4PH8A

Crystal structure of agga, the major subunit of aggregative adherence fimbriae type i (aaf/i) from the escherichia coli o4h104
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'HHHVTNDCPVTITTTPPQTVGVSSTTPIGFSAKVTTSDQCIKAGAKVWLWGTGPANKWVLQHAKVAKQKYTLNPSIDGGADFVNQGTDAKIYKKLTSGNKFLNASVSVNPKTQVLIPGEYTMILHAAVDFDNKQGGASQQTTQTIRLTVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aggregative adherence fimbrial subunit AggA
publication title Structural Insight into Host Recognition by Aggregative Adherence Fimbriae of Enteroaggregative Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli o104:h4 str. c227-11
molecule tags Cell adhesion
total genus 31
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ph8A00
2MPVA 4PH8A
chains in the Genus database with same CATH superfamily
2DYPA 3FQUB 4I2XB 3LZFH 2VLRB 2FJFA 2YXVA 4U1GB 5EORL 3SGEH 5I66B 5J3HD 4HIIA 4KTYA 4IIQB 1A7RL 4PRNA 4L1DA 4JAMB 3V5HA 5KYYA 1HWGB 5E8EA 1QHQA 2QVMA 4LSPL 5LBSH 2NSXA 3LOWA 5CIPB 2ZX6A 1CWVA 3WIFA 3EYOA 4CMMA 3L3HA 2GC4C 2YD3A 4LVOB 3L3IB 3QIWD 1ZA6A 3O3AA 5DYFA 5IROC 2GEEA 4HUWA 4K7PY 2XFXA 3NG5A 1Z1WA 4Q9BA 4NKMA 4A37A 3UJTH 2FWSA 5FFGA 1G7PA 5AVVB 2V2XA 4DN4L 1A6WH 1SLUA 2QKIC 1OIOA 3CLFH 3GDCA 4D9QD 4LNVA 5F1NB 1BF5A 1X5KA 4ZQKB 3HCVA 2P43B 1GGCH 5AL0A 3REVB 3ZR6A 3WNLA 5FA4B 3K1DA 4DTGH 4HC1L 4H25B 5DUPL 1F58L 2F1EA 3LN4B 5FWRA 3HMXH 1E40A 4MX7B 4TNVF 2XIBA 4YK4B 5GS1C 2PABA 4PJBE 5F8RC 3GBDA 4Z7UB 1H8OA 1BM3L 1RZQA 5LCVL 3G5XA 3HVNA 3DMMC 5DLML 3B7UX 5BZDA 1AXSB 2DB8A 3LKSA 3VYNA 2VCOA 3NIGF 1FQ9C 4Z77A 3RPIA 2HTLC 3F7QA 4HV8B 2UUDK 3E6HB 5DHVH 5KVEH 4C83B 3GJEB 4FQ2H 1U8CA 1VB9A 3EO0B 4FAAB 2VL5B 3V5DB 2PW1A 5ADOL 2D3LA 3L8QA 3MLZH 5DJCA 2LFGA 1FA4A 2HAZA 4BZYA 3QQXA 3W0WB 5AZ2H 4AJVA 1Y6KR 1OT1A 1S7TA 4WK2B 3LCYA 3COOA 4RFEB 2V5TA 5BXFB 3OXRB 1NINA 2CE6A 4HKXA 2ESVD 2FEDD 3QEUA 2AF2A 1GPOL 5DO2C 4A2LA 3OKKB 5ABZA 2KERA 3QT2A 1ERNA 4M62H 1J1OH 4XN5A 43CAB 3G3LA 1E30A 1I82A 1HVXA 3STBA 1OF2B 4LGRB 2CHWA 4OJFL 3P4MA 5J9PA 1MFDL 1NGPH 3HTLX 1DN0A 4G43A 4AUJA 2A77H 1I4FA 3QWOB 5C0IA 5JW4R 2PTUA 5EZOL 2NNRA 2ZJSH 3O11B 1BYPA 5MEOA 4N2HA 5F7UA 3QJVB 3I84A 4P4RB 2H6PB 1QFWM 4HBCL 3V7AG 3RILA 1T22A 3VSQA 2AJUH 2FB4H 5HGBB 4NO5A 3RFZA 4L8CB 1E65A 3BD5A 4MBOA 4K5NA 4NN5B 3BLPX 4GRLA 3V0WL 4NZUH 3K71B 2A4EA 1AHWC 4ZO9A 4OFYA 3QFJB 4YQXL 1JWMA 1ZVSA 1EAJA 2ZXWB 1MPAH 1QYGL 3LZOA 4KQ3H 3E80A 1KT2A 5I1LB 4S10A 3ZE2E 3V10A 1A4AA 2ZSWA 4BH8B 3HG1B 3K8LA 2K8QA 3FQNB 5H4YA 3QRLA 1AG0A 4MJID 2WVSA 2O93L 1UYWH 1YEGH 5L2KE 5IQ7H 5C0EB 5HYSB 1ZXKA 3AMLA 4UAOC 2HG5A 2DI9A 1QZ1A 4G80B 4HFWB 4F8PA 4YXLL 4QTIL 1PY4A 5AAWA 1HHIB 1INEL 4PJGF 3VXRD 4ODUB 4M3HA 4EOWH 3FQWB 4L2LA 3NZHL 4MTMA 4YZFF 1NEPA 5CEXA 3ARFC 2GCYA 4QHNA 4AVIA 3EFFA 2HFEB 2BJML 5E08H 2NT0A 2Y5EA 1U8OB 3S35H 5HYJE 4PJIA 4UOQA 4G6JH 5IJVB 4I77H 5JMOC 3UPAA 1AO7B 4APQD 3H7BA 4L5FL 3GGWB 1MUJA 5I30L 5D2LE 3WKMH 2HFFA 4FNQA 4RNRA 1QBML 5C0CB 1D5RA 3UTSD 4ACPA 1JNLH 1QHPA 4UT9L 4PB0H 1L7IL 2X2JA 4U6YA 5AZUA 3TJHC 3ZQ9A 3KDMB 4L1HA 5DJDA 5FDWB 5IQMA 3KYOA 2J21A 1U8IB 2R0ZH 1OM3L 5KN5B 1YPZB 3AUVA 5AAMC 1OGAD 2N7SA 3AREC 3ETSA 2CCVA 4FFVD 3KE0A 1RIUL 2O30A 4PW9A 4NPYA 3JYBA 4ZD3H 3B6SB 3T3PB 3OWEA 1ZK9A 3NH7H 3ESMA 2J88L 1V54B 5IG7A 3LX9A 2BS9A 2ADYA 2Z7YA 4M7LH 3DK2A 2ARJA 4LLQA 4JJHA 1R24B 5CIPH 1JZ7A 3WNMA 2WSPA 2PYEB 1E6JL 1KXTB 4OM1L 2YEZA 3FFDB 2AEIT 3FFCB 3QDGB 4KK6C 4Y1AB 4PYHA 3FUNA 5K59F 1XGUB 4GW4B 4X9IA 1NCNA 4PWGA 3KPRD 1AIFA 4JN1L 3QUXB 5JORA 1NFIA 2FAUA 3UBHA 1GGIH 1PQZB 4OKVA 4G11A 3PWPE 4UI2A 2XV3A 4BGDA 4S1SH 3HS0A 4W9DC 3FH7A 4L8BB 2XV6B 2F5BH 3QG6B 4OGXH 4IK6A 2IADB 3RZCC 2LLLA 3BWUC 4J6RL 1CE6A 4KKLC 3RHWF 3TFKC 3UAJD 1UH4A 3NJIA 5EOTB 1CFNB 3QSKB 1JS4A 1XSOA 4KKAD 4FZEH 3AY4A 1JXDA 4X4XB 3K6OA 5F88A 5CP7B 4Z78B 4Z18A 5CUSH 5I17B 1JZ3A 1R5IB 3MBWA 5E94B 3WEBA 4U3CA 4PUBH 5KZCD 1LLAA 3CSYA 3O8XC 1JGIA 3AMKA 1NUDA 4A1RA 2ZG2A 1BD2E 3GXDA 5DQDL 1AGEA 3QEQA 3CHOA 3QPQD 2ISDA 2Z6FA 3KPMA 4AQ8A 4YGVA 4L3EE 3NYKA 1EJOH 2VLKA 4J3WA 4X7TA 4M6OH 4AI7A 1XBRA 1A0QH 5JOEA 2BWIA 2IFFH 4XO9A 5D2NE 4TSAL 3ISWA 3GO1H 4W93A 1DJXA 5IHZA 4JB9L 3CK0H 1RJYB 3ETBJ 4ZMXA 2A9DA 4LB8A 2YD1A 4LLVB 4CU6A 1H3XA 1U8QB 4P04A 4YR6B 2C9XA 3Q3GB 3ZYIA 1U3YA 3HE7B 2EDLA 4K23H 1COBA 1UHVA 2OAAA 1T03H 5CEYA 2EILB 2A5UA 4V1DB 1NC4A 3MJ9A 3N0AA 1XR8A 3DYOA 2GJZB 4KK5D 3DDGA 4OD1H 3APDA 5I5RA 3KGUA 5F9JB 1QG3A 4PJ6A 4L3CA 1MQKL 2HVJB 2K7PA 5E0FA 4FTVE 1X9LA 2O61A 3QDME 1F97A 4OGAD 4G8GE 2FLRT 2BP0A 2HVKA 3L3JA 1JZ8A 3MUUA 3VX1A 5AVXB 1LJMA 4YDKL 3OAUH 3CHXA 1S5IL 2EECA 1FL3A 3LPFA 1NCAH 1PZCA 1F02I 3UBXB 2JKTM 4KRPC 1EO7A 1YCSA 2WWMC 3MUJA 3N1PC 4AJWA 3UPRA 3AVEA 2B1HH 3U0TA 3QR0A 1NSNL 1JUFA 1J05B 1A6UL 2BX5A 4IOFC 3NIDE 3E6FB 2L7QA 2FJGB 2B59B 2CZNA 2EDNA 3DGGB 4FL4C 4P9HL 2N7AA 5E9DB 3W39A 3RY5A 4GSRA 1UD8A 3IJ8A 2XA8L 2P5WB 2CBMA 1NBVH 1GRWA 1BV8A 4JFFE 2B0SH 4X5PA 1OD9A 1M7DB 1FLRH 2PXYB 5IQLA 1GR7A 5KWYC 4WFHD 3S3JA 5D7JB 5BO1L 3MLWH 3S34L 4JFDD 1QFUL 1GIGH 3HUJA 3MYZA 3P77A 3SCMB 3EF7A 5HHOB 2G4GA 5L9DH 1NKOA 3ULSB 2APFA 4MZ2A 5EIIB 2IOMA 3K6IA 5IV2A 1BQLL 2MMXA 3DWTA 4AQ1A 3HI1A 5E6RB 3MV7A 3IDIB 2XZQH 4PJ9D 3BDYL 1RZFH 3I50L 1J8RA 1J1PL 1J8KA 4LRIA 2EDKA 3BP5A 3P4LA 5K9OB 2NUTB 5FUOL 1KACB 5KBLA 4MNQA 4HWEL 1MXGA 4NKQB 3ZUNC 1AXIB 3D39D 2CDEA 3FTUA 3HLKA 2H8PA 3SQBA 4A2GA 5EO0A 4JVPA 4CC1A 4NO2B 2R56H 4N1CA 3VFTA 1YECL 3QH3A 4RESB 4XVTL 5E1AB 1F56A 5FCSH 2FT7A 2ZXGA 2NW3A 5KG9A 4AIZB 1QRNA 4V11A 1UGNA 2X1PA 2Y69B 5EU3A 4ZX5A 5IHBA 2DQ6A 4NC1C 1WEJH 1J0YA 3QIBA 1KPUB 5FUCC 5B38G 5ICUA 3C8DA 4BA8A 4JUSA 3BT2L 5KSAD 4HISA 1MZZA 2FIKB 2ZUUA 3QJQB 4MZIA 1LP9B 4Z9KB 4A39A 4UYQA 2HSIA 4GP8B 3D18B 4ODTH 2X4RB 4QRPA 1JZFA 1S7WB 2OMXA 4DGWC 1AKJB 3MRLB 1RUMH 3AROA 3FTZA 4ZXBD 2F54A 4MQ7B 4PY8J 1RMFL 2NXZD 3SDCD 2X7LA 2FBJH 3JZ7A 1U92B 1E4JA 3QO1A 4ODWA 1RFDH 4OD3L 1E4XI 1MRDL 2HX9A 3PJNA 2DKMA 3TTYA 1MJ8L 3WTTA 4G42A 3JQOB 4KAQL 4CBZA 2VDLB 3QS2A 2G2RB 4ODXB 2WLJA 1UA3A 4U3XA 3M7OA 3ETBF 5TE7H 5E00A 5FYLE 1SMDA 5TDPA 3AY2A 5J1TC 4YVNA 1E4WL 2W0PA 4G2AA 4H0IA 5T3XL 1MAML 3E2HC 2OK0H 4WNJA 1NCOA 4K3EL 4ZPTB 4ZPVA 3D3VA 1RUPL 4JFXB 2VXQL 4GKNA 4ANKA 4N8VA 5ALCH 3MV9A 4MD5B 4NWUH 3U36B 4I0PD 4J2QA 3T2LA 3MBEB 1LD9B 3BE1L 3KGTA 4Y4HD 5BVPH 3RWIA 1FHGA 4WEBL 3VX0A 3KPNB 4HT1L 4KI5D 1IBYA 2XI9A 3LQZB 3RA7L 3BP6A 5IHUL 5E7BA 1OTSD 1C1EL 5AD0B 2A0LC 2E7HA 5CHNB 3IMVA 4TL4A 4G9FD 2XJLA 4JNXA 5CP3A 1RULH 2W95A 3NA9H 2WLMA 3MODH 5HY9A 2CJUH 4F2MA 3CPLB 4PYGA 1BHGA 1OAXH 2G5RA 4H8WH 4YSTA 3DX9A 4YSAA 1JV5B 1ZLUK 3VA6A 4LSUH 3ZKXB 4ZSOA 3ZE1E 5C0JB 4GT0A 4IRSD 3LZPA 1T1WB 4F7CA 3VXME 5F3FA 4XVJL 4KOCA 1E2VA 2CIIB 3CXDH 3QNXB 4HXAL 1IGFL 3SKJL 3V0VB 2Z0UA 3WN5A 5DCCA 5DK2A 3OMZA 4G7SB 1QSEA 4H2CA 4XPAL 2X38A 1CLZH 4Q14A 4LESA 5DMJB 3FO0L 4MB3A 4C4BA 1EGJL 4TTDC 4XN2A 2ROXA 4X6DE 3WMPA 1EPFA 1Z2KA 2YK1L 3DXAD 3LJ3A 3RTLA 5AUMB 2EIZB 3RFZC 3F83A 3BVXA 3NRFA 4G7VL 4CC4A 4L4TB 5L4JA 2X9XA 3H9SD 2R7EA 5HGAB 2RHEA 1E7VA 3QIUD 4V2CB 2WZPD 2W07B 4OZIB 1E67A 3PL6B 4TQPA 4I0CC 2R2EB 5I16B 4BCXA 1JK9A 2WO3B 3MR9A 4O5LH 5DU7A 2GITA 1E4XH 3L54A 3KLKA 2EVFA 2N7BA 3QNYB 3RX7A 1NM9A 2Z8WC 4XN8A 1NBQA 1NUNB 1UM6L 1XGPB 3RL2A 1OK8A 2DWEB 2N4IA 4OVVA 2PKDA 3ME0A 4P4KC 4CJ1A 3WLBA 1S3KL 5AAWC 1G0YR 1SJEA 3FZUC 3QQ4B 1C5BH 2KDYA 4PRAA 4F2FA 4QRRA 2EIMB 1I9RL 3D50A 1A4KA 3TJPA 1TQTA 2VM9A 1QW8A 4HUUB 3TO2A 4AZ8B 5F7YC 1I1CA 4JO3L 3T08A 5B7MA 1O9WA 6PCYA 5G4NA 1XIWC 4B5ZA 4EUPA 4AH2A 1G7QB 3FL7A 1RI8A 3BQUD 3GMNA 5KBKA 4YXHH 3FTGA 4TNWF 4XC3L 3I75A 4XE0A 1MFEL 5EBLB 4D9QE 4YHYB 3O4OC 4WW2F 3N41B 1ZHKB 3GLZA 2WCPA 4W6WB 1E5AA 5JR1L 4NGHH 1X7QA 1T1ZB 4NO0D 3ESUF 4MXWH 5BZXA 4H0GA 1XTMA 1TIUA 2C9PA 2HKFH 2P9RA 1N6QH 3DV4B 1IBZA 4KXCA 3JTBA 3SPHA 4FZ8H 1SJHB 3FOLA 3FHQA 4BKTC 5MEQB 2CHDA 3DETD 5T3ZL 5FAAA 2W0FA 2CLVA 4QGYA 5CJOH 4JFZH 3VXUA 1OANA 4AKQA 5DFVD 4GLRH 1BEXA 5KAQG 1A21A 1HNYA 1QUNA 2GTWB 5DHXB 3N06B 1BREA 1KC5H 3HMWH 2VM3A 3Q8BA 2MRYA 3ALXA 5I1DA 3AACA 5FYKH 3S37L 4JM2D 4IKJA 4M61A 5FYJL 1EHXA 2XWBA 2CGYA 1RV6X 2OBGA 1KCSH 3FO9A 3MGOB 2AK4B 4TUOA 1IC7L 4IOIB 1PSKL 4PRHD 3WDIA 3RL1B 3EYUH 4NAQA 1QNZH 1DBKH 3CTTA 1L9MA 4Y4KD 2JCWA 4WZ9A 4EXKA 2D9QB 1FNSL 2EXSA 4FQCH 3QEGH 3VXNB 5JIKA 1SYVA 2ADGA 2AJVL 3L2MA 2XJKA 3US9A 1N3NB 1TQBB 2UZPA 2ESVE 1GS7A 4YUEL 1RUQH 2VDLH 4UQ2A 4F7EA 1QSFA 4Z3IA 3L3OC 5MEPB 4D0DB 1D5XB 3MRIB 3T8VA 3MXVL 5T33L 3DBXB 3WFDL 2F18A 3AY4C 1ND0B 4KOBA 4CVUA 1G6RA 5MP6H 4FHKA 5I1AA 2AQQA 5H37G 1TTUA 1MI5A 4F1ZA 1Z5YD 3HI5H 2BW4A 1RK0B 5CLWA 1AZNA 3DUUA 4ZI8A 2GIMA 3TX4A 3VW3H 4PY8I 4C56D 3QARA 3O0RH 4AQ8C 1I1AD 1ZIAA 5HSFA 1WT5A 4TQ8A 2E74C 4KUCF 3V6FA 2FYYA 2APBA 1ZMYA 3NIFB 4HJ1A 4HCRL 4OGQC 1IEAA 4B97A 2WNXA 2ERJB 7TAAA 4M93B 4G70B 3INUL 2H32A 3DIDA 2DWSA 2ZCLH 4ELDA 2HG0A 4AITA 4TQEL 4YXKL 3TC9A 1V7NH 5J13B 2P80A 3VFMA 1Y0LA 5IW1A 4LSVH 4OJCA 3WGUB 1IC5H 4UV7L 1I8KB 1KG0B 4HAGA 1XB8A 4M7ZB 2DD8L 4MJIE 3ILEA 3VFPB 4GSUA 1W2KT 3ULVH 4L37B 1DQIA 4XMKH 5DWUH 3ZDXE 1CJYA 5IK3B 2JIXB 5HHNA 1T2XA 4Z0XA 3M1BB 4ODSH 4PR5B 5C2BL 3WY3A 2DM7A 3VXRE 1UCBH 1IBHA 3ILPB 4MA3B 1CTMA 1E3XA 3GC3A 1L6ZA 1JHTA 1FYTA 4L5FE 4N1HB 1NIFA 5L0QB 4LLWB 1XF1A 1SXCA 3MVSA 5EU6D 3FT0A 1NLDL 3AB0B 4WCYL 5FM8A 3UEQA 5DJ8B 3MHZA 4J3SA 3H9YA 3TPUB 4WUUD 3U46B 1IV8A 3QGVA 1D5BB 4HUMB 4MCYA 5I2IB 4KXBA 4DW2H 4OJEH 1HXYB 3P11L 1QO3A 1J5OL 3UTSE 5EOCJ 1KPRA 4EQ3A 2J44A 2XKSA 3TZVA 4HWUA 4QXGL 3IFLL 4U6XA 2H3KA 4ONOA 5E4IA 2RAMA 2X9WA 1S9VB 5TDNA 2OL3A 4P5TB 5K93A 4MNHB 3S88H 3B9KD 1OGAE 2YD9A 1RZKH 1B9ZA 2AVGA 5CFAA 1BZDA 1ZHNB 2L3BA 2PP9A 3V4VA 2OZNA 3BVVA 4LEOA 4JPSA 4X5XB 1DUYA 3Q6GL 3K0WA 2DJMA 2A73B 4NM4L 5E6IA 3ZQXA 5D72L 2IAMC 2YPLB 2YXWA 1N4XH 4GS7C 1P5UB 4WO0A 3KW8A 2JELL 1XSKA 3FCTB 5D6CB 2NX5A 1MFVA 1BYNA 4TRPL 4AQ1C 3EHBB 3KPRE 4I1NB 2P1YA 4MD0B 1FIGH 5F0LB 1P4LB 1C8QA 4PTUA 2NNXA 2E8ZA 2A9ML 1JE6A 2OXHB 4F92B 2VUYA 3KPLA 1GHFH 4OFPA 4Z7WB 3GJFB 1GYWA 4E5XA 1HHJA 2HT2D 4XWOC 4B3VA 4DZBA 1TQWA 3E38A 2DLTA 5DK3A 1U4FA 1KTRL 2XZZA 1A2YB 4XBGA 2CO6A 2DZEA 2QL1A 4X4KA 5A2FA 3I6KB 5LWYH 3OMIB 1KIPA 1XSIA 1JSYA 1Z5LB 5D1XA 1PZUB 3FSOA 2P5EA 4WFFD 1KCBA 3QRBA 3RKDC 4LQFL 3K6SA 3EZ8A 3R0MA 4I3SL 4JLRB 3T65A 1SF3A 3TASA 1EAOA 3FHEA 3LNEA 3ZL2A 3ECBA 1VLXA 1JJUA 3QIBC 4HHAA 4XPGH 4XO8A 2EIDA 5DC2A 4PLJD 4XPTH 5IVXA 3TYGL 4JO5A 2VLJD 2EEFA 1RZJC 4ZW7A 3QUZB 4AYSA 5FOJA 3QI9D 5FEBA 3IETA 1NGWB 5GGTA 1B4LA 1KN2L 3V9EA 5CBAB 1EMTH 3PNRB 1DR9A 5HD8C 1CPUA 3F64A 3P2DA 4HBQA 1NGQH 3AWGA 4OD2A 4X50A 2VB5A 4FFYA 4N8UA 3S2CA 4Q6IA 2C4FT 4X0KB 1U8JB 3VQLA 1HWWA 1X6LA 2Y1YA 5DJYA 4PCSA 1SYSB 1I7ZA 1E50A 5EHFA 3VH8G 1FNAA 4PW3A 1P7QB 1A6TB 3H0TB 2W88A 3CNKA 1JVKA 4MCZA 5GGRA 5CZVH 4YHNA 5KBDA 3L2NA 2VN3A 1A6AA 4TSBL 1OCWH 3ZPDA 4AQZA 4G1MA 1U8MB 4GQQA 1T2JA 1VFAA 2AJYH 3MNDA 1S46A 3WIAA 2F7QA 1JI2A 3WFHB 5KEZA 1YYLH 5GRUH 3OPZL 3SPGA 3HZMB 1XMEB 3NCFB 4B0MB 3E1ZA 4DF9A 1WCBA 4ADGA 3FTWA 1FGNH 4FX5A 1HHHA 1R34A 2VLLA 3BMVA 3JSSA 4ZNEA 3ZTEA 3WENA 5JHAA 2EH7L 1MFCL 2E3VA 4KJQC 2OZ4A 1I8LC 1QKZL 3NEOA 3NK3A 4XWGH 3X3GL 1DBMH 3NDZE 1YEFL 4X8XA 2NY0C 4I1RA 1IE4A 1F6FB 1W72B 2WCSA 1A7PL 2YRBA 4NXKA 3OAZH 1CCZA 3L6FA 5DS8A 1TUPA 3IKCB 4U6VH 1F3DJ 4GUCA 3DGDA 4HMEA 3K4AA 2L4OA 1KWGA 2ZXQA 2DWYA 5I8CB 1A4CA 1UQSA 2P4AB 2GYSA 3ZDZE 1WAPA 2BOLA 3ECQA 3MA9L 3Q2VA 3L1EA 1QR1A 2IVFC 5EC1A 2UXGA 3ARBA 1ET5A 5IHLB 4UT7H 4MKTA 3GYRA 1OM9A 5HDBE 1HT6A 5IB3A 4CGUB 4BH7B 1F11B 4WFHE 1AZVA 2NY4D 2YFOA 4OAWB 3WN5C 3F7LA 4EDWH 4JFDE 3KYNB 2CJTA 3EUUA 5E2VL 1A3LL 1Z3GL 4I85A 2WUBL 2XWXA 3BD3A 5D93B 3IGAB 5L8LB 3MBXH 3QC5X 1B0RA 4O02B 1QP1A 3KL3A 2HJFA 2XX1A 4OQTL 1VGEL 5TE6L 1YDPA 4JO4H 3PV6B 1ZPLA 4AM0A 4EVNB 1DJWA 2CR0A 2GJRA 1DQJB 2EEDA 3B7YA 4TLKA 5D7HA 5EH1A 4NHUB 3OZ9H 5C07E 2YJQA 1X9RA 4FXGB 4H20L 3HNVL 2Q3XA 3D39E 4JO1H 5ACZA 4OCSH 3ABMB 1ADWA 2BK8A 4XNYH 1M71B 2A9NH 4ZFGL 3G5YB 4NKOB 4HUXA 1G7HB 4TQIA 4L18A 1BQHB 1NCUA 4WLCA 2TSBA 4B27A 4X6CB 2BNRD 2YD0A 3SPCA 1Q4NX 3FQ4A 4FQXB 1A1MA 4X6CF 3Q2WA 3TJEH 3BSZA 5KSVA 1A9VA 4IU2B 2E27L 2DQEL 2RALA 3HLAA 4FQIL 1FO0H 2AEPL 4NQEA 5I15H 3UYOD 4NHCL 3FB8B 4HIEA 4PV8B 1ZT7B 4XT1C 4LLUB 2WXPA 4P05A 2CALA 1IL1B 2AV1A 1CLOL 5AL8A 3TH3T 5ITBH 1WG3A 1OSYA 5KVMC 3B1UA 2FBRA 4DTGL 4PJHF 2VAAA 4E9QA 2VDML 1VERA 4GXVL 3UZVB 3HAEB 1X3DA 1SMOA 4BUHA 3CVBA 4XAWH 5A2BA 3GJFH 4XCCH 4M4RA 1MOEA 3LIZA 3MV01 4G8AC 3QAZB 3X12B 4CVZA 4HQQL 4MQXC 4WW2C 5DFTA 5HI4D 4ONHA 3WUZA 5CEZH 1MNUL 2Q8AH 5LUMA 3RVTD 4M3KB 2OCCB 1B0WA 2P47B 3MMEB 4OZHE 2Q5BA 3ZTCC 2J1KA 3T0BA 4Y0GA 1AGBB 2JLPA 3BOVA 5D70L 2XWRA 2OP4H 1PX3A 1P4IH 1J9TA 3B9VA 2J3SA 5IF0A 3NDYE 2NTFA 4G8FB 1ZJBA 3G6JF 3FSZA 3C5SA 5JDJA 1TQCB 3G6JA 4OI8A 3R8QA 4NQCB 2C3XA 2H3XC 2Z93A 1YEKL 4M7JH 2X70A 4KI5E 2YPVL 2BLFA 4LBEA 4XMLL 1ZLSL 2YSTA 3WUWA 3FS9A 3IMSA 2BSTB 1Q0YH 3JV5A 4KZCA 4G9FE 4AW7A 3BISA 5INDB 3NSXA 4J23A 2C1OA 3LZQA 3V55A 4PLNC 5B1AB 3DSFH 1A5FH 1AG6A 1R33A 4OCXL 1MHHB 1E7UA 2PP7A 5HYQA 4OSUH 4RAVA 1A6PA 3LYRA 1M4KA 4S0SD 1DFXA 3L48A 2OMNA 4JVUA 2ZJSL 1XL6A 3M6DA 2EZ0D 1JZ4A 2AJUL 5FV1L 5E7FA 3VRIA 5BJTA 4PJ7E 2UWEA 1NPJA 4N9OB 3GB7A 4NQUA 5I75B 1G7MA 2K4WA 4HH8A 5ESVA 1FN4B 4AW4A 4OLZH 3BH4A 4D8PA 3RU8L 2YSSB 3LKNB 4AIEA 1XCWA 1GJUA 1WAEA 4U0RB 1FCCA 3QORD 3ARGB 4U31A 2D7MA 3L9YA 4MZRA 3DXAE 1ITCA 1WT5C 3MRBB 5JHLH 4JM0A 3GRWH 1I8AA 1NCJA 1GY1A 4UTAA 1HOCA 4JANA 2DQUH 1XH3B 1F90H 5KTEH 3VWKD 3NRQA 5B4MD 4Z3HA 1S9WB 2LGNA 3FTSA 5IQ7L 4UT6H 1W72H 1UASA 4LLYB 2CKNA 3FHAA 4M5ZH 1SY6L 4AQAA 1TKWA 3NCCB 3BHBA 3MRPB 2FK9A 3RGVD 4D8OA 1A7OL 4P9ML 5IFHL 4PRIA 1E28B 4QT5A 1Y7VA 1OAZH 1U8NA 1MHPH 3CFJB 3VG9B 4P2RA 3PLYA 1WF5A 3TFBA 1ZV9A 1HKLL 1MFAL 2VR7A 3EH5B 5AWNL 3TU6A 4L8DB 3SOBL 2W9LA 3M46A 4IRJB 1OPOA 2FQEA 4LLMB 3K5RA 1JG9A 3KVPA 4PH8A 4GAJL 3PY9A 4R7DB 3T5WA 1QA9A 2EADA 3HZ3A 5ENWA 1BVLA 3WE6A 4E68A 1L0XA 2VLRD 4Q6YA 2WB1A 3QQNA 4PRBB 2XC8A 3EDJA 4OT1H 1I7TB 3JV0A 2XZAL 1ADQH 1LEKB 3HN5A 4M8UA 2DQGL 4M5SA 4L4VA 3HHSB 5LGJB 3PIQA 1QFOA 4P2QB 3MJ8A 2LVCA 4ALAH 1ACZA 2EYTB 5FKAA 1JGDA 4CNIB 3TZVC 3VDAA 4YBQC 3QUGA 4D94A 5F7EL 2GEQA 5ABAA 1HILB 2OMUB 1OB1A 3IVKA 3DSNA 3PWUB 4EIUA 2JJWA 3L5WA 5EZPA 1XR9B 2AAVA 2JB5L 3BPOB 3ABKB 3U30B 1AD9A 1EXHA 3RAJL 1QEWA 2CLRA 1OAQH 5TJWK 3ZR5A 5KYUB 3VFVA 6CGTA 1M6OA 5BRQA 4K8RC 2ODHA 4BFRA 1GSMA 5GHWL 2GK2A 3VFOB 3FRPA 1KJ2B 3P3SA 5IHHA 5IBTL 4WI0B 3O4LA 1R6VA 2NY7H 1EERB 2CUHA 4J4PC 4OGXL 3EXJA 1KB5A 1WV7T 4Q58C 5BV7C 4UV4L 5GXBB 2ZAIA 5E9AA 4G6KH 4XPHH 2XRAL 1FWXA 1NGZB 5FA3B 1DVXA 1HTYA 3S96B 3VVWA 2RCSL 4FZEL 5GGSY 2NXYB 4R26H 3PG2A 5IJDC 1I7UB 3X1EA 5INCA 2KI6A 3HAEH 2P8PB 1N8ZA 3F7KA 2HKHH 2PTTA 4PJ5B 4E0RB 4GMSL 3T9WA 4ZS6D 4Y16A 3ARPA 4GRWE 4F8OA 3OR7B 5B7FA 1FPTH 4WHTB 5EF2A 4HJJL 2R0LL 1L9PA 5D1ZI 3MO1A 4N2CA 4HLZG 5D1XC 5J12C 1AJ7H 1NFDA 4A2DA 3W0WD 4ZT1A 4R90L 1PF3A 5T1MB 2QELA 4AGOA 5BOJA 1VFBA 1I8MB 1TEFA 3HZYA 2IC2A 1AR1B 3FQXB 1T2QH 3JWNG 4K9EC 1URIA 1KGCD 3TYFB 2VLMD 4A63A 5I28A 3B7SA 1FVDA 4KKBD 3AAZA 2O6DA 1ORSA 1QACA 2X9YA 2IWFA 3CH8A 3O3DA 3GINA 1DDHB 3ZLQC 1TLKA 2OJZL 3LNFA 2EDRA 3I2CL 3FO1A 2DQIL 4H13C 1ODUA 4HIIB 1F4XL 4IW4C 3LZRA 1FVEA 5LBVA 2IDTA 3RB5A 2IDQA 4HS6A 5KYYB 3QUYD 1BXXA 1TZIA 1RZ8A 4XH2A 4HCIA 4ILDA 2DQJL 2GPZA 3KNBB 5DJAB 3WIFB 3W82A 2OFQA 3MLVH 5ETUB 4B7IA 4ZTOL 4EEEA 1CXIA 3BC9A 2AXWA 2V17H 4LARH 1ZA6B 1GTFA 5IEKA 5GGUB 1D5MB 1FFRA 2X3BA 2DS4A 2QPDB 2HLAA 4FNLH 2WQUA 2IXQA 1N64L 4M03A 5C0BA 1ETB1 5HGHA 5T5NG 3ULUF 5IMMB 1QFPA 4F8LA 5JYLA 2FX8L 2V2XB 3QFJD 3TNNA 2X4OB 2FWLB 3GSRA 5FWQA 1NCAL 3HN3A 1HH9B 1RL1A 2XN9B 3HCVB 4EZKA 3CVHL 3HG1D 5K39B 4FQLH 2IQAB 1A3RL 2MCAA 3IJEB 4H8QA 5EU6E 3EFOB 2CIKA 1OT2A 3BKJL 1F4WH 2ZOOA 4KHTH 4WUUE 4XMTA 2G9HA 3GF8A 2VRQA 5FW6A 4Z3GA 2Y7LA 2EXTA 2Z31A 3D5OF 3GBML 5BZDB 1X5JA 2X4NA 1NBVL 3RPIB 4U6TA 3EFDL 1IVTA 1WA2X 1KELH 1DHKA 1E0OB 5B3JF 5BS0A 2UVFA 1EEZA 3NCWA 2DN7A 1CK0H 2DMHA 3P54A 3UYPB 4ZMVA 4CVWA 5ICZA 3MLWL 1N6VA 4MJ6A 3PHOA 3TVMA 2DEYX 3GIVA 2WXMA 5GS0C 3UCQA 4JPWL 5C0CD 3DOHA 4YFLF 1PAMA 1WICA 3D07A 4BYHA 1X5YA 4FLQA 2WXKA 3IDXH 1DVUA 3BT0A 1CQYA 1IGTA 5A2IH 3W37A 5JOFA 5BUGA 1E27B 1V10A 1UOLA 4ZUWA 1VFMA 5IESH 4YSPA 2DQTH 1RUKL 4PJDE 2X4UB 2BRQA 4MAYC 4JRXA 4LCCB 5DMKA 4JK0D 1KBGH 1HZKA 4OZFG 1A25A 4AYBA 2WBKA 4HPYH 4EZJA 1EJ8A 2MCPL 4X7SL 5FM4A 5IJCC 1YEIL 1PD0A 2WQRA 2I9LA 3BCFA 2X2HA 2PYED 4AENA 2CKBA 3FFCD 4Y1AD 4DHLA 2JLLA 4N90D 3TS8A 1CI3M 1DQKA 1OSZA 1QLEH 1U2HA 2NY2D 5DI8B 3RX9A 4BSWB 5EBMA 4Z7NB 1Q1JL 5CILL 4WFFE 4HWBA 4K3GA 1KYUA 4GRLB 4RFOH 3OKMA 3SZ6A 3VXSA 3U4EB 3U1PA 1KBVA 1MVUB 2XG4B 1JF1A 2WBJA 1ZVSB 2HT3C 4W9FC 2WV3A 2FBJL 1ZY9A 1QLFA 2HN7A 3ZVVA 4C58B 2VLJE 4CSSA 1BMZA 2FTAA 1KXVA 2DYSB 1KJ2H 2XXGA 4HK3N 4X6BA 4FE9A 1C12A 4UTCA 2JKSA 4ZO8A 4HX1A 2H0FA 4AMKH 2P8LA 1PGRB 2O1AA 2EVJA 3QE5A 4HIXL 2NNCA 3FW6A 1OPGL 1MCKA 1SN2A 3CBJB 3ET9F 4MS8C 5AOLA 4APXA 2LHAA 4HULB 1T89A 4TXVB 1D3CA 1NIAA 4XCNB 3U83A 4YFLI 4LVHB 1U95A 4F3FB 5KVFH 1USZA 3C5ZD 3QYNA 1FL5A 4QHNB 3N40F 5BUAA 1GKEA 2WLNA 3O6FB 5C0RH 2F58L 3L3KB 2Q7AA 4PJIB 4GG6B 4FFZH 1Q9OB 3K91A 2UZYB 4P59L 2BMKA 3D09A 2EEXA 3H7BB 1IQDB 3TBYB 4LIQE 2VXTH 2CD0A 4WW1B 4JFEA 25C8L 1GOHA 3F12A 3GZKA 4MXQC 3T77A 3SYPA 1UM5L 3CCHB 1XGYH 2QZQA 2YEVB 3PJLA 1IGJA 4EBQH 3GI9L 2TRHA 2VXVH 3ARQA 5FX3A 4Y9BA 1XFPA 2J5LB 3LS5L 1VKXA 3GTVA 2YBRA 4V1DD 1XF3B 2AXGB 3JT0A 4PBWD 4P07A 5ESQA 2X2IA 3PS6A 2WWNA 4ZOAA 3TBVB 3OAWA 4P99A 4DESA 2CSPA 4KJWC 4NNXA 3HG4A 5IG7B 2VISA 3QR2A 4WGVB 2OLDA 3I6LE 4ZDHB 1JTTA 5KJRL 5A2LH 2R83A 2YEZB 3ZL1A 2OMYA 3WJMA 4JJOA 1PNCA 3A4AA 4FG6D 2EXYD 3PGFL 3EJJX 4O2FA 4R7LA 2HUHA 1JFQH 3HB3B 3BGMB 4KK9D 2DQMA 4PM1A 3HS0B 2YMXL 3L3GA 3F65A 1BF8A 4ZOBA 5FK9B 4PV9B 4G59C 1IBFA 2EINB 3LRMA 4PLOB 3L2LA 3PUUA 1Q94A 3VXQB 5DS1A 1CE6B 4PPTA 3IN2A 3A67H 3L9BA 1IM9B 5IQNA 4KK8C 5E9DD 3WN6A 5F6IB 4AK1A 4O51B 2CO4A 5JW5A 4ZUSA 2P5WD 1DANU 2VQUA 1YA5A 4YVUA 3V4UL 5EC2B 4IGBC 1UOKA 1P7KA 5HHQA 1TJIH 2V33A 4DPCX 4B7LA 1S5HA 2PXYD 1JRHH 1E4XL 3CSYB 4TYUA 1KZQA 2A9CA 3CUPA 3CDZA 5D7JD 4JQIL 5BZWA 5TF0A 3ZSSA 3KS0H 1AGEB 3OL2A 3SCMD 5B39B 5HHOD 3T8MA 1DTUA 1PBYA 3HPJB 1BW8A 4YGVB 2IG2H 3LNDA 3WDHA 1T5WB 3CHQA 5I26A 1E2WA 3H9HB 2BSCA 4X7TB 1G84A 3ABLB 1AXTL 4POZD 3BPCA 1C5BL 4TNGA 1NCHA 1WO2A 2VWEC 2WYZA 3BAJA 1LMKA 4MHHG 3BJ91 2QFPA 1NIDA 3UAFA 2BCMA 4N0UE 3A3YB 2BNRE 1KGJA 5C3TA 2CLZA 3RWHA 1EK3A 1OCOB 3IFNH 2K45A 5SWQB 4PS4L 2ZYIA 3KPQA 4XOBA 2QPUA 2ICES 3GXMA 1JWSB 4ERSH 1SOKA 2R2HA 4PJBF 1HZHL 4IJTA 4R8WH 2FATH 2X4TB 3BKYH 4OI9A 3BIKA 5D1ZC 1DQDL 4MDJB 4AV4A 5JLZB 1NGYB 3SN6N 3G9AB 1OGTB 2WBWB 4YC2B 4IEFB 3F8UB 1ZAGA 4U3SA 1NLBL 4HS3A 5AB2A 5LXVA 3X11A 3TESA 4XVSH 4MB1A 3WKYA 4DH2A 5FYKD 3X1FA 4DERA 5KVEE 4G6ML 4B9YA 1Z9OA 4GAGH 2V3FA 4AGPA 1PKOA 1ZGLM 4EI5A 5JOPD 5HI5D 4TOYL 3BP7B 3L3JB 4BWTA 3FO2A 2XQYG 4L3FA 3L9RB 1PG7W 3TIEA 3DI2B 5FYKL 2AI0L 1LWRA 4EZLA 3ILDA 5T1KA 4TNEA 1RVFL 2PCPA 2XACC 3GSNA 4UTBA 5BUPA 3TA4D 4KVPA 5T8IA 2GY7B 5D9SA 4NNYB 4PJCB 3U0TB 4DPRA 4B60A 5E5MA 1R3KA 3BN3B 4FFWD 1JBJA 4NM8L 4YHLH 3GBNH 3QXAB 2A6JA 4HHGA 5EUOB 3IGLA 3G5ZA 4JY6A 5EF3A 3FT3B 1VADB 2F1BA 3GI8L 5F96H 2DBLH 1XF2B 2PO6B 3P4NB 3HUJB 4EI0A 5ID1A 3CC5A 3HI5L 3ZMNA 3LKQA 3RIAF 5JYMA 2XZCL 1JF6A 2YUZA 4Y16C 2CBTA 3UYRH 5TD4A 5HYIA 3HI1B 1PTZA 3DK0A 5C6TH 4GSDL 4XGZA 3HC3H 4ZODA 1T5XA 1KLGA 3ZE2F 3R8BB 3BP5B 3VCLB 3FB6B 1TZGH 3ISYA 1ZANH 3DGCR 5DRWB 4R3SB 2DH3A 2IANB 1CDCA 4OB5H 1OAKH 3HRZB 1BFVL 2CDEB 1BJ1J 4UIMA 4PGEB 3VWJA 5EO0B 5L2KA 4ZG1A 3ULVD 3JV4B 3QH3B 3VFTB 1FVCA 5BMFH 1NDTA 5E95B 4P3CL 2O5YH 4YIQB 1AQDA 1V7NL 1W8NA 2J55A 5DO8A 3UADA 5KG9B 3KHOA 4I5BB 1IEBA 4R4ND 4QJ4B 4PY7A 4FQ1L 4LASH 2VT0A 3T0EC 3QJHA 4XMKL 4PJEE 1NQBA 1MCQA 1XT5A 5DWUL 3L4ZA 2GB2A 3CGTA 5HYJA 1TVHA 4BA0A 3DX1A 1TZOA 1NCTA 1F6AA 4ODSL 4W9IC 3IGFA 1E5UI 3ZT6A 5B38A 4MAZA 3ZIMA 5ESAA 3NACH 4TVUA 1IARB 3L1GA 5D2LF 2ITDB 2Y2WA 5KYNA 5C6PB 2QADC 3L1OH 4M6NL 2YKLH 4L4TD 5D2LA 5KVGL 2XETA 2VDNB 5K9QG 3D0LB 2EVIA 5DJ2B 1KEML 3P0YL 5E8OA 3V0EA 1B4TA 4G42B 4MWFA 3TWCL 1JZ6A 4JR9H 4HKZA 4J3VA 5AKVA 2AQTA 2BDNH 3KDPB 3PL6D 5CSBA 1TITA 1QI5A 3D69B 3C09B 3NJHA 2VMEA 4I2XE 2MEJB 2JKLA 2VLRE 3CG8A 1T04B 2V7HA 1I3GH 1QW9A 5TDPB 5FF6A 1P1ZA 1SDAB 5C09A 1CL7H 2VR9A 1N12A 5DEGB 1MCOL 1J8HD 3F5WA 4RBPK 5FPIA 1T0NA 2AANA 5FC9A 3VB8A 2MNWA 3DVGB 5C9JA 3S88L 3KPOB 5C71A 1FSKC 4XI5D 1RZKL 2V7NB 2O5ZL 3EYFB 3IRPX 3JWDH 5ES4B 1J0ZA 2Z65C 4JHVA 1AVAA 4ZUTA 1OT4A 2XQYK 5B8CB 2R4RL 4A2HA 4HCGA 2BP8A 4K5MA 1EFQA 5E6ZA 3V0IA 2HRHA 5I1IL 3PWPA 1IE5A 1CGSH 3U9UA 3TVMC 1DVZA 2ZYRA 3OKDA 4NQXA 2X89A 4WAFA 4WJ5B 4Z3TA 2FDBP 3VM5A 3EOTL 2C3VA 2WOBA 2R9HC 1VA9A 1CUOA 1AS6A 1S9YB 3IRZA 4PWEA 4IMLA 3P02A 3DX9B 1CBJA 1IKFL 4HK0B 2W5PA 1A8JH 5GSRA 4BZ2L 5DD1H 2UZIH 2B1AL 4KHXH 4EN3A 4NWTH 4Z7UE 4F7CB 4KROC 4QR7A 5CGYD 4QXVA 5DRZB 1HE7A 3S36H 1T5KA 1HCFX 2Y25A 3MJ9H 4L3EA 4NC0B 1G7JA 3ZGHA 2ZUQC 4N24A 2QSCH 3EGXA 4Y9CA 3EKCA 4BIKA 3L7FA 2R2BB 2AK4D 4XPGL 4I3GA 5JW4M 3OJDA 3QCVH 2DTML 1EXUA 3JTSB 1A7NH 1GGBL 5AW2B 4QOKA 2B5IB 1F00I 3I3DA 3LMJH 4PGDA 2OSWA 1D9KA 1JIBA 3PCYA 3W0WE 5F1KC 2OR7A 4Q6KA 4NLAA 3QYMA 4Q0XH 3RBGA 1ZTXL 2Y36H 3TA3B 4A7GA 4P2OB 1Z5HA 4B9ZA 4YBLC 3CZJA 2EEAA 4YGAB 1KGCE 4U1MA 2VLME 4YNYA 1LTXA 1O9ZA 4WNQA 4N2GA 1U8HA 3IJ9A 1BJMA 2ILLA 4JM4L 1AQ8A 3O6MH 4JZJA 4Z95L 4YDLC 5FW8A 2NY6D 1KXVC 3NEXA 1JK9B 1N0XL 1JHLL 4ZMWA 4XO3A 2XTSA 3NTCH 3NFPA 3WBDA 4DN3H 3OKEB 3UJJH 4GUQA 3D12B 2DMCA 1FORH 2BIOA 4BE6A 4X5RA 3UMNA 2VN5A 3L4WA 2VR6A 4FTVA 4NN7B 1RK1A 4RFNB 4UMSA 4G8GA 4MJ5A 1P53A 1T89C 4QRRB 4N0YH 2YEQA 5IW6A 1OTTD 3BUDA 4MDRA 2RQEA 1QPXA 2OMWA 3GSWA 3NFNA 2C1PA 1WFOA 5HDOA 4DAGL 3MPCA 2J1YA 2F15A 5F9WC 1TOXA 1NMCB 1UXMA 1SDDA 1ETZB 2VC2B 2VDOL 3QRGH 4JFYB 1MIMH 2J4WH 3IB4A 3FTGB 3QFJE 1JN6A 3VE0B 4DUXA 1CXEA 3NIDF 1OAUL 2PPAA 3I75B 4P5MA 4P2AA 3WELA 3F85A 5DRXA 1N5YL 3N2JA 5EZJA 4JFFB 4ZMQA 5IZ7A 3HG1E 3ZRCC 1T3FA 3N1QC 5L88L 1YSOA 3QQDA 5E9NA 1BECA 4OFVA 5LAXB 3TGXA 5EO1B 3BFWA 2JIXD 3S7GA 1NM4A 4B9PA 1MEXH 1NAKL 1VACA 1V3MA 4J8RA 2W0FB 2B3RA 2BCKA 4I18A 4YZFE 4JDVB 2F1AA 4JPVL 3K4DA 4EAEA 3LXBA 2ED7A 2WKOA 4XNUL 2KZKA 5I6LA 2XWDA 6FABL 1BQKA 4ZOEA 5H4ZA 1EFXA 1RZJH 2OTWB 2XWBB 4AUYA 1M05A 2H6UA 4DKTA 4OLUH 2IAAC 5I5IA 4TUOB 5J6SA 1KFAH 2VZOA 1U33A 3O81A 3FFOA 1JGUH 1ZJAA 1F8TL 3Q1SL 3VU1A 4AX3A 1K6QL 3HNSH 4EIZC 4UQ3B 3TNMB 4DGVL 4ENED 1DVFA 2NYYC 4A6YB 3UC0L 3MBXL 3SD2A 2VDNH 4LCVA 2A1WL 5C0CE 2BVPA 4PJAE 3BZDA 4A7SA 3BGAA 3D06A 4V33A 2X87A 3MQIA 1OK0A 1R3JB 4LMQI 3H6AA 4P5TD 2W9DL 2NY1B 1HDMA 1YPZE 2XIIA 1BVKB 4KKRA 4LSTL 32C2A 2OL3L 2APXA 3BXNB 1SXBA 5CCKL 1OSEA 2YGVA 4M9OA 1G6RB 5EZLB 3T3PE 5CGMA 5CU9A 3OM3B 1CR9H 4WF7A 1E9QA 2PNDA 2ZKHH 5KW9H 2YQ3A 3HZKA 3NFSH 1NDGB 1Z9PA 2YPLD 4XHQA 4AK2A 2FR4A 5H37A 1XSJA 3FJTA 1MCBA 1D6EA 3DUUB 3PP4L 4R5VA 3ZSTA 4KXDA 5K59E 3R7QA 2PYEE 1BM7A 4UB0H 4PJ8A 3FFCE 2WIIA 2X4SB 4Y1AE 2GUOA 1ES0A 4N90E 4WTQA 5T1LB 3SO3C 4JFQB 5T5FA 4NDMA 4YWGH 3AC0A 3EHBD 4N2DA 2OCJA 4JHUA 1OAJA 3K74B 2FYYB 1AGDB 2OI9C 5BV7L 3CZUB 1UWXK 1ILSA 1MRCL 5EUKB 3STLA 1XGQB 1HL4A 2JH2A 2WANA 1ZLVK 4AUUA 5IKCB 3C2AH 1L0YA 2OX5A 1L9SA 2VZTA 3DX8B 3X3FL 15C8H 3FUMA 4LOEA 1FNLA 4LSRH 3UTQB 4CW1B 5HGDB 3VFMB 5CEZD 4PHZA 1Y0LB 3C8HA 3DRQA 4YDJB 4XMUA 4LOFA 5HVFB 1GS6X 1CXLA 3CDFA 4XN4A 1X5XA 4TL5A 1B90A 5KYXB 4DQOL 1NC2A 2AFNA 4O4YL 4Y4FA 2AK1H 2E7BA 1ZDQA 1TQUA 3C5JB 4GNKB 2IV9A 5HHNB 1KTLA 5TFSL 3GHEL 1CLYL 3SDXE 1J5CA 2CG9X 3BEWA 4KZDH 4FADA 2X53A 5F3BA 2P24B 3QZOA 1IAKB 1A14H 3LY6A 1MY7A 4J3BA 1Q72H 1T80A 3QUZD 4MMXB 4P0DA 4WV1B 4X8JB 1CTNA 2OP4L 4U0QB 5C7XL 1RIHH 3UABA 2OW7A 4DPBX 4PVBA 1HSAA 5A3ID 3IMBA 4HWZA 5I6KA 4X5WA 3SKMA 2P48B 3IFPB 1I1YB 4XOAA 4TSCL 1MF2L 1KMGA 4LAQH 3JV6A 5I76B 3CV5A 1QVOA 3L4CA 1JV2B 5CNHA 2OSYA 1U8LA 4X2UA 3Q8EA 2E7MA 4WRLA 1U36A 1FRGH 3WHE0 1IGML 2IBZY 3CU1A 2FX9H 3ZE1F 4B96A 1VZGA 2WQVA 4E9VA 1P7QD 3RY6A 3KWWB 2DLEA 4DP7X 3AM8A 3OVUB 5AOJA 4JBSA 1FCGA 3VXMA 4AQEB 1RZGA 3EDKA 3OR6A 3F3HA 4MSWB 1BOYA 1HHKA 3LH8A 4IRZH 4FXLA 4V1DE 4JKWA 1EAQA 4LEOB 2QQNL 4YDVB 3D51A 1UZ8A 3OX8B 4ZS7L 4E9XA 2HJLA 5GRVL 3U4AA 2QPSA 5E6IB 3QDJB 4HAFA 1TZHB 2NR6C 2VSKB 1I9IL 3J07A 2K4AA 4FXKA 4X6DA 4HOMA 1JFHA 2FLMA 2Z3FA 3ZBMA 3LSOA 5KVDL 3ROLB 3GK8L 2P3YA 2ZG3A 4N0CC 8CGTA 5I8KH 4CBPA 4NJ9L 2BVQB 2YMTA 5EFIB 4XODA 4ONFH 3RTQB 4W4NA 3FQTA 4PTUB 4UILL 4F15B 5EN3A 2G5UA 2VDRL 3IS1X 4EUPH 8FABB 2HX8A 2OZ4L 3LKRB 3RYMA 5C0AD 1AYRA 3C08L 2VC2H 2XPGB 1NOLA 3IDGA 1HHJB 2DQUL 1BBJB 5HPMB 2PYFA 5KTEL 3KGRA 4DZBB 5HDQH 2CBOA 3ARVA 3GSVB 5EZIH 3SGDH 3WEMA 3VWJC 5J06A 3FONA 2W65A 1KF9B 1OO2A 5E9DE 3RPBA 1FV1A 2P5WE 3CLEH 5LJYH 2EUVA 3LRKA 5EOCL 4AJYV 3L9EA 4I89A 2NY5C 1ZHLB 1FAIL 2BHZA 3EZJB 3FT9A 4XTRC 1FBIH 1WTLA 2UYLB 5CSGA 4UNVA 1XO8A 3S5ZA 1MHPL 5CR1A 5GS0L 3FDWA 1H6EA 5LXGH 5HHOE 2R69A 5KSBA 2A74A 5IVXB 3BPLC 5I8EB 1O75A 4G1EB 3S48A 2XUWA 1NMAL 5SX5H 1C5DB 2AQ2A 1P6WA 3QXDA 3FBQA 2HVBA 4HH9A 2W0LA 1AD0A 2AEQH 3SDYL 2PMZA 3AS3A 3HVDA 4D9LH 2NSQA 4KNSA 3C9NA 4I4WA 4DGIH 5JXEA 4MVBC 4KKNA 1BZOA 4Q6IB 2QTEA 5LCVA 4A6YH 3FPYA 5HYSG 3I74A 3PHSA 4KZEL 4O02L 1EV2E 4TM9A 4IMKC 5DJYB 4WSKA 2J5WA 2FECI 3RNKB 4JX0A 3POCA 4O9HH 4PREA 5LAPA 3UEZA 5J0BA 3APMA 4LDOB 1XF5B 3I3EA 2G3XA 4WHCA 2EYRA 3VH8A 3QEHA 3T3MB 1B4JH 1G6RH 3FCSA 4OR1A 5LBGA 4XZ4A 3T3MF 4FQXD 5DZVA 4MFHA 3RDTC 2YN5A 5FYKE 2E9WA 2ZCKL 4JUTA 3UJIH 4DVRL 5ANMB 1U93A 4JG0H 3FOMA 1YG9A 1CDBA 1HK6A 1NANI 1LP9E 3BSZL 4B9GA 5JOPE 2WAQA 3NPSB 1GC1C 1WCBB 3K2KA 4HA1A 1HHHB 3LQAH 1KIQB 1SUHA 2AXFA 4M4PA 1XH1A 2FNBA 1H9VA 4TNVK 2D73A 1LE5A 3F7VA 5DTFA 3OAYK 5HHVL 4L05A 2EH8L 1UB6A 2Y7MA 5F89A 1T0MB 4G8IB 3SYCA 5IB4B 3DLQR 4GMTH 2OM5A 3IDJB 3L6FB 5DS8B 5J11B 2H32H 2LV4A 1OP3K 4XPHL 1DVSA 2X4QB 1QTYT 1UGKA 4YHML 3BKCH 4BK5A 3VMNA 3VSVA 1UWGH 4CU7A 3UZEA 5JQ6H 3F7RA 4K2UH 4XPBL 3UDWA 5I5MA 5DC4B 5EC1B 1LDPL 1I1FA 3ARBB 1IC1A 4UZGA 1M2VB 4IS6A 5I5JA 1OP9A 5I18L 5IB3B 2BZ7A 3AQXA 4CDGC 4HKJB 1HI6A 3QRFM 1Z0NA 4D0CA 4UCFA 4ZW5A 3OKLA 3LS4H 4Y2OA 3PUCA 4GG8A 4XX1E 5I1EL 2OMTB 3BSHA 5GZOD 4AV5A 4PJXB 1EANA 5D2NC 4PV1C 4E9WA 2KZ1B 4NQCD 3KBEA 1JNNH 4JHZA 2OTUA 4L29B 2F7PA 1CFVL 4PJXF 4AL8C 4U4IA 4Q8BA 3AQZA 3WFCL 5H2BA 2WSKA 4LLDB 3BPNC 1D9KC 3F05A 4KQ4H 1E8YA 1K72A 4KVCH 4LOUD 1KY7A 1JPFA 4PCTA 4J3XA 2R0WL 1CFTA 3ZDXF 1D7BA 4MJIA 3VXPA 1FE8H 3LRGA 4LPCA 1YNKH 3MC0A 2J20A 3ULVE 3B9DA 4QCIB 1IJ9A 4XXCC 3BUYA 2X05A 2MQ3A 3L4YA 3C12A 4JZJC 4Y2DB 2AJXL 2OMZB 3EDFA 3FUEA 3WS3B 2OJEA 4OF7A 4PP1C 1KEGL 1AKPA 1KSRA 1XZ0B 3VG0H 5I71B 5DD0H 3BZ4B 3V4VH 3VXRA 2WK2A 3IK2A 4AVKA 2NNAA 3KCWA 5KSUB 1SM3L 4LFHG 3ZRFC 1WGOA 1A1MB 1Z0MA 2ARJQ 4K8RH 5F1IB 4OZGA 2M8XA 5KSVB 2XVLA 3V5KA 5D1QB 3ARGD 3LDBB 4UT9A 4APQB 4HDIA 2VE6A 1UKSA 3RIKA 4HIEB 2GK0A 3UTSB 2GTZB 1WWCA 4HHWA 3MLSL 2YQGA 2BHUA 4KKCD 2AV1B 2MOGA 2V5SA 3FT4B 4L4TE 2DLGA 4NRZA 1I53A 2RGSA 3C6EA 3MV8A 2VAAB 3DOIA 3U6XS 2UV3A 1E9OB 3SE4A 3ELQA 3MNVA 4BDVB 1OSPL 2X4PB 4Y7MA 3VXTA 4R7NA 4N8CL 3CD4A 4OZIE 3IFOB 4CADA 1OGAA 4J27A 4CVZB 1H6UA 3KL5A 5KOMC 4AYMC 3DVNB 1MH5B 5IQOA 4K7FB 4UINH 3VFWA 3RQ3A 2JJVA 1J8HE 5EBWA 4GUPB 3DX6A 2Z64C 3IWVA 3H85A 2JB6B 3NCJH 1KJVB 3GS4A 4I18C 2I5YL 5T1DL 3WXVL 4QXTB 4XBEL 35C8H 4KX9A 3CFKB 3K6FA 4DGYH 4OGYL 4HS8L 3MNMA 2QHRL 3MJWA 3KPRA 2OMVB 4PQXA 5I1KH 3ORJA 2VRKA 5ICYA 3D2UB 1OY3B 3OPUA 4PD4J 5DVLA 4JG5A 4A2EA 2DDQH 5E4EB 3QVAA 5GGTH 4NAJA 3GMRA 3WUWB 4JZOB 1DVFC 4HD5A 3CHPA 4RQQB 4XC1L 3NN8A 4FFYH 3CVIL 4QHMB 3G7TA 3PWLA 3QDAA 4HUKB 2DQTL 5CSZA 3PWNA 1ZWIA 2C1OB 4J8QA 5J6GB 2AJSL 3FUIA 4AEHH 2Z0BA 1J12A 3VFUA 1KBGL 1F3JA 3VFRA 5HYQB 2XV2A 3GNML 2HX7A 4RAVB 1OARL 3LZLA 2VSMB 1MRFH 2CHZA 3GSXB 1G1YA 1PZSA 4LU5L 4M1DH 5EIIG 3SDAB 2XOTA 3QJFB 5D7SH 1Q9KA 2WWMD 5CCJA 2R29L 3EGDB 3VRIB 4JY5H 4X4ME 5C08B 4YSQA 2UWEB 2P8MA 3KYMA 5E6SB 5ESVB 3S5LB 2BRRH 3JZYA 2VMCA 4GQRA 2X10A 5LGHL 3NSJA 1TTRA 2IWEA 4UOW1 3RHWK 2QQKL 2QQLL 2V4LA 3Q0HA 3FTYA 3H3PH 3TN0C 1FNEB 4PJ8C 4ZX3A 2AK4E 1KENH 1CFQB 1NFKA 4P5SA 3RWGB 5AYUH 4KNTA 4L1BA 1NEZA 1K4CB 1CF1A 1HOCB 4B53A 4ZFZA 3B5HA 1P2CA 3EO9L 1KB5L 5SWSA 4NSKA 3CFEA 2NXYD 4ZFFA 4WGWB 4KY2A 4DP4X 1ZD6A 3MRCA 4GI6A 4JN2A 4CC0A 2G4EA 4PJ5D 2CNZA 4KITB 2FGZA 1TKWB 5DGRA 2KHAA 3NZ8A 3ZTJG 1HEZA 2VMDA 2EDMA 2XPZA 3A24A 4FNSA 2K3TA 4G5AA 4H1LB 4QT5B 3HR6A 5BOZG 1U8NB 5FFLA 2E9GA 1S78D 3DJSA 3FB7A 1I7RA 2NSMA 1F4AA 1AR1D 1WCQA 43C9B 2EC8A 4FFZL 1UACL 3BUBA 2Y06L 4X7FC 3N40P 1R5VA 3AUWB 4HKBB 2QV4A 2DYPD 2FUQA 3IN0A 4S1QH 3WE6B 4K55A 4MRBA 3KCPA 1YJDC 1OTUC 1V27A 1SEQH 4F58L 2DLFH 3NIFE 1XXDC 4Y5XA 5D96B 4KKQA 3ZL4L 4XP4L 5JNYA 2GTQA 1AP2A 2IDUA 4OCRH 4L4VB 3ZDZB 4LKCA 1YEJL 2VXVL 1YYMH 2P42B 2YAEA 3CZGA 4R0LB 2G3MA 3ZDZF 4DP1X 4N8VG 3BYYA 3GKWH 5LQBH 3UG5A 1ECYA 1KYAA 4QY8A 3IVKB 2JE8A 3MNZB 3ZHLA 3ML9A 1AE6H 5K1JA 5HDBF 1DANT 2A9BA 3L5WB 4M6MH 5L2JB 2ATPB 2F7IA 5ITFA 4JFDB 4RWHA 3PABA 1L9TA 1TJMA 4ZMYA 1SVCP 4QRTB 3MYJA 3QHTC 1QEWB 2CLRB 1T1XA 2K0RA 5DDHA 3VFVB 4R2GB 3T0DA 5FO9B 2AKRA 1UD5A 4DK5A 3M88A 4N2NA 3ULUL 2XN9D 3KVDD 3FKUS 4FA7B 2KKQA 4TTGA 1OF0A 3WE1A 4PVLA 1NAMB 1U6AL 3GZOA 3MRJB 3BH8A 5D5MB 3EJRA 2FQFA 3JUYA 1JNJA 3OMAB 3GXNA 3HW7A 4NYLA 5IOPB 4BELD 1QPKA 3QFGA 3O2WL 4ELKA 3GHBL 3F84A 5C07A 1IO4C 1BSIA 2CO2A 4OQ1A 4X6EA 3U2IA 2WXHA 1FAKT 4KY1L 5TE4L 1U3HC 1TT6A 2H2SC 4TVSa 3P40A 4L1LA 4DZ8A 4RGNB 2FEEI 2AW2A 2B4CC 3WMQA 4JRYB 1N8ZB 3MCKA 4ZUUB 2YLHA 5BRZA 3LIZH 4LRNL 4PVNA 1XGRB 4CKVX 5SWZB 3VRLE 5J3HC 2AITA 2Z91A 5C0ND 1H15A 2Z9TA 5ISZA 3EO1A 3KWXA 4KX7A 3AXLB 4JO8A 2I07B 2WYTA 2L0DA 1AZCA 1QBLL 5KSAA 1F2QA 4JHAH 3REWB 1CT8A 3HZYB 2D0HA 4UF7C 4XVUC 1J18A 2YPLE 2NXZB 4H0HB 3DX2A 4KU1A 5F7BA 3T1FA 3QIWC 1X5AA 2P7TA 5B22A 5IGXL 1A3QA 3GZPA 1FVDB 5C0FB 2VSCA 2A74C 3IRCA 2V5MA 3SDCA 4Y5VC 4ZXBA 2KLTA 5KBNC 4ZFOB 4AMXA 4Z76A 3KXFB 1EEQA 1RURH 4YFEA 3N43F 1JTPA 4TULH 3O3BA 1RZIB 3H42L 2J12B 1EHLL 3WFBH 1A1NA 5JXEC 5E99H 2BOBA 4HS6B 5CD3A 2PWGA 4Z7WE 4QUOA 4XH2B 1RZ8B 1UCTA 1WISA 1HCVA 5C8JB 2FL5B 4DK6A 2VXQA 5C9KA 5CEZE 2BZCA 4QEGA 5DMIL 4OZHF 5DQJA 4BWUA 4XO5A 3T4YA 1UENA 4IHBA 4WWKB 2VO5A 4GQ9H 1ZLWH 2PP8A 4HP5A 4M43H 2ZWLT 4R84A 3VYOA 2CKBL 5IEKB 2X0UA 4GRLD 2IF7A 1VENA 2VMJA 1JERA 2KS0A 3IMWA 2VTFA 4HWBL 4JKPH 4G9DA 1KPVA 4U6HA 2D31A 5F9OL 1CGVA 4FDWA 3TNNB 3W2DL 1UA6H 1ZSDB 3ZZQA 5IEHA 1HWHB 4F93B 3MKKA 3SYQA 4Y4HA 1JNHA 5CJXA 3PAZA 1BOGA 3VFGL 4KI5F 4NZJA 5I0VA 4GKLA 2Q87A 1QPPA 3MLXL 4FERA 4AVHA 2VJ0A 3EOAA 3G5VA 4YE0A 1KLFB 1WZ1L 2JI2A 3GS7A 3MRMA 5G4MA 4FLRA 3VJ6A 3VD5A 4F7PA 5I6XC 4J3OH 3QCUL 2A6DA 2FJSA 1MNNA 5A2AA 4UTAH 4X99A 3TH4T 3QXWA 4HOXA 2AQSA 4JDEA 1CD1A 4YHLL 5JXAH 2Z31B 2XY1A 4F7MB 1A9BA 1BXAA 2FEDC 3FZUD 1RHFA 2H9GB 4IRSB 3IJYB 5DA0B 4F5CE 5ADPH 1WIUA 3VI3A 4NQVA 3BVNA 1RZPA 2ICWB 2E59A 2OR9H 1JPGA 3GS0A 1OZUA 3O6FD 2IH1B 2MHAA 5FOBA 4BK5C 2DBLL 4LVNC 3UZEC 3SE8H 1ASPA 3T8XB 4PJ7F 1EGJA 3Q13A 3WD5H 4KUZL 1DZ0A 3UDWC 4PJ7A 3EJYD 4H1LH 2ICEA 1S7XA 5FB8A 5KVDE 3FMGH 1DBJH 3L5JA 4ZUVA 3JWOC 1CICA 4H8UA 5C1MB 1B2WH 3R7RA 4E2OA 2PWDA 1WWAX 1KDJA 4LPTA 1ZE3H 3VFSB 3DXAA 2WWKT 4BJLA 2Q1EA 3H9SB 1IGYA 3KLDA 5TF1H 4S2SB 4Y5YB 4ZZKA 1J5HA 3GDBA 3TV3L 1PMYA 3F7YB 4OB5L 3A4FA 5HHPA 4ZUWB 1UKTA 4KMTH 4TN9A 4BINA 4BM7A 3UL4A 3WFEH 3UC2A 1PD6A 1HIML 1UWEH 1X6NA 4F24A 5C0AE 3JYCA 3OF6A 2DL2A 4LCUA 4NI3A 2PWHA 2XCMC 3B7TA 4WEMB 3LVTA 3PWJA 4OZFA 1TO4A 1OP5K 4AENB 4NZTH 3B2XA 4JY4A 3VI4A 1JGVH 3QWRD 2V2TB 4N3UA 1E6OL 1JXKA 3T0VA 4UMGA 4H26B 1RXLA 2UUDH 4K3DH 3RY4A 2HJKB 3VXSB 2EE3A 3MRRA 2E7LA 3C60A 2WBJB 4M5YL 3SPVA 1YNLH 3B3BA 4P57B 3HPLB 1TU2B 2J6WA 4WI5A 5DLLA 5CD5D 5C2UB 3MGTA 3VSTA 1IM9D 1IC4H 3WJJA 1JYWA 2DQFB 4NPKA 4RWYL 1NAMH 1DBBH 1Q0XL 2MQGA 3CFCL 3CFBA 4XHJD 2Q7YA 1Q9WB 3B3IA 4NO0B 3DUHA 2ICWI 4MRCA 4U1LA 2HT4D 3B9AA 4X9BA 3AGVA 3V0JA 4MA7H 1I3GL 2V37A 3X13A 3SE4C 2AGJH 3NGBB 4WJKB 4APXB 3DJRA 3ZZ1A 5TDOA 1RSFA 4F91B 2HH0L 1PY0A 1PCXA 1UH3A 3QZLA 1J9SA 5FKPB 3JWDL 4FFVC 5DD3L 1AFVL 2ZSVA 2DPKA 3GRGA 4RISL 4MB5A 4LSDA 3MKGA 1U41A 4JM2F 3EBGA 2GFBA 4TNWK 4JM2A 2C8NA 4PRHB 5DUMH 2HXAA 3F12B 2N1TE 1XEUA 5IIEB 2BINA 5JPMB 3TCLA 1HESA 4TVPD 1JGLL 5CLZA 3IPFA 4YX2L 1EO5A 3K6NA 2RR3A 3P0VH 3GSUB 5DT1H 4ZYKB 3U1QA 2J6EL 4LF3B 4WI8A 1X7SA 4G5ZL 1JZDC 1YUHB 4WTZG 1SOXA 1DBAH 3H56A 3L95B 5ESQB 2Y7OA 3QG7H 2UY6B 1R3LA 4TVPL 4G83A 4YLCA 2Y3NA 4OCWL 4GRWF 5DZJA 2NUPA 1Z9NA 2N59A 2QDVA 3BEVA 1JPEA 2L8AA 1OAYL 4LT7A 1LK2B 2GIYA 5E56A 1ZVNA 1FDLL 4KKAC 3MX0A 1FFOB 1M9SA 4ZX6A 2ZYSA 3ATFA 1RLWA 3IEAA 3SDDB 2LE9A 3CPUA 4N0FA 2ITEA 3WEXA 3WJMB 3DX7A 2H1PH 3EDEA 4C56B 2KQNA 3MSPA 1KBWA 1X9UA 1MHEA 1TXKA 4X6FA 4O2FB 1BZ7A 4FQJL 3DURA 3QPQC 5JO5B 2ZUYA 1A7NL 3IXAB 1J1XH 1I1AA 4WO4A 1GZPB 2Z1PA 4D3CL 1Q94B 4RSVA 1AS7A 3VSUA 4NQCE 2C4XA 5BRPA 3ISRA 2IEPA 3ARWA 5A6IA 4XP6H 5JIQA 1DJIA 3WIIH 4XNMA 4BUQA 3U7WH 3OXSA 1FZMA 3L7EA 5DD5L 1P7KB 4DO4A 3NUKA 4DCQB 5BOPA 4DP0X 4RH4A 3SO5A 1JDAA 3KJ6L 3O3EB 3CDZB 3OB8A 3I9GL 5BZWB 1CB4A 3D4YA 5AW1B 5DJ6B 4N86A 1L5GB 2F8OA 1IX2A 4LNRB 1D7CA 3U2SA 3O0LA 3VB9A 4ORGA 4O2EA 5EB9A 3CMOH 1KCVH 1A9EB 1DCEA 3C6LB 3OZKA 2W92A 3P3UA 2B3IA 1JWUA 1PLGH 5EU6B 2FEJA 2CLZB 4GAFB 4KK5C 2DQDL 2IAND 2IJ0C 2ICCA 2YAQA 3BDXA 5E2TL 5GGQL 3NCYP 1FH5H 3RDJA 5KS9A 1O6SA 2QGDA 2VUKA 2KMWA 3WO3B 1YN6A 2NZ9D 4Q56A 3KPQB 1UKQA 1INQA 4OGAC 1HQ4B 4WSGA 4GBXB 4PTTB 1DL7H 1KNOB 4C57C 1LO4H 1TDQA 1WH0A 3MLTA 4CSTA 4BZ1L 3T0XA 4ECNA 4WUUA 4AKOA 2BS71 1C9SA 3BIKB 2H26A 3K2UH 5DZLA 3RKDD 3EBHA 4W70A 5CBEA 2LLGA 1TYJA 1K5NA 2XICA 1ZEAL 5A16B 4X80H 2NY5L 4U3SB 4HS3B 1P0SE 1GAFL 3QIBD 4BRJA 3G6AB 5I8OL 2E9IA 2EDWA 4A7TA 5TK4A 2VABA 5E8PA 4HIJA 3RUGA 2DI7A 3B9KA 3VGGA 3QA3B 4J12A 5MENA 4EI5B 4URKA 5IVZB 3TONA 4Q9CA 2LOEA 1SJMA 4MDIA 1FFNA 1KJ3H 5HD8D 3TIEB 2EP6A 2F54D 3HC4L 4JRFA 3UBGA 1WFTA 3GMMA 4HGKC 2XQYA 2PCPB 3GSNB 4DOHB 1IT9H 1SFDA 3I02A 4IIZA 1ACYH 1H8SA 1IQWL 1MKFA 2VDQB 2MKLC 3HBPA 5I1JH 2YRZA 3DMMA 1MAJA 2O72A 4PWIA 4MNGA 3SKNA 5LNGA 3TO4B 1H3WM 2VDNL 2VDPB 3DDFA 4PJDF 1MIEL 1MWAB 2F74A 2IFGA 1RJCA 1WHOA 4PJ9C 1AYOA 4GSXA 4G8EA 3PDGA 4KMLB 5FO8B 1L9RA 1LEGA 2DIAA 1UA7A 2A6JB 4KXAA 1QLRB 2O5XL 4DQAA 4OV5B 2DY2A 4XMVA 3U0PB 3MOBH 1R5WB 5A6MA 1NL0H 1J9QA 3AU0A 4JY6B 1BBDL 4DKDC 3RWJA 1BFOA 3Q01A 2WLLA 3HE6B 4KTDL 2ITFA 1YQVL 2CRIA 2GJ6B 4EI6B 4WUKH 2YUVA 1XCXA 3D1MC 2PR4H 5ID1B 3CC5B 4IJ3B 3LKQB 1EAPA 2WUCH 1H19A 3OKNB 2XVBA 3SOTA 3WXWL 2Q76A 3O6LH 2W81C 2VDKL 1G9NC 1DVTA 4XGZB 4GRMA 4IDLA 1T20A 2IDCA 2LVEA 4NRXB 1N9PA 5D7LB 4X8CA 5KSAC 4NZ8A 2Q86A 5GS3A 5CU5A 4YWGL 1HU8A 2VLJA 4YMPA 4N2LA 1KLUA 2E0PA 3QI9A 1ETJA 3W9DA 4PGZA 2Z35B 5EEWA 5J8OA 4U1KB 3QXUA 3IDYB 1ZGLA 2R59A 5B1CA 1L9OA 5HVGB 1MW2A 1RHHB 5A43C 3D25B 3SDCC 4ZXBC 1FVCB 5IBUB 2JCCB 3MJ7A 1BAFL 15C8L 1QFWH 4AC4A 2I26N 4M3JA 3IE4A 1YYCA 1PG7H 2JCCF 2E76C 1T83A 2HFGL 1BQHG 3GPEA 1K8DB 3IBOA 1BDYA 4PP2A 4M8VA 1LO2H 2YAOA 3B43A 5KVFE 7FABL 3D2TA 4HXBL 4M56A 3DA0A 1AHWA 4PJ5E 4YDIH 1P5VA 5ACLA 1TVHB 2JQMA 3PXJA 1XZWA 4JFTA 1NA8A 5ESAB 4YSRA 1M7IA 6TAAA 3A0OA 2VO8A 3MRFB 3LVEA 2XVGA 5EWIL 2IH9A 3ILQD 2CMRH 4O58L 4AGMA 1I8IA 1RJZA 1QTPA 4IBZA 2HPTA 4ZQTA 4CU8A 4MWFB 1DO5A 4I0PC 4NKDB 4Y4HC 1AY1L 4DO5A 2DMBA 3D9AH 1A3ZA 1IAOA 3HAEG 1W0VB 4O2CB 4KI5C 2DQCL 4YAQB 2OTPA 3THML 2ZOKB 3ARFA 2V7HB 2Y07H 1JZ2A 5FF6B 4PGBA 1OTSC 3MGAA 4M6AA 3K0YA 2E8YA 5GRVK 2ADJB 4IBYA 3QPXH 5CINH 3RVWD 4AM0Q 1T0NB 3JBG7 4YPGB 2BVOA 2D7TL 4OFQA 1N10A 1QEXA 4QRRD 2QVIA 1IKOP 3EJQA 2O26U 1TR7A 1GS8A 4ADJA 3R1GH 2CDFA 3RI5K 1BAGA 4BFBD 4JPKL 3ZOAA 2VOTA 2YPKA 1RU9L 1SHMA 4XPFL 2WAHA 1B6UA 1HL9A 3RWCA 5FW7A 4OIIL 4H5SB 4DKFH 3ZTDC 1SJVA 4WDIB 5AAMA 4I3RH 3AREA 4FXTA 2VKXA 5B21A 1DSYA 4P46A 1FFPA 3GXTA 2C3VB 3MFFA 3MLYL 1CICC 1FGVH 2P45B 2G5BA 2XN9E 3QBTB 4P5KA 2CCLA 3DO7A 4RAHA 2MPAL 3VMPA 5L7XL 1ICTA 2FO4A 3L1FA 3WSQL 3MROB 2W9EH 5GSRB 2K7QA 4RAUA 3CH1B 1CZ8L 3VRJB 1GYAA 2PCFB 3C6SA 2RFXA 4EN3B 5HDQL 2YBGA 3MUGB 2AJZA 3QIUC 5E8DL 1RUAL 3SPIA 4ZAKB 3K8MA 4QXUH 5ECGA 3CHSA 5B3JE 3V6ZA 2SEBB 3RP1A 1EH9A 5I6OA 1G7JB 3ES6A 2CK0H 4J3TA 2R23A 5HGGS 1KBPA 1F4YH 2F8IA 4U3HA 3LAFA 3RZCA 4HUVA 1MJJA 4HFUL 4Q52A 4OUUB 1X5MA 2IPUG 4N0UA 3OTTA 4BKSC 5DJ0A 1EXUB 5DD6A 2J71A 4PB9L 4QOKB 5GISL 1X5FA 5HHXH 1NCWL 3IU3A 3QCTH 3BSGA 1IAII 1GJWA 2AEQL 3GSNH 5JQIB 4OCLC 4XMPH 4UTBH 4RMRA 3PDOA 5DYOB 4U1SA 3O8XA 4U1MB 4AGLA 3BGFB 1QSZA 4WNQB 4YHPA 1FFQA 3LKOA 5I1CH 4PRDA 4ZJ9A 2OMBA 1QSFD 2NY1D 4NZRL 3EADA 2VDPH 2JTDA 1I3RB 1N5AB 4RDQG 4XNBA 1WBXB 3BQUC 1RP8A 1UB5A 5CLXA 3S5YA 2PLTA 3A6CL 2HWZL 3FCGA 5DHVA 1HYSC 2QBWA 3AU1B 5EO9A 1E9PB 1E8WA 4NP4L 4BFOA 2A6IB 1UVQB 3OHMB 3GBEA 1RKRA 3HIZA 1PDKB 3ATEA 4LL1A 3SGEI 1GTNA 1TJHL 1YNTB 1TTBA 4NNPL 1TCRB 4ELMA 2CXKA 1YNTF 4L48A 1XL4A 5GJTH 4Z7NE 3AITA 3DETC 4JREC 2VIRB 2D7QA 1R47A 2HRPH 2MOQA 2FSEA 3CN2A 3DC0A 1HL8A 5DFVC 2Y1ZA 1TVBB 3LQAL 3TBWA 4C4KO 3QFDA 4LSQL 3QZPA 1GJIA 4GAYA 4WY7L 1XF4A 4Z3EA 4FI6A 3HBZA 4K71C 3D05A 2XKNB 4JM2C 2J8OA 1OLZA 2D2OA 4CGTA 2J2ZB 4XP9H 4L8SB 4QF1A 5E03A 3ZT7A 2A38A 2QMKA 3OBAA 3H8NA 4M8RA 2OV0A 2B9AA 4XNZB 3CZEA 4YO0B 4OF5A 3W81A 1NOFA 5AZEH 5JPNA 1CN4A 4MA1B 3Q06A 4Y4KC 1J9CT 1YHPA 2Y1VA 3RWFA 1CO1A 1LHZA 5DSCA 5JQ6L 2OSXA 3FQRB 4J8RB 3QXTA 5AVQB 5F7WC 3M45A 1WBYA 2BY0A 1T1YA 3SY6A 4FABH 4NZDA 5EU4B 2XPYA 3OHXC 1FJ1A 3OZLA 2VH5H 2ZOLA 2JQZA 1GZQA 1TETL 5IB5B 5HTSA 1RZ7H 3Q9QA 2IQ9H 1X7TA 1LE9B 1KCUH 2WYHA 2DBJA 2MOVA 1KGXA 1G9EA 1NWOA 1S7UB 4FOMA 4PJIE 4GG6E 1QWHA 2WW8A 1KB9K 1YJDL 4OLWL 5IB1A 1HXMB 4XXDA 5I0ZA 1CG9A 1E8ZA 4NFBA 1UM4L 2BSSB 2V2WB 3SE9L 3HN8A 1DQMH 4QTHA 4F8NA 3TIDB 5LDUA 4UM9B 3RWDA 1KIUB 1I1AC 4WO4C 3LH2H 4ATWA 3KWUA 2DH2A 2JKXA 4E41B 1KCRH 2CDGA 1SY6A 2BM3A 3NAAL 1HDMB 5E2UL 4KVCL 1CDYA 3LEVH 5GGSA 3A4DA 3VWKA 3BZEB 1PX4A 2XBDA 32C2B 4PJEF 1SLXA 5TPWH 1FE8L 4Z7VB 4JQXA 1NCDL 7CGTA 1HS6A 4PJEA 1YNKL 4BQ6A 1ZHBA 1MFNA 4RMTA 3QNZB 2ADFL 4K8RD 5TQ0H 5ILTH 5DHDA 4GO9A 5G5DA 5I0WA 5E6ID 5J6HA 4TPRL 3PFUA 1S9XB 2J8HA 3RGVA 1G9MH 3KWTA 3F2LA 2XTJB 2C9RA 3LD8C 4QHLB 2ENYA 2FECL 2Y5TA 1WK0A 1ES0B 1GC1H 4WTXA 2IPUK 5L6YH 2NX5D 1XD0A 2Y22A 4PBDA 1MJ7L 2YAMA 3RVVD 3LIUA 2ZE0A 3P9MB 4UDTB 3DIVA 2Z4QA 3BW9A 5D6DC 4NS0A 1MLCB 2CHXA 4HPOL 3C2SA 1FUNA 1DFBL 2IGTA 3O9WA 4RGMB 1CGTA 4JCLA 4Y19A 3M17B 4DVBB 5DK0B 3FQUA 4I2XA 2YQ2A 4PBVC 2E9BA 4ABQA 2VLRA 2YOCA 1JAEA 3NCXA 3EJTA 1JPTH 4LCIL 2B4CL 2V8LA 4FTDA 1TZ8A 4IIQA 2AV7A 4UBDD 2YD6A 3EAKA 5CXPA 3FT2B 4JAMA 4IHOA 2P5ED 1SEBB 1CBVH 4Y4FB 4RMQA 4AGQA 3KYKH 4PFEA 5CIPA 5DVPA 2D03H 1ZV2A 4YHOH 3MV11 4MA8H 5F0JB 3L3IA 5IHWA 1BLNA 5D7IB 4JKNA 3T2OA 2WINA 4FGMA 3MACL 3B9KC 4Z7OB 4Q9RL 3Q8CA 2R69L 5ECJE 1U58A 4QLWA 2AMGA 2B1OA 1HSAB 1YVLA 2FD6L 2XLLA 5KANI 4AL8H 2ZICA 4D7BA 4OLYL 5F1NA 4X5LA 4I13B 4ZQKA 3REVA 3UPCA 5FA4A 3D34A 4IU3B 4WFED 3EH3B 3MLUH 4H25A 2Z8RA 1DDTA 3LN4A 3V9CA 1BMGA 3AZUA 4Z7UF 3PNWB 4TVPE 3ZDYB 5I9QB 3WS6A 3ECUA 3CSFA 5F44A 1NBYB 4NERA 3OR6B 2XXCB 5IMLA 2V9QA 1AXSA 1BZEA 1R0AL 1G1CA 3EOBB 3JTTB 3A22A 3E6HA 1BJ1H 5I73B 1AZZC 1LO3L 3M8OH 2DRUA 1HZLA 5AYQA 2DMKA 3UERA 3EO0A 3QUMB 2P44B 3V5DA 3MNWA 5HVHC 3HFML 4JZNA 3U1SL 1PAZA 1ID5I 3ARDB 1DO6A 4FXKB 3U6XA 2A99A 1H3TA 5JHDB 3QQ3B 1FL6A 1AI1H 5E4OA 1H3GA 3W0WA 5EEYA 3RVXD 3HS8A 1CU4L 4WNSA 4H2AA 5FHAL 1C5CH 3MLPA 1S2EA 1OD7A 4RFEA 5LB1A 3UTTA 3OXRA 3FQ2A 4IK7A 1MCCA 3MDJA 5IQ9B 1KENL 3CWGA 1TPXB 2R0KL 5F7DB 2O6PA 5F97E 1ZLDA 3OKKA 4PLJC 4HJTA 4PJCE 3IDGB 3AWEA 4IBLT 3MLRH 3QI9C 1OF2A 3TCXA 3KEHA 3QUYB 3V6OE 2GQHA 1YEDB 2XQBL 2R4SL 3MA7B 4NQSB 1H5BC 2VW4A 1LO0H 1U8PA 4QHUB 3QWOA 5EUOE 3SBQA 3ARBD 2Y2YA 3EG9B 4U2YA 3WTXA 2HTKD 3OD3A 5K33A 3IGKA 3RURA 3U9PH 3V52H 3O11A 5SX4H 3U6RB 1T83C 2K78A 2EDQA 3BD4A 4P4RA 1FZKA 3L16A 2BFVL 3JWOL 4K73A 4M02A 5HGBA 4AYGA 4L8CA 3HUJE 1A22B 5CMAB 3U4BH 4PLKD 3QHZH 5FLVA 1JHKH 3CVDA 4FG0A 3WLWD 4F57H 3CVHA 4QJ5B 4AEIL 2DJUA 3P30H 3K71A 3IYLW 4FD0A 4HH9B 1VFOA 2ORBL 3QFJA 5TQ2L 2ZX7A 5GIRA 5I1LA 4I48A 3FCUB 2HYMA 3T2NH 2IANE 4BH8A 3E8UH 2ZOWA 2EVHA 2G75B 3IU4L 4HLEA 1A6VL 1KN4H 1F41A 2CA3A 4QYOB 4FCHA 3DV6A 4P4KA 1D5IH 5ICXA 4WK4B 5JIHA 1A1OB 4A04A 4GY4A 4ZTEA 5HYSA 2G0KA 2Q6WB 5KUMA 1HCYA 1PU0A 3N85H 4Y2DD 2WQ8A 5MI0B 4ZMZA 2H2PD 4PJGA 3VTAA 4HFWA 2X6VA 4Z0BH 4F7TB 2EYRB 3CZKA 3G5WA 1HHIA 1IFHL 1NCGA 1DUZB 1PJ9A 3NABL 4H88L 4LHUB 3TT1H 4ODUA 4B95C 4KO5A 3FH5A 3OSKA 3TBBA 3O2DL 1XIWA 2DQHL 2AHIA 4YBHA 1SBSL 3IJHB 3UXFA 2ZAGA 5D1QD 1U8OA 5CJQH 1P6FA 4YHZL 1A66A 3FOMB 4NQED 1NBZA 3D4ZA 5H37H 3VTTA 5BQ7A 5IJVA 2VR8A 2BWQA 4PJAB 3A6BH 1AO7A 4LCYB 1U8KB 3T4AB 3GGWA 4PJAF 4P3WA 2F54E 5C0CA 5T5FH 2JQAA 3DRTB 3PWVA 5DTFB 4ODHL 5F89B 1X5HA 2NY4C 4U1HB 3L5XH 2P46B 3MAWA 2CQVA 5FDWA 3U7YL 1YPZF 1MDTA 4P46C 4MJJA 1YPZA 4XOCA 1AQKL 1J87A 4ONGL 1N18A 2CGZA 3KHQA 2PCXA 3T3PF 1HQRB 4JDTH 4TUKH 1DQLH 1W0WB 1UXLA 3G6DL 4OCMC 3PE9A 2WQWA 1DLFH 4ZMTA 2F53A 4X4YA 1YEEL 5A1AA 1IIKA 1K9TA 2GBTA 5KYWB 4PSPA 3DHMA 2BZDA 3MOAH 2NY2B 2DW5A 3U0WL 3KJ4C 4JL1A 1OCRB 4WKZA 4NC2B 3FFDA 3QDGA 4W6YB 3FFCA 4Y1AA 4BFEA 5DEFA 3DX0A 2VUOA 1B3IA 3WNJA 1XGUA 4GW4A 4K94H 5JHMA 1G7IB 4K7PH 2IPTH 1FZOB 3QUXA 3D2UD 5CZRA 2QQQA 2AABH 3SBRA 3BIAX 4DEPB 2OTUB 3KYAA 2ZCHH 3ZO0A 4LVEA 3L3OA 4CMHB 3RIFF 4IBTA 1ZT4A 4L8BA 3CZFB 3T6VA 3QG6A 2KUTA 4UOW0 2IADA 3DYMA 1DSFH