4PHXA

Crystal structure of aggb, the minor subunit of aggregative adherence fimbriae type i from the escherichia coli o4h104
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
133
Chain Sequence
b'AEITLISHTGSQLRDGMKLATGRIACREPHDGFHIWINASQNGKVGHYIVQNNRHELKVKIGGGGWSSSLIEGQRGVYRQGEEKQAIFDIMSDGNQYSAPGEYIFSVSGECLISRQALERPPIKATETIRLTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AggB
publication title Structural Insight into Host Recognition by Aggregative Adherence Fimbriae of Enteroaggregative Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 27
structure length 133
sequence length 142
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4phxA00
2AXWA 2IXQA 2FVNA 2CO2A 2CNZA 2CO3A 4OR1A 2CO1A 3UIYA 3UIZA 2CO6A 2CNYA 4PHXA 2CO4A 5D55A 2CO7A
chains in the Genus database with same CATH superfamily
2Y7SA 5GRXG 3UAEA 4XMPL 4YN3A 2WXIA 1CWVA 4XCEB 1W8EA 2WKGA 1TJXA 5FYJD 3STZB 1B0IA 3TJPA 2F5BH 4J39A 1XF3B 4S1DD 2VLKB 2ZCLL 3QJOA 1CGSL 3B6SA 5GS0H 5CEZE 3IFOA 3L3KA 5HGAA 4ZD3H 4M5ZH 5JYMA 3BSZH 1LP9B 5DMJB 4A63A 4N2BA 3G5ZB 4G6JL 3ARDB 2JMRA 3MNWB 5EO9B 1EJFA 4HYTB 4L3EA 1U8CA 1DVZA 1LE9A 2X4OB 5D2NA 2NUTA 2J1WA 5IGXL 1ETJA 3CGTA 3FCSB 2BLFA 3TA3B 4AXWA 5LVEA 3ATAA 3HHMA 1EAPA 2DH2A 3GMPB 4PGBA 1CGYA 4YFLI 2IH9A 1T21B 1WGVA 1FP5A 1G4MA 4QHNA 4HT1L 4WCYL 5ESQA 4CC4A 3D6GA 5E7BA 4D9RD 1TETH 3V6FA 3LNGA 4L9LB 5L6YH 5LGHH 1AO7B 3TN0A 3IJ7A 3U82B 3SJVE 3QUXD 3C60C 3S8WA 3BP4B 1JV2A 1E4KC 3WYRA 2WQUA 2NCEA 4OZIA 2EDLA 2KDGA 1J1PL 5JHDB 2KZBA 3MV7D 3MXVL 2DQIL 2Q8BL 2NXZB 1FVCA 3EJYC 3N1QC 4NLAA 5E9DA 3DVNB 3DX7A 1AAJA 4GG6E 3NJNA 1H15B 1LD9A 1EZVY 1QNIA 5HYSA 3CDGA 4RISL 2XV6B 1EZVX 3O3BA 4J3UA 3RLSA 4LVHC 3ZYZA 1CG9A 3VFRA 5JQ6H 3LZFL 4HKZB 1S7QA 4LCYA 1OE3A 2R2HB 4HS8L 4YSDA 5LJYH 2F7PA 4Z3TA 5DC4B 4H1LG 4KZ0A 4B5ZA 1RIHH 5A2KH 4ELMA 4NHCL 1EHLL 1TVHA 5SWZD 1BIHA 1GYUA 2YGNA 4PYHA 2PP8A 3PL6D 3W0WA 4Z7VE 2YAHA 4WNJA 2ICWI 2XIIA 3WMQA 4Y9EA 1CL7H 2XG4B 4XP4L 4ZMQA 4R5TA 2R1XA 3CMOL 1CLZL 1A0QL 5IW1B 1TQCC 3HG5A 1I3UA 4IKKA 1I8KB 3MR9B 4TL5A 5JIIA 2Z93B 3CDCA 3VGHA 1RUML 4DO5A 2C1OA 3G5YA 1MNUH 3KCPA 4M9PA 4WWPA 2EILB 3JT2A 2X70B 4WK4B 4UTBH 3RHWF 3NN8A 5JXED 3SBRA 3VFUB 3DIFA 3KBHE 1IGIL 2J4WL 2NY0C 4NQCD 1KB9J 1XGUB 2X2YA 3V7MA 1HHIB 5LQBH 5GGSY 2DYRB 4PY8J 3CZGA 4XMKL 5EA0L 4ZI8A 1KMGA 2Y07L 1T20A 4YDZA 1XFPA 3WTTA 5BS0A 3UAFA 4MNQB 2WZ5A 3INUL 3T2NH 5JPMB 1F8TH 4IDJL 4LIQE 4JKNA 1WT5C 4X6EA 5KYWA 3OZ9L 1JHKL 4G59C 3VFNB 2CRYA 4LOFA 2BNRA 4U2ZA 3A24A 4ZXBD 3WJLC 5B3SB 1VADB 3GM8A 3INOA 4YHLH 1I7UB 1UEYA 2GABA 3BAEL 3BUPA 3D4GA 3GSOB 2ENJA 4HSAC 5C07A 3LMJL 1LDSA 3N9GH 2X4TB 3RTQA 1UVQB 4KROD 4Y5VC 4YHIA 4BH8B 5I71B 3X3FL 2YMOA 4HPOL 5I1GL 4XODA 5KZCD 3ZBMA 5FW8A 1FL6B 1JGLH 4N0FA 3GIZL 1URIA 3LKRA 2UXVA 3GXIA 3LQZA 4OZHB 1TVBB 4GAGH 4GQZA 5E4IA 8PAZA 2BSEA 3FUEA 4MXWH 5ALBH 1VA9A 4DVBB 3KH3A 3AUWB 3CSGA 5KVEH 3RWEA 3HPJB 4AQEA 3E6FA 4P59L 3BFOA 2ICWA 2WTRB 1KNOB 2C3VA 1U8KA 3SE3A 1PNCA 3LKNB 1H5BB 3NJHA 5L2JA 2IDSA 4AL8L 4K7PY 2EXYC 2G5UA 1KGXA 5GGUB 4K7PX 2XN9B 1LTXA 3AT9A 1WVZA 3QZNA 2GI7A 3MGOA 4WW1A 4CADB 1K4CB 5HDBB 3LY6A 4XCFH 1FN4A 1VEOA 5DHYB 4F33A 3WFBH 3DETD 3RGVB 1KJ2A 3RIAK 1I8AA 2F8VA 2OCJA 3B2MA 1NFIB 2K3TA 5DYFA 4KFMA 2NUPB 2FBJL 1YEHH 5IEKA 1XGZA 1M05B 1PY4A 1DEDA 2D7PA 3HFML 2XPZA 5T1LA 3IFNL 3GRWA 5EG6C 3BAYA 2NY3D 1A7PH 2BO0A 3HG1A 5EULV 2JQMA 3TWCL 3OG4B 2D9CA 1MH5A 5F1KC 1FH2A 4GAYA 2XG5A 2DKUA 3B5HA 1P6FA 5FKAB 1Z5HA 1JAEA 3LEXB 5JUEL 4LFHG 4LAQL 4YXHL 4PUBH 2N7SA 3T3PE 2W94A 5HVHC 1O7SA 2W0LA 1MRFH 1UG9A 3Q5OA 1O0VA 2QELA 1WWBX 4NM8L 4PB0H 4W1TA 2QV2A 1YYLH 3DJRA 3X11A 1L9RA 4E9VA 1AQDA 1KV7A 2OMTA 3U4EB 1C5BH 5CO1A 1G9ML 1DQQB 4Z18A 5J11B 4EBQL 3DBSA 3MHZA 4KTEH 5B4MC 2QTEA 4LASH 4HCIA 4FG2A 4YJZL 1HOCA 3O6FA 5E2UH 1JWUB 4HWBL 4Y1SA 3WAJA 3NCWA 5DJ6B 4KKPA 2GSIB 3ARED 4N0UE 2BHFA 3DKHA 3ZDZB 1X4YA 3TT3L 5IESH 2X9XA 3ETTA 4FXKA 2FT8A 3GKZA 3LV3A 4UOZA 4XHJC 1OAUL 2HVJA 3D48R 3ETSA 4LSTL 2RFXA 3C5JB 3L6FB 4PJIF 4KUCD 4LRIC 1JUFA 3SKMA 2EP6A 4PHXA 2O6EA 1RJZB 2IPUG 1LLAA 1AR1D 1KCRL 3GXDA 3KPOB 2JI1A 1N70A 3TCLA 2KYIA 2WQWA 4XP5L 4PLNC 2BFVH 1U9KA 4RQQA 3QEHB 4TSBH 2CHDA 3L9BA 2VJXA 1MQKL 3CC1A 4OTXH 5C0CD 4FG6D 2VDLH 3OR6B 4ZAKD 3NSDA 1RPQA 2H26B 5AYTA 1EHNA 4U3CA 1RL1A 5F6IB 3QSKB 2XDHA 4YXHH 5HHQB 5JDSA 2ZUQB 1P5VA 1YMMA 2JKXA 4QRAA 1PIFA 4LBEB 2WXFA 5IMMA 1P6AB 4DNLA 2HPOA 3V9FA 4X5PA 4OZGB 3NGBC 1MAMH 1TYJA 3DSNA 2QV4A 3GJFB 4MJ6A 2KZWA 4F92B 3MKKA 1RU9L 3D05A 2CBQA 2YSTA 3L95B 4S2SB 5L9DL 4NO0D 4QRUB 4NZUL 1PZDA 1DVTA 1OM3L 1EO5A 5BJTA 5FO2A 2P5EB 4CU7A 1T1YA 4IS6A 2NMSA 4NQDB 4GRLD 5T3XH 5FKPA 4Y4KB 1F4XH 1N12A 4R6UA 3WN5A 1NBVL 1A66A 2ODIA 3RIKA 1IGTA 4HH9A 2VQUA 2Z35B 3VI3A 5BZWB 3SD5A 4C59B 3VMNA 5DJDB 1BVKB 1NLDL 1OAZL 5IJVA 1RZGA 3QHZH 5C71A 2OAAA 4Z3HA 1U3HD 4P5KA 3ZE1E 5CGMA 2GBTA 4I18C 5DI8B 4X4YA 3VXUD 1JGIA 2UWEA 4PJAF 4R9HA 4XXDA 2B2XL 2PO6B 5E6ZA 4NP9A 4DK3A 4DP8X 5A16B 4MJID 3SYOA 3H54A 5G4OA 2APFA 4BKTC 4Z5RB 4JKPH 3H9SE 5FM4A 3VFMA 3HI5L 1S7VB 3E1ZA 3F7VA 3ZQXA 1SXZA 5MERB 1M4KA 2Y3AA 4NERA 4DP0X 4FNTA 4ENED 5KYXB 3RZCD 1EEZA 2R0LH 2WTOA 4MYPA 2OSXA 4JHAL 3SDAC 4LHUA 3V4PA 4PGDA 4R97C 3WUWA 2IPKA 4N90E 4R8WL 1ZLVH 1LO3L 2ZG1A 4AE1A 1IB5A 4HLEA 5CLYA 4JFXA 3MO1B 4RSVA 3QJTB 1JPGA 4RA0C 1CVRA 1CFNA 3UCQA 1AGFA 3S37L 2R2BA 3T04D 4LNVA 4OF8A 4FI7A 1MDTA 1DUZA 1TCMA 4AQ8A 1DSFH 3AT0A 2W9DL 3SBWA 3T77A 1MFEH 4D94A 2XV2A 5C0ND 2JIXB 1A5FL 3RWJB 1O75A 3KPPA 2ZOWA 3QJQB 1Q94B 4I48B 1IM3B 3MMEB 2ZWKA 1DCLA 3NTCH 4YZFF 1CGVA 2IALA 1ZS8A 2CHZA 1KN2L 1H0DA 4NWTL 2WQXA 1K2DB 4U6TA 3W5MA 3Q5TA 4DKTA 1DVQA 3HE7A 2C9RA 3WKQA 1KBVA 5T1KD 1IE5A 3CX5J 4R2GD 3BYTA 3AMKA 4XZ4A 1INDH 3DGGB 1R3KA 3COOA 3IETA 1GGIH 1SUHA 3MODH 4QR7A 3BLBA 3ULVH 1AKJB 2GIYA 4B9IA 2G9KA 5ERWB 2FT7A 3HAEA 3VWJA 1T2QL 3FCBA 5EUOE 3ARGC 4F9LA 1L3WA 4TVPH 2FX7L 4S1QH 3SYCA 3ALXA 2APSA 3NSFA 3QIWB 1NCIA 1OT2A 3VFVB 4UT9A 1T0PB 2D0FA 1QACA 4XN1A 3IKCA 4OU3A 1ETZB 4JJHA 5AEAA 3C09B 4K5OA 1J0YA 1PLAA 5DLML 1IIKA 4X0KB 1MCPL 4N87A 4I2XE 1Z3GL 4H1LA 3V4VB 1YEIH 4BSWA 4OI8A 1BMWA 1LO5A 2QLVB 4GOSA 4HCGA 4TLSA 4IMLA 2VXQH 1QNZL 3US0A 1Q0EA 3WO4C 1M6UA 3B8SA 1BW8A 2JLLA 3WLWC 1BG9A 2Y7QA 4HIXL 1F02I 2W65B 3RP1A 2CJUL 4FLQA 3LNDA 3EOTH 3RL1A 2A4EA 5AOIA 3E9UA 3NIDE 1ZHNB 1O6TA 1B4LA 3A67H 4B96A 4DQOH 5AVVB 4C4BA 2I9TA 2JXMA 1CLCA 3ILEA 5A43C 1HQRB 4BQCA 5DR5L 3SY0B 1RZIB 3DA0A 4LCWA 4KI5E 3BSHA 3NIGE 4IW4C 4LSPH 3TEYA 1AGBA 2V5MA 4XNYL 4HQQL 2FH6A 3S4SB 4CMMA 5KJRH 3SCMD 4JDVB 1T83C 4YNYA 4UDTA 3SQBA 5JW3H 1SYVA 3QJVB 1E27A 3LKQA 3P11L 1QRNE 4RAUA 5GGTA 4CVUA 5E6ID 4OQTA 2AK4E 1BQKA 3DLQR 4XO5A 3VO0A 2VJ0A 1S78D 2VXSH 1C9SA 1VDGA 4MNHA 1VKXA 4XCYA 1ORQB 4CMHB 5J12C 3PFUA 2OLDA 4WAFA 3WSQH 3HNSH 1JPSL 4PIRF 3PWNA 3U9PL 1XCTA 4KMLB 4R4FH 1JCKA 5DF0A 3WXWL 4C55A 2F61A 1BG1A 4Q6IB 3G5VA 5IG7B 1C12B 1CXKA 4AGLA 1QSFA 4TTDD 1UWEL 3KL0A 4E0RB 3Q2WA 3UH8A 3DUUA 2XUWA 3QYCA 4QRTB 3C8DA 2GC7C 3V5KB 2AJUL 3VU2A 2OZNA 1RJCA 2EE0A 3Q9PA 4OF6A 3HC2A 4MCZA 3H6AA 3WTXA 2ZP0T 4ONGL 1W8NA 2JB5H 3D87B 2VLMD 3BMWA 5HHMD 4LHJB 2H6OA 1JE6A 3WY1A 4UZSA 5I1KL 3NDZE 3EFOB 3FHQA 1AGDB 1YYMH 2XJKA 3GJFK 4GG6F 4A38A 3BWZA 5F7AA 1ADQA 1JZ3A 1N7MH 5B7MA 4JFFB 4XCEA 5KYYA 3HZVB 5ICXB 5IFJB 4DF9A 3HLAB 4RNRB 3NP4A 3STZA 3B2UC 1XF3A 4LVNB 3VXRB 4JFED 1KYAA 2VLKA 1WTGT 1P7QD 3RNQA 3QUKA 3RVVC 2CGRL 5C0EA 2I7SA 3I6SA 2WV3A 4Z7VF 3BDYH 1BZ8A 3QUMH 4AIZB 4QXVA 5I76B 3PWJB 3G5ZA 5TQ0L 2XLLA 3RZWA 3ARDA 4LOEA 5EO9A 1YEDA 1A6AB 1GAFH 2AAAA 4K3JL 3VSQA 4H2AA 1OPOA 5J7CC 3GUTA 3II1A 2X4OA 1A64A 1DVFD 1AC6A 4FN0A 3TA3A 3FCSA 1RULL 5CCGE 2AABL 2BOBB 3QCUL 4PJEB 1QVOB 2VE6A 1IVLA 3W37A 5D1XE 2DM4A 1TTRA 2D9QB 3CFMA 4UCFA 3IN0A 5F7NC 1T21A 5HXMA 2J8UA 5EU7C 5GIRA 1Z3RA 2MHAB 4UQCA 4HMCA 1HESA 4K94C 3ZK0A 1BXVA 3QFJD 4XVUC 2NY6D 1A4CA 3GMQB 1AO7A 4PJDE 3VRIB 3ESUF 3CCHA 5ACZB 1IKFL 5JO5A 2LU4A 3MRQA 4G3YL 3SKOB 4TVUA 5T1MB 2PW2B 3SPVB 2VDPH 1MJJB 2ZJSL 2X53A 4BWWA 5TDOA 1ZV5A 2J6EA 3N1GC 3OHXC 5JHDA 5C6PB 2OJZH 2Z4QA 3CLEH 4YHPB 1GYVA 2HPTA 5LG6A 5TFSH 3RDTB 1H15A 4XVOA 3AADB 1P69B 4HJGB 2CJ3A 4Y2OB 1VERA 3IU4H 4Z3IA 4KKZA 4DN3L 1WF5A 4HKZA 1NGZB 2YRPA 3WIFB 4Y4HB 3IMBA 2WNXA 5L7XH 1RZKC 1I8MB 4ZS7L 3T8MA 3UIZA 2WNGA 4KJPD 4M7KH 5LXGL 3ET9F 1VB9A 4Z0XB 3KPSD 4P49A 4KX9A 1AJ7L 3C2AH 2BMKB 2XZQL 4RRPG 1BM3H 4MQTB 4K9EL 5IW1A 2B1OA 1KJ3H 3MR9A 4W70A 2KH2B 3OLEA 2MTAA 2Z93A 5E6RB 1TZOA 3VGEA 3CQQA 4X7CC 1G7IA 1BX2B 4TLTA 4GUQA 3LD8B 4KWUA 3GJEA 4GNKB 3O4OC 1WAAE 3MRDB 3VFUA 1AZCA 5ICZB 3MLUL 4HBCH 1HAWA 3A3YB 1NBYA 2ZSWB 2NXYC 1H19A 1MIML 2VKWA 4CAGA 5FYJL 3S4SG 2PXYB 3FSZA 4X6BA 1A14H 4XP9L 4IBUA 2DQUH 2B7DT 2NQ3A 3N41F 2EACA 4GRMB 1CR9L 4LRNL 3EH1A 3MJ9A 4Y4FD 1ZANH 5DQDH 2HKHH 4N1CA 4NKIH 3D06A 3ASNB 1IBGL 4G7RB 5ITFB 5I0YA 4EOWL 4ETQB 1SDYA 1LK2B 2YFOA 1TJIL 2TRYA 2OFQA 3VFNA 5ACMA 5DZPA 2NY1D 4YPGB 7TAAA 4QRRB 3KPTA 4FTVE 1V8HA 4Y5YC 3X14B 3ELAT 1Z66A 1INEH 2J57A 3RVTC 1I7UA 3KWVA 5IVZB 1NL0H 3GSOA 3ZDXF 4NNYB 2X4TA 1ODUA 2WBJD 2YPLD 4G8GA 4POYA 2WUBH 4OCXL 4NO5B 4YX2H 4PJHB 4TRPH 1M7DA 2WANA 4ZMOA 1NIAA 4AQ1C 4JM2B 2UX7A 3MBEB 3HHRB 4A2EA 1FL6A 5CU9A 1BVZA 4JO4H 4P9HC 3MOBL 1JFQL 3T3PF 4G6KH 5A7EA 2SEBB 3GEFA 3IT8D 3WFDH 4DVBA 3FFDB 2YD6A 2A9AA 1WFOA 1OCWH 4U1SA 2AZUA 4OQ1A 1DL7L 1S8DB 1XCQB 2OXHA 1KDJA 3PCYA 4QWWC 1TTCA 1HNGA 4P2QB 2WTRA 1YY8B 3QZBA 1A9EB 1RUAH 1U8HB 1QI4A 4B0MB 5I1EH 4FJ6A 2CE6A 3LKNA 2VLRE 3CK0H 5IUSA 3C2SA 1ZLWH 2NY7H 4Q4EA 3BAJA 1PZUB 3BQUB 1MIMH 2HRHA 1QLEL 3VAEA 2YOAA 5GGUA 3PDDA 2IVFC 3FT2A 4KY1L 5ABAA 2Y5EA 1FE8L 2YUWA 4M5SA 4YSPA 2BRRL 2YD9A 3BAWA 4CADA 4AM0Q 1LE5B 5FYLH 2E4TA 1DO6A 2CNZA 4YK4C 2W88A 1HCYA 3O6ML 2BSSA 4FEMA 3ZGIA 1NFIA 2XWEA 3D69B 5J6SA 5BUPA 2FYVA 3GZOA 2ED9A 1OP4A 4O51B 1XCWA 2XKUA 3UPAA 1Y6MR 4YSOA 1M05A 4F91B 2M1KA 1DVUA 3QJFB 2BSTB 1VPOH 1QO3A 3PDGA 4OIIH 3JWOH 4K3GA 1GZHA 5FGCE 1JWSB 3WENA 5LBVA 1YRKA 2KHAA 1GIGL 2GJ6D 5FW7A 1EQWA 1A3QA 1W6LA 3QAQA 2F54A 3PHSA 1R3HB 3LEXA 5C7XL 4WFED 2OBGA 5ADPL 2CJSA 4I0PB 4YDIL 2QHRH 4JREC 5CLTA 2V3EA 4G9FD 1JFHA 4BZ2H 5AKSA 5FFOA 3RY5A 1UH2A 3U7AA 4L3EE 2Y72A 4JAMA 2VC2L 3AXLA 2V33A 1DQQA 2VM3A 4JRFA 1SYSA 1Q8MA 5D2NE 1OPGH 3AQXA 5CZVH 2ZX5A 1QP1A 2E7BA 5T5FL 3Q06A 4NKMB 5DJ6A 1JK9B 4I3SL 2GSIA 2Q87A 4LMQI 4RA3A 4A7UA 1UM5H 3ZL4L 3FU5A 1B2WL 2QADB 3L5HA 4PJ5A 1OCZB 1ET5A 3QULB 2EDBA 5CEZD 1U3JA 4M1CC 5I5JA 2EDWA 1SLXA 3ZLQC 2VABA 3GXFA 2Y7NA 3C5JA 4L48A 1PDKB 3GSWA 2E7MA 4OLXH 1S5HA 1EHAA 4I9WD 2RAMA 1ZOXA 1RJZA 4OZIE 2XFGB 4OD2B 3ZE1F 4DPBX 5DVPA 2WQSA 3KPOA 5E9DE 1UJ3A 1W80A 2BY3A 1CJYA 1LMKA 2D7OA 5IBLD 3ARTA 1H8OA 4MXQD 3OGCB 2ZG3A 2IAMA 2E9WA 3OR6A 3JSSA 4J3TA 3BSZA 3BZEB 1F13A 1QBBA 4KOCA 3CXHJ 5HHQA 1DO5A 1BWMA 2DJMA 4ELME 4HHAB 2FO4B 2IH3B 3BD3A 3I50H 3JTBA 2ZPKH 4L2YA 3VQ1C 4LBEA 3W0WE 4EZKA 2OP4H 3MJ6A 3KGTA 3UTQB 4OZGA 4KU1A 5DCCA 4RLDA 5F2FA 3RWCB 2JI2A 3MRNA 2PCPA 2VISB 4M43H 4M7JH 4J8RB 1W0VB 4S2SA 5EIIA 3FO2A 1TIUA 4N8CL 3GSUB 5D72H 1HX0A 1XR9B 2LGNA 5H8DA 2P5EA 4IGBD 4XPFH 4M48H 4NQDA 3L1EA 1PZ3A 1U42A 5DRNA 3PG2A 3SPHA 5KOVC 1MFVA 4UIKL 3X12B 3AFLA 2CALA 1KJVA 1P4BH 3MJ8B 1UENA 2R39A 2EH8H 4H40A 5BS0E 4RBPK 4Z95L 4PEEA 5BZWA 4H8WL 4Y2NA 1S5IH 2R1YB 1IFHL 4X8CA 5DJDA 3QUYD 5C0RL 3REWB 4WWKC 2DQCH 1Z5YD 4JFSA 3G6JB 4X50A 2P5WA 2X9WA 2VSMB 3MLSL 5EUOF 1KPUB 2BNRE 3QJSB 2N3JA 1GSKA 1E8WA 2AI0L 5DI8A 1MKFA 2JKWA 3PHQB 1CGXA 3VA6A 4KKBD 1S7WB 3VFPA 4G72B 3SIKA 5A16A 3HMXH 4KQ3H 3IGFA 5C07E 1PFCA 2HX8A 4Z5RA 2GI0A 3UDWC 4HS6B 1S7VA 4LSSH 4LU5H 43CAB 2WQAA 5D7IA 2L3BA 5B7FA 1HAUA 5KYXA 1RFDL 1MEXL 4Q9BA 5JW4N 1RH8A 2APBA 2DI9A 1ZLUK 3PP3K 1B88A 4XXWC 3R0NA 3ZKXB 1JOIA 3WS6A 4J23A 2FJSA 5CSGA 3U6RA 1H6UA 1P9MC 3RQ3A 1WAPA 2XWCA 4JZJB 4DQAA 5FR3A 2L0DA 2YRZA 2PP9A 1G6RH 3CVHH 2MOVA 3FU3A 4GAAA 5L2KB 3NIDF 4LVOC 5G4MA 2YXFA 4FLHA 5DRWA 4I48A 1Q94A 2HJFB 3IYLW 1IM3A 2FZ3B 4TM9A 1V3KA 2NDFA 1HNYA 4XB8A 4JKKA 4QUOA 3MV9B 5F88A 4YWGL 2EEAA 3HE6B 1K2DA 3HW7A 4KI5F 1KCWA 5F7WC 3NIGF 4JUSA 1UCBL 1YDPB 4Q0XH 4PS3A 3AWFA 5HGHA 5JPNA 3KLHD 3P0YH 4XVTH 4OF0A 2OMWB 4L3FA 3IDJB 1AKJA 4HWEL 3TX4A 1F90H 4KRPD 4OCYL 1A1NB 4PY7B 2FATH 4M1GL 3UJIH 5L88H 3AWGA 1HJBC 5ERWA 4KZEH 5FWRA 3V52L 4J3WA 5JQHC 5KBKA 3SDCD 3V10A 4YHYC 3QEQD 1FIGL 3SPGA 3EDEA 4FRWA 3QIWA 3BVWA 2NX5B 2V0AA 4L0ZA 4UTAH 2EXTA 2B5IC 3HG1E 1KXTA 4OSUL 1OTSC 5F9OL 3CZSA 4G83A 2VR7A 1ETZA 1ITBB 1BMZA 1CT8B 1BFSA 3N04A 4G8EB 3EOAA 4IRSB 5C92A 3QQDB 4S0TD 2HTLD 5BO1L 5CJOH 5GS1C 3H3PL 1RP9A 3QIBD 5A2BA 1Z32X 2A9MH 3SKJL 1IBDA 5EEUA 1MCQA 1V54B 4JFOB 4XC1L 3FPXA 2CXGA 4P3CH 4OT1H 1G9NC 5CILH 4DGVH 1TQVA 3KWXA 4LLAA 3F6IA 2V3FA 4KXBA 3G6DH 3VX0A 4XP6H 3TESA 1D3CA 3ZL1A 2W65A 4JDEB 3JWDC 3T6ZA 4YDMA 1P1VA 2ADGB 4WNSA 4DPCX 2DYPD 2X12A 4NZRH 4K8RD 4XNAA 1HQRA 1W9XA 5EEYA 1Y1UA 2DM3A 3SY0A 2XVKA 1AY1H 3PHOB 3VW3H 4APXB 1ZJAA 3FT3B 5JOFB 5CGTA 3BHBA 4EDXB 1HZLA 4FKEA 3OSKA 2ITEA 4Q58C 3BD4A 1HK6A 3DX9A 2XXMB 5DFTA 4JDVA 3SSGA 2CWRA 3NCXA 5IJBC 2Z8SA 3PGFL 3AG4B 1FJ1B 2X4SA 2BY1A 4U31A 3GB7B 4H5SB 4P4RB 1E30A 4ECNA 4Z1PA 3T0BA 5CJQH 5D7JD 2CGZA 5CFHA 4Y9GA 1F1DA 3QIUD 4IRJC 4A7SA 5IJCC 1JG9A 2BXYA 4J3OC 3TFKC 4NQVA 1TTUA 2EIDA 3GSVB 3KS0H 1GMIA 4U33A 3SPIA 3HRZB 1EJOL 2EUXA 5TQ2H 2IDTA 3QUXB 4Q6IA 3NJKA 2QPUA 4ADIA 5IG7A 1KCVH 5AD0B 1Y6NR 1HZKA 1CXLA 3NSJA 3S3CB 5B22A 1RZJL 2HT3D 3OAYK 4E0RA 3RA7H 4RAVB 1YMME 2NR6A 3V5KA 4JDTH 3MV7B 1PGRB 4W68A 3FBQA 5DFVD 1ECYA 1YG9A 4JE4B 4PJDF 3VWKC 3MLVH 3VSTA 3WKPA 5I28A 3FTYA 2C5DC 3ASOB 4BKLA 3HLKA 4KUZH 2TSBA 4AK1A 2EIZB 4XAKD 5M7QA 5DJYA 4L1SA 5EZJB 5BXFB 1QLEB 2ICES 3GMLB 2K8QA 4AUJA 4AYSA 4RX4D 3GI8H 3GMOA 2Z3FA 3EFOA 1AGDA 3I6GA 1R0AH 3QQ4B 1L7TH 2Y1AA 1PLGL 4JFYA 4NAMA 4LLQB 3RKDD 5ES4B 4JFFA 3HZVA 5ICXA 4HK3N 4HA1A 3C5XA 1KBBA 3S3BB 4KITB 3HLAA 4RNRA 1MUJB 1Q9OB 1I1FB 2BNUA 4WK2B 1Z5LB 3VI3E 2C4FU 4CDHA 1ZDSA 5J1AB 5J57B 4AIZA 3W9EB 5I76A 1IKNA 1N67A 3JZ7A 4L0YA 4M8QA 2IDFA 3GRGA 4M5YH 1IC7H 1RMFL 1A6AA 4N2HA 4R7DB 3KLLA 3WIHH 2UWEE 1EO8H 1PLBA 2C9QA 3SDYL 4NQCB 3RWDA 1V7NH 2J8OA 5JIPA 2V6HA 4OLZH 1E9PB 3UCRA 2BOBA 7PAZA 1MHCB 3HNVH 4PJEA 1QVOA 1TYEB 4HUXA 3RVWC 3THML 2OV0A 5ICYB 4LQFH 1WAAF 3NFPA 4M61A 1EAOA 3H0TB 1BZDA 5C3LD 5FYKU 3LHPH 2VC2B 4H4NA 2YSSB 3QYNA 3WELA 3W56A 3DO3A 3FTXA 2Z0BA 5IK3B 3GMQA 2ARJQ 3VRIA 2GJJA 5ACZA 3DYPA 2WWMD 1CF8L 3SKOA 5T1MA 1WPCA 2PW2A 2JKLA 2P45B 4LSRH 3TFBA 3LSOB 1NGQH 1DQMH 1KELH 2IDQA 3T8VA 4BH7B 4EN3D 4GRWB 1BFVH 4UBDC 5KZCB 1TITA 2VRQA 3H9SD 4WO4C 4FZEL 3T0WA 3WEBA 1MWAL 3CQFA 3CX5K 4HJGA 4Y2OA 4RGNC 1UA6L 4I77L 1N0XH 1IEAB 5FS5A 2DM7A 1BBDL 4UNVA 4KNQA 3PABB 2ZX9A 1PSKH 2Y22A 4Y4HA 2ZKHL 2J44A 3FOMB 4MCMA 3LS5H 1I8MA 3RUGF 3T0EC 1S7SB 4XI5D 1J1XH 5GGVY 2Y36L 4CN1A 3BO8B 2ENYA 1E43A 2FB4H 4WIQA 1JF6A 1YC7A 2BCKA 3QWRA 3J07A 3EOYG 4U0RC 3CHSA 1X9RA 2ORBL 1LJMA 4XOBA 1QR1A 3FB7B 3MRBB 4ZUUB 5CUSH 1AG0A 4BRJA 2P42B 2XZAH 1T1WB 2O1AA 1OE2A 4C4KT 4X98B 1BEYL 2D7TL 3NFSL 4Z76B 1NIEA 1JP5A 4NWUL 1JXDA 3RWIA 1UXLA 5DMYA 1IL1B 2PXYA 2VN3A 4NC1E 5I30L 4N0YH 4CKQA 3I9GH 3AS0A 3BEVB 4P5SA 5FGRA 4Y2DC 4OLWL 4JCMA 5GS0C 2EDJA 2MCAA 1J8KA 5F7EL 4ETQA 5HVFB 1LK2A 1NMAL 1E9OB 3EGSB 2NY3B 2X4UA 1WWAX 4QRRA 1CFVL 4X4MA 4X5RA 4FF9A 2NY2D 3FU8A 3UERA 5L0QB 3X14A 5GZNA 2VDOB 5LGYA 3UJJL 1JVOA 3DRTB 1UM6H 4FFYL 5IVZA 2LU5A 5AVWB 1BIIB 4NNYA 2WCPA 2DQEL 2E9GA 4OF7A 4LCWE 4NO5A 4YBLB 2G3XA 1CFSB 2ZXDA 3P2TA 1HKFA 4PJHA 5DD0L 5I16B 1UGNA 1FGVL 3MBEA 3QORA 4CVZB 2YRBA 3BQVA 2FNBA 4NPYB 1WBZB 4IRZL 5IROA 2RHEA 3Q3GA 1BF2A 1G1CA 2R0ZH 4W6YB 3VXPB 4QRQA 2CNYA 2EYTB 1GYWA 1YJDL 1TPXC 5TE7L 3GLZA 4RRPM 3WE1A 2SEBA 3BGAA 5DRZB 1UC6A 3GBDA 3FFDA 1QASA 1BWWA 3BWSA 3AU1B 4TUJB 4WVRA 2ZUTA 2WLKA 4QHMA 3GIVB 1PS3A 4X8GA 1N26A 3AREB 5FYJU 3QNXB 4ODVL 1S8DA 3TBVB 3MBWB 4PS8A 3AROA 4BCZA 3PE9A 4X80L 1EVUA 4P2QA 4BZ1H 3BI9X 1A9EA 4KI5D 1U8HA 3WE6B 4FE9A 4XRCB 3X1EA 2D7TH 5BPPA 4LOVA 1IV8A 5BV7L 4R3SB 4AEIL 3ESPA 1HYSD 3TH3T 4PWGA 2GEQA 2WXNA 3GGWA 1QTSA 3L45A 1QSFE 3V0HA 4DKEL 4PGCB 4I88A 4F9PA 5BVJA 2C9PA 1PZAA 1LE5A 2AJXL 2WC7A 2HRGA 2AK4D 1JDDA 3TV3H 1QI5A 5E2VL 3FONB 1RAMA 3K4AA 1FNSH 4HW6A 1BPLB 2FWUA 3JWNE 4D3CL 1IGCL 2ZNWA 5EO1A 3D69A 5LNEA 5C0CB 5J6GB 4OZIF 4W9FC 4O51A 5LAXB 3LQAH 3VGFA 3HTLX 4C8XA 4XN7A 3QJFA 4ZQTA 3WFHB 3C8HA 4WU7B 1UZ8B 1OB0A 1CK0H 1X5KA 3EGXA 3NAAH 5H35A 4BK4A 1L9TA 3L08A 3CFTA 4F7EA 1R3HA 2VLKE 4QPEA 4I0PA 4IOFC 4FQHA 1IBYA 2I7OA 4ELMF 2WGXA 2D3JA 1CDYA 2ZF9A 1KYUA 3E7JA 3VSVA 1QFUL 4L8SC 4NO0B 2HG5B 5CLXA 3O3UN 4F37F 2Y1ZA 4A2HA 5I19L 3FL7A 5A7BA 3RVUD 4QXGL 3Q8AA 1KLFB 3BPCB 2H6PA 3QZLA 4GRLB 4K3DL 3KJ6L 5DSCB 5D4QA 2FHFA 4JG0L 3VUAA 4H20H 4FQ1H 5KYNA 1H3VA 3LH2L 1JK9A 2BVUA 3A6BH 3B9KB 5E8NB 4PS4L 2J8UE 4LEXL 3RDJA 3QULA 1IGMH 1U3HB 2DIJA 4MJ5B 1D6VH 3FTZA 1AO7E 3VXUB 3NZHH 3WIIL 1MJ8H 4CILA 4TVSa 3ZE2B 1ZHLA 4O58H 3T4AB 5HY9B 4JJOA 3VDBA 3D0LB 2QQLH 4YFLF 1PDKA 5BW7A 1WHPA 3P4MB 3UO1H 1NCDH 2X4NA 4BCXA 4OD2A 2EIKB 4I89A 5JHDE 2AEPH 3QJHB 3RJOA 3L3HB 3N42F 1UUSA 1VEPA 3RZCB 1F41A 1RSFA 4P5RA 1BGXH 4OLUH 3L1GA 4UQBA 5D1XD 5D7SL 4LLDA 1CN4A 3OGCA 3MI6A 4X9HA 3S9DB 4S1RH 5I1AB 4H0GA 3JQOB 3N50A 2B0SH 5LB1A 3V4VH 2FO4A 2IH3A 2LABA 4ZFGH 2UUDK 2CLZB 2VITB 2CK2A 1SFHA 3KXFA 2IBBA 3LXAA 3OPZH 4H0HB 1NBCA 4AJVA 3UTQA 3BWAA 4GINA 3BH4A 4JEGB 2YPVH 1TFHA 2LTQC 3RWCA 3U2SB 4FKHA 3B2XA 1DQLL 3NG5A 4IBZA 1F1AA 3O45B 4P2OC 5CWSB 1TCRB 5D2LA 4BELD 2A1WH 2I69A 2OJEB 5D1QC 1R17A 4J8RA 4AMKH 3ZT7A 1P5UC 4Y16B 1XR8B 2J2ZB 3WNOA 3E38A 3VG9C 2KQNA 9PCYA 1K3ZA 5T1KB 4R2GB 1CE6B 1UURA 4PJ6A 1TKWA 3C9NA 4X7TB 1N9PA 1MJ7H 5TK2A 1KBKA 2W9LA 2ATKB 2VMDA 4G6FD 3SOBL 3ME0B 2JV6A 5CGYC 1I9IL 4IBTA 4A1RA 1Q1JL 4WEUD 3X12A 3W11C 4RZKA 4ENZA 3RBSA 3MV01 3BISA 4HAFA 4FMVA 3MJ8A 1N4XL 4NQXB 2P48B 4ODWB 1F5WA 2OL3L 4YBHA 1PG7L 3MBXH 4QY8B 4TTGA 1M7IB 4ZMWA 2X7LA 1ID2A 3GPEA 3RWHA 2GTWA 2PYED 2AJSL 3G6JA 4ZQKA 4HDIB 4DEPB 4O2EA 3BKMH 3KW8A 2W91A 4LSVH 2K7PA 4L5FE 5CJXC 5K39B 3VA2C 1T22B 3PHQA 4ONHB 2BNQD 1UH3A 2FIKB 2Y5TB 1S7WA 3U1SH 3NJMA 3U1PA 3PHAA 4RWYH 2OS7A 2Z31D 1ILUA 3TT1L 1GVIA 2P80D 4HS6A 4OGXH 2Y6TE 2NZ9D 4G8GE 4JFWA 1EBAA 2F9BT 1CFQB 3D2TA 43CAA 3CUPB 4NCDA 3C6LC 3IDUA 3MNZB 5E51A 1RVFH 3CFDB 3N85L 3KNBB 1A2YB 2I07B 2TRHA 4JPQA 2GITA 4ZUVA 4P5TD 1BVNP 1EO7A 1FFPA 4KRLB 2WP3T 1GCYA 4QO1A 4NRYA 4CU8A 3MQIA 2YAOA 1FNHA 3GT6A 3S35H 4JZJA 3DJZA 1D7BA 1NTDA 5L2KA 1RZ7H 1ZK5A 3HJ0A 4NYLB 3X13B 1JXJA 5JR1H 5L4JA 3GO1L 4E41D 4KTDL 2JI3A 1KC5H 2FZ3A 1CE1H 3UZQA 2R7EB 3H2PA 1F6FB 2QJDA 3SCMB 4PVNA 3F58L 2EXWD 3HE6A 1ZGLB 1YUHB 2NW2B 1N8OE 1WBXB 1KTCA 2L7QA 3O3EB 3BDBA 5E1AA 2ERJC 2HAZA 3QEGL 1YDPA 4FDWA 4KRMB 2R56H 3UJTL 2XTJD 2NNFA 3L1OH 4MKTA 2OMWA 1NCJA 3BN9C 3IDJA 5HDBE 2A9NL 1DZ0A 4KH9A 1JD7A 5ITBH 1UZ6E 4F7PB 4RFEA 2VQ1A 1FNLA 2AJYL 3OGOE 5EF2A 2Q0ZX 3UPRA 2N4IA 5INDA 1R19A 1HZHL 3WHXA 1JTTA 5E08H 3QH3A 4YHOL 2GTZA 3ZQ9A 1F2QA 2UV3A 3OF6D 1CLOH 5E4EC 4B0MM 2YRLA 4I4WB 2WVSA 2R9HD 3OJ2C 5J89A 1X5ZA 3VD9A 2VAAB 2ICEB 2J20A 3LDBC 1CT8A 4IRSA 4UILL 2Y2YA 3QQDA 5B21A 1SJMA 5KVGH 1D5BB 2Z64C 2F54E 3G9VA 2DI8A 3L3OC 4ZS6C 3FRPB 4UINH 5HHMB 4J4PD 2DY2A 3BKYL 5I75C 1E4XH 5HI5C 2YS4A 1WBYB 4UT7L 4HAKA 2E5EA 5SWQA 4U6XB 3LIZH 5J1TC 4GBXB 1J7VR 4MA1C 3ULUH 3LZOA 1LEIA 4PG9A 4JDEA 2F58H 3FCTB 4M56A 1F1GA 3IS0X 2WO4A 2H3NB 2HLAB 5I8EA 1A1MB 3TZVB 3QNYB 4JFEB 4H88L 2P7TA 3BGFB 3S8GB 1P7QB 2GPZA 1JERA 1L9PA 5GS3A 3PHOA 1PEWA 1T5WB 2WAQA 1BREA 3QEGH 1JIBA 2MKLC 4EDXA 4ODUB 4PJ5E 1HL5A 4ODXB 3QC5X 2YUVA 4KAQL 5IREA 2MRYA 2FQDA 5F9DC 3VI3F 2AJ3B 3OKEB 3HC4H 4XNDA 1DVFB 3VD4A 3BRGC 2HUHA 1FJ1A 2B3IA 1EEQA 3DDFA 3KE0A 5I0VA 2G3NA 2A74A 3K6IA 3GB7A 2AJVL 4H5SA 2PF6A 4P4RA 1JYNA 2RGSA 2UWEF 1LK3L 1P2CB 1RIUH 3IRCA 5DZAA 2QVKA 2VR4A 1MFDH 4D9QE 3BZ4B 5FUZH 3CXHK 1I9JL 3GSVA 4GAJH 2IWFA 2NY6B 4PJIB 1OAYH 3HRZA 4J7RA 2YBRA 5JZ7C 3VRJB 3QUXA 1LO2H 1WFMA 4ESKA 1I1RA 1U92B 3EYUL 5AD0A 5HYJD 1OF0A 4FKKA 2KBGA 3BE1H 3TN0D 3VGAC 4AYDC 4RAVA 5HHVH 4M03A 4R7XA 3ULVC 2R69H 4BQ9A 4UU9B 5IJKC 3EDFA 3TNMB 4OZGE 1JDAA 2H2PD 1WQVT 2CIIA 4Y5XB 1PKOA 4W9EC 1N6QH 1RIVH 2PTVA 2EIZA 3CJJA 3WNIA 5BV7B 2X28A 5EZJA 3EFDL 2Y1VA 2XWJA 3GMLA 2D0HA 4Q9QL 1I1YB 3S36L 2D2OA 3AGVA 2D3VA 3QQ4A 1G1YA 1UM4L 4KXDA 2CKBH 5EH1A 5FHBH 3VD3A 4XMUA 1JPTL 3MAWA 2P5EE 2LR4A 4PJ8C 2WXPA 5BMFL 4NQDE 5I1IH 1OHZA 3KPSB 5I26A 1MUJA 1Q9OA 1GZPB 4XO8A 1I1FA 4FXTA 3MYZA 1Z5LA 5J3HD 4LPWA 3W0WD 3QQ3B 1T04B 2K0RA 1AI1L 3ENEA 3MCLL 3H3KA 2Q20A 4IKJA 4LL1A 4P2YA 5FEBA 1HHJB 4WEBH 5J1AA 5AYQA 4LMQE 1I85A 5E0QA 5CSBA 3W9EA 2P5WE 2QGBA 4CN6A 3MCKB 1JV5B 2DEWX 1D5ZB 3FFCB 4BXSV 3QZOA 3QXVA 4R7DA 4LGSB 3KHOA 1H3GA 4EUPH 4JFHE 4G71B 3TIEB 3AY2A 2ZCKH 1E9PA 2A0LD 3BPNB 1LQSR 4MZRA 1OAXL 1MHCA 4OFDA 5GRUL 3CSPA 1KENH 2CBPA 2IV9A 4KX7A 3F65A 3O2VL 5D7IE 3MRIB 4Y4FB 2PKDA 3H0TA 5DEZA 3RU8L 4HJ0D 5EZOH 2A6IA 4DEWA 4QJ4B 3VFSA 3ARPA 5F0LB 1JZJA 2YSSA 2HRPL 3GSNL 4M1DL 4PJAB 3S96B 2MNWA 3U1QA 2NY1B 1ZTXH 3I74A 5AG9A 4BK5A 4ZPVB 4HKJA 4NJ9H 12E8L 1N3NB 3KJ4C 3ZMRA 2AXGB 2BNRD 1MPAL 3LSOA 3SBPA 1A4JB 2J56A 2WBJB 4DVRL 3VJ6B 2YPLB 1B2YA 2DN7A 2FD6L 1OW0A 2A83B 1CQKA 4KTGA 2IH1B 4BH7A 1FFOB 5C07D 2C7UB 3RTQD 4AEFA 2H32H 1FSKB 4HEPA 1TQBC 3ZKND 5IWLA 2JELL 3D1MC 4DUVA 3DURA 4F3FB 1MW3A 1NGYA 3P4OB 4IU3B 2FX9H 4MB5A 5DJXA 5HDWA 3PABA 4DGIL 2G75B 4U1NB 2EEXA 1DANT 2QVMA 1A7OL 1DQJB 4KJQD 3FOMA 1NUGA 5CJ5A 3V5DB 1I8IA 1KGCE 3FRPG 4GB9A 4K3EL 2BDNL 1XGPB 1OAQH 4M7LH 4RFNB 2RR3A 4XPGH 5EDXA 3BO8A 3FUFA 2X4QB 4U3SA 1PZSA 3BT0A 2VZOA 5CEXA 3T9WA 1QPXA 3PP4L 1ETB1 4KTYA 5DVLA 3FB7A 3MRBA 5AW2B 3U7WH 1J9SA 3NJVA 4ODBD 5KSBB 1BVLB 1KB5L 5C9JB 2NY5H 2DL9A 1T1WA 5J6HB 1RUPH 1Y0LB 4KJWD 4RIRB 4W6WB 3S88L 4HIEB 5EOCH 4EDWL 4X98A 4Z76A 1Z0NA 2BVQB 6PAZA 4NQTA 3K74B 2QPSA 2XV3A 5D1ZC 3CDZA 4ZTOH 1IL1A 3EG9B 4HIPA 4X7SL 4WUUD 3RIAF 3CVHA 4KVPA 2RCSH 2NY4C 4HJSA 1TU2B 1U41A 3TL5A 2CO1A 1E9OA 3EGSA 2PPDA 3QPKA 1RK1B 5HJDA 1XF1A 3WEAA 1MHPH 4HJJL 5LN8A 1GOGA 5T1LD 3KDMB 5C70A 3PS6A 4JK0D 2GJ6B 2WVVB 3HG1D 1BIIA 4ZYKB 5IQ7L 3PAZA 3H2WA 3EYOA 1NLBH 3VQMA 5C0FA 1FPTH 2B14A 3OAYH 1CUOA 3UOAB 5I16A 4G9FB 2VH5L 2LLGA 3OXSA 4FQQB 2HN7B 4MNGB 4UI2A 2YARA 5C97A 4PJGB 1GZQB 3MPCA 1WBZA 2XBTA 4NPYA 5JLZB 1JNLL 2A6DB 4FYQA 2QT6A 2B16A 1U0QA 3EJZC 2H2SC 2EYTA 2N0MA 5AKRA 2IBZY 4U6YB 5AB9A 3ZYIA 5DRZA 4DZ8B 2IBZX 1IKOP 1NAKH 5TTRA 5ABZA 3QARA 5JXAL 4KX8A 1BAWA 2XWXA 3ES6B 4TUJA 1MW0A 4WUKH 5HDRA 3FNKA 3GIVA 4P9MH 5DC0A 3AREA 3ZMEA 1NANH 5AZ2H 3ZHKA 3QNXA 3QR1A 4FP8H 2QSCH 4X8XA 3S0PA 2F19L 3MRCA 3WE6A 3IRZA 4XRCA 1W91A 1A7QL 4R3SA 2QZ5A 1N10A 5IP4A 2YA1A 2J8UF 1UD3A 3MOAL 4GLRH 2YR3A 4XWOD 2AXWA 2UZYB 1SF5A 5FYKH 3QO0B 3SE4A 5C0IB 4FCHA 3WN6A 2GHZA 2NCMA 5DVNA 4TLUA 5A2LH 5IVNA 4GS7B 1QD0A 1XGRB 3FONA 3PRZA 4G8FA 3D0VB 3KWTA 3TJHC 3CZJA 3V6BR 4HWNA 5J6GA 3ZKMD 1X3DA 2C4FT 2AQRA 4U2YA 5D9SB 1KBWA 1JZ2A 4MS8C 4FXGC 4MFHA 2EVGA 3BEWB 2J1ZA 4G7YH 1MFNA 2IADB 1BZ9B 4PP1D 1JPST 3QDGA 1R5WB 1NCBL 3D07A 4WU7A 3WAKA 1UZ8A 4JFFE 3JV0A 1T03H 1NM9A 5HDQL 1MIEH 3FXIC 2VH5H 4LDCA 1NCWL 3VCLB 3O6FC 3QQ9C 3E80A 1MCNA 5DK0A 4DPAX 4F2ME 5CBAB 3IPBA 1FFQA 4OM0L 1YMMD 1P84K 2V17H 1DQDL 2G2RB 2XA3A 3Q1SL 4GG6B 1QUNB 4PSRA 1QFWM 4XN4A 4X6FB 2BOLA 2EKSA 1RUKL 2HG5A 2R2EB 6PCYA 3AQZA 5DD1L 4Z7WB 3GSXB 2W9EL 1X5AA 4ZG1A 4BFGA 3B4NA 1ZXQA 5EEWA 3EDKA 5D71H 1KLFA 2O5XH 3BPCA 1HE8A 5GZOC 4ZMLA 1SRDA 4XMLL 4EIUA 3NCJH 2D03H 1I8LA 2V8MA 4PJEE 2R8SL 4PWIA 1LNUB 2PTTB 1N64H 1MFMA 3C5ZC 2X9ZA 4J2QA 3UP6A 3VXSD 2DF3A 2VIRB 5TH2B 3B9KA 5SX5K 3EO9H 3VFWB 3QUYB 1HOEA 1I8UA 2WN2A 4GO6B 1OGTA 1U3HA 1DBKL 3I9AA 4MJ5A 3UL4A 5KSUB 4XR8C 1VGEH 2FIRT 3PU7A 4H25A 4JPKL 5LDUA 3UROR 1NEZB 2YLHA 1KG0A 5J1SC 5HY9A 1DJWA 3D0LA 1WD9A 2Z1PA 2LOEA 4Z3EA 1IGJB 3P4MA 4HUUA 1WFIA 1LO4L 1A7RH 3QJHA 2IMMA 4XNZB 3VQLA 1CS6A 4RGOL 4WI0B 4A39A 1J12A 4O4YL 4OB5L 4BFFA 4FNRA 4DH2A 1NGPL 2V9RA 1OWRM 4QXWA 1I7ZB 3F7KA 3O6LL 2CMRL 1D5RA 4PLKC 5E1IA 2DOCA 5BZXA 1OZUA 4PJ9D 4L4VD 1F11B 4LHUD 3DMMA 2FGZA 4QI3A 5EZPA 1WIUA 3BUDA 1MREH 3QE5A 4DCQA 1F58L 4ZO9A 4EI5B 4OZHF 2CLZA 2VITA 4P3DB 4PJCA 2AGJL 4HZLB 4HOXA 5HP5A 4OZFH 3U2SA 1P4IL 3QJZA 5CWSA 4YLBA 3V6ZB 3CWGA 3O45A 3FQ4A 1NPJA 1TCRA 4LLMB 4YPJA 4Y16A 4IOIB 3NABH 1JGVH 1K6QH 1SY6H 3FSVA 2J2ZA 1DQIA 5AYUL 4AT6B 3DGDA 5T1KA 3ZPDA 4KO5A 4OJDH 1GGBH 4X7TA 3X3GL 2J21A 2ATKA 2VZ3A 3HE7D 3G04B 3QG7L 3RKPA 4CSTA 4KRPB 4YHKH 3JWOC 5AVUB 1OTUC 2F08A 1AD0B 1GPOL 4NXKA 3RVXC 1L9OA 1XB8A 3SDCB 1HQ4B 2ZOKB 1JJUA 4M62L 4NQXA 3DV4B 3QEQB 1PY9A 4QNPE 4JCLA 1X7QB 5HDBF 1JHLH 5F44A 1M7IA 3Q43A 1BJ1J 5E2JA 2MNJB 3VWJD 4WF7A 2GBUA 1UZ6F 4ERSL 1N6UA 3T2LA 4C56A 4N6RB 4NM4L 1SVZA 2GC4C 4QRRE 1T22A 2F7RA 3O3DB 4X4ME 4AYID 4FQCH 2FIKA 2OMVA 2AK1H 2HH0H 3QWOB 1BQLH 1BSIA 4J6RH 3QIBB 4AQ8C 3F2LA 4I3RH 5DMGC 1CFQA 2HFGH 3GHPA 4PJHE 5ADOH 2NT1A 4FNLL 2BY2A 1UD6A 2AEWA 1CU4L 3NPSC 3WGVB 2CK0H 2I07A 4TVPE 5D6DA 4F58L 3CD4A 2GVYA 2YEQA 1ZHKB 4HPYL 3ZDXB 1NEUA 1KBGH 2VNCA 2DYPB 4OD1L 3QEUA 2B59B 5HPMB 4XNUL 1QFWH 4PRBA 3V0FA 2UZIH 3LN9A 2YUXA 4BKSC 4ES8A 1HSAB 2WZ0A 4NYLA 3GSNB 4F9LC 4ZBJA 2X4RB 4P2QE 4FABH 2JKJA 3TLRA 2OMBA 3QPXH 4LCWD 5ETUB 1E6JL 3WNLA 5JIQA 3QG7H 2R7EA 4OCRH 2Q2EB 1OOWA 3BOVA 3L8QA 3MRKA 1YUHA 2NW2A 1WBXA 1L6XA 4XPBH 3FAXA 2Y6SD 1UD2A 2J6WA 3LVTA 3O3EA 4W9IC 3EJJX 1FRGL 2Q9OA 4EPSA 7CGTA 1R24B 3H7BB 5DC9B 1U3NA 3KWWB 5I1CH 3CZKA 3QZWA 1CICC 3ZTJG 2CM6A 5IT2L 1MWAA 4JO1L 5D7JB 3O11B 3AS1A 4Y1AD 3QIUB 4NQQA 4NZTL 4H13C 3PNRB 3ZQWA 2JJWA 4AY0A 1QZ1A 1TNMA 3KVPA 5J0BA 1BZEA 5JDJA 3B37A 4XNXL 4EIGB 3IB4A 1C1EH 1X5FA 5D96C 1B0GB 1YEWA 2MPVA 4WFFE 4I4WA 1WV7T 5JQIB 5FUOH 2VAAA 2BVPA 1ZIAA 2ICEA 2WB7A 4P8QA 3NK4A 5FO8A 2XWBA 1WZ1L 1QSFD 4EAEA 1D5BA 4F8QA 3VG0L 5BO0D 4JFZL 5JPNB 4TNFA 3O6KH 3EH4B 4HALA 3W9DB 1PF3A 5INCB 4L4TA 1J86A 4XNQB 3AC0A 1NEZG 1KB5B 3WJJC 4MHHG 5LBSL 4IK6A 4OZGF 3OKLA 1BYNA 4NUQA 1JSYA 3LVEA 3VU1A 4NFBA 3GXNA 5KANG 3IAGC 2EABA 1DJSA 2YGPA 4GBXA 2PR4H 4X6DB 4TUOB 1ZV2A 1ZVYA 4OR1A 3EYSL 5GRJL 2PNDA 1B6UA 1KPVB 4LT7A 4HOZA 2H3NA 2HLAA 1K8DA 2O61B 3MXWH 1MXDA 4OJCA 1KEMH 1MCJA 3TZVA 3A21A 1EDYA 1JXGA 1P7QA 1JGUL 2YQGA 5BNXD 4I85A 3N43B 2W8CA 3VMPA 4JY5H 1R5VA 3WI9A 4JB9H 2HJKB 3JZYA 4ODUA 1C7SA 2Q7AA 4LCCC 1I1AC 4ODXA 4NJAL 4QXUH 1IQWL 2WSDA 1EXHA 4JGUA 2WUCH 3IU3B 5EU3B 1U8IB 3V0WH 2PW1B 4FFYA 5T3ZD 3QA3B 4DGYH 3HFFA 5SV3A 1OQXA 4MAYC 4MZIA 5DEGA 3ARDD 3QDHA 1OSPH 2CR6A 4NO3B 2P8MB 4GQ9L 4AK2A 2VDKL 2AXFA 5IB5A 3OKOB 1IBFA 1YC8A 3MNVB 3Q6GH 4HCFA 4JE0A 4JQXC 2J88H 5CHNA 5F1IB 1P2CA 3CAFA 4IRZA 3L7FB 3QZPA 3GBNL 3K6DA 4MD0B 3F7YB 4TSAH 2YK1L 1KXHA 2DQJL 5ECJE 4PFEA 4Z23A 3WUZA 2UYLB 4OCLC 5D7IF 5DK2B 3LN5A 4X6CB 1U92A 4P46D 4FLSA 5DGQA 3GYRA 2ZZUT 1X9LA 2IQ9H 2FVNA 5F3BB 3RY6A 3UTSD 4ZX6A 3MLWH 4R7VA 4EN3B 1FO0H 3KXFE 4UU9A 1A9VA 1T66D 5ILTL 3FQ2A 2CUIA 3TNMA 2BK8A 2DQHH 4Y5XA 3JV4A 3QCTL 1E40A 1GW6A 3H9SB 1CZ8L 2IC2A 4GMSL 2M2DA 4JUTA 4H26B 3L5XL 3MTXA 4HHGA 5D2LE 4OJFL 2VZUA 1I1YA 2JWYA 1B4JH 1E9QB 3VACA 2O5YL 3VD0A 4U3HA 2LU7A 1GJWA 2VDOH 1KF9B 5C0AD 3F05A 2D31B 3RX5A 4F24A 4HCRH 3TA3C 2KERA 2P46B 4MLSA 4AKQA 1TJGL 2ITDB 3UBHA 2F8IA 5K69A 1GZPA 4LLYA 4M6OL 1FC1A 4KQ0A 1PTZA 5KJ4A 2F8OA 5EIVA 1QW9A 5EEXA 1RURH 4PTTB 1T04A 2FNWA 5CCKH 3BPLC 1UXWB 4KH2A 5LKNA 3D9AL 3FQUB 2WZAA 5DWUH 1F3JB 2VXTL 2DIAA 4L8DB 4L9LC 5EHFA 1QRKA 3G6JE 4GQ9H 4QRSA 3MCKA 2DQDH 1JV5A 3LB6D 3DSFH 2RTTA 3FFCA 5DTFB 4NQUA 2B1HL 4G70B 3VGDA 2GFBB 4NRZB 3ZR6A 4OIBA 3NP3A 4MTMA 3TIEA 4XBPA 3U7YH 3WXVH 2NXZC 1AQHA 1XAKA 4NC2B 4OKVB 2ICWJ 3D34A 2O5ZL 3GDCA 4W9GC 2DMGA 4JW3A 3EBGA 4LSUH 5EUOB 4KKAC 1DBMH 1QKZH 3OKDB 1MRDH 1KSRA 5F0JB 3S96A 3ZTNH 2NYYD 2OTPA 1XF5B 4LCUB 4ZPVA 5EFIA 1LO0H 4OH2A 2NY2B 1SPDA 2ZCHH 1N3NA 4GKLA 3QT2A 3T1FB 1HINL 2YZ8A 2CRZA 3CHOA 2AXGA 4G80B 5EOQL 3ROOB 2YXWA 1A4JA 3STLA 1ZPUA 1HI6B 5HGBB 3VJ6A 2ZICA 4FX5A 4G42B 5CINL 4PI0A 4BSVB 2A83A 4J1UB 2IH1A 1FFOA 2IGTA 5L2KE 2C7UA 4I2XB 4ONOA 4XCCL 4CNIB 4B53A 5E6SB 4G8GD 5HI3C 1JHTB 2A77H 4F3FA 2N0KA 4JY6A 2YMTA 2A2QT 2X89D 4QHLB 3P4OA 3QRGH 4U6HB 2G75A 3MDJA 3IJHB 1U2YA 1DQJA 1HHHA 1PVHA 1AZRA 1SZNA 1J0KA 2HG0A 2ICCA 4LARL 1E4WH 5ICUA 3V5DA 3NIDB 1XGPA 2Q86B 4FYSA 5E5MB 2V4LA 1XXFC 1KIPB 5F7KC 1O5PA 3MUGB 5B39B 2X4QA 2VXUL 4NHUB 1H6FA 1EFXA 1E4XI 5JPMC 3IJYB 2ZUUA 2ZF8A 4HC1L 3DVGA 1PZCA 3M46A 5T5NF 1TQCB 2OMUB 4EVNB 1B0WA 1HU8A 2IGLA 4NKOB 5F72S 5FC9A 1JNJA 2XQBH 5KSBA 1BVLA 4YXLH 3BVTA 5C9JA 2CO2A 1NCHA 3DPBA 1FBIL 5E8EB 2L7JA 3EJUA 5J6HA 1ZGLM 4L1HA 4RIRA 2DTML 4G7VL 2EIBA 4TPRL 4HIEA 2CD0A 3GHEH 5FIEA 5I1HH 2X1XR 5F9JA 4C47A 5I71C 4X5LA 2O6FA 2NY0B 3GSRB 3K2UH 3MACH 4ABWA 3TURA 2AQTA 3EG9A 1TXKA 4WNQB 3ZYJA 4QTHB 1KZYA 5HHXH 2QBWA 3WD5L 3U83A 4ZX4A 1Q9LA 1FYTD 1YY9D 1OGSA 1TU2A 3TO2B 3T8XB 2V7NB 3JVGC 3P0VL 1KCSL 4W9HC 5EZLB 5IHWA 1FLRH 1U8LB 4UM8A 2NSXA 3ARBD 3KDMA 4UT6H 5F8RC 4MVBC 5AZUA 1YEGL 2OL3A 2YD7A 4KBPA 4ZYKA 4JKMA 1T5KA 3GKWL 4L8BB 4P04A 5DMKB 5CGBA 3NA9L 4WQOA 3GLEA 4DPRA 2AITA 3EW3B 2F54D 3QPQD 2J1XA 4FQQA 4MNGA 1AQKH 3G08A 5K9QI 5MP6L 3DROB 1MFAL 4YXKL 1CO1A 1H5BC 3KM2A 4IHBA 1WIOA 1QBLH 2P8PA 4M6NH 4PJGA 1FORH 2B4CL 2A6DA 5KS9B 1E5AA 1QLRA 1XX9C 4NFCA 4AV4A 4IIQA 4U6YA 5TK4A 3OMNB 4JM4L 2VERN 2K7QA 4JN2B 5KUKA 3AS2A 1R9FA 4FFZL 2K6WA 1T4KA 3H7LA 3W2DH 5IEHB 3ALWA 3D51A 3RBGA 1MCHA 4B9GA 2P8LA 3RGVC 3I3BA 1UKQA 1V3LA 3TTSA 3WDJA 3LRMA 3V6OA 1IU1A 4JPVL 2EICA 4I1RA 3OJDB 5E7FA 5H94B 4MJ4A 1CLYH 4Z7OE 1YNLH 3K0YA 3O8XA 4PJEF 1HEHC 5CLZA 5EZIH 4D8OA 5FK9A 4PJ5D 1BOYA 5A2IH 4YUEL 1AXTH 5KVMC 2OYKA 2FWSA 1RK0A 5E94B 2XKSA 3HKZA 3RAJH 3DUSA 3QO0A 4BUQA 5DYOA 4FA6A 4HJEA 1SHWA 5B38B 2VN4A 1PW3A 4KKCD 1SMOA 3D39D 1VESA 3ZRSA 1XGRA 4TQIA 1S9WB 5H2BB 1X5XA 3RILA 5D1XB 2DEYX 2WLIB 4P05A 4S1SH 2DQTH 1DBJL 2J7LA 2Z0UA 2A6KA 1IZKA 5D9SA 3QFDB 5CU5A 4LDEB 3BEWA 4D9QD 2X0UA 3KPLA 1BZ9A 1R5WA 2IAMD 4GW4B 1ZA3B 4PJDB 5T8IA 1DLFH 5K5YA 1J10A 1XD0A 3WU1A 4QYOB 4XBEL 3VCLA 2Q3ZA 5LGJB 1FDLL 4NFDA 5CBAA 4JPIB 1KTRL 2WINB 2QPEB 1SEQL 2OZ4H 2X4PA 5EBWB 5F1NA 1AS8A 3U0WL 4TOYH 1S9XB 3K8MA 1GHFL 2G2RA 4M5TA 2HKFH 3GBML 4YHZL 3UG4A 5J13C 4X6FA 4JG1L 1XEDA 5EC2B 2R2EA 3OJVC 1XH3B 4OCMC 1FA4A 4Z7WA 3ML9A 4M8VA 4JHBA 4F7CB 1BXXA 1RKRA 1EPFA 1WICA 2AEQH 4G6FB 2QDWA 3QXDA 2WYZA 3FQTA 1UWXK 3O2WL 3FB8B 3VI4B 2P5ED 3IDYB 1R46A 3H42L 4XMVA 2PTTA 2E27L 3KGRA 3O2DL 3FUNA 4ZK8A 2VIRA 4NN7B 3QUYA 2PYEB 1DVXA 3GNML 1NCAH 2R0WL 1HCFX 2E46A 1RUQL 1OY3B 2WKOA 5KSUA 4OZ4B 3OSVA 3LS4L 1C7TA 1NJ9A 2Y25A 4O5LL 2BNQB 2JJTC 4QNPF 4YC2C 2P5WD 1KTLB 3D4ZA 1KEGL 2ZUQC 1TEGA 2DZEA 3KL3A 2Z31B 3B2VL 5EBMB 3NRQA 1KT2B 2FUTA 3MYJB 4UB0H 4JFHD 5EORL 5D4IA 4GRWE 1GS6X 2K78A 3EH3B 3FN3A 4WI0A 1LEKA 2APVA 4FQ2H 2WXJA 5LHDA 4M00A 4A7QA 1WHOA 4P5TB 4QOKD 4KKLC 1HWGB 1UTDA 1E4JA 4PJHF 2XT1B 1F11A 2VDKB 4K9JA 2IOIA 2F6AA 1X9UA 4Y4KC 2FEDC 4MD5B 3VE0B 1AIFB 2HZHA 4EI5A 1FF5A 4P3DA 3LNHA 5MENA 4RGMB 1UASA 4HZLA 4U1JB 3N2JA 3S34H 1OCOB 4E41B 5JA9A 4LCIH 5I2IB 4F8NA 4LLMA 3ZDWA 3BZFB 2W0FB 2WKLA 4IOIA 4AT6A 4XPHH 1WCBB 4K94H 2G0KA 3CLFH 2E56A 4IJ3C 3PJSB 5IHZA 1HDMB 2WXGA 4TMPA 4JZOB 4KXZI 2XTJB 1A21A 1AGEB 2PO6C 4L3CB 2IDUA 4GP4B 3TGXA 4X4XB 1TQWA 3FN0H 5DUMH 5I18L 4TSCL 1IT9L 4X8JA 1ANUA 4HJTA 1SNRA 1HCZA 1YAIA 1KGCD 4XVJL 5C0DB 1ILSA 2ZOKA 2XBZA 2B1AL 2VSKB 3QEQA 2GIMA 4WY7H 1N0LB 1X7QA 1OK8A 1XH0A 1IVTA 1KEGH 3MA7B 1K8IB 4BHUI 2WIIB 4FQLH 4J6IA 4N6RA 1OP3H 5B1JC 5E2WL 5A2JH 1C8QA 1BCIA 3QHFH 2FK9A 1BA9A 4U1HB 3U0PA 3QIWD 1NCCL 2X05A 4MJJA 3QWOA 5IB2B 4KHXH 3I3DA 4JN1H 4M8UA 1RZKH 4X7EC 4P9HL 2P26A 3QIBA 4XWGH 3MLXH 3OXRA 1U21A 3F5WA 1NANI 5TF1L 1TSRA 4JPWH 1S7TB 3BP7B 4N22A 3UMTA 1QSZA 1JTOA 5F7UA 2WCSA 4GYBA 5CMAB 3VFGL 5DHVH 4ZMPA 1BAFL 1XBDA 1L7IL 1E8YA 2EECA 1HXMB 1V10A 2VDML 3EYQC 1UB5B 2VZVA 4MAUH 1QZNA 5C6WH 1I7RB 2F0CA 2XIBA 4R97B 4GLRI 5B38G 1VF5C 2VOTA 5DUPH 3HI6H 2WGNB 2W0PA 2XA8L 4XTRC 2B59A 3D3VA 4DKFL 2CBTA 2ZQKA 1HSAA 4DO4A 3GZKA 4OI7A 4JQVC 2AQ1A 3QWQB 1Q9KB 3GSNA 3OM3B 3EJQA 2X4RA 2V7HB 3CE1A 3HKFA 3J27A 4PJBB 1EERB 1L9MA 3APMA 5ETUA 1XGTA 1N5YH 2HA1A 4R4ND 2B20A 3IFOB 3FCUB 5B1BB 3KLDA 2CXKA 2PMZA 3DNKA 3GUFA 2G0LA 3GFUA 1NMBL 3TYFB 5FV1L 2WXQA 1PG7W 3IMVA 4UYQA 4HJUA 2B1AH 1EV2E 1U8CB 3C09C 5F7LB 5L4MA 1LE9B 3H7BA 3K72B 3KWWA 2NUTB 3BGMB 3LJ3A 3LX9A 4LB8A 5CGYD 2MPAH 5D7JA 4BFIB 1GGCL 1KFAH 2R59A 3ARRA 3O11A 3QIUA 2YZ1A 3FS9A 1MI5A 1WIPA 5I23A 1IGYB 5GHWL 5HI4C 1E90A 4YGVB 1OO2A 1QQDA 5IMOA 3FMGH 5CCHE 3IXTB 4LXFA 2IANB 4N2AA 4MLIA 1KLUB 2I25N 3UGUA 1KZQA 3V6FB 3MRHB 1G7LB 2Z7ZA 5TF1H 4Y9FA 1B0GA 5HYJB 3QDGE 4BHUA 4EQ3A 1JN6B 3J2PA 4KY2A 2GSGA 1JV2B 3DBXB 2Z7UA 3FO0L 1MRCL 5IQMA 3HC3L 15C8L 3T2OA 3UYOD 4Q4IA 2NR6D 1U93A 3W9DA 1E2WA 3HRPA 5GJTH 1RZFL 1UATA 2XNAA 2EEFA 3KCWA 1DBBH 3OKNB 4LDLB 5JHMA 1KB5A 3W81A 3BXNB 3HS0C 3US9A 2K6YA 1D9KC 3D85A 5AW5B 3U4BL 2VMCA 4CL7A 3AQYA 4X6DA 3VFRB 1S7QB 4LCYB 3UYRH 1KPVA 3ZKQD 1FHNA 1DLHB 3F7PC 3KD4A 2O61A 1TVHB 1EX0A 1OTTD 2DTSA 4UT9L 3W0WB 3CVIH 4CMHC 1BHGA 2R1XB 2HJKA 4FI8A 4KNUA 2Y5QA 4OI9A 4Y9CA 4H8HA 4EIZC 1ZKAA 3IU3A 4JG9A 5EU3A 1I9EA 2QVFB 1U8QB 1ZT4B 3BN3B 4OLVL 4U1LB 3QA3A 4ONFH 4DZBA 3G5YB 1FGNL 3KCPB 3ZE2E 1TYRA 4IU2B 3NCMA 1EAQA 2EDFA 3ARUA 3G6JF 4KI1A 4NO3A 4TUUA 1WZKA 3NN8B 2HT2D 1IAIM 3L2LA 2CHWA 2VDQL 2Y06L 3D30A 3MNVA 4YSEA 1V05A 3M8OL 4KK6C 2BHYA 2IOMA 1G9EA 3P4LA 3T5WA 2JH2A 4AL8C 3L7FA 1A6WH 3GS4A 1T20B 1P7BA 4ZOBA 4NNPH 3F7YA 5BS0B 1FVEB 3V0DA 2ETWA 5I0XA 3OBAA 5E2TL 4AJYV 3BWUC 3OG6B 4X6EB 5DK2A 5KYWB 4XP1H 1GC1L 4X6CA 1TNNA 5BVPH 1XIWC 25C8H 2BNRB 2ZOUA 4A67A 4P23D 3IDXH 4E9QA 1JRHH 5F3BA 4XX1G 5HD8D 1CDUA 1NIBA 3ESVF 1KWGA 4JGJA 4PJCE 5C07B 3RTQB 3U0TB 5T3XD 4OQTL 1UEMA 5E6UB 4DFIA 2E3VA 2W95A 3FYEB 1T0MA 4N0FB 1E9QA 1V7ML 4DP9X 1MG3C 1O9WA 1H9DA 1KYFA 3WMSA 3HS9A 4GP8B 1UOVA 1FZOB 3P30L 2Z92B 1IC4L 3LQZB 3CFCL 1TJHL 4P06A 4N26A 2OR8A 1MCOL 3E1F1 1JGEA 2QKIC 2C1PA 4ZMNA 2D3LA 3D4CA 2I60L 4QTFA 1A6UH 2ITDA 3FSAA 2HTKC 5PCYA 2EDNA 1UT1A 2FE0A 4JQIL 3RFRA 1XH1A 1SBBA 2BZCA 1HKLL 3EBHA 3KYMA 4KZDH 1X6NA 4PTTA 1HHGB 2P3YA 3OAUL 4MYWB 1UXWA 3FU9A 4AQEB 1CD0A 1ECZA 1D5XA 2QEJA 1G9MC 1F3JA 1AZBA 3QWRD 2V2TA 2EAEA 2ICWB 3I2CH 2RH0A 1KN4H 4RMSA 4KJYA 2K8MA 1QBML 3L13A 4JY4A 1U8KB 2ISDA 3FUHA 4ANUA 4C56E 1NFKA 1LGVA 4G1MB 5L2JB 5C0JA 3B9DA 3UGXA 4U1IB 1JZ7A 4NRZA 2FLMA 5IR1B 1OAKL 3K5SA 1QFWI 3ULUC 3IMRA 4HFWB 4WW1B 3MGOB 4X7DC 1E3FA 2HT4D 1IIIA 4OM1L 4OKVA 2ZOTA 4WUUB 1GJIA 2I27N 3LH8A 3RDTC 5CEZH 1EMTL 4OZFA 2MSPA 2OW7A 1FAIL 1YLBB 1MZZA 2H1LM 2J1YA 3P77A 1F0LA 4LCUA 4Y4HC 5IEKB 5CIPA 2BH0A 5T3ZL 2JJSA 4ZTPL 5GGQL 3HG1B 1Z9SB 4QRRD 1UA3A 5KVFL 1HI6A 5HGBA 3WFZA 1E4KA 5GZND 2XG5B 4LKXB 4ORZC 35C8H 1WWWX 3ULVD 1SQ2N 1SJVA 2H3XC 5C2BL 4CNIA 3BUYB 4CRPA 4XN9A 1ASQA 3MRGA 4NGHL 1O9ZA 2BINA 2R4SH 3PV7A 1RXLA 2B9AA 4U6HA 4OFIA 5MHSE 3LD8C 3QORD 4TVPD 5FM5M 5IROD 2OMTB 2IG2H 1B9KA 3K1KC 5AWNH 4EZLA 4X5WB 1FZMA 3SGEH 3TVMD 5E5MA 1KIPA 4Q56A 2PXYC 5B39A 1RJYB 1ACYH 3OB0K 2EVHA 1SM3H 5F7DB 4P2AA 2KL6A 4F57H 4UQ3A 3IJYA 1KJMB 4FHJA 2NYKA 1G7JB 3BT2L 4EVNA 4CA4A 4NKOA 1TTBA 4FXKB 4P2QD 3T4YB 5IQ9B 1IAIH 1U8JB 4L8CA 1T89A 2QFPA 3R1GH 4HXBL 5E8EA 1NSNL 4Z7OF 3EGDB 3EDJA 3D2UD 4UZUA 2PPCA 3O4OB 2RFXB 3S36X 5CBEB 3SQOL 3UC0L 5T1DL 2O4EA 1JUFB 3GSRA 3MFGB 4JGMA 1SDAB 4J3XA 2VLME 3JWDL 1UHVA 2R29L 4WNQA 4L4TE 2XKNB 3LPOA 5FHAH 4JM2C 3MBEC 4QTHA 4E9XA 1D2OA 1JZFA 1VJSA 1DN0B 3TCLB 2OK0L 4JFDA 4JO3L 4RQQB 3K6SB 2EC9U 2V8LA 3L5IA 3T8XA 3ZN6A 4R5XA 4MS6A 4G11A 5SX4H 5EZLA 3ZRCC 4CN4A 1WT5A 4YSUA 5DA0B 1U8LA 5A3ID 4YMPA 4A7VA 3WJLA 4M93C 5TE4L 1BQUA 2XIDA 4WFFD 1YCSA 3DX2A 1PZBA 2FSEA 2VAJA 4Q9RH 2BSRA 1SUJA 2ADFH 5BZDA 1PD6A 4L8BA 2P52A 3BYYA 4Z7QB 3UP1A 3DSNB 4MJ6B 2FR4A 3DROA 2QQNL 2EE3A 4I0PD 4LIQH 4LAJH 3N0AA 2OR9L 1KGWA 4Q6YA 3BQUC 5KS9A 2GSMB 4YIQA 1CURA 2D4DA 3NSYA 4GKSA 4LLWA 5ID0A 4F9PC 3HMWH 4JN2A 1T1YB 4MX7A 1FCGA 3VB8A 5IEHA 3CFUA 3DDGA 5EUKB 1CI5A 3WN5B 3VXSB 5EU4B 3L9YA 1VEMA 3AVEA 2VDMB 2VWEE 3BVUA 3NH7H 1IGTB 5H94A 3OJDA 4AC4A 5IBTL 3VI3B 4PSPA 3C8KB 1G9NH 2FT6A 2I5YL 2IBGA 4B9FA 4QEGA 2VMFA 4HP5A 2DWTA 2QADD 1ORSB 2RBLA 1PPIA 4BV1A 4PWJA 4P5KB 4R90L 5E94A 2AAVA 4G8AC 1WZAA 4X4YB 5H4ZA 4XXDB 1K9TA 5EU5B 5IVXA 4M7ZB 3EYVB 1GOHA 5B38A 3MJGX 1N5AB 4FZ8L 2OMXB 1S6NA 3VFOB 3VFMB 2MQ0A 3F7VB 2CCWA 4V1DD 1DP0A 5KSVB 2NTFB 2EZ0D 2G4EA 4ZX3A 5KBDA 3FT4B 1EEZB 2WN3A 1KFGA 4GRWF 3QFDA 4PJ9B 4L4VB 4XAWL 2WYTA 4IYKA 4LHUB 3V4PB 4PGDB 1KYDA 4MDIB 3S5LB 5IB1B 1DJXA 1VHPA 1ZA3A 4GW4A 3NACH 3NSCA 4JZNA 4QYOA 1JPGB 3NJLA 3M1BB 1AGFB 3MLZH 3QDJB 5LGJA 2R2BB 4TXVB 2HFFB 2R4RH 3LRSA 4W4OC 5BRZA 4JPIA 2WWNA 1DUZB 2WINA 2X88A 4ISVB 5EBWA 3ZSTA 4CVXB 1A3RH 3NSXA 1YEKL 3KXFD 4APQC 1S9XA 4N2GA 4J3OH 3S48A 3TV8A 5TJWK 1U2CA 5F1SA 5DJAB 5EC2A 5K1VA 1XH3A 1YEJH 5CLWA 2IALB 5D8JH 4F7CA 1C16A 1LEGB 3FFCE 1U8MB 2BIIA 3HE7B 4K8RH 4UOW1 3TJEH 5BW7C 1SXAA 5LCVL 1H3WM 4X99A 1CBVH 2Q6WB 4F8LA 2EKJA 5ANMB 3VI4A 1GGYA 5IUCA 2RIKA 3HC0B 1J8RA 2JKSA 5LBSA 1L5GA 3HAEB 1EDHA 1T1XB 3FF7A 2PYEA 3S5YA 3BKJL 3C08L 1G7QB 1R33A 2KQMA 3N91A 4BIKA 4H7VA 3JYCA 3HNTL 5I73C 1CYGA 2BNQA 1KTLA 4BK8A 4GMTH 2X5PA 1P4LB 3ARFC 5EBMA 2DM2A 1KT2A 4HCRA 4LRIA 3SDXA 4DAGL 4PLJD 3AY4A 3OAZK 3PV6A 3KHQA 4XNBA 4EKJA 1KLGB 3CBRA 1J48A 5E00B 3ARSA 3QNZB 1HVXA 4P5TA 1NCGA 3QHTC 3S7GA 2E6QA 1F6LL 1QYGL 2YJQA 3ZIMA 1NMCB 1RJLB 4D9LL 2BSCA 2IGFH 2VDQB 3DJSA 3L3DA 4YQXH 3V4UL 5GXBB 3RL1B 4MD5A 3VE0A 1AIFA 2R0KL 4XC3L 2I9TB 1A4KB 3LPWA 2JXMB 2CLVB 4I0KA 4U1JA 5LWYH 4GXUM 1HH6B 4E41A 4BEIA 4UM9A 3HVDA 4YDKH 4LCWB 5I2IA 3IN2A 4P4KD 1E2ZA 2C9SA 3R4RA 3LZQA 1QSVA 2W0FA 4YFDB 1MAJA 2DAVA 1WCBA 4G6AD 2F5BL 1DBAH 1Q1PA 4CMMB 3PJSA 5KSBE 1IJNA 4QHKI 1HDMA 5C0BB 4HETA 2M8XA 2YPKA 4JZOA 5GGRB 3HE6D 4L3CA 4UDTB 5GS0L 4UAOB 3ZXAC 4X4XA 5F3HB 3LKQB 4JKLA 4M5ZL 5AW3B 4GI6A 4KRNA 4ZD3L 3WKMH 4AYBA 2EUVA 4I3GA 1Q38A 3BSZL 2BIOA 4UV4H 4MA3B 4ACTA 2BP5M 4Y1AB 5C0DA 2FHBA 4K2UH 1PEZA 1FQ9C 3ABGA 3L16A 4DHLA 3S2CA 1VKXB 3EHBC 4XMZA 3U2IA 1QWHA 4Z8FH 4MWFA 5CZXD 3WFCH 1K8IA 1RZ8B 2WIIA 1Z9NA 5DS1A 4ODSH 3ZKXC 5GRVL 3VFTB 4DW2H 1MHEB 2X2JA 3MREB 4U1HA 3G5VB 1SFDA 1R47A 2GK2A 3GEWB 4JZJC 2O6CA 4XB3A 4BE5A 1QSFB 4D0CB 2HMIC 3VRLE 3O0RH 32C2B 1TETL 4WFEE 5L6YL 1S7TA 5LGHL 3WLBB 1G94A 1YECH 4J4PA 1P7KB 5CMAA 5EO0B 1V3JA 2A7BA 4MA7H 4MNGE 1RSYA 2L04A 5DD5H 1UJTA 2L7EA 1MDAA 1UB5A 4HMDA 4PJGE 5FM8A 5KTEH 1I7RA 2CUAA 2ZUYA 3SDAA 3FH8A 1Z2KA 1MSPA 3F7RA 2E9IA 2WPGA 4UDUB 1PMYA 3UTTA 1OLLA 2Q7NA 3V0EA 2EDXA 5KYYB 4POZC 1LDPH 1MCDA 5DEFA 5JQ6L 2J73A 2HLFC 2DDQH 1Q9KA 1AFVH 5BQ7B 1U95B 1R5IB 4LHUG 3V6OE 2V7HA 3RNQB 3WUWG 2UXTA 4LVOB 4PJBA 1RIHL 2EYSA 3QUKB 4A2MA 2QLYA 1UOWA 5C0EB 5JIHA 5I5RA 1DE4B 1YEEH 5CS7A 3D08A 1CL7L 1NAMH 2WWOA 1SLUA 4N1EA 3TYFA 5F9WB 1URLA 1YEDB 4FQXD 4IRSC 3V0IA 1A7NH 3WTWA 3OC5A 3GUTB 4I9WE 3V5HA 4K9EC 3K72A 2H4EA 4X7FC 3BGMA 5I17B 3GRBA 4DWHA 4BFIA 1WE5A 1MNUL 3ZE2F 2IPTH 2YXMA 2VE6B 1VZIA 5DD3H 3RVXD 3HN8A 4UTBL 5EEVA 1MCWM 1IGYA 5IJDC 5D5MB 3ARGA 1F97A 2J8UB 4YGVA 5GIRB 5I8KH 3KDPB 3IXTA 1OCRB 2IANA 2OCFD 5LQBL 4RVBA 1KLUA 3MRHA 1G7LA 5HYJA 4P46B 4AGQA 3IE9A 1JN6A 3N1MC 2FTAA 3KVQA 3CCHB 5JO5B 3UTSB 3MRQB 1MCWW 3T2NL 3ECVA 4S1DC 1F8TL 3DBXA 3HAEG 1FG2B 4GSDH 1Z1WA 2QQKH 4HC1A 3I6KB 5TDOB 4JRLA 5IMKB 3BIKB 5IMLB 2Z4QB 3OKNA 4YHLL 3ATBA 4B7LA 1IGFH 3PXHA 3BXNA 3NFNA 4PJCF 3SHSA 3IEAA 4Z7WE 3N9GL 1S2EA 2XRAH 5C0AB 5KW9H 4G6MH 1OALA 4PVMA 3ZO0A 3AWEA 1FWXA 1ZY9A 5F96H 1OP5H 4EJ1C 5HVGB 3MLYH 3L9RA 2CQVA 1DLHA 3OC8A 4PCSA 4AEHH 1JGLL 1MVFA 3DIDA 5IHUH 2XVLA 5D70H 4GAGL 3QFGA 4LK4A 1AG6A 4MXWL 5ALBL 4NN5C 1A9BA 5BQDA 4ABQA 5KVEL 1JD9A 2PWEA 1VFAB 3QUXC 2ENSA 1U8QA 1ZT4A 2K3HA 3AGWA 4U1LA 5C6TH 3P69A 3ZZ1A 5AVQB 4L05A 1T83A 1G7IB 2GY7B 4IU2A 1NPUA 1XF4A 1MW1A 1II4E 3GJEB 5LG1A 1W72H 3SKUD 1NBYB 2XXGA 4R26H 5I6XB 5KEZA 4HIIA 4U05A 2D2CC 2DIBA 4J28A 4UMGA 4QGYA 4ZNEA 4X6BB 1R3IH 4JPSA 3LYRA 2AQNA 1FVEA 4BFEA 1QI3A 3FRUB 5B3JE 4XCFL 2GHWB 1HWHB 1PL3A 2AZAA 1I7TB 3ETBF 1OGAB 4J3SA 3WFBL 2CO3A 4FFZA 2BIMA 4TN9A 1SVBA 3BLPX 4ZW7A 4HK0B 3PL6C 3T6QC 2P24B 3A6OA 2WXLA 5MENE 1TJMA 2X3BA 1YEHL 3CFNA 4IOSD 1EA9C 3U0TA 2JCCA 2EVIA 4ZDHA 4OGQC 4KKNA 1A7PL 3DIVA 4G8GB 3TEUA 3UBFA 3VXTB 4WEMB 2JTDA 2FEEL 1YNKH 4U6VH 4Y7OC 1M7DB 4U3XA 4GY4A 2ZYIA 5C86A 2CKNA 1FZKB 4FLOA 5JXEC 1FZOA 2FH8A 2Z92A 4PUBL 1J0ZA 1MRFL 1JTPA 4KPHH 4PB0L 3SYQA 3IJ8A 4PG2C 1YYLL 1ZT7A 4XNMB 4K07A 3JWNG 3KGSA 2C9XA 1C5BL 4U1SB 1HHGA 2VUYA 3QEQE 4J27A 3RI5K 2OXHB 4KTEL 5F7BA 3DX8B 4O02H 4LASL 4DP1X 2LT9A 1E4HA 3G5XA 4ZXBC 4BK5C 5E2UL 1YQVH 2E74C 4G1MA 1ZDQA 4OV6F 4U1IA 2NSQA 5IR1A 3PQYD 3H8NA 3FT2B 5IESL 4KROC 3CX2A 4HFWA 3ZZSA 4GO8A 4WUUA 1BQSA 4L1TA 1ET7A 3N40F 2ZE0A 3GQFA 1ZA6A 3NQIA 4YHMH 1PIGA 1D6EB 1WFNA 1JF1B 1FYTB 2BSSB 2A6JA 2Y23A 1G7HA 1L3NA 1X5JA 1T7WA 3EZ8A 4HBQA 2BPBA 2ZT9C 1FFNA 4OKDA 1JZ4A 2VSDA 4YDJA 4EI6B 3ARBB 5E99H 1KOAA 2J43A 5CF3A 1QO3B 2BFVL 1Z9SA 3O2DA 4KK8D 1H3TA 3D3VE 4TSBL 3NESA 2YLKA 2JKTM 4NBXB 3BUBA 4OTXL 2VDLL 4LKXA 3OHXA 2F54B 1SLVA 3RIFK 1Z6JT 2CG9X 2XVBA 3BUYA 3P9LA 1GCFA 4PV9B 4A6YH 4ACPA 5I8OH 3K91A 3BCDA 1H8SA 1MAML 4CSPA 1MJUH 5FO9B 4A37A 2QMKA 4ZSOB 1BQHA 4JAMB 3E8UH 3AXLB