB 3FN9A 4YSPA 2F8XC 2IDFA 1S7VB 1CDCA 2Y06L 5JIKA 4MMXB 4OCSH 4APQA 2R0ZH 5FUCE 1QLEL 3I02B 3D6GA 4ZXBC 1AQDA 4QF1B 1IKFH 1K4CB 4JQXA 5EO1A 5CLWA 1U92A 1GCFA 3HAEA 4PJ8A 1LEIB 2DL2A 1YEGL 2BNUA 3ARGA 4K7FB 2RH0A 1I8MB 1FNEB 5TE7L 2ESVA 1U3HB 4UTBL 1M6OA 5AW9B 2VJ8A 2DWYA 3JV0A 1J87A 3OB0H 3MUGB 3KPMB 4XMPH 4BH8B 1ACZA 3QXUA 3UAJC 3FB6B 4Q6YA 1W80A 4E68A 1OAUL 5DC9B 2WM0A 5INCA 1FIGL 5DMIH 1WCQA 2RGSA 1I3GL 1Q90A 4K07A 5C0AB 3V9CA 1OSPH 2CBOA 2QMKA 1D5BB 4ZBJA 3JTSA 4F80A 5E8EB 1TJMA 3UABA 2AV1B 1O5PA 2YD0A 1P4UA 2WY3B 2ZUXA 3V4PA 5EEZA 1WTLA 3QIBC 3SO3B 4XOEA 1CF8L 5D1XB 2ZIDA 1RLWA 2XWJA 4ZXBA 1SHXA 4ZTEA 3MREB 2C34A 5C0JA 4JZOA 4PJFF 5FF6B 2DJUA 1HWHB 4FZEL 3VSVA 2GFBA 2BY0A 2W0FA 3BZ5A 3QVAA 5DMJB 1N70A 3LPOA 4GG6B 2A9AA 1KPRB 5KTEH 2ZX8A 2C7FA 4I1NB 2Y7MA 1XGZA 2HT4D 5ISZB 4O2EB 4DGIH 4YEFA 1GCYA 3G5ZA 3MLVL 5HVWA 1JD7A 4IKJA 4YXKL 43C9B 1P4LA 2V3FA 2XTJE 4L1DA 5HD8C 1OWRM 4TNGA 4K8RD 4GKSA 2QQKH 1A9VA 1U8LA 4KHXH 2LQRA 1MFBL 4C83A 5L8KB 5KYWB 3EYUH 4DUWA 5AWNL 5DHVH 5I6XB 4BUHA 1FO0H 4I2XA 1MFUA 3KYMB 2HLAB 4AOFA 4ALAC 1ZXKA 1HCVA 1HYRC 5K59F 2H3NA 2P8LB 2GY7B 1R3LB 3EDDA 5LNEA 2LHAA 2WWMD 5D7LB 5KVFE 5EEWA 1IVLA 3LS4L 3O6LH 5KSVA 1RJCA 1CLCA 2JCWA 3BKYL 2IPKA 4NLAA 1E0OB 2G9HB 4X5WB 4ZFOB 4R4ND 1AYOA 1FVCA 1PZSA 2QGBA 2ZKWA 5IG7B 2C9QA 3V5HA 3D2TA 2DQGL 2LU5A 3AQXA 3MI6A 3OAZH 3ZMEA 3VRJA 3TEWA 1CDBA 2QHLA 3L1OL 5F7MC 5CJXC 2V9UA 4FXLA 2QBWA 1IT9L 5FKPB 1FORL 1SGKA 2KT6A 4QOKD 3BAEL 1I8IA 4GJTB 3M88A 4F7PB 4Z76A 1B90A 5DSCB 2X88A 5GRZA 4Z7IA 4M61A 1R3HA 5HHMD 5C2BL 4R2GC 1SFHA 2CBTA 3K81A 2YQ2A 4TYUA 5TK4A 3G5WA 3TS8A 3LB6D 1X7SA 3KLHC 1NAMB 4ADJA 1HI6A 2X4PB 1GAFL 2W0LA 3L9RA 3UTTD 5AG8A 5IHHA 4PJDB 4PYGA 2WLHA 4NUGL 3HS9A 2JKNA 4LSTH 5DEGA 2E9IA 2J57A 5A2LH 4AWJC 3MVSA 3T3PB 4RNRB 4GS7C 2J73A 4IRSB 2ILLA 4JHWL 1NANH 5A16A 3IDIB 4UANA 3TNNB 5LDUA 4KK9D 1H3PH 5MENA 2CLVA 5LGHL 5DC4B 2BC4B 3EJZD 2AK4D 2FEDD 3VW3L 1JGDB 3LH2H 3S34H 4IOFC 5GGUA 1BW8A 3MV01 2VDMB 5JHAA 5KN5A 1UFUA 3F7PC 1ZT7A 4JFUA 3OJVC 1JPST 5I23A 1AKJA 1G0DA 2B1AL 3SDYH 1OW0C 2WZ0A 3CFEA 2EE0A 4QPEA 1Q0YH 3NQKA 2VLKB 1BQLH 4HKZA 4JFFB 1X5AA 1LDPH 32C2A 3QFJA 4N90E 3RX5A 4KROC 4NAQA 2BP8A 3AW5A 4E41D 2FUTA 1XCTA 3Q8BA 3ASWA 5DLMH 5DQJB 1FBIL 2NLJA 1JZ8A 3QORB 4FFYH 1A3LL 3UJIH 1MKFA 3WCYA 2ENJA 2V33A 4TNWF 3PQYB 1EGJH 2QLYA 4PAZA 4PGZA 1NCOA 1R3KB 1L9SA 2H6UA 1XFPA 1BXAA 1NKGA 5L0QC 4FNPA 5B39G 3MMEB 3K7UA 1KIPA 3LKPA 1ODAA 1C5DA 3TCXA 2CGRH 1NCDL 2CKBA 3QG6A 3PIQB 3R0MA 4L2YA 1UOKA 4FQHB 3VYPA 3GRWL 4LQ1A 4L3AA 3GMQA 1MW1A 1I82A 4KI5E 4XO3A 3MBXH 1A7PH 1U3HD 5CP7A 3NIGF 5F0JB 5F1SA 4A1RA 2RIKA 1SJHA 2H6OA 4G6JH 4MJ5A 4AJ0A 2Y2TA 5FDYA 2Z8SA 1B88A 1RUKH 2EDDA 2RFXB 3RUGF 2JKWA 3QUKB 5LAXB 2K9UA 1U3ZA 5EMYA 3F62A 1QRKA 1MCQA 2H6PA 1FL3B 4MWFB 2Q7YB 1BECA 1AS7A 3U4BL 3HHRB 4OLZL 3PDOA 1P7QB 2N3JA 5T1DH 3CVIH 3FQ1A 4HDIA 2NMSA 4A04A 4QT5B 3DI2B 2IQ9H 4WWPA 1EAQA 3W9DB 3WL9A 4Z78A 1Q4NX 4GMSH 3PUUA 3GF8A 5D1XD 4BKLA 2HP4A 5D8JH 4EDWH 3NFNA 3T1WA 4XE0A 5DD1L 2VZVA 5HP5A 5GGVY 1SN0A 2CIKB 4WWKB 1VAHA 5J5EA 5IROA 5L6YL 1M2OA 2CDEB 4HJTA 4D9QD 3O0RL 1YDPB 1Z5YD 4L9LC 2PCPB 5AOZA 2R29L 1S2EA 2WXPA 3FQWB 2V17H 2YAEA 1RZFL 3SOBH 5K9OA 4NWTL 1OVZA 3DX8B 4GQZA 3I6GB 5KSBE 2XG5B 1QWNA 4OCXL 1HVXA 3NABL 5EBGA 3MBEC 4ZYKA 5ISZD 4L5FH 2IWFA 5FFOA 4ZSOB 2CK2A 2VN6A 2WUBL 1H8NA 5AW8B 5BOJA 4G72B 3FFDA 3FDWA 3WY4A 2ZCKL 3VXSA 4G43B 3PDGA 1NFDA 2IPTL 5FHAH 3VCLA 3CVHH 3UTSE 2GUOB 1A7QH 1JK9B 3MJ9L 3NPSB 3P0GB 4OD1H 3TU6A 3WTYA 3DO7B 4X9YA 4LDOB 3DK2A 4XCCH 3RLSA 3QJFA 2FO8A 4AYMC 3ZYZA 1QBBA 5B3NA 5ESQB 5D7LD 3GHBH 3EOTH 3VQMA 5E4EB 2JMRA 5BCAA 4G7QB 3CU7A 1Q9LA 4UNVA 1FL5A 3WNJA 2HT4C 3UG3A 3QJHB 1A6VL 1P1ZA 3T77A 3MNWB 1NCNA 3HG5A 3UTQA 2HRHA 4GUCA 4J39A 4TRPH 5D4IA 4J27A 2Y5QA 4KY1H 3KL5A 4QHLB 2D3VA 4ILDA 4K8RC 4N0CD 4DKEH 4Y2DC 3ZVVA 4EI5C 2GAZB 2VLRE 1NGXB 3ILPB 3EDEA 3NIFF 5PAZA 3IGLA 4HP5A 1GGCH 1EFXA 4FERA 3FTXA 1BXVA 3FHAA 4GSUA 3BH8A 3ARRA 4XC1L 3DDGA 3FN3A 3MRIA 1ED3A 5DS8A 2F7RA 4UT6L 1RXLA 3ES6A 4B60A 1W8NA 4GW5B 4MKMA 4EF3A 2W60B 4IRSD 1JIBA 4KAQH 4YSSA 5KYUA 1V7NL 1R3IH 4G42B 4KJYB 4M3HA 5BQ7B 1F02I 2BIHA 2WQXA 3ZDXE 4Q56A 3TBVB 1FNAA 3VFWB 4PV9B 2EDEA 5CEXA 3DX4A 4RX4D 3QZBA 1TO5A 2KC0A 1BPLB 2GVYA 3II2A 1QHOA 4TM9A 7FABL 3PAZA 3K4AA 3QB7C 4GAYB 3PLYA 3U1PA 5JW5A 4YBQD 2DLTA 5FYJU 3ATBA 3QUZB 4ZOBA 4EI5A 1E42A 2VLKD 2ZE0A 4JFFD 3MRLB 4YNYA 5LWYH 3H7BA 4I3SL 4NNPL 2YPKB 4DN4L 3CSBA 2R2EA 5IMOA 2LE9A 2VZUA 5EA0H 3S3CB 2DQCL 3L6FB 4JR9L 4RAHA 5A40E 3BUTA 4O02A 2LLNA 4GKLA 3ARBB 3MGTB 4DZBA 3FRPA 3L2MA 4K5MA 4HPOL 1O6TA 4HFWB 1G7MA 3QQ3B 5IQ9A 5HSFA 1Z7JA 5D9SB 1X5KA 2FEDC 4MSWB 4OFPA 5EZOH 3PQYD 3QGVA 5DUPL 4BSVA 4JRXE 3NK3A 4PY8J 3D3VA 3S2AA 2DQDL 1R9FA 3IBEA 1Y0LB 2ATKB 2LW3A 1UVQA 4G6AD 4GUQA 2MNUA 4L1SA 5KS9A 2QT6A 4M7LT 1ZANH 1QZNA 3LRKA 1KYOK 5I9QB 2Z91B 2D0GA 4OZ4B 4XAWH 5CD3A 3D8MA 3N1PC 4FQ2H 3VFGL 3V8OA 3QCTL 2E7LA 1KPUA 5DC2A 5EC2A 3A67H 2YOAA 3RX7A 2I27N 3CZFB 3GKWH 3UX9B 1WD9A 4IDLA 5DYFA 4F8OA 1FVEB 1J1PL 5DFAA 4P9HC 2I07A 1O6VA 3AG1B 1G9HA 2BVTA 5I0XA 1F58H 4PMFA 5FPIA 3T0ED 2Y7SA 1SBSH 5FA4B 1IC5L 3KPSB 3QUMB 1OPOA 2Y6SD 4HJ1A 2XKNA 4LZKA 4HT1H 3EYSH 2EINB 5TPWL 2VH5L 3MUJA 4I13B 2EABA 1NGWB 4FQIL 1Q9WA 2IFFL 2XI9A 1SNRA 3W11C 5M7QA 4MMXC 1P7QD 3TWCH 2VR6A 5C0RH 4BZYA 3EYVB 1U8QA 4H26A 1JXGA 3EH4B 2EICA 2PWGA 3FQNB 3OF6A 3LKOA 2WVSA 1DJXA 3MU3A 4LAQH 3SE4A 1IAMA 4FQXB 4XCYB 3EJQA 3O4LA 4LSPL 4FZ8L 1NCAH 4Z77A 4ABWA 3G6JB 3N1FC 2FUQA 4DT2A 5JZ7D 4Z0XB 3UGUA 3VGBA 4D0BA 4WWKD 3HVNA 5LBSH 3UYOD 2COQA 1CN4A 5DEFA 1UD3A 2G0KA 2XY1A 1C16B 1ZT1A 1R46A 1A6WH 4HXBH 5H2BA 1VGKB 3OHXB 3EYFB 3S98A 4S0TD 2DOCA 5LN8A 1QFPA 1RZKC 2F9BT 3WO4B 4PRHA 5I5RA 5E95B 1A4AA 1F3DJ 2ZOKA 1TIUA 5KBDA 5D1XC 1LL1A 3MRMB 3L3DB 4BK4A 3HMXL 4JAMA 2FYVA 4D2NA 2XOTA 1EJOL 3PHQB 1QPPA 3PWNA 3D9AL 1ZHLA 4O58H 3SJVE 4S0HA 4LHJB 1AD0B 1FLRL 1MCBA 4K5NA 3I6KB 4NEHB 2DJMA 3QXDB 1SUHA 4LCCB 2OZ4L 2RJMA 4Z7VB 3QZWG 4FYRA 5FB8B 3CV5A 3EOBA 4PJFB 2HAZA 3K4DA 2NT0A 3GZKA 3STBA 3IAQA 4G5ZH 1DVYA 4HS3A 2AEQL 4I3RH 4OD2A 2X6UA 5IB3B 4N8CH 4WNQA 1YEEL 1YN7B 1J0YA 2YXFA 4P2YA 1DFXA 4AK1A 3CQFA 2WLYA 3CZJA 1NH6A 4MCYA 2RQ8A 4HGKC 5BQDA 5C0EA 4QRRD 1VADB 4O4YL 1HYSC 4RSVA 2YAPA 2Y3NA 3UP1A 2ZF8A 3RAJH 3W0WB 1WQVT 1EXUA 1JFHA 3MRHB 3RTQA 4HLZG 2VZSA 3OSVA 4KH2A 3W38A 3HC0A 2UY7A 3VFNB 1PG7H 2XA8L 3LZLA 3ZTDC 1J0ZA 3F5WA 3PL6B 3IFPA 5HI5D 1G9MC 2FCBA 4JFDE 5CBEA 3L3GA 1R47A 3LRMA 5L9DH 1I7UA 3QJZA 3OKMB 4PGDB 3SKNA 3TEUA 4ZOAA 5GQBA 1TVBB 1EO7A 2APFA 4AQEA 1R3JB 3CBJB 1DZBA 5LCVH 5LXGL 2ZNWA 1BVOA 3NYKA 4A66A 4PLJD 1Q94B 1GTNA 3CSGA 3PWJA 3ZU8A 3QRBA 2XN9B 4XODA 3MV9A 2IVFC 4N0CC 4LLUA 3P9LA 1ANUA 3C5ZB 2F1BA 2VXQH 2G75A 4P5SA 4QHUB 4B9KC 1PG7X 5LBVA 2FSEB 4JQIA 1WT5C 3L3HB 3QUZD 4IMKA 4XNMB 1OP9A 5FYJL 2Q8BL 1NFIA 4JJOA 3KM1A 1QOKA 2Z7WA 1LK3H 1P4BL 1HAUA 1BZ7B 2FQFA 4KRPB 2YK1L 1WBYA 2EJ1A 5EO0A 3EBAA 1NFDF