4PHXA

Crystal structure of aggb, the minor subunit of aggregative adherence fimbriae type i from the escherichia coli o4h104
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
133
Chain Sequence
AEITLISHTGSQLRDGMKLATGRIACREPHDGFHIWINASQNGKVGHYIVQNNRHELKVKIGGGGWSSSLIEGQRGVYRQGEEKQAIFDIMSDGNQYSAPGEYIFSVSGECLISRQALERPPIKATETIRLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AggB
publication title Structural Insight into Host Recognition by Aggregative Adherence Fimbriae of Enteroaggregative Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 27
structure length 133
sequence length 142
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4phxA00
4OR1A 2CO3A 4PHXA 3UIZA 2CO6A 5D55A 2CO2A 2AXWA 3UIYA 2CNZA 2CO7A 2FVNA 2CO4A 2CO1A 2CNYA 2IXQA
chains in the Genus database with same CATH superfamily
2J88L 1J8KA 5GS0H 5AYUH 3IXTB 4NENB 1RUPH 4J7RA 3WEBA 5LN8A 5GSRA 1KYDA 4NNYA 4WO4A 5GZOA 3SDCD 1FO0L 1UOVA 2C3VB 2CWRA 3LRKA 2VDNL 3L5HA 4PJBA 4G8GA 4PJ9D 1MJUL 2YEZA 2FO1A 1S7UB 2Z31D 1FVEA 2ENYA 2D4DA 3FYEB 4S1SH 1KB9J 3JWDL 2AKRA 4OFQA 3M46A 1NSNL 5DHXB 5ELIA 1CLCA 1AKJB 2A73B 1DVXA 1IC1A 4H5SA 4RGOH 1GJIA 1J1OH 2I5YL 2IQ9H 1UCBL 3EDJA 4FQIH 5EU6A 1QBMH 3IFNL 4FI8A 3RGBA 3FBKA 4Z0XB 1MHEA 1BQHA 3OJDA 4JFUA 1FNSL 2TAAA 3C6EA 5JDJA 1GHFH 4I0PD 4JMNA 5IESL 4AEIL 2HJFB 2FO4B 1SY6L 3E2HC 2EIMB 3QZWB 4AC4A 4BE6A 5TFSL 1HCFX 1QTYT 3I74A 4GEJA 2ZWYA 2BSDA 3GMNA 5AALA 4LSPL 3WNMA 2DL9A 3QT2A 3X3FH 3LKNA 1FYTA 1BMGA 2IQAA 3S97C 3IS0X 3ZDYB 4HOMA 1SQ2N 1OAYL 1WAPA 5GIRA 4G72B 1T1WA 4ZODA 4U7KA 3IDXH 2Y9RT 5A6MA 4NQSB 3HRZA 5KOVC 3HPLA 4OCWL 4GRLD 3CFKB 2FWLB 4PLJD 4A7SA 3U7YL 2AJVL 3GXUB 3P2BA 4YFLI 2XTJD 1N10A 2F8VA 4XPAH 5IB1A 4EIBA 2OMVB 2ZWZA 4K23H 3U4KA 4AL8L 2J72A 4LLYA 3PABA 1WBYB 4PY8J 4F7MB 1AMXA 2QV2A 4U7MA 4EI5C 4I18B 1GPOL 4G59C 4C8XA 4FZ8L 1GOHA 1I4FA 4JFPB 4L4VE 4NNPH 5AG8A 1I8IB 2ZG2A 4XWGL 4P46D 2E6JA 3FU8A 4IMLB 1F1AA 5KBKA 4WHYG 3GEFA 5C0RL 1KDIA 2WO2B 1ZA3B 5KSAA 3M1BB 1Y6NR 1NC2D 3TIEB 3A5VA 5JPMA 3KJ4B 3T9WA 3VFWA 3MA9H 2R83A 3U30C 4RMSA 1T21A 2DJUA 3IDIB 4CVZB 1DEDA 3P0GB 5DU7A 1THAA 5FM5M 5FYJL 1CLYL 3K1KC 1ZWIB 5H37H 4LSQL 5ACLA 1HE8A 1COBA 3N55A 1IAIM 1K8IB 4GRWH 3WHXB 2MPAH 3L3HB 1MXGA 4GAGL 5E6IC 2VUKA 4RGMC 2OTUB 4KRMB 1U2HA 5GS0L 3GSQB 2JCWA 3LN5A 5AYUL 5KZCD 4R2GB 1CE6A 3D3VD 1RUPL 4M61A 4P4RB 4ZMXA 5BUAA 1G5AA 4JKNA 5KAQG 3STLB 4AJVA 1HSBB 4MYPA 3WIHH 2X9ZA 2F54D 1F41A 1FLRH 4Y5YC 5IM7A 1P4BH 3OAWA 3DDFA 3AM8C 3V4VH 5EHFA 4S1SL 5EF0A 1USQA 3SYPA 1T1YB 3C5XA 4I3RH 3WUWG 1EGJA 1U8NA 4OAWA 3VI4A 5HJDA 3EDDA 4RGOL 4N1CA 5IQLA 2YHGA 2VZ3A 4HUWB 5BMFL 4CJ0A 1FFPB 3MTXA 1MJJB 4S1DC 1KCKA 3OAUH 4FQIL 3GS4A 3BVNB 2J5LB 5I1JH 5EU3B 4FJZA 3RKDD 1WAAF 1OSPL 3MV9B 4YBQD 4RNRB 2BY3A 3L4CA 1BXXA 4HMCA 2DIBA 4OZ4A 4F27A 3DUSB 3VG9C 3K80A 1QO3A 4HULB 2G4GA 5A7EA 5IB3A 5JHDB 3ULUE 1BVKA 3ARYA 4MZ3A 4D8PB 3H6AA 4N90D 5BZDA 1AXTH 1W0WA 4AGPA 3EYVA 5DO2D 3ZN6A 4IJ3C 2BNQB 3S4SB 3O2DA 2X1OA 5GGSY 3W3BA 1IKNA 1D3CA 3TYFB 2KC0A 5C2BH 3EH5B 1JDAA 3ZDWA 5HHOE 4IRJD 5IEKA 1IM3B 1Z9LA 1ZDQA 3S36L 2HVKA 3ALWA 4Z18A 1AXSA 4K23L 1YPZE 3QEUA 4DEPC 3AWGA 1CFNB 2CJSA 4PP1D 4UBDC 1JV2B 1QBBA 3BGFC 4L37A 5BXFB 2AVGA 1PX3A 5CEZD 3JWNC 3L6FA 4NNPL 4NUMA 5GRZA 2W65B 3BZ4B 2DQ6A 3PFQA 4HJGB 3TT1L 4N0FA 1ES0A 4M5SA 5GGUA 5FO7A 3C75A 3LVEA 1L9SA 4HKZB 4YDMA 5EBWB 5E00B 2NX5A 4IYKA 4EI6A 5ITBH 2XIBA 4WFGE 4ABUA 2PYEE 1W0VB 5IHLB 3HR5A 2BC4A 4FXLA 1FCGA 1U58A 2AQ3A 4ZQKA 3D50A 1WISA 4UQEA 1AGEB 3B7UX 1F11B 2P28B 2ICWJ 4OZHB 1CGSH 3ZHLA 1W16A 4HH9B 4X8JA 3ILPB 4PRPB 1IZJA 3FPYA 1ZT7B 3KW7A 1I85A 1NCIA 2CMRH 2HVJB 5IMKA 1A22B 2MPAL 1M71B 4PJHB 3TONA 5KAQF 1JWMA 1S9YB 3DOSA 4OQTH 4MAYB 5B8CB 1XH1A 4LLQB 4NYLA 4H8UA 3VMOA 2IH3A 3P40A 2EYTA 3QR1A 2XNAB 3BWUC 4HFWA 3M7OA 2A6DB 1ND0A 2ADFH 5I5IA 3T77A 1N2RB 3VH8A 4AEHH 2WYHA 3V8CA 3WIHL 2IAMB 2WXNA 3EZJB 1WT5C 5F7KC 1FLRL 1P4BL 2WWMD 4AM0B 2AQTA 3MRRA 4FI7A 1TKWA 4TKWA 4K7FA 5TDNA 3V4VL 2NZ9D 4I3RL 1DDHA 4LLMB 4AT6B 4JNXA 1KIQB 3W11D 5DEGB 4ALAC 1I8KA 2XBZA 1D5XA 3T2LA 1JF6A 1BOGA 5D7LD 5E8DH 2FIRT 5J11B 2AJ3B 3OAUL 3LEXA 4NZRH 3FJTA 1HL4A 3DGDA 3LEYH 4YZFE 3ARVA 3WTWA 4L3CB 1P53A 3BHBA 4HZ1A 3HMXH 5EN3A 5D7IA 1ORQB 4ANXA 5EO1A 1RFDH 3V6FA 1KB5L 5ICZA 5JORB 1HDMA 3CFNA 2R1XB 3JWDC 2NY5H 4M7KH 4OZFA 2DWYA 3KM1A 4QLRA 1UHVA 4KKLC 4Z7UA 3ZDYE 1VZIA 3D39D 2IXQA 1IARB 1AXTL 2H4EA 1E9PB 1NAKH 4OZGA 1XH2A 1Z9SB 4ICWA 2BSBA 1MY7A 1WA2X 3VACA 1B9ZA 1WD9A 4O51A 3FKUS 4HWBH 5E1IA 2QQQA 4N2CA 2HJLB 4LLVB 4ZW3A 1DANT 5C2BL 4F9LC 4FF9A 1VIWA 4U1LA 2YPLA 1ED3B 4WKZB 3S7GA 1AGDB 2L04A 2SODB 3ARGC 2AZAA 3MNVA 3OMNB 1SMOA 1DBAH 4IRSD 4XNAA 2Y22A 1XF5B 2FD6H 2R23A 3HE7A 3O4LB 2MSPA 4LCWD 1FQ9C 2ZUQB 1XGRA 2WCSA 2XXCB 1G4MA 5DJXA 1YUHB 4JK0D 5C0AA 3K71A 3FCBA 4AQOA 5BJTB 2XKSA 4HAKA 3ZHNA 3QUZD 3S2CA 2P46B 1YEGH 3X2QB 5E7BA 2JXMA 1QTSA 2GC7C 3N3EA 5D7KE 5C09B 2ZG1A 5C1MB 5IMMB 2OYKA 5ITBL 4JDEB 1DZ0A 4S11A 3VQMA 2XV0A 4NQDD 4AL8C 5IQMA 2BSTB 3CSPA 4N3TA 5CM1A 1CLOL 4CC4A 1RLWA 2C1PB 5D1ZI 4Q14A 4IKJA 5F2FA 3FQ1A 1DJXA 4GT7A 4DWHA 1T7YA 2KS0A 1GC1H 1LO0H 2XETA 2CMRL 3RZWA 1RJLB 4KH2A 2WD0A 4HLJA 2Y6SD 4OQTL 3W9EA 5DZLA 5PCYA 2PR9A 3FHAA 1E7UA 2JKRM 1T6VN 3QZWG 5F3BB 1RJZA 2R4RH 15C8H 2X6AA 4G3YL 5E94A 2ADFL 3ILEA 1FLTX 3SO5A 4AEHL 2A0LC 1RZGB 3JUYA 4XNMA 5AOJA 2PO6B 2HMID 4HS3B 5HI5C 3MHZA 2CM6A 2XWCA 2H3NA 2BIMA 1CFVH 3MRLA 1YPZF 5J12B 4KHXH 3ZE0B 2XFXA 1OGTB 3QXAA 5E8DL 4BELD 5DMKA 2HPTA 3VI3E 4DOHB 5LWYH 3L5XH 4NZRL 3MV9E 1UFUA 3BLPX 3LEYL 4H26A 2EDDA 4IDJH 5BO1H 3UBGA 5LDSA 4HJEA 1H9DA 4BHUI 3HMXL 1ZHNB 3LDBC 2GSGB 4L8BB 4PI2A 4JM2F 4PJFA 5A2KH 4HAGA 3BPLC 1RFDL 1WPCA 1HHKA 1TCRA 2XYBA 5JHDE 3GF8A 4C56A 2QEJA 2W9LA 3WV0A 2NY5L 2WTRA 4P2RD 1OO2A 4M7KL 5KSVB 3EAKA 3W0WB 4HDIA 3RDTD 1IUZA 1NAKL 1FL6A 4DPCX 32C2B 4AKQA 2BNQE 4OQ1A 3BGMA 5EIQA 5BS0A 4D9RD 4MJ5B 2X3AA 4ZDHB 2HA1A 4ZO6A 4IU2A 5T5NG 3RWFB 4HWBL 4RWYH 3QDMD 1KELH 1CD1B 2X70B 2ZAIA 5J6HB 2R0ZH 5IBLC 1DLHB 4LSSH 1TQBB 5C0BB 3MOQA 5FECB 1WG3A 1SUJA 5SV3A 4EXKA 3FQUA 4FLRA 4JFQA 3MPCA 4BH8A 1DBAL 2Y1AA 3TCXA 4B97A 2WLYA 4D0CB 3VD4A 2FD6L 4H1LB 3BAEH 2EKSA 3ECBA 1EO8H 3VWKA 3JBG7 3OV6A 3PGDB 1H3GA 3KVQA 1T4KA 1CJYA 1A8JH 1QHQA 2AV1B 1WCBA 3QVAA 3MUGA 1J88A 1RK1B 1RZPA 3ENEA 4Q0XH 3CH1B 4PVNA 1YEGL 1Q1PA 4M3KB 2PLTA 2VDPB 1BBDH 1EEZB 4YLQT 1BXUA 2H6OA 3GMQA 1KIPA 2CDFA 4OZHE 3UTSE 5AAPA 2YSSA 4ZAKC 3QQ4B 3TP4A 4RIRB 4P23D 3QUYA 3IDYC 4XC1H 3L1OH 3KWWA 3O8XB 4L1LA 4PRPE 4YZFF 2CR0A 3UZVA 4XPTL 5BRZB 1GC1L 2QZQA 4GXFA 4NGHL 1TR7A 1V3KA 3AT0A 1LO0L 1SLWA 3L1GA 4IHBA 4J6RL 4PJHE 4HPOL 2JKJA 1XGQB 5I6PA 5I8CB 2YD7A 4GUOA 3DX3A 4K3DH 3Q9QA 4G8EB 4LHUA 1OALA 4X6BA 1E2ZA 4Z3IA 2Y23A 3EJYD 4GQ9L 2R1WB 3VMNA 3PIQB 2R4RL 5ESVB 15C8L 4JZJB 3GBLA 4FYSA 2QVTA 4HUXA 4LMQE 1CFBA 4FNSA 3ZT6A 2JTYA 2ZXBA 5CU9A 3IAPA 1UWGH 2JIXB 5E0QA 3EH3B 5HD8D 3VGDA 3S4SG 3ZJAA 1B90A 2QR0B 1XGTB 5D4HA 3VGGA 3A6BH 4YHPA 3ZPDA 1FZMB 1YVLA 1XF4A 1CFVL 3GHBH 3T2NL 3BIKA 4KHXL 4JHUA 4LPCA 1YEIL 3JXAA 3DPBB 4RMQA 1RPUA 1KNOB 3RWIB 2EYSA 3TCLB 4X99A 3QBTB 2P5PA 4XCNA 1TU2B 4JQIL 3L5XL 5D1ZA 1ZA6B 5F9WB 4YDLB 5CNHA 3J8F7 3U7AA 2OBGA 4ZPVA 2C26A 1DJHA 4IDJL 5AB2A 1LEGB 1L9NA 4FG0A 1TXKA 2FEJA 2X2HA 3UL4A 4C83A 3P0YL 1ZTMA 1I8MA 3MBEB 2H6PB 2NUPB 2W0FB 1BBJB 2K70A 3I6KA 1HI6B 4U1JB 5A16B 2G2RB 3EOBB 4QRRD 2DQJL 1ZHKB 4F7CB 3MFFB 5T1KA 1AQMA 4UOW1 2WKOA 4H2CA 4J12A 2X87A 5FGBC 1TQVA 3QWNA 1IQWH 1KELL 4EN3A 7FABH 3M1CA 3KNBB 4P5SA 5IGXH 4LSSL 5E4EC 2A6IB 5GRVK 1KFGA 3FU9A 3C08H 3W5NA 3O4LE 3QIBB 4N0CC 5E8OB 3WTUA 4ZX3A 1MQKH 2X38A 1EO8L 3WCYA 4IHOB 2VZUA 3UAFA 1QFWH 4DGIH 1Z2KA 4X4ME 2WBKA 1B4JL 3VGEA 4BHUA 4F3FA 3NPSC 5GGVY 5C09E 4Q0XL 2J20A 2F2HA 3O9WA 4B6ZA 3MGTB 2O61A 1X5FA 4HEMA 1BBDL 1RZFH 5J9PB 4KXCA 3FT4A 1OGAD 3UO8B 3CDCA 2J1XA 3FSVA 5BQ7A 1FI8C 1U8LA 4XC1L 2Q76B 5GZNC 5AOLA 3QUMA 5KW9H 1ACZA 2BNRA 3BQUC 2J12B 3I02B 4GQQA 4UDTB 4WUUB 3KL3A 1CD0A 1CXIA 4NKMB 4JJ5A 1QW8A 1IILE 3RL2B 2FEDC 3B9AA 2GBTA 1QSVA 5H35B 3BO8B 1SJVA 3BIBX 5EC2A 4K3DL 4EI5D 2BCKB 3B6SB 4V1DA 1FRGH 3V9FA 5DA0B 3I6LD 3RDJA 3SDCB 1D7FA 4UDUB 4A66A 5T3XL 3ERXA 2B9BA 5TGBB 4PJ9B 3T65A 4ZZKA 5IHZA 2Z31B 2B4CC 5E51A 2APXA 4PRIB 5DVLA 1UWGL 2R51A 1CZ8H 2V6HA 4OF6A 2IOIA 2PXYA 4F93B 3ZE0E 1SDYA 2QPFA 4IU3B 3MOBH 2UX6A 4DOHE 3GHBL 2BNUA 5FYKL 2OMXA 1G7QB 3V5HB 4I0PB 1F58H 2WP3T 3IE9A 5AD0A 1ODUA 3GZOA 1TMCB 1T1XA 1A3RH 1PLCA 2WANA 4FNRA 1ZGLB 2FL5A 2NY1B 3PF2A 4E42B 5JLZA 3KDMB 3HPJA 1D7CA 2CUMA 3L4YA 4QYOA 4YO0A 4YHIA 3W0WE 1BLNB 5M94B 1EHXA 3U6XS 4X0KB 5KVGH 2GK2A 4OD2B 3UJIH 4OZHF 1MG2C 2ICCA 4GS7C 5IR1A 2VN7A 1X7QB 4PAZA 2GUOA 4ESKA 3WGUB 2YN5A 5IUCA 1IGTA 1JV5A 2DI8A 1E4JA 1Q9WB 3EG9A 3F83A 4L8SB 4PTUA 3G5XA 1ADQA 1F4AA 4UZGA 7PCYA 4G6JH 1HHIA 2XTJB 5C0BE 3UCRA 1T6WA 1MHHB 3LHAA 4PJHF 2WLZA 4JRFA 4DH2A 7FABL 4BFOA 1JNNH 2OLDA 4RAUB 5IGXL 2FH6A 2OX5B 4YSAA 3LZFH 4P49A 3BI9X 4CW1A 2WGXA 4HIJA 1OAZH 1WAAA 4CN6A 4Y1AA 3I84A 1WUZA 3G6AA 1AZVA 2NY5C 5HHNA 2A7BA 1G1YA 3FU7A 3ZU8A 1QR1A 2BY2A 3JVFC 4KO5A 1U8IB 1MQKL 4IIQB 4P46B 4PJ8B 1M4KA 4OFPA 1EGJH 4BCXA 1QFWL 4DGIL 1M7DA 1Z7JA 3HG2A 2AXFB 4L1TA 2FWOB 3KPRB 3Q6GL 1MPAL 4CN4A 1TQUA 5INDB 4MZ2A 3TBCA 1NC2B 4TQEH 3QPQD 3O3EB 3SOBH 2Y69B 3BH9B 1OTTC 1E5CA 4N2NA 5DMGC 3O3DA 3BESR 1RZFL 3L7FA 2OMTB 3CBJB 4LOVA 3ARTA 2Q2LA 1VZGA 1CBJA 3KLAB 1QEWA 1UASA 5TH2B 4AXWA 2VDQH 2K9UA 3O3UN 4TOYH 5KW9L 5F6HI 4AUUA 1P5VB 5DUPH 5D6DA 1TITA 4RZCB 4AG4H 1M2OA 5BV7B 2XWBB 3DX7A 3L3GB 4FI6A 1RVFL 4HKJB 3RYMA 2X6MA 1QLRB 4BSWA 5IMOA 1X44A 5KZCB 5CILH 3D3VB 5BCAA 2AQQA 3V5DA 1AZRA 1G43A 3B7SA 4XP5H 3DYMA 3O2DH 4OLWH 4XTRC 1FRGL 2BDNH 1KSRA 3K2UH 2W5PA 4PJGB 1MCLA 2LU7A 5TQ2H 5JXED 4OJEH 9PCYA 5D7JC 5EUKA 2ZX5A 3CVIH 3DTXB 3MRQA 3IGUA 3QNXB 1A25A 1Q90A 3BAKA 3FN9A 3HI1B 3VXPB 3EO1A 4F92B 2V2TB 1IFRA 2RR3A 2DW5A 3L5JA 1KACB 3FQRB 3MTRA 1CZ8L 3E1ZA 2Z6FA 4ONHB 1FCCA 4L3ED 1AH1A 1E4HA 1OGPA 3HE6A 5EIVA 3MOBL 1D5MA 1QSEA 2ZAGA 1MFBH 1HXYB 4C57C 1PD6A 2ICWA 5IJKC 4MDJB 2HKAA 1F58L 3EGXA 4A6YB 1CI5A 1OCRB 3NCJH 4H1LG 2NY6D 4MLIA 3U4AA 3OAZH 3CFBA 3TNMB 3BPCB 2ATKB 2BY1A 2ITEA 4XN4A 2CJUH 4LQFH 2XN9A 2WZPA 5IHWA 3F5WB 4I9WD 4XB8A 2FO8A 3NA9H 1JP5A 5ES4B 4RA0C 1TF4A 1JTTA 3WUWA 4X5LA 4ETQA 3UJIL 2GSIA 3F84A 4JRXD 3JV4B 4NQVB 1S5IH 1MVUA 3CZKA 2ARJA 1WBXB 3LQZA 1IAOB 1UXLA 3TYGH 4LZKA 1ZT1B 3OKEB 3FUKA 4G6JL 2QGEA 4IRJB 4UMGA 3ATFA 3GFUA 3ULSA 5LVEA 2G5BB 3HKZA 1BX2A 1A6PA 1JNNL 2WQWA 3G9AB 3MNZA 1HNYA 3VD3A 3W2DH 3BEVB 3LZFL 4IGBC 3LPGA 3D2UA 3FF7A 4L4VA 4C59B 3KR3L 3FUDA 3IT8D 3SJVD 2AEQL 3L5WA 4PCYA 2JJUA 2OJEB 4OT1H 3KCWA 3ME0B 3L95B 3MNMA 3L08A 4MA7H 1RP8A 3IJSB 2FSDA 1AD0B 3FQWA 1EGJL 3C2AH 2BJMH 1SQMA 3CH8A 3SE9H 4OIFA 3NZSA 5DEFB 1UA3A 3BKMH 4XN7A 3KLDA 3RNQB 3U46B 3VJ6A 1Y0LB 4TQEL 2EIEA 3Q1SL 3ARFB 4HMDA 1IBDA 2B1AH 3SOBL 4GPVA 1WFMA 1KGUA 3VFNA 2UZYA 4HCRA 2I07A 1XWVA 1KIUB 2P9RA 1P6WA 4X4YA 1DL7H 2FQFA 2H3XC 3WUZA 4FXGA 4J39A 2VDQL 4WI7A 4WUUE 4TOYL 1S7RA 4QRFA 3IU4H 4ODUA 3DSNB 4U6YB 4UOJA 5DUPL 1YEKH 1UB5A 4OZFH 2DL2A 3EFOA 2R2HA 3PP3H 4KNTA 4QEGA 3ARGD 1VDGA 1JGVH 3AAZB 2IGFH 3QCTH 3SE4C 2GCYB 5CILL 4JG5A 1X9RA 4MJ2A 3VFRB 5EEZA 2ODIA 5FA3A 3SKUD 4XP5L 3O2DL 1CGYA 4OLWL 1MI5B 3UPAA 3K2UL 5EB9A 5TQ2L 5LDUA 1NOFA 1YEDB 4PPTA 3ZE1B 2VR6A 5KYYB 4PRIE 3CVIL 4GKZB 3ZTEA 3MLVH 3NSJA 4K5LA 4PIRF 4N25A 3HUJB 1QASA 3BEWB 3VD5A 2LAAA 3WTYA 1MFAH 5FUCE 2V17H 5DJ8A 2P43B 4Y89A 5I24A 5LGKA 1NDMB 4UOW0 2CGYA 3MLSH 3IFPB 1BFOB 1EQWA 2LGNA 4UQDA 3DXAA 1MFBL 5LBSL 3LS5H 1YEJH 1OXYA 3H0TA 3SGDI 4HBCH 4PY7B 3K6NA 3SO3B 4U6XB 3NCJL 2WVVB 2FX9L 2YPKB 3PU7A 3RPIB 2CCLA 3CFEA 1F4HA 4JGJA 4LE8A 5CEYA 2Q3XA 2GI0A 4LQFL 1HHJB 3ABGA 3L7EA 4B0MB 1I1AA 3NA9L 1JPTH 1SJHB 5CO1A 4WSGA 1QYGH 4UNVA 4KNQA 4OKVA 4JVWA 4GSUA 3BFWA 6FABH 3RY6C 4NZTH 2WUCL 1MHCB 2A0LD 1BFSA 1WEJH 3ARBC 1MVYA 4W9GC 1S5IL 1NIDA 4ZUSA 2BVPA 2A5UA 1S3RA 4MA3A 2XTJE 3TYGL 5HHOA 5HI5D 2H26A 3WS6A 4U3HA 1YPZA 1GRWA 5FKPA 1JYNA 3C6LB 2PCFA 4KH9A 4ENEC 4IRSB 5I5JA 1Z5YD 4JAMA 3V9EA 4BUQA 4DPAX 1DQJA 4QUOA 2K4WA 1H5BC 2WYIA 3DRTA 1F6LL 4LCWB 5IF0B 2X4UA 3MLXH 5C3TA 4F2MB 3NFNB 3IGAB 3B5GA 2BHYA 2EDXA 1BVLA 3K6SA 4OT1L 2FZ3B 4JM2A 3KPRE 4MA7L 4G42A 1XV8A 2K6WA 2QBWA 2YLHA 1GKEA 2P47B 3WELA 4IIZA 3C2AL 4DK3A 3TF7C 5HPMB 2BJML 1DUYB 4R97C 2G75B 3NIGB 4XVUC 3RWGA 1V5JA 2NY0D 3P4OA 2PYEA 1WGVA 5B3JE 2IPUG 3BDYL 3HG4A 1KCLA 4YSEA 2B1AL 3MV7D 4LCVA 4NQDB 2DIAA 2YAOA 4DPRA 4WO4C 3N91A 1EFXD 3IRCA 5ETUA 5CD3B 1DL7L 2W59A 2XSKA 3BSHA 3QYNA 5IBLD 1T22B 3IXTA 3JYBA 3IU4L 4HH8A 3T3MB 3F8UB 2QDVA 2VZTA 3F05A 1Q9KB 2OKMA 3D3VE 3DV4A 4IK6A 1J0YA 1YMME 4Z1PA 1JGVL 1SM3H 2C3VA 1WTLA 1DQVA 1FFTB 4PJGE 4A63A 1S7UA 4IKKA 3WY1A 4DERA 3B9DA 5JQIB 1G9NH 1BPLB 2BSSB 1TO4A 4FXTA 1AKJA 2A73A 4UQ2A 2TSAA 2HFGH 5FA4B 3MLVL 3NBNA 4IM8A 1ZSDA 3WU1A 4M7ZC 4G7RB 3MR9B 1BZ9A 2PMZA 3VXRA 4DK6A 1I7ZB 1MFAL 2ZYHA 4Z0XA 3ES6B 4WY7H 1A1OB 4ZAKD 4MLSA 4HUCA 2HJFA 5EF2A 4JVPA 5FFOA 3MLSL 5A40E 1C5BH 3T2PA 3QZWA 1JF1B 3HRZC 3LS5L 3TFKC 1YEJL 2AABH 2N1KA 4XBEH 4HBCL 2CDGB 4Z3GA 2ZP9A 3WO4B 2CE6A 3O0RH 1E90A 3TCTA 5ADOH 1DP0A 1H0DA 2JCCF 3IMSA 5E2VH 4TNGA 4AITA 4AWJC 1JPTL 3UTTD 4NCDA 1QYGL 1HE7A 5I76A 3IETB 4PLOB 5GS3A 3H3BC 6FABL 3CFKA 2EABA 1OP5K 1VHPA 1OE1A 2GY7B 1HOCB 4UWQB 1WEJL 5F1OB 1OZUA 4GQRA 1N6QH 2OMVA 1RH8A 3QDMB 3TJEH 5C70A 5KSAC 3B2UD 3BZEB 4F7MA 3O41B 2YC1B 4I18A 3OKLB 5LN4A 1NFKA 5B1JA 2VDOH 1RL1A 1I8IA 2BZ7A 2WC7A 1C12B 1SPDA 4IMLA 4M48L 4MS6A 5CEZE 1JOIA 3FQXB 1ZA3A 1U33A 5E24E 5EBMB 3M07A 4NFDA 1QA9B 4OM0H 2ZF9A 4GO9A 4GJTB 1A6TB 2Z92B 1CFTB 5CZKA 1W0YT 2G30A 3KPMB 3V6OA 3IDIA 1TVDA 3PCYA 4CVZA 5I6XC 1B2WH 3OSKA 4HUKB 3RTQD 5I0ZA 2Y7LA 1HH9B 4N6RB 1QLEH 2ZKHH 1ZWIA 2FHBA 3QGVA 4NBZB 4BZ2A 3WHXA 4JQVA 3T6VA 2Z4TA 6TAAA 1L0YA 3FMGH 1M3IA 1ZMYA 3IRZA 4WWKC 1IC5H 2OS7A 1LVEA 4P4RA 4F7KA 4N2GA 5DHYB 3STLA 4H25B 4FA6A 1K4DB 5F7AA 5E6YA 4NLAA 1HSBA 3VXQB 1J9QA 2J4WL 3ZZ1A 4MNHB 2EVGA 1NEZA 3HG1E 1MI5E 4AUJA 2BS8A 4N5EC 3RVXD 5JZ7C 2IH8A 3L9EA 4XGZA 1T1YA 3ZE1E 1G9NL 2A4EA 3M45A 4W68A 4A37A 3EOAB 3B9KC 3LKRA 2HFGL 5H4ZA 3HUJE 1JJUA 4HUWA 5J1AA 1C08B 1FFPA 3DETC 2YRPA 3IJ8A 4YFDB 1C16B 4H4NA 5D9SA 5EU3A 2WWKO 3DGGB 4AOFA 2M83A 1JPFB 4E41D 4ZS6D 2VZ1A 1K85A 3LPFA 5GZND 1EJOH 2B14A 2J43A 3BQUD 5IY5B 3DUSA 2A77H 2EE3A 1DSYA 2DMKA 3PGFH 2O5ZH 2NNFA 3TH3T 2AABL 4GUPA 5JHDA 4XBEL 2E47A 3F7QA 2FEDD 3KLLA 4D8PA 1TCMA 3O0RL 4JUSA 5ADOL 1NFAA 4UOQA 1EHAA 1YNLH 2X09A 2VMEA 3MRHA 1DHKA 1F3JB 5LG1A 4PLKC 4A1RA 2XVGA 1SOSA 1WIPA 4QRRB 3WNNA 1UD8A 2BNQA 3S4SA 3QUMH 2BCMA 4ZUWB 1ZVNA 3NJHA 2BP5M 1QMUA 5K69A 1ILUA 2BVQB 3E9TA 4NAQA 1IM3A 5EMYA 2VO8A 5JW4M 1OCZB 1CURA 3TJEL 4XNQB 3B5TA 1CFNA 2ERJC 1SXBA 4AYFB 3BMWA 2EO1A 4TLUA 2QPDB 5BXFA 3PWJA 2EE2A 2VDOL 4LCWE 2H45A 2W65A 3BZ4A 3X12B 4F2ME 2GBUA 1LNUB 4HJGA 3P3UA 2KLTA 1NUGA 4LP4A 3HNSL 4HKZA 4N87A 5EBWA 5E00A 5AKSA 2DEXX 3NIGE 3QJVB 4OM0L 3UZQB 4LIQE 1W0VA 3LV3B 3L13A 5IEHB 1GZHC 1LXMA 1F11A 4OZHA 1B2WL 3MUZ1 4OI9A 1D2PA 3NSDA 3FT3B 3L4VA 2VC2B 1XXFC 4G1EB 4EIUA 4HH9A 1OGAB 1TQCC 3DHPA 5D55A 3ILPA 4PRPA 1ZT7A 5CINH 2X10A 4NI3A 2HVJA 1H8LA 1CG9B 1M71A 4PJHA 1MW2A 3T3ME 4DP6X 1BQRA 4MAYA 3ZQ9A 3FMGL 2J8UB 3DUUB 4XMPH 3TA3D 3TBTA 1ZIAA 1NCBH 2VAJA 1NWPA 4RFEB 4ZRGA 1TUPA 1IC5L 2XNAA 1UADC 1WZKA 2A6DA 4DGVH 1KB3A 1A6UH 2QPEB 2AQPA 1N2RA 4KTEH 3K2MC 4P06A 4N8VB 5F7FA 1F6AB 1YEWA 1P69B 4AM0A 1ADQH 5E03A 4B7LA 4NP9A 3C8DA 4MD5B 3GMLB 4YUEH 1THCA 3AACA 1KIQA 5CSZB 3RQ3A 3UJTH 3GM0A 3C5ZD 1BWMA 1G1KA 3B9EA 3FFOA 1CGUA 4IOFC 2AJ3A 1OTTD 1RJYB 2RFXB 4U1NA 5SWQA 4A7UA 5IHBA 5EOCH 5DMGD 5ACMA 2XPGA 5TE7H 5J57B 1LEKA 1MZYA 5E95B 4NM8H 2BINA 2RB8A 1WV7T 3RWCB 2Z93B 4GAFB 1IAII 1FA4A 4QWWD 3RILA 1ORQA 1U8OB 2H1LM 3FH5A 3D69B 5JORA 1NOAA 3FRUA 3PGFL 3Q01A 2O5ZL 2R1XA 1DVUA 4JE0A 1UACH 3LIUA 4RGMB 5GGSB 1U93B 1CTMA 4J27A 3VSTA 5HYIA 3H4HA 3JTSB 3VXSB 3IDUA 1Z9SA 1YNLL 1R46A 2NXZC 3DMMC 4XTRD 1OB1B 4Z7QF 3QUML 4XXCC 5D7JD 3RAJH 2HJLA 5CUSH 4MAUL 2P1YA 4IBTA 2F5BH 1QQDB 3KH3A 3QDME 1OW0A 4P05A 4WHYH 1ED3A 2JB5H 3OKOB 4WKZA 2P5EA 1AGDA 3X11B 1J5HA 2PWFA 4WWPA 2XVBA 4WO0A 3S88H 1ONQB 3F7YB 1XF5A 5E5RB 3N06B 1RZKC 3O4LA 3LB6C 4WAFA 5IW1B 4PW3A 5L0QB 1KPUB 1U3YA 3BN9C 1BEXA 1YUHA 2BRQA 3H2QA 3NK4A 1IAKB 3C8KB 5BJTA 4Y4FC 2P4AB 4IQHA 3UTQA 3ASOB 4J6IA 4JPVH 1O9ZA 5C09A 5ALCH 2X9WA 5IMMA 3CQQA 4AIZB 3VG9B 2YUVA 2O4EA 3HUJF 1KENH 3EJRA 2BSTA 2CCWA 4K8RH 5DS8B 3R8QA 4KJYB 4PRAB 3B2XA 4U1SB 1AZUA 4PD4J 4B60A 1R33A 2ZTBA 2AFNA 3D87B 4QNPE 4UQIM 2C5DC 2OMWB 3WKYA 3GC3A 5CINL 5IWLA 1RJLA 3EJUA 2FT7A 1MW3A 4FG6D 4OLVH 2CQVA 4WK4B 5F7YC 1AQ8A 1MFDH 4XMPL 4XNBA 1LD9B 2YD8A 2HT4D 5F70A 5JHAA 5F3BA 5TPWH 4L9LC 4Y19B 1F86A 4DGVL 4FQCH 4TSAL 5HXMA 1A6UL 2Q2EB 3Q8EA 3TPKA 3BDBA 4KTEL 5JIIA 2H0JA 3FQTB 1RZGA 4HIHB 4A2DA 1AC0A 2PO6A 4WNQB 4A39A 1ADQL 1L3NA 3OWRA 3CZJA 2OSLB 8CGTA 3DGCR 2ESVA 4YUEL 3UJTL 1JHKH 2DQEH 3PNWA 3RBSA 1CCZA 2WVSA 2GTZA 4H0GA 5EOCL 3WFEH 5HTSA 1AI1L 3EBIA 1F56A 3D07A 3MLRH 4IEFB 5TE7L 4R7DB 1AIFB 2A9MH 4NM8L 12E8L 5C9KA 3ESMA 3DV6A 1N5AA 2GSGA 4L8BA 2G0KA 2DQGH 4LSUH 3AXLA 1ZK5A 2NY6B 1GS6X 5HHMD 4KMTH 5ABZA 2OJZH 1G9NC 1UACL 4G8IB 5JOPD 4HKBB 4HCRH 2C3GA 3W0WA 5LNEA 5KSVA 4RQQB 4ZUTB 2ATPB 2A9BA 2ZXGA 2G9HB 1PY9A 2PTUA 4E2OA 5CBEB 7PAZA 2AW2A 3G6JB 4MJ5A 4TSBH 5D70H 5EZIL 1D5BA 3H8NA 5IROD 4GH7B 4APQD 3GMPB 3OHMB 1NGWB 4K71C 3RWFA 5KBNC 2X70A 1MLBB 5BOJA 3RAJL 5J6HA 1K8DB 3VW3H 1IAMA 2ZYRA 4KRPD 5C0BA 2B20A 4EZKA 2HG5B 5I66A 3LAFA 4JFHD 3SKNA 3UAEA 3T3MF 2Y5TB 1G7JB 2JB5L 3VA6A 4BKSC 3FO0H 5C86A 3EBHA 1A9VA 3S88L 1U8QA 4S0TD 4M8UA 4H1LA 3DRQB 4X5RA 2XT1B 1KWGA 1EMTH 3MV11 3D25B 3K0WA 1NFDB 3SJVB 2AV1A 1CFSA 4ANWA 4LAQH 2JI1A 4V2CB 3CH1A 1FNGB 2IF7A 3CDYA 4ODSH 4JFDD 3F7VA 2HJKB 4JPVL 2OK0H 3GBEA 1EEZA 1A7PH 5DQ9B 3ECWA 2HTKD 3IJ9A 1KENL 4RIRA 4K8RL 2I26N 2WAHA 3GSUB 1FVCB 2DJMA 1JGIA 3K74B 4KZ0A 4ZW6A 1IMHC 3DVFA 5EZJB 4PJ5B 4WV1C 3FCUB 4X5WB 1A8ZA 4EUPB 2DJSA 5DUJA 5BRZA 4LCCC 2FLBT 3VD9A 1DBBH 2QKIB 2LLGA 2UWEB 1CC3A 1QP1A 4BK4A 3TWCH 4XWOC 2J8UE 4G7YH 3ULUH 1XGQA 1F2QA 2H2PD 4MCZB 5I8CA 1KTRL 2WTOA 1KJMB 4G8EA 1MFDL 2FTAA 4FTVD 1SOKA 4ODTH 3ARGB 1IBZA 2R1WA 4C4UA 3PIQA 1CN4A 5ESVA 5TPWL 4JZJA 1WLHA 5AKTA 5LGJB 2E7LC 3I6LE 4FQCL 2FNBA 1KJ2B 4ZTOL 3GI9H 4QF1B 2VCOA 3QULB 4DN3H 3GBNL 2JIXA 1YN7B 1AYRA 2QR0A 3U83A 5K59E 1XGTA 4XVUD 2P3YA 5F0LB 5DRNB 4ATTA 5CIPA 2AXJA 1TJIH 3GPSA 2DQEL 3SGJA 3DPBA 5BVPH 3TCLA 3RWIA 4UV7H 1TU2A 2ZJSH 1F8TH 2AQ2A 3QORD 5G4MA 3P3TA 4PUBH 1XDTT 1NCGA 3FUFA 3F7PC 2A9ML 1LEGA 1D9KA 3VAEA 1QLFB 3EJSA 4P2OA 3RWEB 3VCLB 2DQGL 2UZXB 3P77B 2VQ4A 3MBEA 3TT3H 2FNWA 1RUMH 2H6PA 4TL5A 1RK0A 1KLUB 2W0FA 1BBJA 4KMTL 4M6MH 1HI6A 1ZRUA 3AUVA 2G2RA 4PS3A 3EOBA 4EN3C 2MOQA 3NIFF 5A16A 4HCRL 3RZCA 4BFRA 1ZHKA 2V3EA 4F7CA 2DN7A 3MFFA 3ZRCC 1U8MB 1EIBA 4U33A 3S35X 1CD8A 5HSFA 4DAGH 1KG0B 4TSBL 5D70L 3ZBMA 4ZMAT 3N9GH 5KN5B 2XWXA 4QNPF 4PHXA 3BE1H 3GPEA 3KNBA 3T0EA 2K1MA 3F62A 4LP8A 1AFVH 4XNZB 4AQ1C 4NPKA 3FO0L 3QIBA 3UC0H 5E8OA 2ATAA 1ZE3H 3ML9A 3EGDB 2EDYA 4F1ZA 2X41A 1XTLA 4IHOA 1EMTL 2GJPA 4DVBB 5F9JB 3H42H 5IHUH 5CLTA 1MF2H 4MJID 2ODHA 1I8UA 4P5RA 4N8VG 5L8JB 4ODSL 3MGTA 4R3SA 4PCTA 3FFDA 2OK0L 2MTPA 3BPLB 1A7PL 2XWJA 1JHTB 2NY0B 2X4PB 5J9PA 5KVEE 1ASPA 4HISA 4HJUA 4PSPA 1EJ6A 1ITCA 3GS0A 3MV7B 5LB1A 5CBAB 2Q76A 1LTXA 1QW9A 2X1WL 3BP7B 3VDBA 1EFXB 1CUOA 2IMMA 3CAFA 4UDTA 1DBBL 4NKMA 4BRJA 1ZTXE 1J18A 3RL2A 3O2WH 2EDBA 3TWCL 3PG2A 4G7YL 4E36A 1YEFL 3ULUL 4S1RL 3AABA 4HLEA 1AGCB 5EA0H 1CDJA 4ADIA 2BCKA 3B6SA 4Y19E 3V0FA 3HIZA 1IM9D 3CE1A 2PXYC 4GXVH 3SDCA 4WI3A 5DD0H 4HEPG 3WEMA 5ESQA 4MXVE 1IBFA 2V8LA 5SWSD 4UDUA 4L0ZA 3MV8D 4PJ9A 1A14H 3PLYA 2Z31A 4MB1A 2O30A 4DN3L 1L5GB 1BYPA 1OEZW 4GAYA 3GMRB 3ZYOA 1G7MB 5FHAH 1FP5A 2QQKH 4PYGA 4GI9A 2XWRA 1XQ4A 4J3WA 5TE6L 1TJIL 3T2QA 3HCVB 1XSOA 1YAIA 3QIUA 1G7QA 5I8EB 3B3BA 3V5HA 4NCC1 5BVPL 4UV7L 5H94B 4UTCA 4ZAKB 3T0AA 4I0PA 5AOIA 2CU9A 3GWJA 4IKNA 4PUBL 3FTVA 4FFVD 4AGQA 3B9VA 4A2EA 3NEEA 3V0WH 1E8YA 3G5ZB 3AC0A 3K8MA 2JJSC 2VZSA 2DAVA 4ZMVA 1S46A 5E6ZA 4E42A 2GJRA 3KDMA 1OD7A 3Q3GA 2J3SA 3HLAA 4MYWB 4WWKD 4ZW5A 1X6LA 2ICEB 1RUML 1BLNA 1VFOA 1OCCB 4I9WE 4X0KA 4M6ML 4Z7WB 5C6PB 5EC1A 1QTPA 3QZOA 4OD2A 1MCJA 2E46A 4Y2DD 1X7QA 3G6JE 1BXAA 3UTTB 5FLUA 1ULVA 2ED7A 5I8KH 4BZ2H 1HTYA 1EUUA 1J0JA 3OHXC 3KYNB 1Q9WA 4DAGL 5JZ7D 4GRLA 1TVHA 3U79A 2EILB 4L8SA 3V0AC 3N9GL 2LU5A 1C7TA 2PW1B 4AJ0A 2K8MA 4OGAC 1R1CA 3B9KD 3BE1L 4KX7A 5I8OH 3JYCA 3Q2LA 3B8SA 2ADYA 2J8UF 1G6RB 4RAUA 2OX5A 4R4ND 3DETD 1AFVL 3VX0A 4N8PA 3T08A 3UC0L 4YQXH 1J48A 2JK5B 3ABMB 1P9MC 4JG0H 4TNWF 1NFDE 4FFWC 1U8IA 4P46A 3SJVE 2J1ZA 3A67H 1CMOA 3MOAH 2VL5B 1ETA1 1IBHA 4JY4A 2FWOA 3H42L 3MRBB 3OB0H 3O4OB 2FBJH 4OIBA 5FCSH 5IHUL 3AGVA 1MF2L 1NAMB 2A9CA 5INDA 1FH5H 1J8RA 1NC2A 3O3EA 4FXKC 4G6MH 3ROLB 3WDHA 5I73B 5D6DC 1KFAH 2F18A 2NXYD 2VJ8A 3II2A 3ZYIA 43C9B 1BV8A 2VWEE 4LSDA 1NEUA 5EULV 4XI5D 3WO3B 4PJ5E 2FT8A 4GYBA 3RTQB 2FLMA 5D2NB 5TH2A 1AR1C 2Z8VC 4G9FD 3QYCA 1FAKT 1M7IA 3ESNA 1MCOL 2UWEE 3L17A 2AI0H 4JGNA 1DN0A 1P5VA 3Q44A 4KX8A 5FK9B 5FO8A 4RZCA 2ZP8A 3MA7B 3TEXA 3ZZQA 2EUXA 1DVFC 1M9WA 3L3GA 5CMAB 2NDGA 3O2WL 4HKJA 2AJUH 5HDOA 4PS8A 2X2UA 3D3VA 4YIQB 4G7VH 5E4EB 4DZ8B 4DO5A 3AU1B 5DGRA 2UUDH 1ZS2A 1T83C 1B0RB 2EAEA 3X1EA 4BD4A 2ZOTA 4GXVL 2EO7A 5DD0L 3A24A 3MYJB 2F54A 3DVGB 1BIIA 2X4NB 1TFPA 3DTXA 2FWSA 1A14L 3QNXA 3VXPA 3HI1A 4KHTH 3L16A 2V2TA 5DZVA 4M8RA 2F8XC 3FQRA 3NPSB 1NMCC 2NY3C 3VRJB 5LGYA 4ONHA 4WI2A 5FHAL 4N1HB 3HS8A 4QIRA 3T71A 1UZ6E 2QQKL 3BUPA 4MGXA 1Q9LA 1SOQA 4MAZA 2A9NH 1ZJAA 1UG9A 3QP3A 3TJHC 1HXYA 3MCKB 1IE4A 3MRDB 4E41B 1IO4C 2WIMA 4LSRH 2GEQA 1NGQH 3Q7JA 4A6YA 1B0IA 4P07A 3V0WL 4KVPA 3TNMA 2XLLA 1AAJA 1DJGA 1ZS8A 2ATKA 1JZFA 3FCSB 4CDGC 3F5WA 5AB1A 2WBJD 1EAPB 5CS7A 2VERN 3UBXB 4GAJH 1E5BA 5A3IC 4TSCH 5ESAA 2WLMA 1MRFH 1ZPLA 1JUFB 3M1OA 3JV4A 4MDRA 4NQVA 4E9WA 1ZV2A 3RJQB 1WBXA 5HVGB 1QWNA 1IAOA 1OM9A 1AHWB 3TGXA 3UMTA 4BZ2L 1U3ZA 4M29A 1ZT1A 4N0RA 3RWHB 2VDLB 4BK8A 4URKA 1P1ZB 2G5BA 3IJHA 1PZSA 3MACL 4X80H 4EUPG 5HVFB 5I8OL 2DM2A 1EUTA 2GJZB 3BEVA 1QFWM 1SEQL 4LF3B 4QHNB 1A9BA 3EGSB 3LRHA 3QSKB 2O26U 1UJ3A 1TTUA 4NUQA 4Y9EA 4YQXL 2OJEA 1BREA 5FKAB 3ME0A 3L95A 4JG0L 4MXVF 3A67L 3IJSA 3MOAL 1AD0A 1O6SB 1OAKL 4XPBH 1XTMA 1HS6A 4U1MB 1J9RA 3TTSA 3I50H 2KQNA 1QSZA 5DJYB 5DEFA 1E8XA 2FBJL 3S37H 4FXGC 2OA9A 3U46A 1FH5L 3CPUA 2I25N 2L4OA 3G5WA 5MI0B 1VZHA 1KFAL 4LO9A 4TNEA 4TNVF 4MJJA 1M53A 3OLEA 1KIUA 4MX7B 3AQYA 2GT9B 4FG4A 2NXZD 3BSGA 3RPKA 3DMMD 2L7EA 4X9HA 3BVDB 5IBUB 3ZGHA 2K3HA 1E3FA 2JQAA 1OOWA 4CVXB 2AI0L 1O75A 3DSNA 1E4WH 3MGAA 4U6YA 3TWYA 4Z3TA 3HFMH 3KBPA 2XZAH 3AAZA 3TA3B 1I3VA 2AJUL 2FGZA 1DCLA 5C0IB 2GCYA 3R19A 3LB6D 2DLIA 4G7VL 3VFRA 4G83A 2LU3A 1KN2H 2XPYA 3BWUF 3U1QA 4EKJA 4F9PC 4QY8B 3IMRA 3G6JF 1YEDA 4O02A 4N2LA 1GYUA 1ZGLP 4Y4FD 3C09C 4GKZA 3WS3B 3POHA 4KHTL 1XSKA 3REWB 2EUWA 2B7DT 2K78A 2OSWA 3HUJA 3BEWA 2P52A 3U9WA 2R2BB 3C5ZB 1SN5A 5DA4A 5D7LA 3HAEB 1NDMA 2LVEA 5ID1B 3ULUC 3FFCB 5DGQA 3HKFA 3IFPA 1BFOA 1R75A 2QELA 1I1AC 3IYLW 5FLVA 5DHVB 4OLYH 4H8PA 2J5WA 5C0NC 3K8LA 1CQKA 3QI9D 1FZJA 4LBAA 4LSRL 4PY7A 4K7PH 4LVNC 1P5UB 2WVVA 3NQIA 2YPKA 3VFTB 4AVJA 2R2EB 2BP0B 4POZD 3PWVB 1UD4A 3PXHA 1HHJA 4QR7A 4Z7WE 1SJHA 4PWFA 5FFGA 1A1NB 3P69A 5EOQL 2Q7YB 4GAJL 3D39A 3ZT7A 4F37K 1BHGA 1WWCA 5JW4R 5HHVH 3MO1B 4TSCL 1MCSA 1MRFL 3KLSA 2WIIB 3AREA 5EEUA 1MHCA 2E86A 4K94C 4JB9H 5KJ7E 3I9IA 4GBXD 3BT2H 4EOWH 3UXFA 2UWEF 3LYRA 2AEPH 3OMZA 2R1YB 4JM2C 4X50A 4DVRH 1QVOB 4X80L 3HC0B 1OP3K 1KTDB 2NY7L 2X42A 2P44B 4IRSA 4OW6A 3ASNB 1AKPA 5KVFE 1X4ZA 3IDMA 4QMEA 4W4OC 2WJ7A 4LCWA 2QHRH 3IMWA 5IF0A 2N59A 3IGAA 4F20A 5SX4I 2FZ3A 4RA3A 4UI2A 2H32B 3ZT5A 3KBEA 4XPBL 1PZBA 3U82B 3ZTJH 4CKQA 3QUZA 5FWRA 1DUYA 1SHSA 1YA5A 3I50L 4PGZA 5L2KB 3DTUB 3S37L 5I0DA 2D3NA 3VXSD 1BA9A 3VUAA 5A1AA 5J7CC 2E9JA 2OQJB 3NSYA 2IGTA 3K6IA 4CKVX 4NQDA 3GBMH 1HKFA 4UU9B 5D2NE 3SDAD 3MCG1 5CD3A 5DUMH 1A1MB 5CJQH 3FCTB 4AKPA 1JVLA 1TTRA 1ZE3C 2V5YA 1O6VA 2WLKA 4G5ZH 4TN9A 1F4XH 3P9WB 5ICYA 4GQZA 1T22A 2O5XH 2Q3AA 4XR8C 4E9YA 4TRPH 1UA7A 4JR9L 5K9QI 1Q9KA 3INUH 4NIYE 4TLSA 4YHZL 3HFML 1F45A 2J8OA 2XZAL 2Y3AA 4KXAA 5E1HB 1F90H 1X5YA 1UZGA 1UWEH 3WJJA 1VKXB 4P2CG 2LTQB 4KZEH 3BRGC 1KN2L 5DVKA 2H8PB 4X9IA 3REVA 2W95A 3CHOA 5CZXD 1GZPB 2C1OB 5GHWH 1YEEH 2BSSA 2ZCLH 4PWGA 1FG2B 3EH4B 2OCFD 4TUJA 2Y2WA 5FA4A 4JDZB 1T1ZB 4BDVB 2KZKA 3DO3A 4N86A 1LO3H 4K5OA 3X14B 3AW5A 2NR6C 5AW3B 4H1LH 4NIKB 4UT9A 1GS8A 2VM4A 3FO9B 3PHSA 3IMUA 3IU3B 3WENA 1TYJA 1FYHB 3WL9A 2XWZA 3DECA 4E41E 4HLZG 4OLYL 4L5FH 5DC4B 5T1LD 3BAJA 2B9AA 4LPYA 2AMUA 2CDGA 5ICXA 3NJGA 1P1VA 5DEJA 4GSXA 1ASQA 2BW4A 2P8LB 4AENA 5HHMB 4XVSH 5DHDA 3MUY1 4P2RA 4PWIA 1FJ1B 3HS0C 3DK2A 1T20B 3RDTA 3IETA 4BSVB 3DX6B 1M05A 3UAAA 2BLFA 3OAZK 2FRGP 2A74C 3B37A 4LKXB 4BUGA 1HOCA 2P8MA 2P42B 1X5ZA 4APQB 4JB9L 1WBZB 1DJSA 3BT2L 3QDMA 4G71B 5D5MB 1S3KL 3GSOB 5DZJA 4EOWL 1BG9A 4NBXB 4NRZA 2OFQA 4NHCH 3BZEA 4KRPB 3O41A 1JPST 4KGJA 4YHNB 1I9IH 3KJ4C 3OKLA 4RWHA 2GY5A 4NLHA 1JN6B 2NLJA 3QZLA 4PRDA 4P0DA 3F64A 1C12A 2WLIA 4AIOA 1ZOXA 3CMOL 1L6PA 3B3IB 2ZXEB 1GXEA 2QT6A 1PDKB 3FQXA 2QHRL 5DF0A 3P4LA 4KQ0A 5EBMA 2J6EL 1U30A 1QA9A 4FX5A 4G6FB 1PG7X 3BLBA 3MCYA 1A6TA 2Z92A 1CFTA 1KTJA 2VE6B 1MW0A 3P9LB 5CIPH 4JFDB 4TV3A 3KPMA 3TBWB 3UFIA 2C4XA 4R2GC 4MCNA 1N6VA 3X1BA 2FECL 4N6RA 4HUUB 1Q94B 4JANB 2BPBA 1PNDA 3GBML 3TH4T 2VXUH 4P23A 3UP6A 4QPEA 3V0JA 3EZ8A 5DUML 5CJQL 2Q5BA 4J3BA 1UKSA 1E9OB 4G5ZL 5D72H 1F4XL 4XCYA 4ZD3H 2C4FT 4ZMPA 1S9VA 1NPUA 3INUL 5DHYA 1FF5A 1OV8A 4H25A 1IVLA 1K4DA 5C0CD 4FTVB 1F90L 4XNYH 3VXQA 4MNHA 2NTSP 1UWEL 4MHHG 3KVDD 4KZEL 3UBXG 3PP3K 1RSYA 3A4FA 3AQDA 4K55A 1YEEL 4MJ6B 2ZCLL 2E8ZA 4QO1B 4WJ5A 4DKAA 3CCHB 3EUUA 5FFLA 3H2WA 4IBYA 1C08A 1D7BA 1J87A 1MCIA 5AW0B 1LO3L 1UXWB 3WY2A 1MCCA 5GGRY 5DFVC 1C16A 3MREB 5AW6B 3VGAB 3FNKA 3FFCE 1U8KB 1JPFA 1VSCA 2MQCA 4GRWF 5DTFA 2CLRB 2NOYA 4U6TA 2L7UA 3CN4A 3OJ2C 3QORB 4CU7A 4EN2A 3DJRA 1YCSA 2X2IA 3QQXA 1AXIB 4YEFA 1ZV5A 1BP3B 1SDDB 2VDPL 4WU5B 1J10A 1P7QD 1ZDSA 2PABA 4JJOA 4ZX4A 2CUIA 2HKFH 4K7PX 3BVUA 3O6MH 3HNTH 1AGBB 1F3JA 4XVSL 3QDHA 4QRRA 2APSA 5FXCH 1NIBA 3ASWA 4UQBA 1GGIH 5FX3A 4ZK8A 3OMIB 3KWVA 1DQDH 1KBVA 2BVQA 3RWJA 2UYLA 3BN3B 3N42B 3CMGA 3V4UH 4K4KA 4XNQA 1YNKL 2Q0ZX 4OCNC 1I7UB 2O5NA 4NHCL 3UGUA 1W91A 3IFLH 2EEFA 5FDYA 5IBUG 4DCQB 2WXKA 2Y7QB 1I9IL 4XN1A 2LVCA 1T7XA 3MLUH 4RMVA 3UACA 4YSTA 3X12A 5C2UB 2K6ZA 3MRKB 1LNUA 4NZFA 2UXVA 4DKTA 5MP6L 3CC5B 4YGVA 4Q97A 3CC1A 3CZUB 1XGPB 4I7ZC 5L2KE 3RFZC 5T1MB 4MJIB 1Q38A 3U9UA 1ASOA 3LV3A 5FUOH 4FEMA 2LQRA 5IEHA 4MAYC 5B8CC 4ADJA 3AZUA 3K3QA 4Y7OC 4J8RB 2XZZA 3FT3A 5BO0D 2GABA 3IPFA 4G1EA 3TBYB 1OGAA 1AVAA 2AQ1A 2VXUL 1X5AA 2YPVA 3AT8A 2WLNA 1CG9A 5KBPA 3D5OF 3LZNA 3HAEG 2IAMC 5GQBA 3H2PA 5EWIH 2J8UA 3DUUA 2FYVA 2FX8H 2IWFA 5D72L 4AZUA 4ZD3L 4BQ8A 1L9PA 3B4NA 4BWUA 3MLTB 2CO3A 4PMEA 4EI5A 1VEPA 2WXGA 4M03A 3DJTA 4NXSA 4KROC 1PZDA 5J11C 4N8VA 1IM9B 4FD0A 1F6AA 1NWOA 4QD2E 4XNYL 5DJ6A 4N22A 4AW4A 4ETYA 1EO5A 4P4KD 2VNCA 1JGUH 1JD7A 3F6LA 3MV8B 3KGUA 4MD5A 3SCMB 2KL6A 3GMLA 2PNDA 2OCJA 1IJ9A 4J3OC 1H19A 1X9LA 1ANUA 5CSZA 4RESB 3IAQA 2XA3A 4GSRA 3WKNA 3ESPA 1I3RB 2RFXA 4ZFQA 1XEUA 1EEQA 1H15B 3EKCA 2WQUA 5FW8A 3ISYA 3HZVB 1MSPA 2CR3A 2FHFA 4NRYB 1J1PH 2Z93A 4JLRB 3RWCA 4MXQD 2A9AA 4S1QL 3GJFK 1AR1D 1U8OA 2NT0A 3FQYA 5CHNB 1WUNT 4HEPA 3LKPB 4XHQA 5GGSA 3NDYE 1U93A 4XOAA 3VGHA 4O9HH 3QO0A 4O2EB 4Z5RB 5BOPA 5I0XA 1L7TH 1NMBH 5HHME 5D7SH 4QGYA 1B9KA 5JOPE 2AF2A 3IE4A 3JTSA 4WWKB 5ITFB 1NBQA 2WLLA 3O6ML 3OKMB 1YN6B 4XH2B 4LPWA 4BYHA 4F7PA 1OB1A 4Y2DB 4X6EB 3WFBH 4M8QB 4EPSA 1GGIL 2ZUQC 2OCCB 5I1KH 4LBEB 1VADB 1J5IA 1HL5A 4C47A 1DQDL 3VYOA 1QQDA 1AIZA 1XGUA 3R0MA 4MNQB 1LK2B 1NGPH 1PLBA 4LOFA 4PJXF 4WTZG 2R7EB 3V4UL 3X11A 1QRKA 1BZEA 4FRWA 5E6UB 3L3KB 1DN2A 2NY3D 1ONQA 3B9KB 2GQHA 3F7YA 2EVHA 3BP6B 5IW1A 1ZPUA 1KPUA 4JM0A 3RGHA 5J13C 4MWFB 1XSJA 1N0XH 3ZDXE 4OZIE 3MLUL 4PRBB 4C55A 3C8KA 1Q1JH 4IJTA 1W72B 1OIOA 3ZRFC 3LY6A 3BP4B 3T6ZA 4AIZA 2DY2A 4JFDE 5IWLC 4KK6C 5FUOL 4UTAL 1SRDA 1QATA 4KJYA 1AJ7L 2NXYB 4PRAA 5HJBA 1GTNA 5A3ID 4U1SA 3PL6B 3ARPA 3NDZE 4XZUB 1RJCA 2VDKB 4A6YH 1JI2A 3S6CA 4ZMTA 4YBHA 3C5JB 4OCLC 3DVNA 1EO7A 4G9FB 1H3TA 4ZFFA 2QSTA 5C08B 2HCZX 3TOPA 1UH3A 4F8OA 1WO2A 3MRIB 1EFQA 3EYUH 5EWIL 2MPVA 1BWWA 2FX8L 4OLUH 1LD9A 3ECVA 4JO4H 4CA4A 3V7AE 1CDIA 5FM4A 1JZ4A 2CKBA 2A38A 4FTVE 3KDPB 4FNUA 3NA4A 1MIMH 1UT1A 1HK6A 3HZMB 3OKNA 1YHPA 4NJ9L 4E9SA 4HIHA 4Z76B 5JXEA 1QBAA 4B9KC 1JGUL 2OSLA 4BKLB 2E27H 3SPJA 1MCRA 2EXSA 3CSGA 4AGMA 1NLDH 4L3EA 1HILB 2WW8A 1GGBH 1A7RH 1K2DB 2WKLA 4JPIB 1DCEA 1U41A 2WNWA 5CEZH 2VABB 4IEFA 1PKQB 4GG6B 2Z7UA 4R26H 4R7DA 4WW1B 5C71A 1CVRA 1JIBA 1J1PL 3PWLB 4JN2B 4BFNA 3VGBA 2YUXA 3GZQA 3WKQA 1B3JA 1J0HA 1TQCB 2BHFA 1XMWA 3LPPA 4NQCB 1CD9B 3BQVA 3GEWB 4P8QA 2MEJB 4XRCB 4YZWA 4F15C 5HDQH 1K4CA 1V3MA 2B39A 4G8IA 3ZHFA 4FNTA 3W57A 4P99A 4O9HL 2ARJQ 1NMBL 1TQBC 4G70B 2WBJB 5D7SL 3KYKL 4RQQA 5BZWB 3T6WA 4ZUTA 2ATPA 1Q72H 2B5IB 2G9HA 2VDMB 4LL4A 4KKPA 3G6JA 3JWOH 3DX0A 3GMPA 1EDYA 1NGWA 2WLHA 4QRSB 3WFBL 2W0LA 4JRXA 4XODA 2WINB 1JSYA 3UG3A 5I1KL 3D9AH 5BV7L 3DYOA 3UYOD 2ZSVA 4ZNEA 2HG5A 2DH3A 1NGPL 2YJLA 2Y5TA 1G7JA 1FZKB 3BLKA 1RPQA 4QTHB 3K2IA 1CGWA 3TEWA 1IEHA 4U1HB 1AZZC 4DQAA 1BVOA 2GUYA 1N0XL 4O02H 4WI5A 1NFDA 3SJVA 4DGYH 2BS9A 4ES9A 5K9JH 1IFGA 4ERSH 2KYIA 3V7AG 1J9CT 1Q1JL 1FNGA 2QGBA 3O8XC 2HJKA 1MCDA 3B43A 3NCBB 1F5WA 5I15H 1JFQH 5F0MB 4FYTA 3GKWH 2WSPA 3GSUA 1MCPH 1FVCA 4FHKA 4Y16B 2YRBA 4S0HA 3E9UA 4X5WA 5JIHA 4EUPA 3CFMA 5IVXB 4A6YL 4JZJC 3GYRA 3DMMB 1JCVA 2UWEA 2QSVA 3FTGB 3HN3A 4X9BA 4F9LA 3Q6FB 4KBPA 1EJ8A 3EXLA 3FB5A 3RVWC 4OLUL 3ARGA 5ERWB 2JKSA 2QQNH 2WQSA 1IJNA 5LGJA 2Q7AA 1KJ2A 1ZJBA 2OR7A 4DO6A 2XWEA 4PD4K 4PMFA 4U6HA 3GM8A 4UZUA 3GSWB 3ML8A 2WNKA 3QUXD 4QF1A 5I82A 4CJ1A 3QULA 2WXQA 1LE9B 3O6FB 1YN7A 5K1JA 4Y4FB 5HGHB 8PAZA 5D5MF 2VDRH 2D9CA 5DRNA 3T3PF 2E27L 3AWEA 5D6CB 4JHAH 2EZ0C 2YAPA 3I3BA 5CN2A 2PPCA 3F6IA 3ZRSA 4ANUA 1NLDL 1U8HB 1F02I 1GGBL 2EDMA 1CTNA 4ZX5A 3ZX1A 5CEZL 1U8JA 1JXFA 1I7TB 3DOIA 3WY3A 2BWIA 4R26L 1FWXA 5GRXG 2W9DH 3HC3H 5A2AA 1UUSA 1QLFA 4J3UA 3RWEA 5DQJB 3VCLA 3QI9B 1E67A 1R3IL 4FCHA 4LIQH 1WQVT 5LNDA 4OJYA 2UZXA 4BV1A 2VT0A 3A47A 1KLUA 5HDQL 2KZWA 1VLXA 3S9DB 2YO3A 1EAJA 1QSFD 1YQ2A 3PAVA 4Y1SA 1Q72L 5FR3A 3WJMA 4JO3H 3NK3A 4R84A 3ULVD 4R96B 3RRQA 1KG0A 2R69A 2LT9A 1I1YA 1SEBB 2VIRB 3JWOL 3O3BA 2YQ2A 3CN2A 1CICB 4FZEL 4I89A 4MNQE 4RSVA 4N2EA 3ZOAA 2XZQH 1J5OH 4PJCB 4GBXB 3D9AL 1IBGH 3CHPA 4TULH 2Y7MA 2XC8A 5GRJH 3SQOH 1AO7D 4FQ2L 2A4CA 2NR6D 2EEXA 4I1RA 3QNFA 3P30H 2EDFA 3BKJL 3EGDA 3LNHA 3FSAA 5A2LH 4KFMA 4WHTB 5TDOB 2EE6A 2TRYA 4DVBA 4JKKA 4O02L 4DGYL 5I71B 3ARXA 1MDAA 2G5UA 2A9DA 2ZXCA 4JG9A 2CXGA 5JQ6H 1BJ1H 3QFDB 3S3JA 3ECUA 2ZXAA 4FQPA 1GVIA 4WIQA 5DWPA 2VKWA 4X4ZA 3BUTA 4UT9H 1JHTA 2X4PA 5I15L 1VCAA 1JFQL 1PPIA 2NTFB 3M17A 3QEGL 3QRGH 1M7UA 4WTWA 1F6FB 2ZOOA 4PVLA 2F7RA 2Y24A 3GKWL 3SKOB 1A4BA 1AANA 3MV7A 1MCPL 3FOMB 2NSXA 5LXVA 3TU6A 4HS8H 1RZQA 2D2OA 3BP7A 1G7HB 4G9FE 1WTGT 1EFXA 3SDAB 5C08E 1KMGA 3HJEA 3VXMD 5SX5H 4K71B 1TSRA 4N2OA 3VD2A 1M56B 5FO2A 2Z31C 3K72A 1INQB 3AU0A 4DKEH 5GGQH 4KTGA 1G9MH 1AGCA 4X83A 2JQMA 1VB9A 2CRZA 1C9SA 2YMTA 4X9FA 4MMYB 1J9SA 2QQNL 1M6UA 3QS3A 3UROR 5FUCC 2YXFA 3ZKNC 3QQDB 1GYCA 4JZOB 1D5RA 4U1IB 4O00A 5KYWA 4I0PC 3FPXA 1L5GA 4UTBA 3KLHC 3N42F 3GMRA 4FLHA 1G7MA 3CZNA 4YNYB 3ESVF 3UJJH 2VDRL 3VMPA 2JE8A 2D31B 2KZBA 3MKKA 4L4TB 4LLDB 1CXFA 3KMDA 3HTLX 4JHAL 2NY1C 3FH8A 1BZQK 1LJMA 1PKQE 3C5SB 4R2GD 1UXMA 2WWKT 4GG6E 5H94A 3APFA 4ZAKA 5FGRA 4E0RB 1PG7W 4WV1B 2W9DL 3HC3L 4Z7IA 3VD7A 3G5ZA 3D33A 4NQCE 2H6UA 2L7QA 5DJDB 2P80A 2O6FA 5T1LB 4LIQL 2HXAA 1A3LL 4L8SC 1E27B 2X4RA 2ICEA 2XTJC 4X7TB 4Z7WA 4RDBA 3LZOA 2AAAA 2APVA 2IG2H 2AC0A 3OPZH 4L4JA 5FAAA 3UYPB 3UTTA 4QJ5B 5IFJB 2BMKB 2DWTA 2XQYK 2PP7A 4EE2A 4JO3L 5LQBH 2XVLA 3LXBA 2HN7B 5IB5A 1CL7L 4GEIA 3L9BA 3MV9D 2B1HH 2PW1A 3P73B 4IIQC 4PJ8C 4FABH 2XZQL 1J5OL 4JJHA 3ZW3A 1IBGL 4YN3A 4ZUUA 3U1PA 4CL7A 4TULL 3UADA 4FHBD 2BOLA 5GRJL 3SQOL 3C60C 2BOCB 2XKNA 3Q13A 1TSHA 3P30L 4MZIA 3OSVA 4I0KA 3ILDA 5JW3L 2E9BA 5T3ZE 1I82A 2FHCA 2Y5QA 5SX4H 2VL5A 1HEZB 2GK0A 3MRBA 5B38B 1NAMA 4HETA 4KK5D 4RAVB 4AQAB 5DMYA 3ROLA 5JW5B 1L9MA 4FKKA 1XF1A 3AG4B 1F97A 1QD0A 3QWOB 2BS71 5BV7C 1E50A 4UT9L 4FHJA 43C9A 1INDH 4DP7X 2O72A 4GT0A 4ZFGL 4Q4IA 1ZCRA 3OG6B 1FUNA 4QXWA 2ZWKA 5K93A 3RTQA 4PV8A 5IVXE 4B9FA 4FLSA 2QVIA 4F58H 4HS8L 3F2LA 1OCWH 2K0RA 1JL8A 1JI1A 3MA7A 4XPGH 4KPHH 5L7XH 5FGBA 3R0NA 3W81A 3KL0A 3BAXA 4X98A 2WV3A 5GGQL 1G9ML 4XE5B 4YIQA 4DKEL 2WZAA 4DZ8A 2CUAA 3AU1A 5I9QB 1B0RA 1KB5A 3LCYA 3VI4F 3NG5A 5C0CB 4HIEB 3QFJD 2O93L 3MYJA 1UGNA 3MKGA 3WJLC 1S7WB 3UTSD 2RCSH 3DVGA 2VQTA 2X4NA 4LU5H 4X4KA 3V0HA 1R47A 4Y4HC 1A4KB 2AQSA 3D0VA 2CO6B 4O2CB 1OLZA 1NIEA 3RKDC 4UAOB 2BVTA 1SBSH 2ADIB 4YBQC 5DK0B 2VJ0A 3VRJA 1W9XA 4PCKA 3UJJL 1TZAA 1MFEH 4BK5C 2ADGB 3BWSA 1UKQA 1NPJA 2EC9T 2VSCA 2X1PA 1OTSC 5C0JB 3T0WA 2R29L 4EZMA 5J4MA 3F3HA 3MRDA 1EEYB 2DQHH 5E99H 4E41A 4P5MB 4U1KA 5MENB 4A04A 5DO2C 5L4MA 5GZNA 2HFTA 2DMCA 4XCEA 1I3GH 4E5XB 5ISZB 4KO6A 2CDEB 3BQUA 4B9YA 2ZCHH 4GI8A 5D1QD 3BD4A 3FCSA 1L4IA 1MQ8A 2WSDA 3E8UL 3D52A 1P7QB 2DWEB 1MELA 3DLQR 3H6JA 4JFWA 1XVSA 4IRJC 3Q8CA 3W1ZA 2VC2H 2IBZX 4TUKH 2NNRA 5F9OH 1JUFA 1MXDA 4KROD 4PSRA 2IG2L 3HZKA 2YPVH 4OJFH 2XJKA 3SDXB 1CO1A 1AHWA 5LQBL 3QEHA 4ZMYA 5E5MB 3K0YA 3RWHA 4F33B 4KU1A 4PJCE 2B1HL 1ZK9A 4FS0A 3P0VH 5AFAA 4J3OD 4FABL 1P1ZA 3MJ8B 2W1NA 2GJZA 4CMHB 1T5XB 4G80B 4WEUD 3QJQB 4ZFOB 4LF3A 4QHNA 5LUMA 1O9WA 1G9EA 4RBPH 3EGSA 5G55A 1PLGH 4HG4J 3ARFC 3L8QA 4PEEA 3PJSB 1XBRA 5FKAA 3KZ8A 2NUTB 2BP8B 3ZUCA 1A4JB 4U1MA 1FV1B 3LHPH 5DJYA 1PZ2A 2BSRB 2LFEA 1H9VA 3SY6A 4N9GB 2WUBH 3VXSE 1E6OL 3PXLA 4XP6H 1MHPH 3KE0A 4QXVA 1JGEB 1INDL 1UOLA 4B9JA 4MX7A 3T5WA 2GT9A 4YSUA 4L23A 3RP1A 4M4RB 4F58L 2GI7A 3PHOB 1EBAA 2G5RA 1QFHA 2XX0A 2CHXA 4PJXA 4CVXA 3OHXB 4HMEA 1OCWL 4GNKB 2J1KA 5HYSB 2EJ1A 4XPGL 4KPHL 5L7XL 3ARDC 3WHE1 2GIYA 1C5CH 5JDSB 2WWMC 3TA3A 5G5DB 4AM0Q 4HJSA 4B5ZA 4RETB 3MNWB 5AB9A 1ZHBB 2DLHA 1AG6A 3NJMA 1QPPA 4QY8A 2APFA 3VE0B 4N6QA 1EAQA 1XF2B 4C54A 4FMVA 4P4KB 2RCSL 4LU5L 4BFKA 3WS3A 2HUHA 1JK8B 5J06A 4GO8A 2VM9A 3REWA 1MFVA 1JXKA 3JZYA 5EBGA 1DDTA 1SBSL 1TZHB 4L4TE 3SO3C 2OR9L 2R2BA 4B50A 1W6WA 3C5ZA 2Y2YA 1Y6KR 4JFED 4GP5B 3TL5A 5B7MA 1CF8H 2A2QT 2VN3A 2VQ1B 1WFIA 3AS2A 3HAEA 4Y2NA 5ID1A 1YZZA 2WHVA 4NEHB 2XYCA 2IPKA 2ZOLA 5DHVA 2AAVA 4XMLH 3VTTA 2Q8BH 4DF9A 1TJHH 3UAJC 3TBSB 1ESOA 2VO5A 2YIHA 4HHWA 2BSED 5AZ2H 1AR1B 3NJIA 1P5UA 2EDHA 3VFTA 1MRCL 3OLGA 1EWHA 1CDUA 2R2EA 3OGCB 1T6BX 5CR8A 5SWZA 4BFIB 3PWVA 3S0PA 2QADB 1WWWX 2ZCHL 2FVNA 3QNZA 5KVEH 4WCYH 4EXPX 1BIHA 4XN9A 1MDTA 3SY0A 5CCJA 2Q7NA 2V8MA 2ZYSA 2Y25A 2X4OB 3C6LC 5FF6A 4U3CA 1N18A 2VC2L 3MO1A 5F9OL 3Q1EA 5DVOA 4IRSC 2WIIA 4NO0D 2B2XL 4OJFL 4B96A 1NGXB 5CP7B 3WN6A 4OFYD 2J73A 4J1UB 5D7JA 4UILH 1ZTXH 1KPVA 4L3FA 1SZNA 1QZ1A 2N01B 3V4PB 2R1YA 1BJ8A 2I9LA 4HFUH 3P0VL 1AQHA 1DBMH 1QVOA 3DVIA 5KBLA 3BUYB 3HC0A 1KTDA 2CKBH 4HV8B 3F00A 3MMEB 3QXVA 5FOBB 4AI7A 1FH2A 1NL0H 1PLGL 3B2VH 5TQ0H 1V27A 3MRPB 5EZPA 1BZDA 4M02A 4EF3A 3DBXA 5F97E 2H32A 1I7RB 2V33A 1PZCA 2CIKB 3O11B 4F2FA 5IJKA 1JFHA 1I31A 3B7YA 1WSST 4KMQA 3LHPL 1E9QA 3R4DA 4J8QA 1KT2B 5CSGA 1FNHA 1T66C 3MRMB 1DR9A 3DROB 4OY9A 1U92B 2J1YA 3ZO0A 3R4RA 3AS0A 4NT6B 5IG7B 1H6FA 2WUBL 4RRPG 4XP6L 2QVFB 1KXHA 1HYRC 2C7UB 1IC4H 1ACCA 5AL8A 1UD5A 4WTZA 2Y6SC 1A4CA 1KGCD 3WEXB 4Q56A 1YYCA 3QQ9C 3TN0B 5KVDE 5CGYD 1A1MA 2FJSA 3FCTA 1ZLSH 1A5FH 3DWTA 1PLAA 4YHZH 2ZE0A 1GR7A 1A65A 4JO5A 3WFZA 3VYPA 2BOBB 5TK4A 4YLCA 3TJPA 2FJGB 2ZNWA 1RZ8A 4JQIA 5A7BA 5HBBA 3AVEA 2CIIB 1CPUA 4N2HA 2V9UA 4OIAA 4OGZA 1QFWI 3QCUH 1C5CL 1R5WB 1TJXA 4UT7H 4F57L 2H1PH 2WOYA 5F0JB 3EYQD 3UH8A 1RHHA 3U36B 1IQDB 4XP4L 5C0CE 1VKXA 1WAEA 1WZLA 1JMZA 3VTMA 4NSKA 3S98A 2H8PA 2E7CA 2VZOA 4KZDH 1FPTH 1GZPA 2C1OA 1CLVA 5J0BA 1IZKA 1FIGH 1Z5LA 3ARZA 1JNLL 3O8XD 3A0OA 2DQDH 1T1ZA 4BDVA 4PJCF 2AGJH 2P8PB 3ZHKA 3X14A 1DLFL 3C9NA 3M86A 1S2EA 3MSPA 1MNNA 4UT6A 1SF3A 2J88H 3FQ4A 3NFSL 3WO4C 1DFXA 3IU3A 3QQNA 4FFZL 1CF8L 4HPYL 4PJFF 3GSRB 4NZJA 2VLKE 4JCLA 1G9MC 5MHSE 2ORBH 2IC2A 3KBHE 3V5KB 3GTNA 5MENE 4D0BB 2WBWB 3GHPA 4FDWA 1TJHL 1JVOA 2B3IA 5ISZE 3BD5A 2XQBH 4PBDA 5AVWB 2Q10A 4FOMA 3MRJB 5AZ2L 3CX2A 1T0MB 2EDWA 3WNOA 4Q9CA 4OI7A 4TXVB 1SXCA 4PGDA 4HCGA 4XBMA 2P8LA 1JK9A 2YA2A 3GB7B 1ZLUK 1LM8V 2WLJA 2C8NA 4JY6B 5KVEL 1YDPA 3A3YB 4WCYL 4BCZA 5B38G 1T20A 4NERA 4BSVA 1WF5A 1YSOA 2DM3A 3DX6A 4EUPH 4R5VA 3QXWA 1R3KA 3SDXE 1W8OA 4LKXA 4BQCA 1ICTA 5IROA 5HY9B 1E40A 4APQA 2LR4A 2ZUUA 4EJ1C 1WBZA 3VDAA 5IESH 5D5MA 3GSOA 1ZTXL 4UILL 3ZHDA 1S7VB 4MQTB 4YDKL 3ETTA 4HFUL 2GTWB 3WNLA 1DBML 4L48A 3DJ9A 2CKBL 2EZ0D 3WAKA 4UINL 1JN6A 4LSPH 5F96H 1KJ2H 4TVSa 5EBLA 3HI5H 3B3IA 3QARA 1PDKA 1A7BA 1NL0L 3B2VL 5TQ0L 1OAYH 2ZUTA 1QFOA 3LKSB 5FM5O 1GOFA 1MY5A 2X4TB 2JKLA 4WVRA 2VE6A 5HGBB 3P9LA 1JGLH 3LMJH 2AJVH 4JFDA 4LVNB 4QXGH 1TETL 1OL0A 3QJHB 5IB2A 4FC3E 4HUUA 1Q94A 2MTAA 1IC4L 4Q89A 1S78D 3VG0H 1L9OA 2VN4A 4XPFH 3EJYC 4QOKD 4JMXA 4E9XA 1ZLSL 1A5FL 1AD9B 1EZVX 2HB0A 1YC8A 1E9OA 1JDDA 1X5LA 2E9IA 3ARBA 4OVVA 4XAKD 4UM9D 4BFBD 2OL3B 4JHBA 3KHQA 3MRCA 4Z8FH 4RMWA 2YQGA 1HH6B 3QCUL 4I1NB 2H1PL 2YD9A 1SUHA 4FTVA 4E5XG 2XPZA 3BAWA 3HI6H 2F19H 3GK8L 1HC1A 1KYUA 2R69H 1F3DJ 3QO1A 1HQRA 4JEGB 1F2XK 3BZ5A 5MEOB 1UH4A 1O0VA 4XOBA 1H3UA 3EUDA 1H5BA 2MWCA 4KZDL 1FPTL 3DBSA 1ZHLA 3QUXB 4MJ6A 4QO1A 3CCHA 1JZ7A 3QNYB 4ODXA 2L0DA 3RLSA 1MLCB 2DQDL 2AGJL 1OT4A 4J3XA 4ODVH 2ICES 2DYSB 2V5MA 3AG1B 4GAGH 4WUUD 5AUMB 2R8SH 1DBKH 3MREA 3D09A 2DEWX 3BVTA 1U8KA 2NDFA 1GA2A 4F8LA 3V6BR 4PJ7B 3RX9A 2CLRA 4QHMB 4YXKL 4WK2B 3GDBA 3A6OA 5GGTA 2ORBL 3TTYA 4AYDC 1R0AH 2G60H 4YOKA 2VMCA 3W37A 1WK0A 1SDDA 1Q0YH 2C9QA 2XQBL 1Y1UA 3NFPB 4A2LA 3L3DB 3AXHA 2K4AA 2KERA 5HI4D 2WKOF 1KBWA 3FT2B 4PRID 3LXUX 4YK4B 4LLUB 4Y5XB 2FJFB 4OGXH 5HJ3B 4PRHB 5CN1A 5BMFH 3DX4A 3CFUA 1HIMH 4NDMB 4F7EA 5IQOA 4X5QA 3MC0A 1QSFB 2WB1A 2JMRA 3AITA 4X7DC 1BVZA 3ZKND 4NZUH 2AXWA 3ZUNC 8FABB 1KLGA 1OSPH 4PG9B 3TV3H 3KLHD 4IBSA 3O6LH 1I7UA 3S48A 1HAUA 1ROWA 4W9IC 4DCQA 3DIFB 3PQYE 4C56D 2Y7QA 2MQGA 5HP5A 1AO7B 5HYSG 2NY1D 5IJDC 5F96L 1KJ2L 3MRKA 4M9PA 5EF1A 3HI5L 3CC5A 4UTBH 1O7SA 5IMLA 1UVQB 1XGPA 1AS7A 3WHE0 4AH2B 5T1MA 4MJIA 4J28A 1JS4A 5DDHB 3H4FA 1OK0A 2Y07L 4G43B 5DRWB 1JGLL 3LMJL 4QXGL 3S36H 4YWGH 3QJSB 1BF8A 4U7SA 2FSEB 1IGCH 4J8RA 2QSCH 3SDDD 2X89D 3TBYA 4OCXH 3HS0B 1UYWH 3VG0L 3VWKD 3FHQA 4XPFL 2A74B 2NYYD 2VAAB 3JV5A 4F2EA 4PJ8D 4XMUA 3TT1H 3VXMB 1J9TA 4Z8FL 3KPRD 2SEBB 1OWRM 5GJSL 3QG7H 3FTWA 3UDWA 3C60D 1SNRA 4GUQA 3JTBA 1A4AA 5FCUH 2CHZA 3QPKA 3HI6L 1JYXA 2F19L 1R3LB 3D4ZA 3FYIB 2EDJA 2R69L 4GSQA 5HYJD 1Q9OB 4RGNE 3D30A 5GGRB 5SWSA 4NCC2 4M43H 1F0LA 1JG9A 1GMIA 3MV8A 2YD2A 2GW5A 1YNTB 3G04B 3VQ2C 3V55A 2FQEA 2AEOA 5FHBH 4HLZH 5T8IA 1XZ0B 1IL1A 4PWKA 1DBJH 2D2CC 1SMDA 3MZTA 5GGVH 4ODVL 7CGTA 5KVFH 2R8SL 1DBKL 2O6EA 5AVYB 4OTXL 4QHUB 4NRYA 3ABLB 2BZDA 1U21A 1L9QA 5KANI 1YMMD 1GSMA 4QAWA 2ZG3A 1DJWA 1NAMH 3W38A 1S7TB 3TO2B 4WNSA 1R0AL 5CHNA 3VFUB 2G60L 5D93C 4LOEA 1M1XB 2IDCA 3LKPA 4KRLB 1Q0YL 1DVTA 1G7PB 4YBLC 4O2EA 1TDQA 3Q2NA 1DZBA 4LCYA 1VJSA 4ODWB 1TZIA 4WWKA 4Q8BA 1KEMH 5ITFA 1PBYA 4NAJA 1YN6A 4XH2A 4OGXL 2IWGA 3N44B 1J0IA 1HIML 2FDBP 2NW3B 4M8QA 3P54A 4X6EA 4Y8AA 2VXQA 5L0QC 1NPNA 5MEQA 1U2YA 4LBEA 1VADA 3VM7A 2DJ4A 3HG3A 9CGTA 4NZUL 4Y4HD 2KLSA 3T8XB 1LK2A 3VI3B 1EAOA 2CALA 4MMXC 3TV3L 4QLWA 3B9KA 3O6LL 1X7TA 1CXHA 1U95A 2J2ZB 3IJYA 1WE5A 3BP6A 3ETBJ 1KB5H 2EDEA 3KPOB 4I5BB 3TIDB 1OTSD 4Y9BA 3DX2A 1OAUH 3QPQC 4ABVA 2I9TA 4PRBA 2CGZA 4DKDC 4HZLB 5EUOB 2NW2B 1ILSA 2OMUB 4QXUH 1A9EB 4WQOA 2ZCZA 2C9VA 2NQ3A 3QZNA 4UTBL 3OKDB 4MDIA 5KWYC 1W72A 2IADB 3WTSA 1O9VA 3BP4A 4PJEB 1TG8A 2JLLA 3RUGF 4ANKA 5EEYA 1RU9H 1U3JA 3IBOA 5F8RC 2ZX8A 5C0FB 5CGBA 1WHPA 4KC3B 2TSBA 2GIMA 5EN2B 2V3DA 3MJWA 4YWGL 5AVXB 1IGCL 1YJDH 4XZUA 2QSCL 3G5YA 2R27A 2YFNA 1KCSH 1XL4A 1S9XB 4OCXL 4EVNB 1CFMA 1UYWL 3FW6A 4G9FA 3T2OA 3U6XA 2E4TA 2FH8A 3NCMA 2X53A 5C0GB 2FJHB 2WAQA 3S3BB 5JXEC 3Q5OA 3U2SB 5E8PB 4WTQA 4WWOA 1P7HL 3O9WD 1C8PA 1AZCA 5LBSA 5JNYA 2ENSA 1K72A 4XVOA 2F9BT 2Z8SA 2YARA 3QG7L 3O81A 3HZMA 3RTLA 1E28B 3ARFD 5FCUL 4AV0A 2XJLA 1CLOH 3QFJB 3FU0A 1BAWA 2VDLH 3MU3A 1OQXA 4M43L 3UTSB 2B4CH 2CRMA 2FIKB 4H20H 3Q8BA 5HHQA 1JXDA 1WZ1H 1RZJH 1G6RL 5FHBL 2ITFA 3RFZB 3ILQC 3UIZA 4WTXA 1DBJL 2NY6C 5GGVL 1HILA 5KVFL 4PJ7E 4JPIA 3CXDH 1GZHA 2VABA 4MMZC 3V10A 4GG6A 4O2FA 4WW1A 5DCCA 2JKNA 3PWLA 4AGOA 3QDGA 4G3YH 3KVPA 4PWHA 1CS6A 2YEZB 4ILDA 1NAML 3HG1D 1MI5D 3WTVA 4XRCA 1ET5A 4OR1A 1IGJB 4AYSA 3ARDD 5D1QB 4B41A 1AYOA 1JPEA 2WBJA 4DP1X 4DUWA 5JOFB 2EVJA 1TQTA 2IGLA 3OAYH 1KEML 4PRHE 5AVSB 3CHRA 3Q06A 5IKCB 1QSFE 1HZHH 2LHAA 1UA6H 4KROB 3ULVE 2DLFH 5L2JB 3MAWA 4W4NA 2WINA 4YDNA 2Q9OA 5E9DD 4N0UB 2DD8H 1KJ3H 2VLJD 1FZKA 2Z91B 4QTHA 3UZEC 3ZYJA 3KYMB 1AO7E 4GXUN 4CSSA 1SXZA 2XV2A 2ITCB 5B3SB